3D30A

Structure of an expansin like protein from bacillus subtilis at 1.9a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
b'MAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin like protein
publication title Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Peptidoglycan-binding protein
total genus 52
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3d30A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3d30A02
2PI8A 3X2MA 2G5DA 3X2IA 3SULA 3X2NA 3X2OA 2AE0X 2G6GA 2VXQA 4ZM7A 4JCWA 1HD5A 2BH0A 3CZBA 3X2LA 4FFTA 1BW3A 1N10A 4JS7A 2ENGA 4AVRA 1OA7A 1OA9A 4JJOA 2GAEA 3SUJA 1BW4A 4JP7A 1L8FA 2HCZX 3X2KA 3FT9A 3SUMA 2JNZA 3X2GA 5GLXA 4FG2A 5GLYA 5GM9A 3X2PA 4ENGA 1BMWA 2KQAA 5H4UA 2PICA 3ENGA 2PJJA 2PNWA 1WC2A 4FG4A 4FERA 3SUKA 3X2HA 3X2JA 1WHOA 4L48A 3D30A 3M3GA 3FT1A 4JP6A 1WHPA
chains in the Genus database with same CATH superfamily
2ID5A 2HLAB 1CFTB 3D52A 5AD0A 1MHCB 4XCEB 3NOIA 4PM1A 5K69A 3EJJX 5LHDA 3KPRB 4NZFA 4MMZB 3VI3B 5CLXA 1ID5I 4K71B 4ERSH 1GC1C 5GSRB 1U92B 3FSAA 3NSDA 1WF5A 4WJG3 2WMPA 4GRLA 3OAUH 2VR8A 3QQDA 2OJZL 2P3YA 4F27A 4YDIL 2YPVH 2NQCA 2P46B 2X3CA 3IDGA 3Q05A 3FO1A 3GIVA 1E0OB 1IBGL 1ZLSH 2GCYB 4N22A 3PP3K 4RFOH 3GSNA 3ZKNC 2ZOLA 4Y5XB 4HALA 3QIWA 3WYRA 2Y7NA 4KUCD 3RGVA 2QGDA 2XN1A 3NMEA 3KPQB 4KGLA 3TEYA 2PTTB 2ZWLT 4NQVA 4F7CA 4Y4KD 3W0WB 1YQ2A 3K6NA 4WUUB 1OW0A 3FKIA 3F7QA 3X1GA 5JIPA 1M7IA 1SFOA 1AI1L 1IEHA 4GEJA 2R69A 4E41D 4XNXH 1BVKA 1HDMA 2HN7B 3ARGB 4TVPL 4PGDA 3LPGA 3AG2B 5D7KD 2Q8BH 3HHRB 4TMPA 5I75C 3LKNA 2G2PA 3KPRE 3WAJA 1CD8A 1ZDSA 3WTUA 4LT7A 3IMSA 3B83A 4UANA 3QC8A 1VEPA 1IEBB 3ZHFA 1YNKL 3OUGA 4L1BA 4P3DA 1IQWL 1D5MA 3CVHB 1V54B 4W9CC 3RFZB 3UXFA 3M45A 1KLFA 5E8NA 2X2IA 5FPIA 3T3MF 1OARL 4U1LA 5C9JB 5L88H 2YS4A 2YO3A 3P4OA 5EOQL 3T4YA 1AR1D 4P2OC 3W0WE 1I7TA 1BBJA 4WUUE 1Z3GH 4PGBB 3LVTA 4AZ8A 1X5AA 1TZHB 4CRZA 4HS6A 2VUKA 4G8FB 4NNYB 3L9EA 3HB3D 4X7FC 1K4CB 4NM4L 4XNUH 5LCVA 1T7XA 1NGZB 2FJGB 3PABA 3KBFA 5C9KA 4NNXA 4XN8A 3ES6A 2AK1H 1I9JL 2VISB 1YRKA 5FXCH 1Q9LB 1QQDB 5DRWA 4N1HB 5I15L 3H0TB 3CFTA 1CE6A 3SPVA 2KH2B 3OB0H 4PHZA 4DO6A 2YBRA 1GW6A 2OL3L 4XH2A 3PNRB 1UKTA 4YWGL 3WNJA 4D2NA 1LO5A 2NNAB 2VR9A 2A9ML 2W92A 1L9MA 2YWZA 4GOSA 4HIIA 1A3QA 4RESB 1QUNA 2B15A 1DJZA 2IXQB 3GBLA 3EYVB 2ZKMX 5DJ2B 3BLKA 4LSSL 4OTXL 3L3GA 4MKTA 4A63A 2Z8VC 4TKWA 4A37A 3WNLA 4EVNB 1EZLA 5E2TL 1CK0H 4JCLA 2EIDA 5I8EA 4KDTA 4L23A 3DMRA 1UACH 1IC0A 4NZUH 1E2VA 4OJFH 3WEAA 4XNDA 2QVIA 2Y24A 5C3LD 2AJYL 3T4AC 3ISWA 4XMLL 1SDAB 1BF8A 4W9KC 3MDJA 3P4LA 1OSZB 2N3JA 4PJ5D 1CDCA 1RZJL 4PV1C 5CCKL 1PZ3A 3FTXA 2DQEH 3QG7H 4MAZA 1BLNA 3ARYA 5AKRA 3HS9A 3TEXA 5AYUH 2EAEA 3QHFL 1TZIA 4KTEL 2AEQL 3BCFA 2VYRE 1DUYA 4JE4B 2X5PA 4MQ7A 1E7UA 1MI5B 2X4NB 3B9AA 3IK2A 4E9TA 5AOKA 4K7PH 4DK3A 2A73A 4HGWA 4OQ1A 4HIJB 3NZUA 4X6DB 3WEXB 2IFGA 3A21A 1A9BA 3NCJL 1FLTX 2IQAA 4JVPA 3CFDA 1A7QH 2G5RA 1H8LA 1Y18B 1BVLA 1UWXH 2VC2L 1QFOA 5EU3B 4X6BA 3ZZ1A 3SQBB 3IAGC 3MRMB 1TPXC 4HU2A 3FFCD 3W5NA 4ELKB 4HSQA 3UTZB 3LNGA 4MKMA 4F58H 1P1VA 3UOAB 4Y9GA 1T1WB 2VSMB 5JMOC 5JXED 2H2SD 1V8HA 2YPKB 3JT0A 3GWJA 4G7SB 5F71A 3MV01 5KZCB 1S9YA 3TFKD 2K70A 5FK9A 5BRZB 5D9SB 3VGBA 1O6SA 1WFIA 1DQML 4ZS6D 3SE3A 3LD8C 4ZXBD 4OZGA 1FFOB 3HMXL 4QTFA 3L54A 1XIWB 4MMXC 4OLVH 4S2SB 2GB2A 3WDJA 2X4RA 2MTPA 3G5YA 4UDTA 4WTZG 4TNVK 4IBTA 4LGSB 3GLDA 3GUTB 1SN2A 5H4YA 1MOEA 5GRUH 1H8SA 3GBNL 1UGKA 4IGBA 3TONA 4U6HA 2AABL 3WNKA 1FORL 4HAKA 5D5MA 3NK3A 3PRZA 3QIBB 2BP5M 1G6RH 3FO2B 3D51A 3L6FB 2E5EA 4KVNH 4OF3A 4UV7H 3KWTA 1WCMA 3D25A 1KIPB 1HINH 4GT0A 1IC4L 4R26L 1Q0YH 2BZCA 3IJSA 4XMKH 3D4GA 2D3LA 2BP8B 1QZNA 4NO2A 1YYMH 4NQQA 4BA0A 1QSZA 2DKUA 3A22A 4PIRF 2RFXB 4PJCA 1PJWA 1JZ8A 3O4LE 2N7BA 3SE8L 5F7NC 4Q7DA 4FI7A 5AVZB 4OU3A 1DANU 4H0IA 1G9ML 3NP3A 4MS8C 1LEIB 2VDPH 4MX7A 3X2IA 3SOBL 2O6DA 2OX5B 4U1HA 3EH3B 1E8YA 1KEML 1U8OB 3LKOA 1BFSA 3L17A 4QHMA 1XSKA 5J0BA 3TA3B 2OMWB 3DTDA 4KWUA 4UM9A 2F7RA 5FOBB 1N59A 3UGXA 1WUZA 3CFBB 4I7ZC 5HGBA 4QWWD 5IROD 1ACCA 5E7FA 3SUJA 2FLRT 1BQHG 3FRUA 4FHBD 4CMMB 1P5UB 4R4ND 3FN0H 3FF8A 1GZPA 4J4PD 5F8RC 4Z7WA 1NCBL 3ZZLA 2MCG1 1KULA 1GOHA 1BBDL 3QFJA 4PJAB 2X42A 5DJCA 4AKQA 1U8NB 5D7JB 3FDWA 1LQSR 5C0RL 3IJ9A 2O72A 3KW7A 2FD6L 1QLFB 5E2UH 3MBED 3CQPA 3IAPA 3EUDA 5CILH 4AYGA 3WLBB 5AOLA 3SO3C 2HH0L 3G08A 5A40E 1W15A 4W68A 4OIIL 4Q6IB 4WTQA 2CKBA 1MW3A 2K9UA 3EKCA 2BHZA 3CSPA 4JHUA 3H2WA 2HFGL 5C0BE 5FM5O 4BE5A 4KVCH 1JV2A 4ALAL 2Y9RT 5KVGL 2KHAA 3AXLB 2YA1A 4FKKA 3G5WA 4FMFA 5JW4Q 3QQ3B 4FFYL 4D3CH 1K2DA 3N85H 2EEFA 4LBAA 4KU1A 4MCYB 4XBEL 1HHHA 1CGSH 2HRGA 5DO2D 5HDQH 1O9VA 2F74B 2VRQA 4NFBA 5B4MD 5DMGD 2F53E 4AGMA 5F88B 3CXHK 3EYFB 4YK4C 4ZQTA 5KVEE 4PJAE 2JKIS 4JFPB 1SY6A 4DQOL 3S34H 1BFOB 5F7UA 5A7BA 4IIZA 2BO0A 3EFOB 1YJDH 3MJ7B 1NBZB 4GG8A 3DRTB 3H85A 3SE4C 3B7RL 2JJTC 4HYTB 1AGBA 5TPWH 1SYSA 4JFYA 2VDOH 1FIGH 2ZXWB 5IFHL 4Y9CA 1XZ0B 3VX1A 4UNVA 3N91A 3RWJB 3GTMA 3LKPA 1L6PA 4NZDA 3V5KB 4C58B 4JZOB 4Z95H 4OIBA 1AKJD 3V4LA 1HILB 1T2QH 3IE9A 4LCIL 1PKQE 3ZR6A 4X42A 1IE5A 1GYWA 3NG5A 2H1LM 5IQ7L 2PR4L 3R19A 1VFBA 2GG1A 5I76A 3TEWA 2VDKL 1G7IB 3MRGB 4YHZH 2ZXGA 5DK3A 4B96A 2FR4A 2G3NA 3LKSB 3QRLA 3CDZA 4KMLB 1IV8A 4LVEA 4NPYB 4YHOL 2FATH 3LJ3A 2KPNA 4HUUA 2X4OB 3WFEH 4Q9QH 5GGUB 3MLSH 3CZNA 3FU7A 1BLIA 2WIIA 2XPYA 3P9MA 3QO1A 3HJEA 4LPYA 3VFSA 2FEEI 3D30A 1NCDL 1KJ3H 4DTGL 5HYSB 2UUDH 4F15C 3LKRA 3GRWA 1ESOA 3O3EB 5FC9A 3UTQA 1U8QB 3X3GL 2K4WA 2GIYA 3DX9B 3ZL2A 5DK0B 2R1XB 2IFFH 2Q6WA 2VJ8A 3O2DH 4JDVB 4PW4A 5AW3B 3W37A 2EH8L 2LLLA 3BYYA 3Q0HA 3KXFB 2HJFA 2ILLA 3WIFA 3NFSH 2Z8SA 1C1EL 4XP4L 1L9NA 2ADGA 3SIKA 2ITEA 4LVOC 2CHZA 3VG0L 5KYUB 4WUKL 2B5IC 4HWBH 4X9YA 4FXGA 5DRNB 4W6YB 1NFDB 3TBWB 2Q76B 2R7EB 3CVHH 4OZIA 4B9JA 1MFUA 3T9WA 3WTYA 5E6IB 4KNTA 1R27A 4O9HL 4P06A 4WTXA 4RRPA 5DJDA 4K9EH 1WT5C 1BJ8A 3BD4A 3K2MC 1JPTH 2F54A 2LR4A 1JZ6A 4XBGA 4QY8B 2X09A 3KEHA 3PGCB 3FB6B 3RWHA 5I1LA 1RMFL 3RILA 2BVPA 3FHQA 3MRLB 2FYVA 5EO0B 2CGYA 3ZT5A 2CJ3A 1S7SB 1TJIL 4H4NA 3WDHA 1CO1A 4P2YA 4IU2B 3BGMA 5CUSL 1E6OH 1ED3A 4DP7X 1X9UA 4YDKL 3N3EA 5JHBA 1OT2A 2IF7A 4DOHE 2ETWA 3CHQA 1MLCB 1HNYA 1KCRL 2DQCL 5I18L 4ANXA 4RA0C 3EGSA 5AD0B 4NN7C 4NERA 3T0DA 4UZUA 1KDJA 3DXAD 3FH7A 4IRJD 1T89A 1BOGB 4OZFB 5DI8A 3SDCC 3RYMA 3KPOB 5G5DB 3NDZE 2YR3A 4L2YA 1G9NC 2YOCA 2WMPB 3LIZH 3O3BB 1J0HA 2NY2D 3QUXD 4GIPD 5GGVH 3TVMB 4YXHH 2ZX8A 2DQHH 1H6FA 1SPDA 1J1OL 2CO4A 2MMXA 1JG9A 2D7MA 2EDDA 3S3PA 1GY1A 3NZHL 1UXWB 1JWSB 3GSNB 2AMGA 2ZOLB 4FTVE 4XAKE 2ZCKH 4CILA 1IGML 2ERJC 4GQQA 4WI6A 4AMKH 3V5DA 1HH9A 1GAFH 1EJFA 2VMEA 4K23H 4WDIA 3D09A 3DURA 4RX4D 3LZFH 4Y9EA 1U6AL 3VI3F 3LN4B 4H20L 4HEPA 1HDMB 4B9CA 4HHWA 4PGDB 2QPEB 3LHPH 4PEEA 5IREA 3HU2A 3MRKB 2YD3A 5DC2A 1QW9A 3LKNB 3L3JB 1SVCP 2CA3A 2G60H 3STBA 5L4FA 1CD0A 4TSAL 5FYLE 4QXTB 4GAYA 1UM4H 3GKWL 1OP5K 1F4YH 2IV8A 1MQ8A 1D5MB 4HCRH 4YXKH 2LLNA 4HFUH 4F3FA 4U1SA 2XACC 5E8NB 3IB4A 1DBML 4R4FH 1CXEA 4B9IA 3UMNA 4EQ2A 3P30L 3SKJH 2IV9A 1JPGA 3GTNA 2QLYA 5F96H 2O5JD 5AZ2L 3BN3B 1RP8A 2P52A 1ZCRA 3T0XA 1C5CL 3T4YB 6FABH 3QK0A 3WN5B 3WFZA 4XT1C 3O4LD 2I9TA 1BBJB 1DQLH 1FGVL 1LWRA 3NZ8A 3MNMA 2XBTA 2BNQA 3M8OL 4F33A 2ZUUA 2IWFA 4J6RL 1CN4A 1J9TA 5J13B 1ZE3H 1B2WH 2IOMA 4JO2L 1UEYA 2KT6A 1AC6A 1ZVHA 2XRAL 4ONFL 5HVGB 2GBTA 5ABAA 1DQTA 1QSVA 4M7JL 3ZKQD 3HG0A 25C8H 4NNXB 4ONOA 4A67A 3ILQC 1RFDH 2F7IA 2YA2A 1JXKA 4HMEA 5ADOL 3L4CA 5B7EA 2CO3A 2DYPD 2Z35A 5DRWB 2XKUA 3RWGA 5DMYA 5KG9B 1G4MA 1TUPA 3SPVB 1VRSA 1XHHA 2O5NA 2ZOTA 4I0PB 4XH2B 3UTSD 5LGJA 1J5HA 4O02B 1H3XA 4GSDL 1A3LL 3SY0A 1P4BL 3L45A 4BZ1L 2BWIA 1VEOA 1U3HC 2HTKC 3BJ91 3QDHA 4NHUA 3GS0A 4W9DC 1A4AA 1MDTA 5DJ6A 4WCYL 3RGBA 5C7XH 3X1EA 4RAUA 5KBPA 4HIIB 3LZOA 1FP5A 4LSPH 4JJHA 2F19H 3OJMB 1FNHA 2JKXA 4WW2C 5MI0C 3HS0B 5FO8B 3TBYA 3QW9A 3WE6B 2WLLA 4RMTA 1XGPA 4TOYH 2W8CA 3FT9A 4L29B 5C6TH 3CGTA 1YQVL 4H26A 4TL5A 1EZVY 3BHBA 1X5MA 4MXWL 5C0BD 5H94B 2BPBA 4GP8B 1URIA 5HPMA 3DARA 4QR7A 3DX0A 3ZHLA 4ABWA 3KJ4B 2CUHA 4WI0A 3L4XA 3L1EA 4CAGA 5A6IA 2NY5C 1QX1A 1W0VB 1JRHL 1J05B 1HU8A 2F53D 2NCEA 1VAHA 5EZOH 1PTZA 1QLRB 1BLNB 4HD9A 3UBXG 1CPUA 1WSST 4KDVA 3ZMEA 3GINA 4H1LH 2FQGA 1ZRUA 2A6ED 1DTUA 2OMUB 2XYCA 2X2YA 1B0GB 2XZAH 1X9QA 1TZIB 1J1PH 4ODHL 3L13A 2CW0D 4MQ7B 4QO1B 5D1QE 3UBFA 5E0QA 1AA6A 2P44B 2R0LH 4I89A 1WS8A 4MBOA 1IQDB 2CDGA 1J86A 2A73B 2G2RA 4HGWB 3SYOA 2WXKA 5EZJB 5SX5H 4P2QA 2XTJC 1JS4A 1ET8A 3LEVH 3NPSC 1XF2A 2CA4A 32C2A 2GK0A 2IQAB 1MRDH 4LEXH 3CFDB 3LS5L 4W4OC 3S2AA 3WKML 1UT2A 3B9KD 4WEBL 2J21A 3VQMA 1G7LB 1AQKL 1U8KB 1MLBA 1BVLB 3MMEB 2VXQL 3UBGA 1N7MH 4X6BB 4F9PC 1NC4A 5H37G 5JMRA 2J5LC 4HJIA 2WXNA 3IEAA 5K33A 4IM8A 3BUDA 5KVEH 1BOYA 2OSYA 3L4WA 5GISH 4FYSA 1CICC 1TQWA 3IDUA 3M6DA 3QUML 1OF2A 1IC7H 1UKQA 1CLCA 1IARB 1QAWA 1ZK9A 4QGTA 5E95B 3NESA 4XVJL 1HXKA 1XH0A 1RCYA 5E1GA 4X6DF 4UAOC 1OGSA 3BZEA 3ZRCC 4ZAKC 4LLDA 2VZUA 3QI9C 4GKSA 4X6EA 3QJOA 3HKZA 3MI6A 1GGUA 3MA9H 4G43B 1O6SB 1OGAA 3E3QE 1T4KA 5DTFB 4OZGB 1OCWL 4LLMA 3CN3A 5AB0A 4CRYG 2X4RB 3RL2A 1Y6KR 3ZMRA 5IWLA 1X6NA 3RZCD 3JTBA 4IJ3B 3A6BL 4FJZA 4H25B 4CKVX 1H8OA 3WJLC 4F37F 1ULVA 4IGBB 4POZC 4U6HB 2VR6A 5D5MB 4OGZA 4Z7IA 4MXQC 4FQ2H 1CIUA 4Q9BA 4K7FB 5IMLA 1EZVX 2I25N 3ZQ9A 3V4VA 4WGVB 3IDXH 2BHUA 3PFQA 4HG4J 4PCYA 2BZDA 3MREA 1R0AH 5JPMC 3OLEA 1RZ8A 1WAPA 4PLOB 1NINA 4Z6AT 3ULVC 3QB7C 4D0BA 4EDXA 4NO2B 3RA7L 4OLZH 1SOSA 4KI5C 4WGWB 3TT1L 4YSAA 3X1FA 2R59A 4OZGE 5EF0A 1AGCA 2P80A 4HS8H 4D8PB 5ICZA 3WD5L 2IV2X 1CLOL 2CK0L 1TJGH 1YY9D 3K46A 5DFVC 2R9HC 1JGEB 1SYVA 2FWOA 3U0PA 3QUYA 2DL2A 5J11C 4JGUA 5CJQH 5E03A 4UILH 1V3MA 4XPBH 5DD3L 3IJYB 3LKOB 1RIHL 4QHMB 4MA8L 5L4IA 3F7PC 5FO2A 4N0UA 5IF0A 4XO9A 4GKNA 4JY5L 4XMVA 3MRFB 5D5ME 3VTTA 3BDXA 4F57H 2WQ8A 2IGFL 5E4EB 3DO3A 4NIKB 1TMQA 4FQXA 1GZPB 3PHSA 2NAPA 2Y2WA 4NAJA 1EVUA 2KYIA 1GIGL 5TQ2L 5L9DH 3VQ1C 3J27A 1OB0A 5DJCB 2QV4A 4WEMB 1MW2A 3TCXA 5DA0B 2QKIA 3B5GA 2FL5A 1DSFH 5C0DA 2E2IA 3CK0L 2EYSB 4IK7A 4PJCE 4AJWA 3WY1A 4GW1B 2FEDC 2QT6A 2RCSH 4N2AA 4YHKH 5HHNA 4F2MA 3HN5A 4TQ8A 3WJJA 5C8JA 4FTVD 1H6UA 5IMMA 3Q1SL 5DJ8A 4GUOA 3UO1H 2H0JA 4PJFB 1R7RA 2ZAIA 1QPKA 1XBDA 2LT9A 3IRCA 4JVUA 1H9DA 3I6LE 4JO4L 3SDXA 2BVYA 2WLIA 1BAFL 2WLNA 5D7SH 4PWJA 4J3OF 3KGTA 2YD7A 2ZYIA 4HH8A 3IXAB 3QZOA 4PTUA 5I5IA 1K2DB 3K8LA 3P3RA 3HAEH 3X11A 2W9DL 4PJAF 2KZWA 2OTUA 5TGBA 4OD3H 2DKMA 2VN6A 4Z7WE 5FYLD 3JWNC 2DV6A 4JZJA 4M1CD 2X44D 4OGQC 4LEOB 3QFJE 1N6QH 3IPBA 4GRLD 1YLBB 4FTDA 2JA7A 2BVQB 3UAJA 2XXCB 4QCIA 5DD5H 4I85A 3C6LC 3ZTEA 3KPLA 5GIRB 3QIWD 4DZBA 1AGBB 1O7DE 1SYSB 2CR6A 3G6AA 3BZ5A 1AZUA 1U8MB 3CFMA 2JIXA 3I3EA 3OGOE 5EWIL 5F9WC 3O6ML 5HXMA 4EAEA 3TT3H 3TBCA 5CINL 4XPTH 1K4DB 4OZHA 4AQ8C 5EEVA 2AI0L 1KPVA 1VFBB 2V7HA 4HEMA 4PS4L 3W3BA 3IR6A 2A0LC 2EXYD 2VSDA 5FYLH 5K9QI 1UATA 4PJ9B 1CDHA 5I1EL 1BQKA 1NCCL 2AXHA 5GPRA 4EUPG 4ISVA 4B6ZA 4DP0X 3HJ0A 3FU7B 2CIKA 3P9MB 3KDMA 4GO9A 4IRZL 1OSPL 2F58H 5TH2A 4MHHG 5DT1L 1IZKA 3LKRB 4AQ1A 1HNGA 5AWNL 2J7LA 3UTQB 3K4DA 4QNPE 4YFLI 4UQDA 2N59A 1F5WA 2YLKA 1I1YA 4UQ3A 4WFEE 4NKOB 3TH2T 4O58L 1NBYA 5GGTL 3JV0A 4E2OA 3RGVC 2V5TA 2FSEB 3L1FA 5SV4A 1IAII 2NT0A 4GAAA 2Y6SC 3SPJA 1SOQA 1R17A 4HG4K 3JWNG 2ZUTA 4GP5B 3D69B 3KYOA 3HOGA 4YUEH 1YNND 5F7DA 4ECNA 5F97E 1HZLA 1NIFA 4KJWC 4CBPA 4ERSL 1ID2A 1FRGH 4H7VA 4QT5A 1UQSA 3NSYA 4HP5A 3OAUL 1PDKA 2DM4A 2BSCA 3WE1A 1ZGLP 3DX7A 2C3GA 5HHVH 2V6HA 2YPVL 3ECWA 2QPUA 1KYOJ 2GFBB 3ATAA 2UWEA 5I0XA 5JHDB 1PX8A 1ZLSL 2J8OA 4RFOL 5DJDB 1I31A 2DEXX 1AGEA 4CC4C 1MREH 3NFPB 4HJ0D 3X2KA 3QH3A 4ZUWA 3U7YH 1SBBA 2F54B 2AV1A 4L9LA 4XBGB 3RAJH 4LP5A 3PXLA 3TM7B 4ODXA 4CGUB 5I1LB 4URTB 5JORA 3T0EA 2BVPB 3FSVA 1TNMA 1XSIA 5GGRY 3LYRA 5D1QD 3BGMB 4G8GB 1RZIA 4XNXL 4AENB 4G11A 4BUGA 2NR6C 3QJQB 4R7XA 2Q8BL 1KN4H 4NJ9L 5EZLA 4DEUA 1NFDF 4OIFA 5LCVH 1P0SE 5LN4A 5GLYA 4KVPA 4E68A 5FTJA 1G1KA 3D08A 3ZOAA 3DPBA 2BOLA 3OJDA 4Q8BA 1R46A 4MA1C 5T3XD 5KYYA 1NMAL 5D7HA 1OOAA 4OZIE 4PJ6A 2NX5D 5DI8B 1IT9L 5INCB 3FMGH 5L88L 4X50A 4FFTA 3Q8AA 3BIKB 1ROWA 1BWMA 2V2TA 1CT8A 1HEHC 1LL1A 2F54E 4MJ5A 3VFRA 4PG9A 4LGPB 1IC5H 2HG0A 3NIDE 5DS2A 4U1JB 5GRXG 5IR1B 3C9NB 3FQUA 1Z3GL 4X5PA 2AJUH 1JXFA 3H2QA 5I1IH 1G1YA 2FCBA 4EZKA 4WDIB 1ETB1 3MNZA 1J8HA 4W93A 2A1WH 5FTNA 5IJDC 1TZGL 1GPOH 2W0PA 1JMXA 3B2UC 2MEJB 4O51A 1IKFH 3OC5A 3KWWA 2AK1L 2V8LA 1YYLL 5GS0H 5JIMA 5T3XH 5D1ZI 4O2FA 4KKLD 5D7EA 2WZPD 3TNMA 4J3BA 4AVIA 3IJ7A 4R2GD 3Q1EA 1F4WH 1J9SA 4CMHC 3S37H 3O41B 3TBVA 1N5AB 2HRHA 3SDDD 1BVOA 2YJQA 5TE7H 3D33A 3B2VL 2EC9T 4C4KO 4F3FB 4K73A 1ZVSA 4HKXA 1T1ZA 5C0JB 1C5DA 1LK2A 2IAAC 1E27B 1P5VA 3SULA 4BXVA 5IFJB 4RZKA 1CK0L 2YD2A 2ZXQA 2I5YH 3VXTA 4HJJH 4JM2C 4F1ZA 3SKOB 5FM5M 3QJHA 1UACL 4KZDL 3FULA 3NZ8B 4NZUL 2IBGA 4OJFL 4F33B 2W1NA 1RVFH 1S7XB 4Z0BH 1ZTMA 3S2CA 3O2VH 3IXTA 4LCUA 1D9KA 3ECBA 4FQIH 1O0VA 1IL1A 4I77H 1SBSH 3T04D 2CH8A 5D72H 3GXFA 2DQEL 2NDFA 3QG7L 4HIHA 4V1DB 3RVXC 5EU7C 2OJ1A 2EECA 2MNWA 4HLZG 1E61A 1CYXA 2Z35B 3C2SA 1U95B 4U2YA 1YC8A 1F1GA 2UY6B 4BSWB 5AYUL 4Z7VA 2XV0A 4GQPH 3W57A 1BD2A 1ZLDA 2H6UA 1GSMA 1CVSC 2WWKT 2VL5A 1KCUL 3BVDB 3X14B 4U05A 2JXMA 3TBSA 4K7PL 4EIGB 3JV4A 1PLCA 4YHYC 1IFGA 2MTAA 3ARFC 1TQSA 2CCLA 1M1SA 1OTTD 1ANUA 1TEGA 2WLLB 1NICA 2BNQE 2Z8RA 3FQTA 1KG0B 1A7QL 4GO8A 4H26B 4QYOA 1KYOK 2HFTA 1TWAA 4ZOCA 3BHBB 1BHGA 1RIUL 3GMOA 1QD0A 3IJHA 3WU1A 3I6LD 5GS1B 5IEKA 3ARPA 2A77H 4UM9D 2HKFH 3BH8A 4LSDA 3KD4A 3AMLA 1A22B 4KMTH 2R29A 5AOMA 1SNRA 4WI0B 2EIKB 3LNDA 4LHUB 2XWTB 2DM2A 1LM8V 3IMTA 3ZKSD 4TUUA 1AIFA 3QFJD 4FP8H 1KYDA 2JF1A 4OI9A 4YXLL 1J0JA 3PG2A 2RQ8A 2DB8A 2H6PB 3BC9A 4YSUA 4OLVL 5ESAA 1PL3A 2D0GA 2VKWA 3RJOA 3DO4A 1Y6NR 3AQDA 2Q1EA 5FTLA 3N5AA 4QRUA 4LARH 2F5AL 3G3LA 3ZK0A 5SX4H 4HIQA 4P2QB 5GRUL 3VU1A 4IU3B 4APQB 1GC1H 5E2WH 3RPKA 1XF2B 3DOHA 2X89D 2ZXEB 1N64H 2ITDB 4GQ9L 5EU6A 1QWUA 4R5TA 3BEVB 5JW5A 2P43B 4QOKD 2AJSH 3MGTA 5D6DA 2DZEA 1U2HA 4KRPD 1MLBB 3DMMC 1G6RL 1M05B 1F3DH 4KVNL 2I85A 2OJEB 1NC4B 4UV7L 4YL4A 1AE6H 2Z4TA 4R5VA 1HINL 2MQCA 1XH3A 1F3JA 2FHBA 4J3WA 5KVDE 1B9ZA 1Q0YL 4XMKL 2BS9A 3NJJA 3W56A 4DNLA 1YYML 1YEIH 4F7KA 2QKSA 2XX0A 3BMVA 3G6JB 4ZOBA 2BC4A 2K1MA 3TV3H 4B60A 4RSYA 5DHYB 4BHUA 2CM6A 1H3VA 1Z5LA 3FUNA 4LLDB 4ADIA 6CGTA 3KYAA 3HEIB 5FKAB 5I8CB 2CKBH 1X5HA 1OGAB 4A7TA 3ETSA 3OD3A 4WFED 5K9JH 2XNAA 5TQ0H 1UM5L 4FL4B 3VG9C 4JFED 1GS6X 4BZ2A 1E9QA 3KR3H 3UL4A 3CTTA 5F44A 3HZMA 1BZDA 1RUQH 4K7PY 2EE6A 3TX4A 5EOCJ 5IOKA 2YFNA 1IAOA 1QTPA 3PY9A 4TLUA 1RZ7H 4G2AA 1EHKB 4FI8A 4UYPA 5K59F 2ZOUA 5T33H 5LNGA 3O9WA 4CVXB 2P1YA 1EK3A 3FN0L 4N3TA 4Z3IA 3O6LL 5DWPA 1OP3K 1N8OE 1XSJA 1TZAA 3RE0A 4B27A 4QHLA 1N5YH 2Z7WA 1SY6H 3H4FA 3KHOA 3BPLC 4I5BB 4FZ8H 1E2ZA 1H6EA 2A38A 5DMKA 2FUQA 4BJLA 4P57A 2W60A 5DA4A 3LTVA 4OZGF 4FFWC 4NI3A 5ID0A 5AW9B 5CILL 3KH3A 5EBWA 4D0BB 3VO0A 2AC0A 3BGFC 4U6TA 1PGRB 3OQ3B 1OGAE 1TU2A 2O6EA 1R5VA 1AGCB 2WKOF 2L3BA 2N1TE 3QO0A 1HN1A 3D0VA 2XV2A 2DEWX 5ICZB 3CFKB 4KVCL 5IB5B 3BX7C 1O5PA 3TU6A 1F4XH 3QUYB 1PFCA 4D3CL 5D5MF 3CE1A 3FF7A 5HHOA 1JNJA 1KXVC 1CGSL 3MRCA 2DQUH 1T1YB 4P5TC 4HZAA 1OB1B 2ICEA 4AJVA 3GSRB 3S96B 4B53A 5HDQL 4N0UB 5IF0B 4PD4J 1PT1A 4GKNB 2PXYC 5F0MB 1ROCA 1E90A 2LE9A 4A38A 1OANA 1HOEA 4MNQA 4LSUL 3MO1A 3DX1A 4QRPB 1IJNA 3QXUA 3S34L 4BWWA 1YJDL 1EHXA 2XWBA 3F62A 3GRWH 4HJ1A 4LCCA 5AW0B 3HRPA 3PHAA 4QKXB 4ODWB 2VDOL 2CLVB 5DHMC 5E8OA 1AS7A 4F9LA 3NJGA 1G94A 2DI7A 2EC8A 3PE9A 4IYKA 4QRSB 5CP7A 3Q6GL 4Z95L 3FT4A 2MCMA 1T2QL 3DWTA 4F8LA 5DVKA 5IMMB 5DJ8B 2E7LC 3ZTNL 3GTJA 1UOWA 4XO4A 2PW1A 4ETYA 3U30C 1YEFH 2PW2B 4PJ8C 5T5FA 1BM7A 3QNZB 4YHZL 3SDXB 5C07A 2B0SH 2X6VA 1MFBH 2BIHA 1JZ5A 1TWCA 2FATL 3W9DB 1CBVH 3WFEL 4Q9QL 3DX8A 3MLSL 2J12B 4FQLH 4IOSD 3LQAC 1BVNT 4X9FA 2QGCA 1KJ3L 3GHPA 4I9WE 2A83B 1A3ZA 1KZQA 3WHE0 1YEHH 5D6CA 4K7PX 3VXPB 3I84A 3VU2A 2XXGA 1U93A 3UG4A 1CJYA 2WVTA 2JJSA 3LPFA 4G6FD 2IFFL 4YHNB 2DRUA 3O2DL 4KHTH 4PJFF 4MQSB 4JQVC 4L5FE 4M3KB 2ZQKA 4F2ME 4DZBB 3ZSSA 3G6AB 2QVMA 2WKLA 7FABH 2Q3XA 3NFSL 2WBWB 3GB7A 2BMKA 4KKZA 2PN5A 1U30A 4JVWA 3ZZQA 5I82A 3B7TA 3X2JA 2D7NA 1DN2A 1N0XH 3PREA 4TSBH 5IHLB 4YHLH 2V7HB 5CNHA 1X5YA 4JQIA 5FF6B 5I23A 1K72A 3I3DA 3RPIB 4OGAC 2EDOA 1KXHA 2JCCA 4PVLA 2R4RH 4M93C 2AMUA 2MPVA 1KBWA 3HR5B 4LCVA 3WL9B 1N12A 1IM9A 4HH9A 4K9EL 1VKXB 2V3EA 3I6SA 1MFAH 3P69A 4QNPF 1JPTL 4PWKA 3FUEA 3TLRA 5F9JB 4P99A 5B22A 4FQCH 2R92A 2QFPA 2VTFA 3JVFC 4I13B 4YBLB 2EO1A 3SBPA 3MRBA 1CGXA 4AQ1B 2RTTA 3HZVA 3WEMA 3HG1A 4MS8D 3N9GH 1E6OL 1L9TA 3BH4A 1DZ0A 3WG7B 3CBJB 1NBYB 1QA9B 5A2KH 1QKZH 4E9QA 1YA5A 4OZHE 5GJTH 1EO8H 2DWXA 2BNQD 3VD3A 3MROB 2LU7A 3VUAA 4JCMA 2WUCH 4HEME 4LDCA 5E9DA 1AXIB 2HX9A 2K7PA 2APWA 3G5ZA 1L9SA 5F7DB 5D96C 1YUHB 2WINA 1UB6B 4GA6A 4BFEA 4F8QA 4QT5B 3LIZL 3LN9A 3CVCA 4HHGA 2DQHL 2ICWI 1KUMA 1JK9B 1XR8A 2AEOA 2UWEB 4LHQB 5I73B 3NJFA 1AGEB 2EZ0C 2PKDA 1UCBL 4CL7A 3K4ZA 3NJNA 3QH3B 4AMKL 4GA5A 3ZKXB 1GAFL 1IAKA 4L4VA 4ODXB 1I8KA 2AAVA 3JVGA 4K23L 4PD4K 3RTQC 5M95B 5IJKA 2OK0H 3GO1H 1UHDA 3NCWA 4P49A 3QFDB 5HDBE 3GRGA 2A9NH 5HY9A 5CHNA 4LKXA 4ZMAT 1FYHB 2GC7C 3LHPL 2RBLA 3F01A 5EZLB 3V4PA 5BUAA 1G0YR 2B3IA 3NGBB 2WC7A 4Y19A 5BVPL 2G60L 3LOWA 3NAAH 1BZ7A 4YOKA 3BISA 3CZEA 4ZMTA 3OJDB 5EUKB 1MW1A 4RDBA 1F4YL 3CPUA 4JDZA 4HCRL 4YXKL 1E5ZA 4LVNC 1KTLA 2QADD 3WO4C 2UWEE 1YNLL 3VWKC 2J25A 1CE1H 2UXVA 3BPNB 4JAMB 4R4FL 5EOTB 5EEXA 3WKYA 1IGTA 3G5VA 2DI9A 4Y2DA 5HJGA 3SKJL 4MS6A 1NCJA 1KGYE 1P2CA 2V2TB 2WQUA 1WAAA 3N1MC 1A1OA 1NBQA 3DGGA 3NK4A 3T0EE 6FABL 4LOEA 5LJYH 4OI8A 1M6OB 3OWEA 1F1DA 1DQLL 3FQUB 5DC9B 4D0CA 4HOXA 2APSA 1H9VA 4KXDA 1DO6A 1RHHA 4ZQKA 3KYKH 5C08D 1Z5HA 4CW1A 3T0WA 5K39A 4NQCA 1B2WL 4MWFB 5T5NG 1E5YA 3MNZB 1KBKA 4PWGA 2EDBA 2WCGA 1N26A 4MLIA 3AMKA 1H5BA 4O51B 25C8L 3K5RA 5DUPL 1SHXA 4A2LA 1RFDL 2Z92A 4Z7QB 3QUGA 4O2FB 2E9WA 3OKYA 4NO3B 1ZVYA 2R2HB 3KBHE 3QUZC 3TNMB 1A6ZA 2B2XH 3OJ2C 2QSQA 5KVDH 1YUKB 3TBVB 3DIDA 4WZ9A 2BIMA 4MB1A 4LQ1A 4FG0A 4A2DA 2FIKB 2Z9TA 4R96A 2F19L 4NKQB 4J12A 4TOYL 2ED7A 5E6SB 1DVTA 3SBWC 5C6TL 5A2AA 3IBOA 2A7BA 3CLFH 3I3BA 2IPUK 2NY1D 4RGOL 2F7OA 2QLVB 3VXTB 3QQXA 1QMUA 3MKGA 4JKNA 3EBGA 1J8HE 2Y06H 2K8MA 3EG9B 3QJHB 1EFXD 3HBPA 1UA7A 1W80A 5GQBA 3OR6A 5AL8A 1IAMA 4M7LH 4ODBD 5HJBA 5C0FB 3KWXA 5CEYB 5HVWA 2DMBA 2XWDA 2YMTA 2YGQA 1D9KB 3ROOA 1PQHA 2BWDA 1CF8H 2VMDA 4HIHB 2E8ZA 3RDTC 5EZOL 4A6YA 2V8MA 2CQVA 4PJHB 2APBA 2NY3B 2ENPA 1D5ZB 1FAKT 4HISA 4N25A 4Z7VB 4MDJA 3U2JA 1BD2B 1J1PL 4LE8A 3IFPA 3D39B 4JFXB 2VL5B 2Z1PA 2XY1A 2VLRA 2R0LL 3TBSB 1ORSA 5EA0H 1G87A 4WI4A 3JV4B 1Q72H 3IMVA 3W9EA 1TVHA 3C08L 2P80D 1I3VA 4WWOA 3LEVL 5F7YC 1KJ2H 2Y5QA 3DIFA 1MRDL 1CD1A 4LEXL 2CMRH 1HOCA 3ATFA 4JQXA 2RQEA 2W81C 5D71H 4QJ4B 4WHYH 4E9VA 2WXLA 4R8WH 1JYWA 2CCWA 4NC1C 3FT2B 4YQXH 2OI9C 1SXAA 5E1HB 1VA9A 1N7ML 3IJHB 1E28A 3I6GB 2OXHB 3X1NA 2Z34A 1UKSA 4M8VA 3C09B 1G9MC 2C9RA 1R5IA 1AGFB 1U9KA 3V4VH 4FRWA 1RPUA 2DLTA 1T22A 1Y5IA 4WO0A 1IC7L 4FQXD 2J1YA 2GSMB 2NNFA 3DETD 1WEJH 4Z7VE 4WKXA 5DGRA 1BD2E 1M4KA 3MJ8B 4TYUA 2WAQA 5GRWA 1UD2A 3AU1A 3MOAH 5DEJA 2D9QB 2XWZA 1KV7A 4PRPB 4FLSA 4LVHB 1MCQA 2XJKA 3L3IA 1ES0A 1I3GH 1WA0X 1U8IB 3FU9A 2WVUA 5F72S 5BCAA 4MA3A 3L1OH 1BQSA 1P6AB 4HK0B 4URKA 1NCIA 1S7VA 3O2WH 3UADA 4LOFA 1LDPH 1L0PA 4OKVA 3CD4A 3P4NA 3CFCH 2H47C 4AGNA 2DLHA 2VAJA 4O2EA 4OY9A 4PV8B 5JW5B 3ELAT 2VDMB 1ZLWH 4A7SA 1ZSDA 3D7PA 1XCXA 2EIZA 4X7CC 4FQ2L 3BP6B 2X3BA 3F5WA 1DVFC 1FG9C 3S35H 2OSXA 3LS4H 1KQFA 2CUAA 1EDQA 2CPCA 1R0AL 2HG5B 1Z7JA 5G4OA 1UXLA 5G55A 1E8ZA 4J5VA 3AZUA 1LMIA 4OLZL 4IDJL 4WHDA 4YHIB 3UAJD 5C71A 1QSFA 4KNQA 4HS8L 1VPOL 2BC4B 1OE1A 3IU4H 3JV5A 4L5FH 4ELDA 3TP4A 1EA9C 2YHGA 1Z5LB 1TJGL 3U6XA 5K9OA 1AQDA 3FQ2A 4KODA 1BP3B 4R3SB 5SWSA 4TUJB 2JIXD 3W11D 2XNAB 4UILL 1THCA 4XPBL 3D1MC 4UQAA 1E9QB 4P2OA 3CUPA 1USQA 3ILQD 1OPGH 5EU6E 4NSKA 3QEGH 2OYLA 2NY0C 4DZ8A 3II2A 2ZWKA 4RMRA 2AXWA 4YC2C 1NOLA 4FAAB 4I4WA 1E2WA 2ZF8A 3B2PA 3HVNA 5EC1A 3G6JF 1BYPA 4UT9A 5L9DL 3F7VB 5CFAA 4X4KA 3ZE0B 1J0IA 1NAKH 4L4TB 3AT0A 3PGFL 3BUIA 4ZTOL 5DMKB 5IVOA 1DSFL 2W60B 4KKNA 2P5WB 4YHKL 3E6HA 4EF3A 1G0XA 5EBWB 4NN6B 4L2LA 3UO1L 1I7ZB 5FFLA 1TU2B 2OXGA 2DDQH 1R5VB 1VIWA 4KOBA 2BINA 4ZW7A 4H40A 3TO2A 3EOTH 3ILPB 1GZQA 5TK4A 2PPFA 4FXKC 5D7SL 3P73A 1FA4A 1PIFA 2K45A 5LG1A 4AL8H 4LOUC 4XWOD 3IU3B 2KL6A 5BV7B 3OHXC 2LTQB 3FCBA 3FCTA 4L37A 4F80A 4JFDD 2DWSA 3QEUA 4JREB 2XHNA 2WO4A 1KIUB 3R1GH 2OAAA 3HA0A 5C6WH 5CN1A 4KK9C 1EEZA 4N2OA 3A23A 5DD5L 1PX3A 4XCNA 3QUKA 2PYEA 2XWBB 1OSYA 3S3JA 4LCCB 2CJSA 3S36H 1JVOA 1NMCC 2OMVA 4OCNC 3QRFM 3CG8A 4CDGC 3I6KA 3T0ED 3TCTA 5FA3A 3CX5J 3TT3L 2W59A 4OJEH 4HC1A 4XPTL 3FT4B 3QJVB 4XVTH 2WZ6A 4I1NB 5CBEA 4ABQA 2OS7A 2A6HD 4JFHE 3CXFA 3OKDA 3Q6FA 2NY5H 4PUBH 4TNFA 1MJJB 5HHOE 2DM7A 1FYTA 2EUXA 2WQXA 3VXOA 5DU7A 3I85A 3WGUB 4M62H 5C07B 1I1FB 5FYLL 2X9WA 2AXGA 1G7MA 1CICD 4AK1A 5C0AA 4MNQE 2NUTB 2ZAGA 3DX8B 3KJ6H 3TL5A 3LRGA 1WG3A 2QJDA 3B8SA 3T8XB 3TH3T 1JI1A 2F58L 4ZAKD 3NYKA 5C09A 1MFEH 2V5RA 3MRHA 2GY5A 3TO4B 4IEFA 4KROC 3S48A 1T3FA 2WQVA 1AYOA 2AXFA 3BUBA 3GHEL 5ETUB 3WTSA 1RJCA 3BFWA 1XWVA 4K3EH 1QHPA 4HKBA 3BN9D 3SDXF 5EPMA 4DKEH 3FTGA 4YNYA 4HZLB 1I1CA 2BMKB 4U1GB 3FQXB 3D5OF 4YUEL 8FABB 1LK3H 1J8HD 3EGXB 4HF5H 2H3KA 3EFFA 3QDGD 4MMXA 4UTCA 1X5KA 3X12B 2B16A 5F9AC 4M6ML 1KJMA 1QYGL 1FRGL 2VW7A 1AO7B 2WBXA 1TQVA 3L08A 1IBFA 5B7MA 5MENE 3VVWA 5HHVL 2JCCB 3VFUB 3NRPA 5HDLA 4KLNA 1NIDA 4WI9A 1LVEA 1JZDC 1JF1A 1DSYA 3WNMA 4HH9B 4Q89A 1HTYA 2Q7AA 4KI5D 1I7UB 4Y1AB 3U7YL 5GS2D 3JTTA 4EDWL 2YZ8A 3QZMA 3FU3A 2WLJA 1FHNA 2ZIDA 4HIPA 4WTWA 2VXTL 5JR1L 1BG1A 5HVHC 4KDWA 1F6AA 3ETBJ 5DFVD 1DVUA 2R9HD 3AJ7A 4XMXA 3HZVB 1L9OA 3HG1B 4LEEA 5DSCA 5CGMA 3ME0B 4D9QD 4OCWH 3U0TA 2OZ4A 4I0KA 3HUJB 2A99A 2C3VB 5DUJA 5LCVL 3V0AC 3ATEA 3QCUH 4B7LA 4DN3H 5GSVB 3U2SB 1SJMA 4B97A 1P1ZA 5E6ZA 3KYNA 2EDLA 3T1FB 4JG0L 4U3CA 3LB6D 3BKYH 2GPZA 1K8DA 2ZSWA 3FMGL 1ZGLA 4LESA 5GS2H 4MZIA 3I9IA 1XR8B 1OLZA 3B34A 2FEDD 4GI9A 5EEWA 3TBTA 4OCXL 4Q97A 4YS4A 4LLWA 4U6YA 2C9QA 3HG1E 5C6PB 2GEEA 1GZHA 3ARSA 4QRRA 5I1IL 4L4VB 1I8KB 4MB3A 3WNNA 1KIQA 3AG4B 1RAMA 1V7MH 4PY7B 2A1WL 5FIEA 1NCWL 1GPOL 4NPJA 5GHWH 4PJIA 1NDTA 4WU7A 4NKIH 3NCCB 3SCMC 3CFUA 5T3XL 3VFMA 2OULB 5HY9B 4LKXB 2QPDB 2WWMC 2VXSH 3IN0A 4HPOH 2AQTA 4W9ZA 2XKSA 5E9DE 3V4PB 5J12B 3QORC 1HYRC 4Y19B 1F4WL 2WXFA 4LFHD 4MAYB 1JZFA 1NKRA 5F1OB 2UWEF 4OM1H 1Z9MA 3FXIC 4FFVD 4GYBA 5TE7L 5HHQA 3LNFA 4PJBA 5INDB 5C0GB 4U1NB 3N2JA 1FGNH 4B0MM 3HE6C 3V0GA 3MVSA 2NNXA 3EH4B 3IETA 1AZCA 4TQHA 4XI5C 3G5VB 5FGBC 2ENSA 5JPNC 4KK8C 3NQIA 3GLAA 5J1AB 2APVA 3POCA 2BRRL 2I5YL 4L4VE 4GIAA 5HGDB 4HJJL 4E5XA 1BA9A 4ZFZA 1BW8A 4DP2X 4J2QA 4D0CB 3BSZA 3Q8BA 2YPLD 1RHHB 2VITA 4YO0B 1RVFL 4Z0BL 2HCZX 2A0LD 2JJTA 3B6SA 4FQQB 4NQCB 5IQNA 3VI4B 4GKZA 5IP4A 5E8EA 1G0DA 4NT6B 2ZP9A 1GGBH 4Y19E 5D1XC 3D9AL 1K3ZA 4FQIL 1PJ9A 5A3ID 1H5BB 1MWAA 4I77L 4KAQH 1KXTB 5EU6D 5D72L 2PWHA 5CD5C 3ZTJG 2Z92B 5KVMC 4L3EA 2I60H 2R29H 2D4FA 2WTRA 1KEGH 1L3WA 3HE7B 1UHEA 2IMNA 5IBUG 3AREC 3CVIH 2H3XC 5D4IA 2AE0X 2BVOB 5FA4A 1YNTB 1ZA6A 1RZFH 3KVPA 3RU8L 3VFVB 4YHPA 4BFIA 2X0UA 4X5WA 4I48B 2ZG2A 5EHFA 3H9YA 5A2IH 3KPTA 1UOVA 4EI5D 1WAAE 3CFIC 3JYCA 3OSKA 4R96B 3ZDWA 1YEEH 2NMSA 3CIQA 4XXWA 4UF7C 4HX1A 4R0LB 3O4OB 4LASH 2W65A 4R7NA 2UYLA 1SDYA 4DUWA 2EVIA 3DV4A 1RPQA 5T1MA 2FIRT 4Z7QF 4NQCE 3SDDB 1U58A 3QQ4A 4JFFA 1XGTA 3PL6C 4OBRA 4Y4FD 2A77L 4G9FD 4M9PA 3ORJA 2WBJC 2HKFL 3SDAD 3U36A 2X4TA 3OR6B 3PWVA 2XFXA 3OKEB 4IMLA 3L7EA 4M4RA 3IMUA 5A2FA 3GZQA 1RUKL 3CV5A 3O9WD 1OK8A 4NQDB 2NY4B 2MOQA 5TTRA 1UD3A 4QHNB 1OP4A 4Z5RA 1I3UA 1AXSB 1WFUA 1CFBA 1BGXH 4A6YB 3ECUA 4FP8L 1KB9J 5DRXA 5DYIA 5DVOA 1PIGA 4MDJB 5ECGA 3RKDC 1RD6A 3IFPB 2DS4A 4AY0A 5DWUH 2VLRB 3QIUB 1A6PA 5CJXC 1ORSB 4Z76B 2JKWA 4LARL 2FJHA 4EI6A 5CCJA 3PIQA 1OP3H 4ZMLA 3W9EB 1LO4H 3QT2A 2YEVB 5D4QA 1GC1L 5DS8B 4N5ED 1T0NA 5E2WL 3QHTC 3VW3H 2Y36H 1N64L 2WVVA 3DIFB 3S5ZA 4JFHD 3KZ8A 1CGTA 2QPFA 5HHOD 4YSEA 4M1GH 1T0MB 3TTYA 1S7UA 1E28B 2X70A 4PJHF 3MLPA 5FTKA 5MEOA 3ESOA 2WNGA 1JWMA 1AE6L 2DQ6A 1SEQH 3CDGA 4HJSA 2VERA 4Z7VF 3PLXB 1KFGA 1R5IB 3FAWA 4GG6A 4M7KH 3LPPA 4I18C 4XNZC 3PHQB 5EO9A 2YAOA 2YGVA 4GBXC 4LRIC 4MNQD 1E9PA 1YEIL 4IBYA 4UMGA 3ZHKA 3HNSH 4NO5B 4FNLL 2J44A 4HUVA 3CH1B 4M3JA 1OTSD 2OMXA 2XQYA 3TYFA 3AU1B 4FMKA 4KX9A 1SFHA 2CKBL 4XMUA 5D2NE 4HFWA 5K9JL 3ELQA 4FLQA 1KTKE 2AJXH 3D34A 4ZW8A 4NO0A 5TQ0L 3VRJA 5BVJB 4B3VA 3KR3L 2OMYB 4MA3B 1NL0H 3UC2A 3JWOH 1GVIA 1TMOA 1RUQL 3H3KA 3SQRA 4RRPM 4G71B 2WYIA 1KF9B 3IS1X 1C5BL 4A7VA 4L8DB 4N4YB 1JUFA 4WSKA 2YARA 3P3YA 2XQYK 4CVUA 5T33L 1CR5A 4JHZA 3ARBC 4OKVB 2Z6FA 2Y1YA 2L8AA 4FQHB 5EU5A 4N8UA 1L7TH 4IW4C 4O2EB 4DO4A 3RVWC 4MRCA 1ZSDB 3RIAK 4JRYB 2VLLA 3F5WB 1N5YL 1SY6L 5D1ZA 4FZ8L 4G6KH 4MZ2A 5IOPA 5L6YL 5MEND 2ZPKH 5AKSA 5EBLB 5I75B 2X12A 4BWUA 4ZMZA 5BOJA 3OMIB 1XR9B 5HGHB 5HI4C 4OD1H 5GRVK 1E40A 1TETH 2AEIT 1IGFH 2ARJA 1H0HA 2X9ZA 3EOAA 3IGAA 5D7LB 4JM2D 3BJLA 1OAXH 1GGCH 3GF8A 1FO0A 1RZQA 4G5ZH 4JANA 4E42A 2GUOB 2YSSB 4WJ5B 3IFOA 3K0WA 1I50A 5DZNA 2FJFA 3QAQA 4DEPC 1H6TA 3QNYA 4FGMA 5T5FH 1VHPA 3LZNA 2C9UA 3FCSB 2DQUL 4P2OB 3O6FC 3QWNA 3CUPB 4L8CB 1J5IA 4NSKB 1FVDB 4DZ8B 5AB1A 2HT2D 2XXMB 4DO5A 2CRZA 3P2BA 4ZODA 1MNUH 1U4FA 3AXIA 3GRWL 3H1ZA 1IM9D 5BS0B 4BZYA 1MCNA 3QAZC 1N8ZB 4UM8A 3EDJA 4A55A 2H9GA 4K15A 5KS9B 4UUJA 5I9QB 1DBBH 4FJ6A 1DBKH 1OT4A 1QSFE 2COVD 2LQRA 2ODHA 3IN2A 1HQRA 5J3HD 3MBWA 2KLRA 3C8KA 4NM8H 3GMRA 3HPJA 4U4IA 5J56B 2G3ZA 5SWSE 3EAKA 1U3HA 2XC8A 1FH5H 1NGXB 1FJ1A 1N2RA 5CD3A 1YEFL 3WGVB 1VCAA 5CFHA 1KB9K 3E9UA 4Y7OC 4GRWE 1LLAA 4X2UA 3SBQA 4RGNC 1MFBL 3P73B 4JQIH 1ZAGA 3RWFA 3S4SA 2HMID 2B1HH 4PLNC 3OAYK 3ZE0F 1CBVL 1P69B 3UPRB 4XOCA 3BAIA 5BUGA 3OAZK 4Y16C 4CA4A 2Z31C 3TIDA 3ULUF 2NXYC 4N26A 3QEUB 1EXUA 2H4EA 2ENJA 2CR3A 3VXSB 1J5OL 5I19H 4WO4C 3EJQA 4P9MH 1YEHL 4JN1H 2ALAA 4XRCB 5F7BA 3TN0C 2X87A 2P8PA 3U9PH 3X13B 1MFVA 4PP1C 3LDBC 2YAFA 4KHTL 4OLYL 4XCNB 3EIFA 3KS0H 4ZX5A 4NLAA 3I75A 1UWGH 2V7NB 4WSGA 2OMVB 7FABL 3DUSA 1KTRL 1B0IA 3BQUC 3I6KB 3ZE1B 3MRNA 5FA3B 2Z64C 3NIGB 3FOLA 1DQDH 3UTPD 3H9HB 2EDXA 3ZX1A 3FUFA 1UGNA 4AJ0A 4HHAA 5CBEB 1R47A 4IOIA 5C1BA 5BXFB 1TWFA 1I85C 4TSBL 2B1AH 4YHLL 2R23A 3QPKA 3MV8A 3N55A 1G5AA 1TTBA 1HCVA 2R4RL 5DRZA 1YMMA 2DIBA 2QR0B 5IB1A 3STLB 1P7KB 1L0XA 2CDEA 1WZ1H 3E6FB 1MCFA 4K3DL 4DKTA 4JS7A 4Q6YA 5C0AB 1MFAL 3GMLA 5EO1A 2EABA 3VXMA 1UJTA 3UFIA 1DUZA 2X53A 1JZEA 4LEBA 1UB5A 4NBXB 3GM8A 4FQCL 1FQ9C 4MJHA 2PYEE 2PWEA 3QDJB 4NUPA 3SO5A 1BF5A 3QZLA 1BZQK 1RKRA 3MRHB 3VX0A 1TPXB 3LRSB 3VGAC 4Y2DD 3DV6B 3GMNB 4P04A 3N9GL 4JR9H 1Y1DA 3OL2A 3V6OA 3OC8A 4GT7A 2AXFB 2MQ3A 3OKLA 4EXPX 3BUPA 3CSFA 1QKZL 4MCNA 3B7UX 1L4IA 1NCTA 4RFNC 5GJTL 1EO8L 5EPMB 3PJSB 4RAVA 3NEEA 2KKQA 3QI9A 1D5BA 1HHGB 5E1AA 3FTGB 4OB5H 2WUCL 1LEKA 2OPCA 1N0LB 3V4PH 2ATAA 3ZMNA 4Z7OE 5I24A 1O75A 3LD8B 1FYTE 1QSEA 1JGIA 3TTSA 1OEZW 4PTTA 4MMXB 1DL7H 1SVZA 5DGQA 3B3IA 1UA6L 2F7PA 5DJYA 1KJMB 3UABA 2IADA 2PCPB 3ALPA 3KGSA 3S5LG 3FOMA 5C0AE 5IW6A 1DJSA 1SEBA 3ZO9A 4JM0A 1S9KC 4FFWD 1UASA 3WJLA 1JF1B 5C09E 3MA7A 1FG2A 2XZZA 4FZEH 4U3SA 1T2JA 3UTOA 3DSNA 3JTTB 4UQ2B 2N4IA 3O11A 2WO2B 2UV3A 2OK0L 1F6AB 4GFXA 3GO1L 1ASOA 2CNYA 2ADJA 2Y7SA 4J2XA 4HPYH 1AR1C 3ROLA 1UH4A 1NCUA 5JIHA 3MAWA 1BMGA 4XAWL 4BK5A 2ZUQC 1BV8A 1TT6A 1VFUA 4IBSA 5AAMA 3U0TB 3DJTA 1ZXQA 3DKHA 3ESUF 3MRPA 5FB8A 2JCCF 4IK6A 1PKOA 2J8HA 1QPXA 3HB3C 3NAAL 5SWZA 2FTAA 1U8JA 1ZV2A 3C5ZD 1L9RA 3KYNB 3PQYB 4YH6A 5E5RB 1FN4B 4AC4A 1SLVA 3GTPA 2JJUA 4MXVE 5T3ZE 1WBZA 1ICTA 1ZLVK 4A7GF 2ZSWB 1CE1L 5I0ZA 1ZGLB 2Y6TE 1TR7A 2WXGA 1IUZA 1P6FA 4L8SC 4OF7A 4WI5A 5IJVA 3P02A 3TBTB 2XN2A 1BFVL 1MCEA 3HUJF 4IBVA 2MRYA 4NBZB 5FUCC 5ICXA 2R1YB 3SQOH 3KYKL 3GXNA 4ZSOB 1A3RH 4M5YH 2C26A 3DVNB 2PO6C 3DC0A 1PEWA 2YN5A 2V9QA 3IDIA 4PJIB 3V5HA 4DVRH 2NW3A 4EUPA 4BYHA 4DPBX 3SO3B 4MCZB 1KB5A 4WEEA 4XXDA 3VFMB 5MEPA 2IWGA 1GGIH 5GLFA 2BXYA 4XX1G 4PR5A 5ITFB 1IBYA 2TSBA 4FCAA 4PLJD 2B2XL 4U1KA 2QTEA 5KVDL 4A6YH 1KNOA 3N50A 5I1AB 4XNBA 3QXAA 2YAEA 5HHQB 1MDAA 3F05A 4MTMA 4WFGE 4AUJA 2NY7L 4IBQA 5K5YA 1ZKAA 4P4KA 4DGWC 1MUJA 1EVTC 4MMYB 2P4AB 3EHBD 1UVQA 3IETB 3VXQB 5TDNB 2ZJSL 4M9OA 4IIQA 4YK4B 4QRRE 1HZHH 2G9HB 4HAGA 1PYUB 4OF6A 4WK0B 3CHOA 5CLYA 4ZFZB 3QNXA 5I0VA 1I8MB 5KAQG 1UOKA 5EZPA 1JYXA 4PJIE 5BRPA 5TDOA 2VITB 1EXGA 4EKXA 2HJKA 4M8QA 1K85A 4M7LL 3B6SB 3ABKB 2JKJA 4GKZB 4NYLA 2HA1A 3CQQA 1G7PA 4PSPA 2ZYHA 4B9PA 1MXDA 2X40A 3EJYD 1WC7B 5MHSE 5FYKU 1C7TA 4JPIB 1CF8L 4FNSA 4KRMB 1XCQA 5CGTA 1XGUA 3A0OA 1BG9A 4FQ1H 4Y7MA 1P7QA 4PJBE 1A25A 1F6FB 4KC3B 1A47A 4MD0A 1PQZB 4BFBD 4HQQH 2Y07H 4WIQA 5BJTA 5AL0A 3VSUA 4BKSC 4YHPB 2VAAA 1V5JA 4X5WB 1YAZA 4X5RA 5JXEC 2B39A 4DETA 4GLRI 3VGHA 2H2SC 4JN2B 5EA0L 1IM3D 3ABGA 1Q72L 1QZ1A 2GTZB 1QSFD 4NWUH 3VI4F 3SJVB 2DWEA 4HX1B 3BVUA 1KJ2L 3RJDA 5IUSA 4DP6X 4ZXBC 2CMRL 3DDFA 3HG2A 5D71L 5SWSD 4R8WL 3IGUA 1IILE 4YQXL 1U58B 4NRYB 3QQ4B 3CF2A 2ZUYA 3J2PA 1XGTB 3HI6H 3VH8G 2ITCA 4B9FA 4EN3A 1GGYA 1YNTF 2IANA 1RZGA 2X4TB 1W16A 3FTZA 3MLRH 4LPUA 4PQXA 3D05A 3PWVB 4UT6A 5F1IB 4L3EE 3EJZD 3T77A 2NW2B 2IMMA 2XFXB 2VE6A 1OF0A 1MAML 4LGRB 4M4RB 2ZONA 3OXRB 2NUPB 3V4VL 4S1QL 3WS6A 1OVZA 1WEJL 5AW1B 4DK5A 4HUWB 4LVOB 4P23A 5A2LH 4Z5RB 4JPKH 3MOAL 2DQIH 1GHFH 2B5IB 3FN9A 1A6TA 3E2HC 3R06A 3WAKA 2F1AA 1ZPLA 4GAJH 4QAWA 4DW2H 2ICWA 1A1MA 3QXDB 1WCBA 1I3GL 5TK2A 3CZKA 5HYJA 1YEWA 5IVNA 1Y0LA 4EZMA 4ZMWA 1NFIA 1BXUA 3L1OL 3MYZA 2IAMA 5B38G 3SYPA 1TTRA 2FJHB 3FQWA 3O2WL 4EI6B 4OJAA 4IS6A 1LDPL 3WI9A 3CFCL 3DJ9A 5ICYB 4UINH 4GRWH 4JFFE 5B21A 4TLSA 3EOYG 4YMPA 1J0ZA 4UQEA 3V2AR 3VD0A 5BO1H 3AQZA 2G6GA 3S35L 4XNYL 1S7UB 2NR6A 2X70B 1NMBH 3LS4L 4N2NA 3U25A 3RJQB 5MEOB 2P7TA 3BUYA 1RK0A 4QWWC 3CDGB 5IROC 4Z3EA 4NUQA 2R27A 5BPPA 4GG6B 4R4NC 2FLBT 2VWEE 4QF1A 1E9PB 3P9LA 4J4PC 3THML 5L2KB 1DE4A 2YWYA 4HKZA 1PVHA 4NN7B 5BZZA 3MC0A 4APXA 1AP2A 1J8KA 4HUVB 4QXVA 4L5FL 3IU4L 3U7AA 4LU5H 2PYED 4B95C 1CTMA 4BUHA 1OQXA 4FNPA 5KBKA 3SDCB 4TNGA 2EKSA 4IOFC 3GGWA 4LCWE 5B8CC 3UP6A 3MBEC 3WOVA 1YJDC 1A7RH 2YK1H 4Q2ZB 3VRJB 5IW3A 3D4CA 3ARXA 2FH8A 1MPAH 3U46A 1OPGL 1F56A 4PGJA 3QEGL 3C60A 1NIAA 2OM5A 3ESVF 4MDIA 5DUBA 2AGJH 2E7DA 1JUFB 4NGHH 3QUZD 4AUYA 1BSIA 1FYTD 4X0NA 4K5NA 3DROB 3OLDA 5AVVB 1WLFA 4HMDA 1MY5A 1T5XB 1BQRA 2VW4A 2FVNA 5AZUA 2J5WA 5GJSL 4WWKA 3A4DA 1Q1PA 1NAKL 5DO2C 5IOPB 1S7RB 1HKLH 4YVNA 4CADA 2V3DA 3AABA 2EE3A 4A39A 5C09D 4WJKB 1OKEA 1UG9A 4XOEA 3IGAB 1EQWA 1B0RA 3D8MA 2CO6B 4KO9A 2DDQL 2DICA 2ZXBA 3ZYOA 3STZA 4HC1H 3EOTL 3CZGA 4NQSB 2VZ3A 1RPKA 2B8OT 5IEHA 1KB3A 2AF2A 1D6EA 1AFVH 1TQBC 3MJWA 4K94H 3M3GA 3EYSH 5ERWA 3V0FA 5A7EA 3QEQB 1U8CB 3VWJA 1M56B 3QNYB 4LNRB 4AL8L 1F18A 1WFJA 1LJMA 1JGLH 3MRQB 5EF2A 1PZCA 2XU9A 4GUQA 1BECA 2A6KA 2F7QA 4NQEA 4CU6A 3R1GL 5A1AA 1YVLA 3PPSA 1KWGA 2NDGA 4ZPTA 3MUHL 3RWCB 3QZWA 1HCYA 5T1LA 1UJ3C 3CSBA 2K4AA 3UJJH 4F7MA 4UM8B 1XF5B 2XX1A 4WW1A 4N0YL 1TITA 3N1GC 1FL5A 2IWKA 2VQ4A 2VDQH 3I74A 3KDPB 4PS3A 5GGQH 4K9EC 1HQRB 1NC2A 3MBWB 5J7CC 2JJVA 2JV6A 3GMRB 3VYOA 3D06A 2K3HA 1TXKA 1U3HB 2NY5L 1I53A 2XKNA 1P4LA 5PCYA 3BVXA 2MPAH 1SFDA 2DQJH 2KZKA 1SZNA 3DJZA 4M62L 5C2BH 2V3VA 4AYBA 4WW2B 5MI0B 1KGXA 3BQVA 2FO4A 3WUZA 5FO9B 4FG4A 3ZQWA 2RIKA 3HBZA 1LD9A 1S9VA 1F0LA 1XAUA 4JRXA 4NBYB 2XZCH 3X2MA 3K71A 5E5MA 3TM6A 5IG7A 1V05A 4UIKH 3SB3A 2XG5A 3OGCB 1GS7A 1MFEL 2BVUA 4EN2A 1BWWA 4PRNA 4MAUH 3QZPA 1CR9H 1OP9A 4WFGD 3Q8CA 2A6JB 1KTCA 4OQTA 2ISDA 4ESKA 2R0KL 4ZMVA 1XEDA 2Q7YA 3GC3A 4K3EL 5HYEA 4KXAA 4S1SH 3ZDYE 2VZOA 2UZIH 3BZFA 3I75B 1GH7A 4DKEL 5SWQB 3DUSB 4QRRD 4J39A 1ZVNA 1K9TA 5CM1A 1QNZL 5T5ID 4HF5L 2ZSVA 1EIBA 2GJ6B 5AUMB 5T1DH 3F7KA 4IOIB 3UTTD 1UCTA 1ASQA 1DVFD 4YZFF 4YEEA 1P9MC 3PAUA 1ETA1 3EGDA 4MZRA 4OCRH 5JOPE 2VABA 1Z2KA 2XTJB 5C86A 2E8YA 5MHSD 5IB1B 1IKNC 2GSGB 3NPSB 5IMKA 2A2QT 4IRJC 2J4WH 1NAMA 4IRSA 2VDLH 3GMLB 3RUGB 3WNPA 1SM3H 4XPGL 1BYNA 1CDBA 1N3NA 1DUZB 4POYA 3WFDH 3ML9A 4N0FA 5EB9A 5AVYB 2MNUA 3QUXC 2ED9A 2NY2C 4NZTH 4KTDH 2J5LB 1DCLA 2QGBA 1S6NA 3REVA 2BOCB 2XCMC 1RUMH 1TEYA 3L5HA 4XC3H 2BIQA 3OKLB 5EU4A 4OCWL 3DJSA 5E2VH 4UAOB 4NENB 1M7XA 2ICES 1W72B 3MRIB 3QI9B 5E1AB 1ODUA 3S35X 4YSCA 1LEKB 4XNAA 4J3SA 3MV8E 3MOBH 1WZMA 1QSEB 1CLZH 2G30A 1KGCE 4XVUD 5I1CH 3BKYL 4PTTB 2I9LA 4XGZB 4ZUUB 4K2UH 1YMME 3DBXB 5F89B 3B3IB 2R15A 2A69D 2EDQA 1ZE3C 4UU9A 4ZFOA 2YUXA 5DJYB 4L3ED 5I1GH 3FOMB 3UJIH 4Y5VA 1XVSA 3VXME 3DK2A 1R3IH 1A6WH 3HI1B 3EUUA 2BSSA 1E4XI 5HBBA 4K5MA 2GAEA 3MA7B 1FG2B 1MCCA 3QDGB 3D85A 4W6XB 1SUJA 4U3SB 3RZWA 3DSNB 1DVXA 3V6OE 1BX2B 5L2JA 4JPQA 3GSOB 3OJVC 3U6RA 2J72A 4PRHA 2FWSA 3QULA 1V7ML 4ZX4A 3BSZH 4WI7A 2ADJB 3OZLA 5D2LA 5JPMB 1H3UA 1R3KB 4NKIL 1XIWC 4LMQI 4NKMB 1SDDB 2VXSL 3VGDA 4HPOL 5BZWA 1LEGA 1QSEE 5FGCB 1MWAH 4JFFD 3MRPB 2Z8WC 4JY4A 2WSDA 3K2UL 1U8JB 4U2ZA 3VDAA 3BCDA 1UWFA 1F00I 4CRPA 5J11B 1GKOA 1FGNL 2H1PH 1EMTH 1T83C 3QIBC 2WCPA 3VCLA 5CGYC 2PNWA 4RQQB 5JHMA 3MV7A 3TZVD 2XIIA 5I0DA 5IJVB 1KGIA 1KTJA 2WXOA 3LNIA 5DEGA 3FL7A 3L7FA 1S46A 5CMAB 5I16B 3WHXA 3ZDZE 1OA7A 3OKMA 1QVOA 4LCWD 1PY0A 2KPWA 4F7EA 1NCOA 2BM3A 2IC2A 3HHMA 4W9EC 2WXQA 3TC9A 2HLAA 3H9SD 4I3SH 1GGBL 5FGCE 3DVIA 1HAWA 4XCEA 5F6HJ 5M94B 3V5HB 4PU2A 4EUPB 3H3PH 4KAQL 1TSRA 1I9IH 5SWZE 2CALA 4MMZA 3VI3A 2I60L 1KB5B 2R29L 5BO0D 4XXDB 1KEGL 5MEPB 2E7LA 5GSRA 4PR5B 3WEBA 1U92A 5JIIA 5EF3A 1CFSA 3CVIL 3Q44A 1RZFL 3MV9D 5HDWA 3SOTA 4AE0A 5L4JA 3TEUA 3CZBA 3AG1B 4DP8X 4KROD 3HZ3A 5IVZA 3VTMA 1P5UC 2GCYA 3T6VA 4ADGA 4Y5XA 1JZ4A 4P4KB 1U3JA 2KLTA 4XMZA 5F9OH 3UJTH 1YEEL 1OAYH 4BE6A 1PZ2A 3KPQA 1MJ7H 4LASL 2YFOA 1M53A 3SGJC 5GZNA 4IIQB 4PJIF 4PRDB 2RJMA 1EGJL 1I75A 4NO0D 3ARGA 4LIQE 4CC0A 1Q4NX 4NLHA 2K8QA 4OV6F 4X8CA 3C6LB 5TDOB 1KLGB 5HJDA 3AACA 4M8QB 1S5HB 1Z6JT 4UCFA 5F9WB 4RMWA 5KOMC 1BW4A 1IEBA 3B9KC 1E4KC 1BJMA 5GZOD 3GS7A 4PRID 1XF1A 1EAPA 2XV3A 3NDYE 2BLFA 2X28A 4BBWA 4I1RA 4M61B 4Y1TA 3ECQA 5D1ZD 4A7QA 5C9JA 4H1LG 3KPSB 3NABH 4QHKJ 3J7HA 5CCHE 2A68D 2A5UA 4UOJA 3SEPA 2NPLX 1F2QA 2ZUXA 4KK5D 3X2NA 5DWUL 3T3ME 4HOMA 4PGBA 4YDLC 3HRZA 2UZXB 5ALBH 1LO4L 3KVDD 2R2BB 4OZ4B 4FS0A 5ABDE 4G8FA 1GMEA 5CSZB 3GMQB 3DUUA 1Q9WB 1WIOA 2Y36L 3HKFA 2BSTB 3VW3L 4YN3A 5GLXA 4ICXA 2FJGA 2N7SA 3FCGA 4M1GL 4NFCA 3RZCC 5ELIA 3QPXL 1Q9LA 1J8RA 3FO9B 4FQPA 1VJSA 1SEQL 3H0TA 2IANB 1OM3H 4EN3B 2HFFB 4MNHA 3RGVB 4M7KL 3AFLA 3BAJA 4JW3A 2NNAA 3HNSL 5IMOA 4J3UA 3NPZB 4YSRA 5B1BB 4AV4A 4C4UA 1QHQA 1AZZC 3WDIA 2EVHA 3FUIA 3ZL4H 3D0AA 1HSBB 2IJ0C 2IXQA 3QDMB 4G9FB 3ETBF 4IQHA 2XPGA 3MNVB 2AERT 3EYVA 5DJ2A 4WNJA 1FO0H 2AJXL 3IDJB 2HWZH 3P3SA 3T0BA 5IT2L 4WV1C 1TQCC 2PNDA 5HYJB 4KUZH 2VPXA 1Y0LB 1NFIB 1NL0L 3SKNB 4ENED 2IAMB 3JWOL 5DLMH 3KPMB 4CU7A 3FO0H 1G1OA 2IQ9H 2D8KA 1XL4A 3CFQA 3FQWB 3OSVA 1K3IA 1YY9C 4GIOA 2OL3A 7PCYA 1SLXA 5DZPA 4YPJA 3WENA 1L7TL 3FPXA 2IANE 3PJLA 4P9HH 3AITA 2G4EA 1EAJA 4JRLA 1B90A 2NZ1A 2P24B 4G6KL 1PD0A 3BVNB 2ZPKL 5LKNA 2CIIB 3BUYB 2CJTA 3NSCA 1YEJH 4KMQA 2C7UA 3GXTA 4XI5D 1TYJA 4HDIA 3H54A 2DYSB 3L9BA 4OD1L 3IJEB 3MQIA 4PWFA 2KERA 1IGFL 2CDFB 1IGJB 1OO2A 3P9LB 4QF1B 5AYQA 1S78D 4HKZB 4O5LL 1MI5A 2X4NA 1AP2B 2D31B 1G7QA 1GGCL 3OAYH 4M5ZH 2EIJB 2X4QB 3E0GA 4X6DA 3FZUD 3WEXA 3D3VB 1KT2A 2EKSB 4OLXH 4OVUA 3NBNA 2X05A 2R2CA 4QXUH 5T5FL 1WP6A 1WGOA 5D1XD 1A0QL 3TPUB 2E4TA 1CFVH 3ML8A 5JO5B 1PLBA 3SQBA 2A4ZA 3C60B 2PETA 4MDIB 2XTLA 4LL9A 4PB9H 1JGDB 4K9JA 3MRMA 4ODSH 4GG6F 1V10A 3MV8D 5I8OH 3ARED 3IPFA 3QR1A 1KGCD 2GIXA 3MR9B 1YMMD 4KO7A 3CNKA 1WH0A 4B9ZA 1TDQA 4GQZA 5FOJA 3EYQD 3DGDA 2YPKA 4GAGH 4N0RA 3VXMD 3ZXAC 2A6DB 2A9AA 3CZUB 2FJSA 4LDOB 4NWTH 5DD6B 1DBBL 4M1CC 5BRZA 1DBKL 3KCPB 5D9SA 2FGWH 4CADB 4GRLC 5J1TC 3RIAF 5A2BA 5IIEB 1FFOA 4CMHB 2GEQA 3UCRA 1H8NA 3WUWG 4NM8L 4TTDC 5EIIG 2KMWA 4F37K 3VACA 1B0RB 5KUMA 5F1KC 1FH5L 3STZB 3QIWC 3GUTA 5IHWA 2GW5A 4AI7A 1H3PH 1L7IH 1RJYA 1MJ8H 5IEHB 1LO2H 2Z3FA 4M8UA 3M46A 4U7MA 4HZ1A 2EYRA 5C0CA 4JQIL 4KZEH 1XCTB 3HBQA 2B1HL 3RBGA 1OW0C 4GW4B 4LBEB 1OL0A 3HAEG 3GJFB 3GRBA 2A6KB 3FO2A 2F1EA 4NQEB 3ESPA 1QUPA 5I19L 2R1WB 3EJPA 4JN1L 4P9ML 2EXYC 4UOQA 5GRJH 5HHXL 3CQZA 3HMXA 3U9PL 3OMAB 4Y0GA 4UB0L 4ZPTB 2BP8A 3QR2A 4LLUB 1D7DA 5KANI 5FW8A 1XGYH 5T1LB 3DVFA 2MOGA 2RFXA 1UWGL 1W8OA 2G0KA 3U7WH 1FL5B 2ENGA 2EEXA 1BXXA 2DH3A 5ISZD 3RY6C 1OGTA 1QLEB 4PAZA 1QRKA 1U8HB 3TJHD 4MJIA 4I8DA 1MHEA 1NC2B 1OD7A 1S7QA 2QZQA 1VGEH 3KWVA 5B3SB 1LEIA 5BMFH 4C2MA 1U8OA 3GK8H 3IGFA 1F6LL 3TA3A 2OMWA 3JV6B 2B1AL 2VIRB 4O2CB 4GRMB 1DR9A 4ZPVB 5FOBA 2W95A 1P4LB 5DZLA 1ZTXE 3CFBA 4JHBA 4FMVA 4YHYB 2K6WA 3ALXA 5J13C 3ARFB 1E3FA 4NQEE 4GI6A 4CMMA 5SWZD 1MELA 1WZ1L 1BJ1H 2K9FB 5D7IA 5KSAA 3QJSB 1CMOA 2WXHA 4OJDH 1AY1H 1ZK5A 1BXVA 4PB0H 3CLEH 3LXBA 4KNUA 1U8NA 1WICA 3CJJA 4MFHA 3OAWA 1KCVH 5D7JA 2UVFA 4A1RA 4FABH 1QLFA 4ZD3H 3PV6B 1WGVA 4G7QB 5CJ8A 1P53A 2LVEA 3IFLH 5CAYB 4JR9L 5LB1A 2OMTB 1RURL 2YXMA 2SEBA 2ZKHH 2Y5TB 4Q6IA 3FQNB 2OTWA 4FN0A 4HJ0C 3TA4D 4JNXA 4MNGB 4FLHA 1HHKB 1WWCA 2BDNL 3BZFB 1N18A 4WW2F 2RH0A 5ESVB 2FAUA 4OB5L 1J5CA 5D1QC 2NTSP 5CIPB 4TPRH 4BKLB 1DVQA 3VE0A 2WP3T 3GDCA 2Z93B 3V8OA 2ZSVB 3LRKA 1DL7L 2VJXA 1FV1A 4LHJB 1JGUH 2YEZA 3CLWA 4KDTC 2MKWA 4JKPH 3N42B 3B2DC 2FYYB 3EYFA 3EGDB 4GMTH 1X5LA 4JRXE 4LLQA 3X2HA 3OKOB 4GXVL 3ZPDA 1EANA 2AJZB 5GS0C 4AIOA 3EXLA 1BFOA 5I17B 5IMKB 2HSIA 3RY5A 4ZBJA 1NAMB 2DWDB 3M86A 1UXMA 2YQ3A 4HK3J 4IKKA 3DMMB 1KC5H 2JELH 4PJGB 2V37A 2Q10A 2WGNB 4S1RH 2Z4QA 1XZ0A 3Q9QA 4FFYA 4Z7UA 3HC0B 4HPYL 4FLOA 5ICUA 2VDNB 3RWJA 3REVB 3NA9L 2JJWA 3VXUD 4JZOA 2VLKD 3BIAX 2H2PD 1HILA 4R7VA 3K2IA 2APTA 1TYRA 1TJMA 3E3QC 1G7IA 3F64A 5AZEH 2DOCA 2OMZA 2W9LA 3CU1A 2AEWA 2HLFD 2AQ3A 5B3JE 1FFRA 1NDMB 5J6GA 3IDNB 4ZZKA 4TF4A 2M1KA 1WVZA 3J07A 4NPYA 4QTHA 1HESA 4ZO6A 3RUGF 5CN3A 2E2HA 3JXAA 4ODUB 2I9LB 3PWNB 5GGUA 2Q86B 3GLZA 3VG9B 4AVRA 4KKLC 2C3WA 3ARQA 4ZFOB 2KUTA 4KRLB 1NGWB 5JNYA 5HYSA 4R2GC 1JJUA 2MOVA 4U7SA 3AB0B 8CGTA 1AHMA 1P7QD 3U79A 3O3EA 2CO2A 3GSUA 4Q0XH 4UAHA 3DX9A 2DJ4A 2FEEL 4Y4HA 5DK0A 2R1XA 1M7DA 4HV8A 5HHMD 4PREA 3D85B 3SQOL 2VCOA 5L8JB 2GI7A 4RCAA 1A3RL 4M5YL 1F11B 4MZ3A 3KXFA 4B5EA 5HYFA 5L2JB 2CXGA 4PRHB 7CGTA 2O61B 4UBDC 15C8H 2ADIB 2I26N 2ZOWA 2DW5A 5D2LB 5T1KB 4CKQA 4DVRL 1WUNT 5KYUA 4G72B 3BGFB 4AYEC 4CUCA 1GGIL 2K3TA 3IRZA 3ULSB 2NOYA 2OCFD 1LEGB 5DRNA 2J57A 3FS9A 2DQFB 1YECH 2Q76A 2R7EA 3QA3B 4U0RC 3L2NA 4WO4D 4JY4B 3TN0D 2Y69B 1CDYA 1WFOA 3FN3A 5E6IA 4OVVA 4DP4X 5I6OA 2E9GA 1I8UA 4UNIA 3ZTCC 3DPDA 4P5TB 3WLWD 1CIDA 3VCLB 4QRTB 4QY8A 1M3IA 2DKSA 1ITCA 2IDSA 2W91A 3PGCA 4MD4A 3TESA 5EF1A 2PXYB 3CZJA 2UXTA 1DBJH 3MRLA 5EO0A 5CEZE 2CUIA 3ULVF 3UP1A 1HNFA 1HZHL 2BJMH 3D2UB 4IU2A 3H4HA 4PRHE 3AQXA 5EULV 2QFRA 1JWUA 3HNTH 3WIHL 5D2LE 3WHXB 4AIZB 4DQAA 4FFZA 2HZHA 4KJYB 1OTTC 2CGRL 4R4BB 4QLRA 1CU4L 1QEWB 2X1OA 3L16A 4MD5A 1FNSH 4ACPA 1FZMB 5HHPB 3F85A 3BSHA 4Z18A 1BOGA 4OZFA 3VB8A 1IFHH 1UD8A 4C54A 4AQEB 2X4PB 3KPOA 1TCRA 3DX6A 4FQ1L 5G5DA 4AZDA 3O3BA 1CFSB 2VXVH 3TVMA 4HQQL 3U30B 2VH5H 4PJ8B 3RX8A 2UXGA 4R90H 4OV5B 1FFTB 2Y07L 3O3DA 3SUMA 4U1IB 1A4JA 3CPLB 4IBUA 4A2FA 5B7FA 3I9PA 3C2AH 4P46A 5IVZB 4X0KB 1BMWA 1A1NB 3MV7E 4XWGL 2EUWA 4XZ4A 1EBPA 1GMIA 1JWSA 1UXWA 2VDRH 3AM8A 3ZKMD 3S8FB 1SF3A 2QDWA 4YSPA 1FCCA 4JDEB 4NWUL 1WPCA 3MACH 1PY4A 1XEUA 3EO0A 1OAZH 2XN9A 3RP1A 1MIEL 3S8GB 1UD4A 3LN4A 3O8XD 2ZXDA 1DLHB 4MYPA 1O7DC 5F93C 1S8DA 2YRBA 3JZYA 3HI6L 4YAQA 2AQRA 4D0DB 3NIFB 3MRKA 43C9A 3MLRL 3BXNB 3L3JA 1D3CA 2DIAA 5DZJA 4DGVH 1JNNH 3VI3E 1CLYH 5CO1A 4QXTA 1PLGH 2QL1A 2TRYA 2HUEA 1S7TB 3IJ8A 3BT2H 4KRPC 1EAPB 1R34A 2R7ZA 1E5UI 2VMCA 4JPKL 4WWKD 3ESNA 1GHFL 1J48A 1SF5A 3JUYA 5HGAA 4R83A 5HDRA 4BHUI 5AVQB 4XO5A 4PV9B 1I9EA 4DW2L 1MFMA 1ZHBB 3QE5A 3MGAA 4JG9A 3CWGA 4M93B 4H5SB 1L8FA 3WN5A 3WY2A 3T09A 4WHCA 2VNCA 4FCHA 3HRZB 2MJWA 1MJUH 4UINL 3DUUB 5I26A 1JXJA 2VLJA 3WMPA 3VSTA 3PXJA 5E1QA 5BO1L 3VWJD 2R93A 3WY3A 4F7TB 5C70A 1IVTA 1HXMA 1NMBL 3IRPX 3VRLE 3FQYA 1IM3B 1RERA 4QPEA 5KG9A 1JI2A 1JP5A 3QDAA 3A47A 4MNHB 3L3KA 4I0PA 1J87A 2FNWA 4O02A 1XFPA 5FWRA 5IMOB 2WQRA 5AB9A 3PXHA 4LU5L 3RTLA 4AGQA 4BFOA 3TBBA 5D96B 4TVPE 5HDOA 4HXBH 2XPGB 3VAEA 1QRND 3HS0A 5FO8A 2PO6D 3CBKB 3WE6A 1VKXA 5DMIH 1UT9A 3O3AB 4JG5A 3RX5A 1A7RL 2YK1L 4W9HC 3SGEI 4L29A 3UBHA 5EORH 4N85A 4MBRA 2HRLA 1MPAL 4JZNA 4HETA 3MCYA 4K3JH 2NSQA 5E4AA 1YEGH 3DUHA 4GH7B 5H94A 2D3NA 3LV3B 4ZFGH 2ENQA 2AGJL 3MBXH 2X10A 1ZTXH 2RAMA 3SPHA 4EBQH 4NGHL 2Y0SA 1NANI 1OLLA 2OL3B 1BXAA 3RTQB 1I1AA 4MCMA 1S3KL 3MOQA 3F2LA 5CN2A 4AXWB 1W0VA 3HR6A 4G8IB 1J05A 4UIMA 2DIJA 3SCMA 4W1TA 1JE6A 1Z9SA 4KJQD 4JRXD 1QLRA 1KCKA 1YEDB 5DQDH 1HKLL 1BZEA 4FXGC 3VXRB 4PJEA 2C7UB 1INDH 2OMUA 2YUZA 4HDIB 1B0GA 1O7VA 4KFMA 3ARWA 1R33A 4LLYB 4QO1A 2E7CA 3PU7A 1LILA 1VEMA 3V0JA 1G7QB 5FLUA 1S9WB 1IQDA 2NY6D 3MXWH 4LVNB 2CU9A 4FOMA 1RZPA 3WO4B 5EZJA 3VWKB 1KELH 4K94L 1HFUA 5CBAB 1AFVL 1KT2B 1ZGLM 4YDMA 1WFNA 1RJZB 5E4OA 4RMQA 3TIEB 1JGLL 3CZSA 4DGUA 1G7LA 1U8KA 3MMEA 4F24A 1JXGA 3O3UN 2D73A 3OPZH