3D30A

Structure of an expansin like protein from bacillus subtilis at 1.9a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
MAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Peptidoglycan-binding protein
molecule keywords Expansin like protein
total genus 52
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3d30A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3d30A02
1BW3A 3M3GA 2PI8A 4JP6A 1N10A 3D30A 2KQAA 3X2KA 2JNZA 1WHPA 4JJOA 2PJJA 3X2JA 4ZM7A 4JS7A 2GAEA 3SUKA 2VXQA 1BW4A 3SUMA 3X2PA 1L8FA 2AE0X 3CZBA 5GM9A 5GLYA 4ENGA 3X2NA 3X2IA 2G6GA 4FFTA 3X2GA 4JP7A 5GLXA 3SUJA 1BMWA 4L48A 3X2MA 3FT1A 2HCZX 1OA7A 1OA9A 2G5DA 3SULA 1WHOA 3X2OA 5H4UA 3X2HA 1HD5A 2PNWA 2PICA 4FG2A 4FG4A 3X2LA 1WC2A 3FT9A 2ENGA 4JCWA 2BH0A 4AVRA 3ENGA 4FERA
chains in the Genus database with same CATH superfamily
5DJAB 3ES6B 1YEFL 5HJ3A 1UHDA 4U6VH 4FA8A 4U6VL 1UWYA 1QP1A 3KWXA 3NJXA 4HQQL 1PBYA 2XN1A 3TONA 2YJQA 4KJYB 4A2DA 4CS0A 2GC7C 3L3OC 4YIQA 5GS0L 3LXUX 3B2PA 4OIIL 4QGTA 1KJ3L 4H44C 1DBMH 3LHPL 3TU6A 2JQMA 3MRMA 4FA7B 5DDHB 2QTVA 3DX8B 1EEYB 2EICA 1T7ZA 1MPAL 1S7TA 2HP4A 2VLRE 3BKJL 4KKCD 1FDLH 5JQ6L 2Q7AA 4QRSB 1QLRA 1UC6A 1N26A 1C5CL 1IO4C 4KXZI 1DYZA 1ETZA 3FK3A 1EJOL 2MHAA 4XPGL 4XPAL 5D1XC 5HPMA 5KAQG 5ADPL 2BVEA 1OAQL 3LNHA 4YSUA 4PJ9A 1LDPL 4NQTA 4X6EA 3MLUL 4AW4A 4L8SC 1A02N 3FUFA 3T8XB 4S1DC 3E6FA 5IR1A 5ISZE 2Q1EA 1RIVH 5TDNB 3H7BA 3IR6A 2R4RH 3CVHB 3K4ZA 1DQQA 1EV2E 3NG5A 4F24A 4DP5X 2ZUYA 4I77H 1DZ0A 3EW3B 3IDGA 3JYBA 4JFHE 4XP1H 3EJJX 2DLFL 1ZTXH 4OCSH 3VXSE 4OCSL 5HDOA 2OL3B 3L3GA 1BAWA 3QNZB 3ILPB 4RETB 4LSSH 2HLEB 5INDA 5KVGE 1JCKA 3NTCL 5C0CB 3GTTA 4JGJA 4MMZB 5E8DL 4M93C 4LSQH 4RQQB 5IMLA 5I2IB 2LGNA 4GKNA 4IQHA 4Z77A 3D2UD 4JPWH 4NKIH 1A1NB 3TCXA 4BH8A 4ELKB 4NQUA 4P2OD 1KGCE 3N40P 3GPSA 3VWKA 3MO1A 5BS0B 1OT2A 1KY6A 3NOIA 5JR1L 3IU3A 5L8LB 3MU3A 3S3JA 4HHAA 4FC3E 4JN1L 3PWUB 4ELMA 2O5XH 4JPQA 4G7YL 4AVHA 2AMGA 4R8WH 1AQ8A 5IT2L 4HKJB 1N12A 2ODHA 1PGRB 3HAEG 3L4TA 4IDLA 1KGIA 3QIBD 1KN2H 5FB8A 2ZUSA 3B6SB 3AROA 1MCCA 3WJMB 1S7SA 3B9VA 3VMPA 4GO6B 4ZFZB 1YLBB 1HHIB 4H20L 5AB9A 2LLLA 4F7CB 1U2YA 5EN2B 1RVFL 4NQEB 1WHPA 4GG8A 5D4QA 3ARTA 3RVWD 5ICZA 1HL9A 2VITA 4P48A 3RWEB 4EOWL 2VL5B 3ISWA 1SYSB 4N2FA 4GEIA 4O2EB 4R3SA 1GZHA 5DD1H 3CLEL 2Q5BA 1YZZA 4ZSOA 2E0PA 5IR1B 2CGRL 3MODH 2X6UA 3N42F 2K6WA 1EAQA 2J1ZA 5CD5D 2WOBA 3LEYL 3CZEA 5LGJB 4LIQE 4JY5L 3LKRB 1EGJL 3GJFB 5KANI 1BJMA 1TQSA 1T20B 2AF2A 4RDQG 5DFWH 4FN0A 1DQKA 4GW5B 4UQEA 3X14A 9CGTA 2A6DB 4KAQL 1IC7L 5F96H 4KJYA 4OZHB 4M7LT 4FA6A 3QIWC 5CJOH 5DZLA 4G3YL 4GQRA 2X3AA 5F1OB 3JSSA 3CDYA 3ZRSA 1LE5A 3KHOA 2KLTA 3QXDA 4FYSA 4NZDA 3ZW3A 1S7QA 2SODB 1GGIH 4E41E 4KNUA 1IFGA 1MHCB 4AV4A 1N18A 4P5MA 1A4KB 3EHBC 3VM5A 2VDQL 5BMFH 1MIML 1TCRB 5A16A 4LEXH 3VFGH 4UQDA 4UOW1 1MFMA 1NINA 4RGMB 3WXVL 4LLQB 3MCYA 5JNYB 3GKWL 3K6DA 1RI8A 2E76C 3GB7A 1WJ3A 4C57C 1HL8A 5GZNC 1JOIA 4X6CA 1K9TA 1SXNA 3HVDA 4V1DE 4KODA 1R34A 2O5JD 4PBWD 5D7SL 2NY0C 4G6MH 2R23A 5CAYB 3TEYA 1R3LA 1WWCA 3NGBC 4JM2F 4UOZA 2AEPH 4F2MB 5DHMC 1O7VA 4DMRA 3ROOA 3FN9A 3IPEA 3G5YB 1QG3A 2UUDK 3WS3A 4CRPA 3RIKA 1P1VA 4XNZC 2VDNL 1IGYB 4ABQA 1XXFC 1P53A 4E9WA 1D5RA 1IEBA 5D7IF 4OLZH 1Q9KA 3S98A 3FOMA 3E8VA 1Z0NA 1XXDC 3QFDA 3HN5A 1I9EA 2F53E 1M6UA 1BX2B 2PR9A 4PYGA 1CXEA 1HJCA 3EDJA 4BHUA 4ZYKA 4BGLA 3VXQB 3LEVH 2OYKA 1INDH 1MY7A 1YEGL 1IM3D 3P2BA 4PIBA 1KLGA 1Y6KR 1ZLWH 5D93C 3GMMB 3K4DA 3ZK0A 5DHVH 2HWZH 4NGHL 1CDUA 1DLHA 3FPYA 4K7PX 4Z76A 2DM4A 4GI6A 4KQ4L 4ZQKA 1JFQL 4LT7A 5TE7L 4JO1H 5DK2A 4FKHA 3LH2L 4JP6A 4FEIA 5D1XE 1BQ5A 2ZOOA 1K85A 4UDUB 4M56A 5IB2A 4PRHB 4G83A 4JFPB 2XG4A 3D7PA 3OKKB 4ZK8A 3UTTE 1YEHL 4PEEA 2J6EH 2QSVA 5E9DA 4AGMA 4AW7A 3CXFA 1NGWB 9PCYA 1AQHA 1FE8L 2G75A 4WWOA 5BRQA 5BVJB 4JREC 1KLUB 4X8JB 5KG9B 2P7TB 1IQDB 3MCKA 3PV6B 1LXMA 4PSRA 3U1SH 4M43H 4NUPA 3R06B 5JORA 3B9AA 3GBLA 3GSQA 2KYIA 2PMZA 1BPVA 5D1QB 3IJSB 2YEQA 3QJXA 4YZWA 1BQKA 2ITDB 2Y24A 1I1AC 3VFMB 5GS1A 2NVYA 1S7TB 2WWMC 4NO0B 5AALA 4XCNA 4TOYH 1P0SE 4BWTA 5D72H 5DMGC 3BUIA 2IOIA 3X2NA 3LZPA 4G6AC 3X2GA 3OGCB 1KOAA 1XF5B 4XCCH 3FCSB 1YMME 4G11A 4WWKB 4L8CA 3ISRA 4XX1E 1WZ1L 3RQ3A 4WJKB 3UTSE 4HKXB 3MBEB 4YFEA 3QCTL 1NJ9B 2X4SA 3WNIA 2BVYA 3LEXB 2J8UF 3SCMD 5LXGH 4ABWA 1UQSB 2DQHL 2V33A 3WHXA 1W91A 4HKBA 2VN6A 4JRYD 4BFIA 1NCTA 3F62A 4X7FC 2AKRA 2Z31A 4L29B 2KZBA 2XOTA 3UCRA 1WFIA 1E28A 4I3SH 4XTRC 1YYLL 1MREH 3UTTD 1SXBA 1V7ML 4KUZL 1CFNA 1PX3A 3QR1A 2AV7A 3ULUL 1PU0A 2HVJA 2IVFC 1BOGB 3H9SB 4LBEB 1SFOA 1J0ZA 3TBVB 3T0BA 3WEXA 2YD0A 3K6SB 1JTPA 4ENEC 3HAEH 1EAOA 4CKQA 4M1GH 3BX7C 5B6CA 2YMOA 2CJTA 4OCXH 5SWZB 4XNUL 5AEAA 4NP9A 2QVIA 5DUML 4I8DA 3ARGC 3FJTA 1VFOA 3IE9A 2XTJB 3F05A 4H0HB 4OLVH 2FSEB 5AKRA 3ZE0E 4R7NB 5GGUB 2NXZB 4ZMLA 3LNEA 4QJ3B 2E74C 4HX1B 2R51A 1ZA6B 4TSBH 3BT0A 4LCIH 1D9KB 2X4UA 3RWGB 3NJKA 1HZHH 3CZJA 4QYOA 2XYCA 2VR3A 4IEFA 4LLMB 1X9RA 3DO4A 5IGXH 3ARGA 4X5WA 3X1GA 3J8F7 1P4UA 1GC1L 2KLSA 2X1PA 3QQDB 5HYSG 3L1FA 5DK2B 8PAZA 5BZDB 2XA8L 2Q3ZA 5DQ9B 3SKUD 1QSFD 3MV8B 4G6KH 4G6KL 4HH8A 3L7EA 4P9MH 4RA3A 2Z8RA 2FJGA 4S11A 4JFXB 3RI5F 3RHWF 2EH8H 2DL2A 2C9RA 2DMHA 1D7FA 4LOEA 1ZT1A 2ED6A 1K6QH 3ARVA 3FQXB 4M5TA 4P57B 4Y9FA 3WS6C 4XPBL 2A6IA 2GJ6A 3CH1A 3IMVA 1J1PL 2EEFA 1CGXA 3P54A 1KJ2B 3B9KA 4BXSV 2UYLA 4OF8A 5JQIB 4LSPH 1XGUA 5CBEB 3ZE1F 1SY6H 3WLBB 1BFSA 4PD4J 3KPRD 3QFDB 4AH2B 2NNXA 5HJDA 5TF1L 4EXPX 4TULH 5GRJL 3SD2A 2BNUB 3OKNB 2R69A 2R0KH 3CN3A 4QCIA 1INEL 4WUUE 3GXNA 2WD0A 1NCHA 2JSFA 1Z32X 5F7LB 1ZRUA 5IROD 1JVOA 3KAAA 4XZUB 3HMWL 1GS8A 4OGAD 4U3SA 2M26A 1J5IA 1P5UC 3UTZA 3UTSD 4HIQA 4E9LA 4AYBA 2HA1A 5FYJD 5EBGA 5B39A 2XWJB 2OSLA 1E5AA 4U05A 3L81A 2ZOUA 1KQGA 3LXCA 4K3JH 4LF3B 4NRXA 3U1PA 2HZHA 4LVEA 3S37H 3WY1A 3MA9H 1ZLUH 4IHOB 3MI6A 4NUGL 1ZEAH 5B7EA 1YY9D 1CFNB 1IAIH 1QSED 4WFHE 4FAAB 3DA0A 4FD0A 4G72B 5E2TL 1SJMA 3AM8C 2ZJSH 3LN4A 5IFJA 3P3SA 3WG7B 3AS3A 2O61B 1G4MA 1DQJB 1YAIA 5F7WC 5FM8A 5T1LA 4QRSA 4JFWA 3H3PL 1TZGL 4G42A 3VI3A 1N67A 3AQZA 1ECYA 3L9BA 2OL3H 1QZNA 4RESB 3LIZA 1IAKB 1EUTA 4OB5H 3FU8A 5C0AD 3HMWH 4HUCA 3MV7A 1NCDL 5D71H 5C07D 2DWYA 5AD0A 1S3RA 2VLMD 5A6MA 3FFCA 3H3BC 3IDXH 3MLUH 1VZHA 4LPWA 2Z35A 3WHE0 2NYZA 3DARA 5C0BD 3VD3A 1VC3B 5JOPD 5KVDE 2DDQH 3M7FB 4J3SA 4IHOA 3UPRA 1FYTD 4QTIH 1GKEA 3PP4L 4HJ0C 4F7TB 3MBXL 4UTAA 4ODWA 5EF2A 4YXLH 2ITDA 4GQ9H 2YHGA 4I18A 3FU0A 3KG5A 4UZSA 4UYPA 2W65A 5IF0A 5DD5L 3UX9B 2AEQL 3OMAB 3B34A 1L6PA 3KJ4C 5ID0A 4DZ8A 4MS8C 1WBXB 3FF8A 4ELDA 1FI8C 2YKLH 1XB8A 5L0QB 5LWYH 5ESQB 2VN4A 2XETA 3DGGA 4KKBC 1NCBH 1ASQA 1QSFA 1MHPH 2KC0A 2IV9A 2X4NA 2CM6A 2FEEI 2VW4A 1NGPL 2NY1C 4MNQD 3N44F 4J3OC 1PY9A 2BHFA 1W0WB 4LAJH 1XIWD 2PCPB 2WTPA 4OCRL 4MD4B 3BGFC 3O11A 2WTRB 3VWKB 2L04A 3N2JA 4W6XB 3Q06A 3F83A 4JN1H 3GSVA 3KPMA 4G9DB 3RP1A 1B0GA 1U3HB 2H2PD 5DZOA 5I9QB 2I69A 1JWMB 4JX0A 3KGRA 4L5FE 3GS4A 3WE6B 5ALBH 2O5YH 2YXWA 2AABH 1T7XA 3RE0A 3MRGB 4WEBH 1DMRA 2KUTA 4AGOA 1A6TA 2FQFA 2CHXA 3VGGA 5I8OH 2FHBA 1BDYA 1FNHA 2X1WL 4XODA 4Y8AA 5A7BA 2WYTA 4EN3D 4BQCA 2XWTA 4M1DL 3CSYB 4X4YB 2P5EE 1VACB 4LMQI 5HHNA 4GKOA 3K0YA 3NN8A 5DC4B 5DJ6B 3MOAH 2PW2A 4KY2A 1JUFA 2PPFA 3ZHKA 2DEWX 4WHYG 1NTDA 2VQ4A 2AQ2A 4MA8H 2MPAL 2Z4QB 3LKQA 4ZO8A 3G7TA 4FRWA 2H1PH 2EEBA 4KVNL 1FG2A 2PYED 1MJJA 1YMHB 3W37A 4Z3HA 2ZWLT 2DLTA 4TUJB 1JVKA 1YY8B 4N2BA 4V1DD 4JHVA 4WY7L 3MUZ1 3ARYA 3DJ9A 3HG1A 3WKNA 1NZRA 2DF3A 3PREA 4HJTA 4L9DA 1ZGLP 3V6ZA 2A83A 2GJJA 3O2DA 3MYJB 4WFGE 5JOEA 5ESAA 3UG5A 2A38A 2OTUA 4WUKH 1KJVB 1NEUA 2OSYA 2VXUH 3AS1A 1CD0A 5DVKA 2DYPA 2ENYA 4DIXA 1YAZA 2HAZA 3LEVL 5SWZA 4RWYL 3K6FA 1MPAH 3GZKA 3BIKB 2Y7QA 3CQQA 1LEGB 2FWOB 3LKSB 2IFFH 2NW3A 5IB4A 2EYSB 7TAAA 4JRXD 2J8UB 3HNSL 3HZYA 2Y07L 4ODHL 4Y1TA 5AQ0A 1O6VA 2YJLA 2PABA 4G8IA 4XN8A 4YX2L 4YX2H 1LK2B 4HUVA 4Y19B 1SVCP 4JAMB 4OAWB 4HK3N 4MX7A 4BA0A 5BV7C 1OLLA 2DMCA 4HIEB 1I53A 3S5ZA 2NTSP 1SXAA 3QDJA 5KSVB 3MHZA 3QJFB 1GPOH 2EE0A 4P2RE 4LF3A 4K94C 3ZSTA 3HHRB 2MJWA 4MD0B 4YK4C 4QLWA 3S88L 5H35A 1NFKA 1P7QA 1E65A 4Q74A 1U91A 4CL7A 1QRND 1UD5A 4L8SA 2EXWC 1PX8A 4W70A 1FVCA 3TIEB 3PCYA 5IG7A 5A2JH 1PJ9A 2V37A 1CFQA 3DX9B 2HLFC 2IMNA 3AREA 1UKQA 2BY1A 1OTUD 3B7RL 4N20A 5DRWA 4O2FB 5D7IE 3VXSB 3U0WH 5JHAA 5CCKH 2IIJA 5CZXC 4PRIE 3RPIA 1A5FL 5EF1A 3SQBB 3I9PA 4HH9A 1YN7A 2AQQA 4XVJL 4PJDB 3P9WB 5CGYC 5SX5H 1NM9A 4UM8A 3H56A 1T2QH 4P4KB 4R97B 1T03L 2P8PB 4H25B 3TWYA 1ANUA 5CN3A 2B16A 4XOAA 1N7MH 2WSKA 4HF5H 1HAWA 2YQ2A 3CLWA 1PKOA 1HL4A 3WGVB 1GPOL 1MFBH 4FI8A 2BSTB 3IU4H 4XPTL 3LKRA 4M8QA 4P2YA 1RUAH 1TTGA 1JGEA 1ZHLB 3ILEA 4NQDD 1F6AA 5DGQA 2J71A 3CFKB 4GW1B 1ZANH 4AQ1A 2CCVA 4GJTB 5DMGD 4C56D 1DBJL 1R4XA 4QXGL 1A4CA 4NO3B 4APQA 3T65A 3QEQD 4P46D 1H3GA 3BSGA 5DLMH 3EJZD 4X9FA 1L9RA 3BPOC 3CNKA 4MJ5B 4BCXA 5FO7A 1WZKA 5KYYA 4FXGC 3MRFA 5DI8B 3KZ8A 1C1EH 4ZMZA 3E6HB 4PRBA 4Z7AA 1NUFA 1BP3B 2Y3NA 1R5WB 2DYRB 3M07A 4MJHA 1RZ7L 1BG1A 1NC4A 2L7UA 2B1AL 5G4NA 1E50A 5I15H 3ENGA 2H8PA 1R9TA 2BNQD 3FCBA 3H54A 3VXPB 4BFFA 1J5OH 1Q0XL 2G2RB 4O02L 4ZS6D 3A6BH 4OJFH 2BSBA 3RL2A 2XBDA 4S1SH 1K83A 3PJLA 1LO3L 4ECNA 1F6AB 3FFCD 4RMBA 1KJ2H 1V55B 3IJEB 2XPGA 1MW2A 3T0EE 2WYHA 1FYHB 4HHAB 2XZAH 1NGYA 2F5BL 3TO2B 1TTRA 1D6EA 3W9EA 1M3IA 2OSXA 5IHLB 3EJRA 4B9KC 2UV3A 3QXUA 1I8KB 2FHFA 1SOXA 4WV1C 3TNNB 4A2MA 4AQAA 4CU7A 1I8LA 5GGSA 4ANKA 4AGNA 1QFHA 2NOYA 1JGUL 1G9HA 1QNIA 4U3XA 4DP0X 4LZKA 1CLOL 4YQXH 1E6OH 1W6WA 5BPPA 1OAZL 1P5UA 5I28A 2K8MA 3SBWC 1BZ7B 1NC4D 5EOQH 4X7CC 4X9BA 4PJ7E 2AXFA 4FJZA 1CYXA 4MFHA 3TN0A 5C08B 2FZ3B 1VKXB 1Z9LA 2ZF9A 3WXVH 5DQJB 5KZCB 4D0DB 4JPSA 2C1OA 3VCLA 4PJ7F 2X09A 3VGDA 1LO5B 5KBNC 3SKOB 2Y7QB 1EZUA 3N43B 3WNPA 1RURH 1FFOA 3QT2A 1RPKA 3PJSB 4MDIA 2XWXA 3FSWA 5I1EH 5KBKA 4EVNB 2JQAA 4FNSA 4XI5D 1E27A 4MSWA 1IZJA 2BIHA 5AZ2H 4E0RA 1X5KA 2WXKA 5D7LB 2ZZUT 4DKDC 3GMOA 1NOFA 4WCYH 4ZX6A 4TULL 2R56L 5GGTA 3TEWA 5FTMA 1L0YA 4TL4A 1HX0A 4ZNEE 2CG9X 1EBAA 5D93B 4M7KL 4MAYC 2H3KA 4M7KH 3RVUC 4C8XA 2G0KA 4JKPL 2N7SA 5EEVA 3SGJC 1K72A 4K23L 4K23H 2X2IA 2G75B 1E4XI 2G2RA 2VISA 4HK0A 2Z93B 2R2HB 4Z18A 3IDIB 3CSGA 2NY2D 3RWHB 2G9HB 3W3BA 4HKJA 5F0JB 1G7JB 3A3YB 1SVBA 4MKTA 3T0DA 2ZOLA 4IRSB 1HEJC 1OTSD 1QZ1A 3QIWD 2Z7WA 4XPHH 1NKOA 3E1ZA 1U2CA 5AZ2L 1T7VA 2BVQA 3NA9H 4IRZH 4XBGA 4AG4L 2O93L 1KGJA 1FL3A 2VDNB 4TV3A 4Z3TA 2Y7LA 5CD5C 1ZHLA 1YNKL 2N01B 1MFUA 1YNKH 3HR5A 4S0SD 4YDNA 3I3DA 3B2UC 1UUNA 3K3QA 5DD0L 5K1NA 2DD8L 1WBYA 1OV8A 3SJVA 4XN2A 4NAMA 3QNZA 1SJVA 2P24B 3E2HB 4RISL 2HB0A 1X5FA 3WOVA 3AB0C 3PAVA 2IH8A 3O3BA 1QEWB 2C1PA 2HLAA 1NCNA 3V9CA 1DQQB 2DQEH 3C5JB 4KC3B 4WKXA 4ONFH 5KZCD 3ZHLA 1KB9K 3T0AA 4W9KC 1UWEL 4CMHB 2L4OA 3E6FB 1MLCA 1TQUA 2NY4B 5E7FA 2YUVA 2XWDA 1F4YH 4PVLA 2FIKB 3CFUA 1NC4B 3EXJA 3RKDD 5LVEA 4AYEC 5IJVA 1ACYH 4D9LH 3T1FA 3HS0C 4ADJA 1AZZC 2APBA 2FRGP 5DK3A 5DJCA 4QF1A 5DA4A 3BGMA 4LHUA 5LGKA 4FFYL 2AJYL 1I1AA 2LAAA 2WB1A 1Q16A 1MAJA 2HG5B 4LEBA 4WU7A 1SJEA 1C7SA 2R59A 2UY6B 2OZ4A 3MXWL 1BZOA 3MXWH 4P5KB 5CWSA 1V54B 1WHOA 1NICA 2PCXA 2VMDA 3NVQA 1PCSA 2J4WH 4JM2B 1L9QA 1NAML 2LTQC 3I6LD 4XI5C 5HI3D 3LQAH 2PWHA 5D5MA 4Y4KC 2DQUH 2BNQB 5T1MB 4KZEL 2XTJC 1FFPB 1PG7L 3MRBA 4FQIL 1Q9OA 2H5UA 4ES9A 1WS8A 5D7IB 2EYRA 4TVUA 2ADGB 1Z5HA 1RIHL 4NN7C 1CXFA 1ZVYA 1O0VA 2A1WL 3TJEH 3RAJL 2JI1A 4HS6B 4XBEL 1GGCH 5DHEA 3ECWA 5EOCH 3OR6A 3T6WA 1YEFH 3MRPB 1K4DB 2YEVB 1WVZA 5E6RB 2BHZA 2RHEA 1CL7H 1YMMD 2V9RA 3NZ8A 3PWPB 4L3EA 1T6WA 3IDMB 1MCPL 1WAEA 3B83A 3PQYD 3QDGE 4A39A 1IC5L 4UI2A 4BZ2L 1JXKA 1GOHA 4PJEE 3VQLA 2XTLA 3O45A 3DO7A 3UCQA 4KNQA 4FMKA 2MCPL 4OZFG 1JDDA 3DUSA 4NWTH 1BREA 5AUMA 3KDMA 4CVXB 4XBPB 2IQAA 2NT1A 3UYPA 1T0MB 4XH2B 2WYZA 1WISA 3FQWA 3HNVH 5GRUL 3KYMB 2W0PA 4IIZA 3QXAB 2F7PA 2E9JA 4FFWD 2BOBA 4ZS6C 3DMMB 3BEWA 3FUMA 4XPGH 1LHZA 2GSIA 2VLJA 3O6LL 4LLVA 2Q7YB 4AL8L 4XNUH 1BGXL 1IKNC 2P1YA 3ILQC 3LZOA 4FFZL 4JO2H 3VXSD 1A0QH 5JPMC 3QDMD 4ZOBA 1JYVA 5K9OA 2D7TL 4RFEA 1IC5H 4OZIF 1JZ4A 3GI9L 1BJ1H 2CIKB 1U8HA 1WF5A 3SQRA 4PR5A 5EU4B 5IEKA 2HT3C 3MLRH 3HNSH 1GRWA 2W0FB 3CVIH 5E6IC 1CICD 1KCSH 2V5TA 1KCSL 1JPSH 1S3KH 2P46B 4K7PY 4WWNA 4I5BA 4F8OA 4Q14A 3OF6A 2G2NA 5E6YA 4BDVB 1BXVA 1TZ8A 1TQWA 2ZP9A 4K15A 5FOJA 4RMQA 5FM5O 4AK2A 5E0FA 5I76A 4RAHA 2EKSB 3PPSA 2IQ9H 2XNAB 4WI9A 5CSBA 4P5TD 4J4PD 1MCLA 1KIRB 2ALAA 1IGCH 3NJNA 5DEGA 1FNEB 5G4OA 1QRKA 1H5BB 2ADIA 3EYVA 3QNXA 4NN6C 4NWUH 4UQ9A 1QBMH 4NC1E 1CFSA 3QHFL 3VFRA 4HS8H 2BDNL 2JKWA 2XJLA 4EPSA 3VRIA 3H9YA 3MLRL 3WD5L 1CXKA 5HDQL 4W9LC 3BD4A 3X13B 3DX2A 4MQSB 1F90H 1T0OA 1UGNA 3QEHB 5INCA 3VTMA 4ZUUB 1NIAA 5DWUL 3QXWA 1A9EB 1OGAB 3OF6D 3US1A 4QRUA 3O8XD 4PWHA 1FHGA 1EHLL 4ZRGA 3ULUE 3SGEH 4K5OA 3KPMB 4MJ4A 4BSJA 3CZFB 1Z9SA 1YYCA 5D5ME 3U48A 1KLFB 4LEEA 1N9PA 1J9TA 2O6FA 3CFDA 5B4MC 5LCVA 1IGCL 3W2DL 4RIRB 3LY6A 1ZIAA 3DVNB 5I18L 4EI6A 3POCA 3W5MA 4JK0D 2OTWB 2FEDC 1CZ5A 4KDWA 1XF4A 3QJVB 4TNWK 3FU9A 1SEBA 1XZ0A 4J3OH 3VD4A 3ARZA 1KGYE 4BSWA 3IPBA 4MA1C 1WBZA 4ZFOA 5F1IB 3U82B 1BQHG 3AWFA 1YNTA 1KDIA 1X5XA 5FYKE 4H88L 2WBJD 4G3YH 2X4RA 2P52A 3OR7B 4EEEA 5GJTL 2AKRB 2ZXEB 2GBVA 3D0VA 4K9EC 1YC8A 3FQTA 3U4EB 3RFZB 3FT3B 1T3FA 3LRLA 3TJHC 4Z7NF 4H1LH 3BEVA 3O6ML 1XMWA 2MCG1 1FVEA 3ZDYB 1QFWM 4XAKE 3KDMB 3TBBA 3NCEB 3E9TA 4QTFA 3ZE1B 3I6SA 3O2VH 4X98A 4C4KO 3T4YB 2YZ1A 3VO0A 1SMYD 4DGVL 3HE7C 1HJBC 1XO8A 4WJ5A 1WFOA 3S3SA 3TBTB 4N0RA 3RIFK 3D8MA 1CI5A 5F1IA 2D4DA 1CXLA 2GY7B 4P5SA 2X44D 4DP6X 3AAZA 5BO0D 5DRXA 1DJHA 3AQXA 1BYNA 4NT6A 5M7QA 2I27N 4P23C 4EN3C 3GMPB 1JNNH 4P57A 4L3FA 4OVVA 5IJDC 4LEXL 3DPBA 4GUQA 3DOHA 4FZEL 4YAQB 2Y36H 4PRNB 1EU1A 2QADB 3VRJA 1QX1A 2K6ZA 1DVQA 5FYKL 4JFOB 2OX5B 4NKMB 1MCSA 2VLLB 3ZOAA 5JDSB 1VPOH 3RX5A 1QUPA 4FTVB 1FNEA 2PTUA 5L4FA 3PIQA 3A4DA 1A3ZA 3CZGA 4B9GA 4ZW8A 1ONQB 3RTQD 3IN2A 1YEEL 4NAQA 3SPJA 2SEBB 1O6SA 3BKJH 1BVLB 5F21B 3WMPA 1OL0A 4Z8FL 3FB5A 3HHSB 1C12B 1KYAA 4IBVA 3O9WC 1DN0B 4MA7H 5B8CA 4Q89A 4J3XA 2NY1D 4H8UA 4BWWA 5F9JA 43CAA 1AKPA 5C0EA 5CJQH 3UPCA 5JLZA 5C9KA 5E8OA 5IBTH 5I8CA 4EMZA 3NEXA 2WZPA 2YGNA 1RZ8B 3BXNA 4GAYB 4KKBD 2DQDL 3FT1A 3MREA 1AP2A 1IGJA 4OFYD 3SE6A 3DXAE 1TLKA 2GTQA 2BVOB 3DJZA 3WCYA 3I50L 4MS8D 3ZT6A 2Z91A 2ILLA 2W0LA 5IIEA 2J2ZB 1OAUL 3L4XA 3OMZA 1OAUH 2H3NA 2B20A 4OD3H 1EMTL 4R7DA 3UBXI 2OTPA 1O5PA 1AZUA 3RNKB 2JE8A 1YEEH 1LEKB 2ZYSA 1MHCA 4GRLD 4XMZA 5A2BA 1G7HA 4L4JA 1A2YA 1KYDA 3A4FA 2AQNA 1JGLH 4L4VB 1ADWA 2Q86B 3NRQA 5GGRB 1IX2A 3M7OA 5ANME 4WV1A 1V7NL 3EJYC 1GIGL 3GXDA 3ZDYE 1ES0B 1SEQL 2NY6B 3T77B 4GYBA 4YC2C 3BSHA 4IK6A 2C5DC 4LLMA 4MCMA 3ZMRA 3VVVA 5IBTL 1DSFL 1A8JH 4OFDA 2R39A 4DN3H 5C0NC 5I1AA 4WUKL 2J3SA 4PBXA 5DUBA 1GZPB 3QDMB 4U0QB 5ES4B 4PJ8D 5HVGB 1W0VB 4U2YA 5GHWL 4CADB 5GHWH 4M4RA 5LO7A 3RWIA 2XN9B 2CHDA 1WWWX 4KDTA 1SJHB 4PJIB 2F5AL 3ZKXB 2Q6WB 1FV1A 3FN0H 5I0DA 3UAJC 1LP9E 3GXIA 4NHCH 3MGTB 3LPFA 2B39A 1E9QB 4N28A 4O02B 4LGSB 3P2DA 1E8WA 1URLA 4GQZA 3UAAA 4APQC 3FPXA 3FQ2A 4J1UB 4JMNA 2DB8A 5D5MB 4OGAC 3OWRA 2YA2A 4FYTA 2IAMB 1ULVA 1ZLSH 4Q97A 3SYOA 3QRGH 2CALA 1BFOB 4QRFA 5B8CC 1IARB 3CUPA 4O02H 1NDGA 1JV2A 3N5AA 2D9CA 1OGAE 2CKBL 4HBQA 4Q7DA 4D0CB 4M00A 1KC5L 4YEFA 2WVUA 3H2WA 4ACPA 3BUTA 3MBEA 1JPFB 2EDEA 4UT6L 2MIZA 3KM1A 3L6FB 4HGWB 4I3SL 2PO6C 4OBSA 4ZFGL 1C1EL 4Z76B 3QDJE 3D3VA 5L9DL 3HBQA 5FUZH 4RZKA 1MHHB 2R1YA 2VH5H 2X6BA 1OE3A 1SUHA 3TVMD 1UWEH 2FYVA 5DQJA 3KYAA 4GRWE 3FB6B 3OAUL 5F7HA 3ULVH 4JPVH 5IHUL 4JBSA 3O4LB 3KGUA 4TOYL 2Q86A 3T0WA 1IKNA 2HRHA 6TAAA 4GRLA 4YGVA 3DI2B 2VO8A 4YFLI 5GGRY 3W38A 4ETQB 1MFBL 5H4UA 3IKCB 3KWWA 3M6DA 1AZVA 4S1QL 2A0LC 3V5DB 4PRPD 3ZDXF 4E42A 2A68D 2ZKHH 3ULUF 2NY5H 2YRBA 3D1MC 4HA1A 5EIIB 1AACA 2P7TA 3MOQA 2AK4B 2DWSA 3BOVA 2X4QB 1SMAA 2FD6H 2DQJH 1FDIA 2BP8B 6CGTA 2W9EL 4EUPB 4TN9A 1A6ZB 1E5YA 4XNMA 4AVKA 4TQEH 4JG9A 1BW4A 5IMMA 2PETA 4NBZB 43C9B 5IMLB 3V9FA 5IB2B 3HVNA 3CAFA 1GHFH 3O4LA 4PJFF 4DK6A 4QRPB 2QL1A 5HYQB 3QZBA 1EO8L 1A4JB 4MA3B 5JXEC 4HD9A 5KAQF 3HZ3A 3S8GB 2FDBP 3KBEA 1GC1C 2GABA 1RZIB 3GSRB 3RTQA 2XBTA 5A6LA 3VYOA 2XRAH 1N0XH 4K55A 2D3NA 2DQMA 2J6WA 1GZHC 4KKQA 3AGVA 3TM6A 1XSIA 2K70A 4A2EA 1BAGA 5KSBF 2GUYA 5DD3L 1EVUA 1FVDA 3ZYZA 1B9KA 1ZD6A 1A3LL 4AITA 3Q7JA 4NQXB 5JTWA 2WNWA 1R3IL 1R3IH 5K39B 3CX2A 5IVZA 2NX5B 1CXHA 3DX1A 5B22A 2YEZB 3TZVB 3ZTDC 4JM0A 3FH5A 3C5ZA 3HI5H 4XNQB 4BZ1H 3HI5L 4BZ1L 2JLLA 1JZHA 1AHMA 3WHE1 1U36A 3BVDB 1JK9B 4RGND 3CFJB 2UVEA 3CDGA 3VXMD 1I1RA 3TA3C 4YBLB 4NKDB 1PNDA 1OF2B 2Q6WA 4MAUL 5E8EB 3F7PC 4UTCA 4EKJA 4M4RB 5TE4H 1EAPB 1FLTX 1DCLA 4Y5YB 4UTAL 1KQFA 1OP3K 1F2QA 5JOFB 4F33B 1ORSA 3G6JA 2H0FA 3MRCA 3FQYA 5HHOD 1QCSA 1J9SA 2BIQA 5FM5M 5B3NA 4NOHA 2G5RA 2DAVA 4Y4FD 1NPNA 3UO1L 1PD0A 1S2EA 3MSPA 4QRBA 3NK4A 1UT1A 3BUYB 4UTBH 2FGWL 1L7IH 3I02A 1FG9C 3BYTA 3FC8A 4F15C 3ULUD 1L4IA 3L5JA 4GI9A 3K1DA 2G5BA 4XMXA 4H0IA 5B1KA 3RVTD 5IESH 1ZE3H 2EABA 2GTZB 3A4AA 3IF1B 4FNUA 2CO2A 4HZAA 3TBYA 1E42A 3HAEB 1SEBB 1YEKH 2VGLM 1KYOJ 1RJCA 2QGCA 3FYEB 3INUH 4HMDA 4HFUL 3TCLA 3VSVA 4BK8A 1NIFA 3HZMB 3TO2A 2YN3A 2AXGB 4GT0A 5H94B 1K4CA 2JK5A 4G1MB 4J3BA 4UCFA 1YQVL 3QZPA 2VMFA 4GLRI 4NKOA 4M7JL 4N2KA 4MAZA 1ORQB 1OPGL 3QNYA 2GAEA 3W1ZA 1FYTE 4LGRB 4PJ8C 4HGMA 4PUBH 2CMRL 3S4SB 2BY0A 5CEZL 5HVFB 1XVSA 1IV8A 4N2IA 4X5LA 5DZNA 2V7NA 1KT2B 1HKLL 3LKNA 3W9EB 1A4JA 4JJ5B 2C3GA 5IW3A 2A5UA 4PSPA 2EUZA 2DIEA 3IDYC 3EJYD 3U2JA 4W93A 1EDQA 1DBBH 3DX0A 3SOTA 2R2EB 4XC1L 4ABUA 4WWKC 5E1HB 5KSAD 3KVDD 3UOAB 4F92B 3WUWG 4LP8A 1I9RL 5LQBH 2FBRA 1H5BA 1DJSA 2OS7A 2BSTA 3MBXH 1WAAA 1IMHC 2DQFA 4KJWD 4IMLA 1DBKH 1S78D 5GRXG 4ONFL 5HJGA 3Q1SL 3D9AL 4L37B 4NZRH 1E4WL 3WY2A 3P4MB 3K5RA 5I74B 3KLDA 1G0DA 1ZMYA 1DVFC 2ROYA 3AM8A 1CBJA 3QCVL 3QQ3B 1A1OB 3VH8G 5G4MA 4RWHA 1PLCA 4YPGB 1TU2B 4PS4H 4ZW7A 2YPKA 3SQBA 4JJOA 4YHYB 5GLFA 4GBXB 2E7MA 5GPRA 2JIPA 5AAMC 3MV9B 3QA3A 4FP8H 2OMWB 4MXVF 2MNWA 3MKGA 3G9AB 5FYJH 5E4EC 4GKZA 4XPBH 1NL0L 4JFEA 4GUOA 1I1CA 3ZTNL 4DQOH 2YBRB 3O9WD 1TJHL 4ZNEA 3IDNA 5HYIA 3HJEA 1OY3B 3O11B 5T3ZL 3W81A 4IRJD 1UD8A 1JV2B 1BMZA 2MQ0A 3STZB 2BZCA 3MFGB 3VG0L 4Z7WB 4TTDC 3OPUA 3TF7C 5CJ8A 3RGVD 4WHYH 1Y07A 3OMIB 2XZCH 4Z3FA 4KRLB 3PHOB 1E8ZA 1A6WH 1XF1A 3AQYA 3P4OB 5FK9A 4QJ5B 1DL7L 4LQFH 2WKGA 4F33A 2QQQA 5LDUA 2DYPD 4R84A 1B90A 1UWGH 1FSKB 3HZVA 4IIQC 5DJYB 4FXKB 3MV9E 4LAQL 3O4LE 1NMCC 1OCWL 2EEDA 4NAJA 1EEYA 3FS9A 4U0RC 2ED9A 2BWDA 2OXGA 3TVMB 4B53A 1OPOA 4F7EA 4OD3L 3CU7A 5D6DC 1LVEA 3U2IA 3GXPA 1YMMA 3CMOL 3HRPA 3RNQB 5MEQA 1XEDA 2EIDA 5J89A 4HUUA 3ASOB 5DVLA 4AKPA 3BVNA 1L5GB 2FECL 3LNGA 3GBML 1A7BA 1I3GH 3X3FH 2QGEA 1JJUA 1G7IA 3D39E 3Q8EA 4LPTA 3DVFA 3MLXH 1E9OA 5EH1A 4KDIA 1RFDH 2D7MA 2QPFA 3EG9A 3ULSA 4FQJL 5KBLA 4HLJA 3MROB 3L5WA 5CSZA 1DEEA 5BW7A 4TM9A 2E56A 5SWSB 1TNMA 4HEMA 4WO0A 3EO0B 2Z4QA 2VDMB 3FSVA 4HWBH 1O9ZA 4L4TE 2OTUB 3HE6A 1OEZW 3VFRB 4MNHA 2E8ZA 3WJJC 3LKPB 5HVHB 4PP1D 3EYSH 2RR3A 2Y6SC 4PJHF 5EZIL 2A73A 4YHZL 2D0GA 2O5XL 3BZDA 1HH9B 4YXLL 3FT4A 1MCFA 2VUKA 3OSKA 1E32A 1H3VA 2J2ZA 1ZGLA 4FCHA 5CJ5A 2D2CC 4TS6A 1AE6L 1SF5A 1KT2A 1MEXH 5HGAA 5FKAA 2O6EA 4H20H 1VFAA 1ZT7A 2AI0L 3G6JE 1UOVA 1K5NB 4L1HA 4R2GB 3B5TA 3VGHA 1R33A 4UIKH 5JIIA 1JAEA 5GISL 2ZSVA 1NGPH 3H4FA 1U58A 1U8LA 4A04A 2EO7A 3FQNA 5DJXA 3DYOA 5TJWK 4L8DA 1O6TA 3WLBA 5D2NC 1AO7D 3FTXA 4I3GA 1M7DB 3X1EA 3QZNA 5ADOL 4GRLB 1MCDA 1ONQA 3LVEA 4EN3B 2BSSA 2WNXA 2PW1B 2EADA 2QPDB 4RAUB 4XZ4A 2TRYA 2XWZA 2X4OB 4ZD3L 3J07A 3MUUA 1OCZB 3PQYE 3QDGD 3SKMB 4BFGA 1BYOA 5I71B 4ODTL 4UQ3B 3WIHA 5A3ID 2WWKT 3S0PA 4N0YL 1Q9LA 4LLDA 3FHAA 1TJMA 1R9FA 5T1LD 1DCEA 5JLZB 3U6XS 2UXTA 1FYTA 2HX9A 3Q13A 3AG2B 5JHLL 1SN2A 5GSRA 1BFTA 2BVQB 4XBGB 4QT5A 3CFEB 5HHOA 4BK5A 4P8QA 1KYFA 3GINA 3VX1A 3GI8L 1G9MH 1BVLA 2KMWA 4MNQB 4X7TA 1J9RA 4DW2H 4JY6A 2GK0A 2ICES 5I5JA 1H6EA 1MFEH 3GTMA 2OXGB 4WK2B 3W2DH 4AK1A 1MVFA 2N59A 4HPOH 2FLRT 4X4XB 2W59A 2VLJE 5E8PB 3RB5A 2BIIA 4XP5L 4MGXA 4YQXL 1AI1L 3NACH 4OF5A 1HHGB 2DMRA 2JIXA 3NH7H 1BZDA 2NY5C 1SDAB 4L8BB 4YHOL 5FFOA 4DEUA 1QSEA 1QD0A 1YUKB 4G80B 4FZEH 1MUJA 5EZLB 2IDUA 3V4VL 3P3UA 1PQZB 2YQ3A 4JR9H 3SDAC 4U1JB 3MVSA 3O9WB 4WU5A 1FH5H 4KKPA 1KGWA 2CIIB 2B4CC 1TPXB 3F6LA 3H9SA 4IJTA 4ODXA 4DP9X 3B9DA 3MJ7A 3D6GA 3PL6B 2CHWA 1OGYA 4JEGB 2WM0A 1EGJA 1B3JA 1ZXKA 2ITEA 2JJSC 4LRIC 4M93B 5T1JA 1XF4B 2XC8A 4JY6B 2VQ1B 3U46B 4LU5H 5D70H 3WHXB 2AP2A 2B1OA 5MI0C 2BNRA 1P6WA 3AXIA 3MX0A 4Z0BL 4AV0A 3IR7A 3K2KA 3QPKA 4ZTPL 2NY6C 5GGRA 1CDGA 2ZXDA 4Z7UE 3QEQA 4P46A 3HI1A 3GBNH 4XVUD 3KLHC 3BZFB 1A1MA 1L6ZA 3O6KL 3NFNB 5FV2A 4NJ9L 5I6LA 1EEZB 3F04A 4NJ9H 2DKMA 4WSJA 1UZ8A 4P0DA 5JOFA 2AEPL 2R0ZL 2GSMB 3GJFK 4AXWB 3QNXB 2Q9OA 5FKPA 4N9OB 4QXTB 3T2NL 1AGDA 3U7YL 3DX4A 1DO6A 3MUGB 2EIEA 1YEHH 1DQTA 4LDCA 4Y1AA 3GM0A 1MJUH 1I8KA 2BWQA 1KB5B 2NXYC 3TNNA 1QBLH 4JZNB 3ORJA 4E42B 4UIMB 4JRXE 2WKOF 1N0XL 2YGQA 1U8NA 1GOFA 2CDFA 3PL6C 5KSUA 1MFVA 5GGTH 3VD5A 3K80A 5E9DD 4W9HC 1LO0H 1PZ5B 4L2LA 4PREB 2B0SH 3FU6A 4Q9QH 1VFAB 2A9DA 3GBNL 3MA7A 1GH7A 3QQDA 2WUBH 4P59H 4QRAA 3DRQB 2PWDA 3QYCA 3BH9A 4LKXB 1UM5H 5E00A 5AW7B 1SLXA 4OQ1A 5F71A 3R4DA 4BWUA 2IANA 1KULA 3R0MA 1OAXH 1S5HB 3LZFH 4U6HA 1PLAA 4HFUH 4ZOAA 1PPIA 1RJZA 2R1WA 3E8UH 3FRPG 3KPSB 1WYJA 3B9EA 1GVIA 3BHBB 1TVHB 3VRLE 5FA3B 1B2YA 3V0JA 2WLNA 2X53A 5JO5A 2IAMC 3JZYA 5T8IA 3QO0A 3D52A 4P07A 2DRUA 1U9KA 3CZNA 3MV8D 3VXUA 4HMEA 2H1XA 1MREL 2YN5A 2EC9T 4NIYE 1RLWA 2JB5H 3T2QA 2JIQA 1OA9A 1AC0A 2NY0B 4TVPE 1MY5A 4D0BA 3TJPA 3UC2A 3BVNB 4MNQA 2VXTH 3GSNH 4ETQA 2R15A 3BAKA 4PJAE 3SBQA 1PDKA 3NFPA 1R0AH 1X3DA 2QHLA 2OMYA 3LJ3A 3MBWB 3U83A 3FU5A 1I9IH 1CWVA 5IQ9A 2D73A 2ZONA 1AGCB 2AAVA 4PRDB 3I9GH 2IGLA 3RVVC 4GRMA 5LGYA 1KC5H 5AB0A 5GXBB 4I7ZC 4S1QH 2AQRA 4EIZC 1TWGA 2GIMA 2F1EA 4MDIB 3TFKD 4AOKB 1MHHA 1WLHA 3FF7A 4IBWA 3OAZK 2E9IA 1QI3A 6FABH 5I66B 4CSPA 3P3RA 1HCZA 5JMRA 1TCMA 4A67A 4JPVL 5E70A 5IHUH 3S34L 1CU4L 1E4HA 3KS0J 1E9PB 4MXWL 4UQIM 4WW2C 2VRKA 3Q05A 3BZEB 5IJKC 3PWNB 2A77H 1UH4A 3C5ZB 4XO3A 3X2KA 1BXAA 4EI6B 5LUMA 2P48B 4M48H 1L9TA 2B77A 2C9VA 2ADGA 5ICYB 1TTCA 4YVUA 3LN5A 2VXTL 1U4EA 2ZKHL 2A6DA 1NBVH 1HHJB 2O6CA 1HSAA 1X4ZA 2W94A 3FRPB 4OIIH 5JIDA 2QV2A 3QP3A 3MLVH 5EFIA 4M4PA 3F7YB 3NJLA 2HKHH 2C26A 3ZR6A 1IGJB 1ZDSA 2WZPD 4TSAH 1QSFE 4ZFQA 3U4BH 1QPPA 2DKSA 2I5YH 4YBLC 4ALAC 2E4TA 2WP3T 5E8OB 5I8CB 2C9SA 1AQDA 5E51A 2VM4A 5CINH 5C71A 5I1GH 2R2BA 3AT8A 2FNWA 4D9RE 3V5HA 2I9TB 1F11A 5KANG 4HK3J 4XT1C 4AZ8A 4F9PC 2ETWA 5GLYA 2HVKA 4TUJA 4CVUA 3FQRB 5CLWA 3UYOD 2P24A 1MDAA 1RUPL 2E7HA 2GI0A 4X9GA 4PP2B 1MJJB 5BVJA 2ATPB 4AGPA 3O0RH 2WGXA 1CI3M 4EN2A 3C5ZC 1KZYA 1OCWH 4A7TA 1ZHBB 1IT9H 3VXOB 5EIIG 1NCGA 3LH8A 3LQMA 2RCSL 3U1QA 4UDUA 2VDPB 1QEWA 2R2EA 4XP1L 3FRUB 5DJ6A 2C4FU 3GK8L 2ZCLH 5AL8A 3TV8A 5CCGE 2AHIA 4PBDA 4DGUA 3ESNA 4LOFA 4KWUA 4PG2C 1G7MB 5EA0H 4DPBX 1JMZA 3HNVL 3U0TB 4D8OA 1I8LC 4FKEA 5DJCB 4X7SH 4X7SL 4OIBA 2XQ0A 1CBVH 4KI5E 3GSXB 3QHTC 2O5ZH 2R7ZA 2E9WA 2R0KL 3ZE1E 5IJVB 4F2MA 1S9YB 1NCCH 1F86A 3ZE0B 3EGXA 3I3EA 2XTJE 5IREA 4Z23A 3BP4A 3OZKA 1F6LL 3RPIB 2N7BA 5K59F 1KBVA 1FO0H 2HLAB 1G9NC 3Q6GL 1GMEA 1O5DT 1H5NA 3KYNB 2P5WB 4P06A 4LFHD 1EA9C 1F13A 4QTIL 5IWLC 3DDGA 5I30L 3X1NA 5T33L 1FZMB 4NKQB 3TL5A 2LFEA 5CNHA 4MB3A 3PGDB 5H35B 3WO4B 3CN4A 4PGZA 2IH1B 4QXUL 3CMOH 1G6RL 1UACL 2PXYC 1K3IA 4D0BB 1FCCA 2KZKA 4PJXA 1BQHA 4DSYA 2ZJSL 3BZ4B 4DVBA 1VESA 2DTML 4AENA 5FV1L 1JFHA 3ZDZB 35C8L 4F57H 1HSAB 2BJMH 4A68A 5C09B 2VZSA 3SKOA 3KR3L 3LTVA 3GJFA 1HKLH 1UD2A 1ZV9A 4PRNA 4FNPA 1ZLWK 4DTGL 1OD9A 5K9QI 1FVDB 1VGEH 1JZ8A 1W16A 3KXFA 5DQDL 4OKVA 1AQKH 4E41A 1RD6A 1EAPA 2Y2YA 4JLRA 2AAAA 1OWWA 3MRRB 1CGWA 4MMXA 3T0XA 2H6PA 1QBML 3VNYA 2ZUTA 5I6XC 4UZGA 4P2RA 4R4NC 4AY0A 5IEHA 2GKIA 3ESUF 4G43B 5FW7A 2FO4A 4OCMC 2CZNA 4HXAL 4NCDA 3U30C 3P77A 4Z7OB 4OCWH 4X9YA 5IV2A 3WEOA 2FO8A 5JUEL 1J5CA 4Y4KB 4HOXA 4B27A 4AKQA 3W0WE 1PYUB 4MQXC 1KENL 1OALA 3FU7A 3G5WA 4TRPL 5C2BL 3DTUB 4JREB 1EANA 4YHML 2APSA 2H8PB 5AKSA 3VXPA 3EF7A 4FCAA 3FTGA 2CR0A 5BW7C 1P7QD 4FQ1L 3TBCA 4AEHH 1VJSA 2VDLH 4Z7QE 4CJ0A 2PW1A 4XHJD 2XPGB 2ICWA 3BQUA 2H1PL 2VR8A 4WWID 4YHKH 4MCZA 5FGCB 1MRFH 1MHEB 3IJYA 4CSZA 4PJ9D 4AYFB 5J6GA 3FUJA 4KROC 4KZDL 4B9ZA 2WTOA 4HKZA 3AC0A 5EORH 1FAIH 1TJGL 1WGOA 1D5ZB 4HV8A 1KN4H 3DYPA 4UDTA 2EVIA 5IB1B 1F02I 4FQQA 1K4CB 1R27A 3STBA 5K9KA 4PJGE 2ERJB 4F7PB 4JDZB 4JFFD 2F54E 3CX5K 4PJFE 4YUEH 4FG6C 3M45A 1J1XL 4KU1A 3BYYA 4H5SA 5B1CA 4DH2A 4OGYL 5I8OL 2CIKA 2EDDA 5TQ0L 4HU8A 4UV7L 4DQOL 1M56B 2BHUA 2VXUL 4HS3B 1A25A 1G1OA 4U1LB 3K8MA 1KNOB 4OZGA 4WI5A 3PFUA 1YEGH 4JUSA 1RJLB 3QCUL 3ZQXA 4IKJA 3FT4B 3TT3H 5BQ7A 1BFOA 4GS7C 4XCYB 1Y6NR 4IRZA 2DWXA 3H8NA 4LPUA 4MA8L 5INDB 4C2MA 3TIWA 2WLKA 4JRXA 1X7QA 3OLGA 4CILA 5DMIL 1AQMA 3B5GA 5CIPH 3OHMB 4F9LA 3CZKA 1WLFA 3KYKL 1G1YA 5CF3A 2XUWA 3HI6H 2MTPA 4PRPE 4K8RD 4QHKI 4WW1B 1B4RA 3D85B 2MNUA 2YKKA 1SGKA 3BAEL 3RVXC 3P4LA 5E94B 3H4HA 1U8QA 3AU1A 1XL6A 5I1CH 2Z7ZA 4IU2A 4I9WD 4OR1A 4BZYA 4NXKA 3RVVD 3KS0H 5BVPH 2PTVA 5C8JB 2V2TB 2OMUB 4QHMB 4HT1L 3MUY1 4X6DB 3L2MA 4F7TA 2OZNA 5AB2A 3LD8B 1M1XA 3ENEA 4JQIA 4E41B 5CEZE 4KK9C 2P5PA 1WITA 2YEZA 3MTXA 3ZUCA 3F58H 5DRZB 1R3HA 4FQPA 4D3CL 1BECA 1HHJA 1T6VN 3V9EA 1JZ3A 5ITBH 2YD2A 3QEQB 4P46B 1JD7A 1EEUA 2CAKA 1IGIH 5AD0B 3S8WA 3VG0H 4A38A 4BFNA 4YXKH 4J3OD 2Z8VC 3R18A 2C7FA 5BJTA 1F3DH 1LM8V 1T1YB 2ITCA 2V5SA 4KQ4H 3SJVD 4P3DA 4YDLB 1YNTB 1UVQB 3CXDL 4B3VA 3KL5A 1NUNB 3QUYB 5DDHA 4HF5L 4JKLA 1MI5A 3NIDF 4C58B 1JZEA 3E1F1 3FAWA 4ZS7L 1SM3L 4EN3A 3D08A 4IOSA 3LZFL 1HI6A 1BQLH 2YD7A 3V0GA 4AZDA 1KTKE 1ZPLA 2D3JA 1Q72L 4PJAA 4E9RA 4HAKA 3BKCL 3LS4H 2H3NB 2V5RA 1YPZB 3HE6C 4FQXB 1AXIB 4PRIB 1NFIB 2XN9D 2WIIA 4DP7X 3MBWA 4RBPK 5E8PA 3WIAA 4M3HA 1X6LA 2VR9A 3CIQA 3D4CA 4KO6A 2LU5A 4OCYH 1AY1L 2WIMA 4XOCA 5SWQB 1X5MA 3ULVD 3KLAB 4IYKA 2MOQA 3CFQA 4N0FB 2GUOB 3O2WL 3KCWA 4ODSL 4JHWH 1IM9D 5I8KL 1G7MA 3HG1B 4UB0L 3OAUH 3EBAA 3ARWA 3QHZH 5E1IA 3LSOA 3TWCL 5TE6L 1ZV5A 2C7UB 5SWSD 3NPZB 5CGTA 2COVD 1JHTB 4P5TB 5JXAL 3BJLA 1FNGA 3B56A 3OKLA 4GY4A 4ZFOL 1A9VA 2WGNB 2EYRB 1GYUA 3EYSL 1CGSL 2R69L 1WZ1H 1UB5B 2X4PA 4MVBC 4NUJB 4U3CA 1NPJA 2QKIA 3BSZL 5HI4C 5I19L 5DO2D 1A3QA 4PY8J 1AZNA 5HD8D 5L88L 2FNBA 2V9QA 4P9HH 1Z9PA 2BP5M 3N55A 3QFGA 3LMJH 4K71C 4CN4A 1TYEB 3NN8B 3BVWA 4XXWC 3S35X 4YDIL 5HGAB 3CHRA 3IGLA 3B7SA 1AI1H 2Y1AA 3IRCA 1F3JB 3MTRA 4MZIA 4N5ED 2VJ0A 2FQEA 1IKFH 2GT9B 2ICEC 4PS7A 5T3ZE 5EU5A 4FULA 3D69B 4YZFF 2A73B 4YZFE 1RUMH 3FN3A 4LSVL 4WJ5B 4UNVA 3HS9A 3D2UA 2JELH 3K72A 5FYLL 2XDHA 2UX7A 1CPUA 2DMGA 4PYHA 2X4PB 4G8FB 5I1EL 3QC6X 4UOQA 1B6UA 1OP3H 2BC4A 3S5LA 3DMMD 1YNJD 2Q3XA 5F7NC 3HZVB 1LGVA 1UG9A 4JDTL 1D5IL 4PRPA 1CD1B 3ULSB 4B96A 1RK1A 2D03H 3LIZL 2A9AA 3LIZH 1IC7H 3AGWA 4PJDA 1VHPA 1UA7A 5F96L 1UXSB 3T5WA 3PWNA 4ZPVA 4U1SB 4FHKA 3SYPA 3ATAA 5FCUH 5EZOH 1HQRA 3KYMA 1E5BA 4WTWA 3ZDZF 4A2HA 3WTTA 4P4KC 4XNAA 1QFUH 4WI6A 2DWDB 2BNRB 3BFWA 3I50H 2WIIB 5D1ZD 4LSVH 3EG9B 1I1FA 4KLNA 5BZZA 5I16B 4HZ1A 3TYGL 4APXA 3LZRA 5GRVL 2OMWA 3ETBF 4QXVA 3N43F 3QDJB 5KSVA 2R7EA 1FFNA 7PAZA 3UAEA 2NY7L 4XP5H 5GIRB 1IBYA 4L9LA 3O4OB 2XXCB 3EOTL 1XF5A 4WQOA 1FNSH 1J1OH 5CM1A 4LMQE 2FSDA 3QG7L 3ARGD 1CF1A 5BZWA 1CBVL 2HRPL 3FDWA 3IBOA 1U8JA 3LKSA 4PVNA 2CLVA 3ZY7A 2WLLA 4AAYA 3ARBB 1RJYA 3VRIB 5HDWA 2D9QB 1OOAA 2CRIA 5FYKD 1ECZA 2VE6B 1KB3A 1PY0A 3B2MA 4KOCA 5LCVH 4BCYA 4DKEL 5FGBC 5F9AC 3WTYA 2B5IC 5ECJE 4KFZC 4Z0XA 2HX8A 3KCPA 2NLJA 1FRGH 2EDOA 5GJSH 4H0GA 4PJ8A 1KWKA 4AKOA 4I9XA 1KG0B 4R3SB 5I1HL 2Y06L 3DHMA 3QWQB 3K7UA 4XNBA 4M8VA 4R7XA 1LILA 1FYTB 1R5WA 1XGUB 5E2VH 2VITB 4ES8A 1AKJA 2PPDA 2HFFB 1TZHA 2WVVA 2XG5B 1PJWA 4PN6A 4TLSA 1KXTB 2DLHA 5JHBA 1MH5B 5D7IA 5BO1L 2QMKA 3DTXB 5CFAA 2ZG2A 3L7FA 4HWBA 2VDRB 1KXVC 4OQTA 2I85A 3BGAA 1EJFA 1TZGH 3CSPA 3MAWA 4NUJA 4LRNH 3ZU8A 2VSDA 3ASNB 2WWMD 1NFDA 3ZN6A 4L4VE 1I1AD 4PS8A 2VW7A 1JHKH 5IVXF 1P4LB 4BGDA 4NC0B 1RK7A 3IDXL 2P8LB 4AOFA 2OR9H 4XMUA 3TV3H 1A4AA 2UY7A 1I3QA 3MLSL 1KJ2A 1QEXA 3FSAA 1QDNA 1U8PB 3R1GL 4N8UA 3RA7H 1BPLB 4Q6KA 3II2A 1F45A 2Y6TE 1MW1A 1YNLL 3WNJA 4A1RA 1I1YA 4TNFA 2AVFA 4J39A 3L3OA 1TTBA 2XVBA 3SE8H 3LIUA 2FQDA 2QGDA 3VH8A 4JG5A 2XWBA 5E1AB 2QDWA 4HH9B 2ZOKA 2B2XL 1R75A 1BVKA 3K81A 3NIGE 2AJUH 1TIUA 1QASA 1EO7A 2ZX5A 1HE7A 3IJYB 1H6TA 1L9OA 5I5RA 5DMYA 2BRQA 5KVFL 5KYNA 3OR7A 1I9RH 5CBEA 2ZOLB 2NYAA 4Y5YA 1Z1WA 3B9KB 1CICB 3EUUA 1D7BA 5K9OB 2W60B 4Y2NA 2WLJA 2MWCA 5LXGL 1R3JA 4UU9A 2NX5D 1QO3A 3JWNE 1NBYA 2DQJL 1KV3A 1EIBA 3WFCL 3T6QC 1TJHH 4ODXB 3A67H 3I84A 3UIYA 1B6DA 2G3MA 2G5BB 5E08H 4MMXB 5AVYB 3LPGA 1J7VR 1NCIA 4TTDD 2WXQA 2X3CA 2IANE 2IDSA 3M86A 3QORB 2OTWA 5DHVA 4A7SA 4FTVE 5IF0B 4DEWA 2JCCE 2E86A 1CXIA 4GAGH 1S9KC 1N8ZB 2OZ4H 1DUZB 1I9JL 3V7MA 5EBMA 2X1QA 2XVGA 3UZEC 4JCWA 5D2NA 5LJYH 4CN6A 4AVRA 1FORH 3O6LH 4LLUA 2OW7A 2R83A 1QABA 5EBLA 4FLQA 4WHTB 4GP8B 3GMOB 2J5LB 5D7KE 2GIYA 3BVXA 4MXQD 4XCFL 4DEPB 1IBGL 1U95B 5FA4B 5CZVH 1QLFA 2ZPKH 2I60L 1G7JA 4JG1H 5T1KB 3QZMA 5E8EA 4G8AC 4R96A 1J18A 2ZP0T 4G1EA 5C08D 5LDSA 5C0RH 2E47A 3GO1H 1VZGA 1XCTA 3U4BL 4JRFA 3HIZA 5F7EL 3AMLA 3BPOB 4EI5B 5J1TC 3BEVB 3WTSA 1ZLVK 3WFEH 4QT5B 3QJOA 2Y07H 2C1OB 2H0EA 4P05A 4BUHA 2APWA 1NAMA 2J43A 1RZFH 3SYQA 2WO4A 2G0LA 3VWJA 3RY6C 3KPQB 1K5WA 2QMJA 5AOLA 1TVDA 2D7PA 1JWSA 1TWHA 1U8MB 3QCVH 4OM1L 4POZD 4XHQA 5GGQH 4DUWA 2QHRH 2NRDA 1IC0A 2AK4E 3EHBD 1GJWA 2Q3AA 4LVOB 3L95B 2NY3C 1Q0YH 1HWWA 4KOBA 4UMSA 4Q6IB 4N1CA 2MQ3A 1GXEA 3HMXL 5D7JC 3X2QB 2DQCL 2R4RL 4Y0GA 3D09A 3PHAA 5GGSB 1U8OA 1TMOA 4HS3A 5IFAL 1JXFA 3PJNA 5TE4L 4FFZH 2QQLH 4R83A 3DBSA 3O4LD 4YBQD 3A23A 4GIPD 4YDMA 3WNOA 1T0NA 5CP3A 3X2LA 1VACA 5HHNB 1ILUA 3MXVH 4OF0A 2DIJA 2JIXD 3POHA 5DVNA 3VW3H 2PUQT 3AY2A 4QOKD 6PAZA 4ZAKA 3TT3L 1XR8B 3KPLB 4ODBD 3IN0A 1QKZH 1G8JA 3EHBB 4JS7A 5DUPL 4Y16C 3KPSE 1Y0LA 3NCWA 3N0AA 4WFFD 3PWJB 4MQTB 4TQHA 5IESL 3ZSSA 2VXVH 3RVWC 2VPZA 1X9QA 2ZXQA 4IGBD 4X0KA 2EVGA 4LLYB 3NCYS 3BAEH 4CDHA 2VUMA 4JO4H 3L2LA 1OGTA 2YA0A 1EXHA 1UB6B 2J55A 1GYWA 1KY7A 2YOAA 4YSDA 3SPCA 1B0WA 1RZKC 2AJ3A 1X5AA 2D3VA 5IFAH 1T4KA 3S9DB 5F3HB 5ILTL 5CLYA 4YO0A 2WMPB 5T1KD 2OMVA 1YEJH 5F1SA 5J06A 3QW9A 1SHXA 3UJTL 4NO5B 5C07E 4PIRF 1U3ZA 4YLQT 3WXWH 4JFDA 4JJ5A 4J3VA 2W07B 4HLZG 1E9OB 2OK0L 1T5KA 2XN9E 1SXCA 1VAHA 3MMEA 3LN5B 5JW3H 2E7LA 5LGHH 3Q8FA 2ZAGA 3VVWA 1AMYA 4D7PA 4DETA 4JPWL 4NKIL 3L1GA 4YL9A 4ZDHA 2JB6B 4DO6A 2EXTA 3BC9A 5D9SA 4L0YA 4R96B 3FB6A 2H47C 4RGNC 5I1IH 2B4CH 5TDOB 1MOEA 2VSMB 3CZUB 3QUKA 5T1DH 4WK4B 3UBFA 1KSRA 1UHEA 5MHSD 5FYJE 4UNUA 4YPJA 3LZQA 4D0DA 3EGSA 4KO5A 4W1TA 1JPFA 2ED8A 1IVLA 3NPSB 2NY2B 5FAAA 3DIVA 1N6QH 5C86A 4YHKL 4F3FA 1TTAA 4P99A 4KHXH 3W11C 4S1DD 4H1LA 1USZA 2H9GA 3BPNB 4UM8B 1AS8A 4RWYH 2VIRA 1RVFH 1JNNL 4OD1H 2PPAA 2JKTM 4PVMA 1AS6A 1WFTA 3GI8H 3MNWB 4GS7B 4JHWL 4Q6IA 3QR0A 1T0MA 4XH2A 2BOCB 3L3HA 2J8UA 3AB0B 3HZYB 1YUHA 1PYQA 3GDBA 1I8IB 4GG6E 3G3LA 5I75C 1LEGA 1UASA 2FWOA 2H1LM 3F8UB 5FYLH 2H45A 3OHXB 4NSKB 4G5ZH 4PQXA 3HNTL 4GAJH 5GZOA 3ZDYF 3QQNA 4LCWB 2DMKA 2EAEA 4PV8B 2YPVL 4H26B 3QDAA 4V1DB 4Y5VB 1OLZA 3GSXA 1J10A 3H85A 3V0VB 3UBXB 1UZ6F 1G7HB 4PJEB 4TPRL 5SX5K 3SKNB 4H1LB 4ZW3A 5CJOL 1BAFH 1S6NA 1SLUA 5CJQL 1V3LA 3EO1B 1PEZA 3MMEB 4X2UA 4NQEA 5KBPA 4X8XA 1UJTA 1GGIL 3MBEC 1R5IB 1S7RA 5KYYB 3ARDB 1N64L 1N64H 3DSFL 1MQKL 4M3JA 3KNBA 2IC2A 3RKPA 3QYMA 3QQ4A 5IW1A 5AVWB 5FYKH 2GC4C 3GKWH 5L7XL 4MMYB 2DBLL 2VLJD 4YDLC 1BF2A 1KCRL 3LQAC 4TNVK 2D3LA 2YO3A 2FBJL 4AJWA 3WN5A 2QZQA 2G30A 1PPYA 2YFNA 3EH1A 3TVMC 3UXFA 4WKZB 5KYWB 4JGUA 1R3JB 4X0KB 4NZUH 2KI8A 1TO4A 4NN7B 3ZO9A 2IWKA 3E6HA 4PRBB 4Z7IA 1NPUA 2CJUL 3GLZA 3NEEA 4IEFB 4R90L 4ZZKA 4OTXL 1GIGH 2NYKA 3NCYP 1OSYA 1TUPA 5KVEL 4JDVA 4JMXA 4TKWA 3UBGA 1L9NA 3UZVB 4ZAKB 2K4AA 3RHWK 5KSBA 2ZWYA 3ZX1A 1BD2D 4DESA 3CFKA 4PWIA 2FE0A 5CILH 5DRWB 3QUMA 4N2GA 3RDTB 2FSEA 3WDHA 1FVEB 2IWEA 3ARFD 5FR3A 5CP3H 3S97C 3GD1C 4EQ3A 5FGSA 4L3CA 3GSOB 3MRKA 3L4YA 4YNYB 4C56B 1NIEA 4ABVA 3VI4B 4OI8A 4LLYA 5HVHC 2X0UA 2X4NB 4ALAH 1UXLA 2UYLB 3DSNA 4BRVA 4N2EA 2XZZA 5FUOH 1BF8A 2PPCA 3UAJD 4PJFA 3B43A 3GJFH 3BZEA 5BZWB 1F4YL 4BCZA 3JZ7A 5I2IA 4N9GA 4YSCA 5HYSB 4HBCH 4AT6B 4HG4J 1TG8A 5FKPB 3C2AH 4LEOA 2Y22A 3GZQA 4U1JA 3ZRFC 4OJDH 1BG9A 4N8PA 5C0FA 4NQQA 3NIFF 3H1ZA 4K2UH 3W9DB 1ZTXE 4KZCA 3L3GB 3US9A 2W65B 1MWAH 1PLGH 2WTRA 4WZ9A 3LOWA 2FATH 5C0ND 4PGBB 4LHUD 3VG9B 4OUUA 3D39B 1MW3A 5HI5D 4GFTB 2AITA 3H42H 1OF2A 3SDYL 3MLSH 2GJRA 2R2HA 4UT9A 4URKA 3UYRH 2B8OT 3ULVC 3MV7B 1MAKA 2YARA 4PJIF 4GRLC 1KYOK 4PJBF 5D1QE 2B0SL 2K0RA 2VM9A 5HHMB 4Q9QL 4PCYA 4X4ME 1UHVA 1KIQB 3MLZH 4Y5XC 3BO8A 4ZPVB 2BY2A 4Z5RB 5ISZB 1QSEB 2ARJA 4RH4A 3EOBB 3MRIB 5T1LB 4KTEH 3WN5C 1VGKB 1XGPA 2MKWA 2CR6A 5EOCL 4ZTEA 2KZ1B 4FGMA 4HWEH 2GHWB 4XCCL 2JCCA 1QR1B 2BC4B 2WLMA 3CDZB 5HSFA 1N3NA 1ZKAA 3A0OA 4G8FA 4K3HA 2F5BH 4O51A 1XGTA 2XQYG 4PLOB 1BW3A 2C9PA 4P3WA 1J0JA 2FAUA 2NSMA 5IVOA 5EV7A 3L08A 3NCXA 5HYJD 4QYAA 4IMKA 4U1HA 2XWJA 2XX1A 1KXHA 2XYBA 4IOSD 4NUMA 4WHTA 1XCQA 4LHJB 3IS0X 3X2PA 1PCXA 1D5MB 3FQUB 3MJ6A 5L6YL 3DVNA 4RAVB 4L5FH 1OAKH 4IBSA 1YEWA 4UV4H 4UV4L 1KLFA 4PJBA 5E1AA 3T4AC 1BOYA 2VC2L 2VDLB 2H0JA 1OK8A 3OXSA 5C0IB 4KGJA 5ESVA 3TFBA 2RALA 2IPTL 3CVHH 1NFAA 2BP0B 3A6BL 1P6AB 4OUOA 2IWGA 1HT6A 1MVUB 3FH8A 3FO9A 4OF3A 3RX8A 3SDAB 2X6VA 1KCUH 2AK4A 3I9GL 5DUMH 2XRAL 3Q8BA 3HZKA 4NHUA 5E99L 2OV0A 5K93A 2PYEB 1FPTL 3Q2NA 4ELKA 5KS9E 3WTVA 1XV8A 2COQA 3ZDXB 5IROA 1YECH 2EKSA 2C1PB 4YNYA 4JP7A 3QUZB 3QZWA 3MLWL 5DFVC 5EU6D 4P9HL 3FOMB 1AP2B 1E8XA 2BRRH 4QXTA 3KYOA 2G3XA 3WFBL 4FFVD 1HZHL 4QHLB 3GUTB 2Y1YA 4AM0A 4FADA 4ZODA 4QRTB 3RBGA 3F6JA 3G6AA 1CLOH 1D9KD 3SJVB 5AWNH 1CFQB 5FUCC 2FCBA 3GC3A 2BNUA 3RJQB 4ZTOL 4L8SB 3W5NA 5ID0B 2NXZD 3CDCA 3MX0B 2R23B 1C12A 3C09B 1ZS2A 2IQ9L 3PWPD 1QYGL 4WSGA 2NUPB 1JDCA 1MG2C 1HWHB 4DZBA 4QIWA 3F65A 4HIEA 1XQ4A 1MLBB 3THMH 5JDSA 4NP4H 5MI0B 3VFPA 2D0FA 3H9SD 2F8VA 3UO1H 1JPTH 4WCYL 3APFA 4KROD 3MJ9L 3VTTA 4MB5A 2VQUA 5IB4B 1A3LH 2W81C 1E3ZA 3D85D 4P23B 5ENWB 2Y06H 3QI9D 4OBRA 5HGHB 1QR1A 2EUXA 5J8OA 4Q52A 3GXMA 3MRJB 4KTDH 3QISA 3K91A 1A3RH 4ZUVA 4OCNC 1QHPA 2YK1H 4OJCA 1VB9A 3V8CA 3QJUB 2BP3A 2H3XC 4GLRH 1SBSL 2ZX9A 2VAAB 5TFSH 1MRCL 3D50A 4CADA 2GJZA 2A83B 3D51A 4H8PA 3EKCA 2W92A 1ML0A 1KCVH 1YN6B 4JG0H 2ZXBA 4W4OC 4PJDE 4EQ2A 3BDYH 4APXB 3PGFL 3L1OL 1MJ8L 2V2TA 3CV5A 2UZIH 3BIAX 5KSBE 3CPLA 1ZYRD 1OPGH 3QRFM 2LV4A 3RPKA 4ERSL 1Z0MA 3GTNA 4XBPA 3FONB 2ARJB 1JI2A 1FG2B 5GM9A 2JKIS 4Z5RA 3AT0A 3OJ2C 3ZR5A 2XLLA 1AXSA 1SOKA 3EBHA 3IRPX 3CSTA 3NJJA 2G4EA 5AVVB 5DSCB 1T2XA 2ZT9C 5E8DH 3FCGA 3NZ8B 3UJIH 2HTKD 1LK2A 4HUVB 3E0GA 1E7VA 4OLYH 2Z31B 4AEFA 4I1RA 5IQOA 1JZFA 3IJSA 3NBNA 4J4PC 3BFOA 3BN9C 4Z7VE 5F93C 1RU9H 2OR9L 2UZPA 4OT1H 4FQ2H 2XQYA 3E80A 4NRXB 4PJ7A 4U1LA 5BJTB 4K7FA 4PB0H 4XGZA 2KDGA 4NFCA 3SODB 5KVFH 1AO7A 1E2VA 3ALXA 4HG4K 1MIEH 5F6HI 1PSKH 3MLYL 4BUQA 4BKSC 1HSBB 1VRSA 4DVRH 1IE4A 4JHAL 3UTQB 4QXWA 5DS8B 1HHHA 4XVSH 1BJ8A 3FCSA 4FQLL 1PS3A 3OQ3B 5ESVB 2QR0B 2NNRA 1KFAL 3P4NA 1A64A 3HUJF 4QO1A 1WC2A 4IRSD 3UBHA 3OPZH 4QRTA 3BESR 4WEBL 1ILSA 1OSZA 3WNLA 4QCIB 3OJDB 1VF5C 4F37F 4A2GA 35C8H 1MFNA 2HRLA 2XHNA 4F57L 2QFPA 3HC3L 5ICXB 2ZCHH 1ZVHA 1KTJA 3OKDB 1TWCA 2BXZA 3S5YA 4KXZH 4B7IA 2V2XA 3QRLA 3ILQD 2N56A 4JO5A 4MNHB 5EN2A 5H8DA 5DF0A 2YC1A 3BQUD 4PWEA 4OCRH 3ETBJ 3U7WH 1PG7X 3A67L 4JFED 4JPIA 3TBWB 4FFWC 1FNGB 3OKLB 2ADJB 3RA7L 2ZXGA 3V4VB 5DC9B 4Y7MA 3QCUH 5JQ6H 3PXHA 3F01A 3PAZA 2IV8A 2DWEA 4WY7H 5A7EA 4L3ED 5CINL 1N4XH 2YRLA 3G9VA 5I1GL 4NQVA 2MHAB 3SZKC 4K8RH 3ATDA 2O6DA 1MCOH 3FSZA 2F7IA 1NCWH 2PXYA 4EI5C 4YEEA 3RAJH 3FO9B 4IRSA 1E3FA 4N8VB 4JB9H 3HPJA 4LCCA 2VUOA 3FMGL 3QRBA 4KK5D 1NFDF 1KBWA 5E56A 3W0WB 1YEDA 5BRZB 3WKQA 4F2EA 3N9GL 5JHDB 3BE1H 3GO1L 4JLRB 3UTTA 3G08A 4FNLL 2VL4A 5FLVA 3HU2A 3UTPD 4PJ7B 3NGBB 4MD4A 1YPZA 1UOLA 2RCSH 3C2SA 4RRPM 3NABL 4XMPL 1E5VA 3IDUA 3EDFA 2FBJH 2DLFH 4LLQA 5JNYA 2I26N 1DTUA 2FZ3A 2CR3A 4YDVA 4PD4K 3HNTH 3H55A 4GAJL 5BV7L 4MBOA 4G8EB 1P84J 2XTJD 3JVGC 1JTTA 5FFLA 4Z3IA 1I3GL 5DUJA 5JPNB 4MCNA 5DS2A 2GCYA 4PV9A 5E9NA 4BFBD 3OAWA 4N0FA 2G9HA 2NY4C 2UZYA 4B97A 1BEYL 3UJJL 1LE5B 5J11B 2AJZA 1E28B 4LSQL 3S88H 4OZHA 2L0DA 2L8AA 2XV2A 2Y7NA 3WIHH 3OD3A 5FLUA 3GTVA 4ZX5A 5IBUB 3IXTA 2PJJA 3UABA 3CXHJ 2X4TB 1YUHB 3E2HC 3DV6B 2OCJA 2IG2L 2ZUUA 5IM7B 1RPUA 3CQZA 3NJMA 2YFOA 5L8KB 4NQED 4F2FA 25C8L 1J05B 5A1AA 5FDYA 2WUCH 5CHNB 1OARL 4ODHH 4XMVA 2JKSA 4J23A 3ZHNA 1OM3H 1ADQH 5FDWB 3VGFA 1YEIL 3CWGA 3MRJA 4KKLC 1T7YA 2ORBH 4F3FB 1MJ7L 1T1XB 1QBAA 1JHLH 2AI0H 3GYRA 5KYWA 1N10A 2PXYB 4IGBC 4B9IA 3TFKC 3U6RB 1FBIH 1NUDA 3MJ8A 5K39A 1RMFL 3GSQB 3S36H 2ZYIA 3EFDL 2VLRA 3QWRA 4BFOA 5ACZB 5KVEH 1DFXA 2IMMA 3IETA 4KV5E 1O7DE 2ZCKL 1T5XA 3QIWA 4L9LC 2Q2EB 4AGQA 2XPYA 4WGVB 5J12B 1M1XB 5D1QD 1ETA1 3FBQA 4U49A 1X5JA 4GBXC 5SX4I 3RGHA 1JRHL 1AD0B 2I24N 1K8IA 5BUGA 1JZDC 3TPKA 3DTDA 4IMKC 2XIBA 4OI9A 5K9QG 5BZXA 3VFSB 1M57B 3EJTA 4M8UA 1LL1A 3OX8A 4L3EE 4PJ6A 3X1FA 2J8OA 3V5DA 1ZVSA 5K9KB 1FL5A 4KK8D 3NCFB 3HFFA 4RCAA 2BS8A 2X9YA 4H88H 3NQKA 1EXGA 3B5HA 1D5ZA 3WJLA 4R0LA 4RV0A 5DCCA 4DFHA 4OJFL 2CCWA 3VD7A 3IGUA 3GTPA 1GAFL 3OKNA 3RWJA 5HHQA 3ARXA 2X1OA 3DPDA 2DEYX 2WXLA 4UQCA 2X9ZA 5E5UB 3QGVA 5GSVB 2GB2A 3C8DA 3CFTA 3ZDWA 2HN7B 2JI3A 4WO4B 1F3DJ 5EHFA 3CF2A 3QQ4B 2YD5A 3UDWA 2DM3A 1Q72H 3TPUB 3NMEA 5DS8A 1XR8A 3KPLA 3W0WD 1FZKB 3HG5A 4PU2A 4GAFB 4U2ZA 1NFDE 1MFEL 1RKRA 3CCHA 4G9DA 4FABH 1P9MC 3BAIA 3BDBA 1THAA 2FEJA 3EZJB 3NCMA 5I1KH 2YWYA 4EZKA 4WEEA 1WFJA 2O5NA 2BXYA 4G5ZL 2E9GA 4NQSA 4KZDH 1KCKA 2MOGA 1RZKL 3MR9B 4KHTH 3VI4E 2APTA 1OANA 2ZIDA 4LKCB 4ZUSB 4ELME 3WL9A 3PG2A 4QOKE 1RZ7H 1T89A 2BS9A 4YHIB 1KZQA 2I07A 4Y88A 3X11A 4D9QD 3DV6A 2JELL 2N0MA 4DFIA 4CVXA 2ZX7A 3BQUB 4WWKA 3MV8E 3OHXA 4CSSA 2K78A 1MH5A 4KTYA 3MOBL 4ZT1A 5C7XL 3A47A 3WN6A 1KJMA 2BW4A 1ETJA 1I3RB 4ZM7A 1M6OB 4FHBD 4P2QA 3U2SA 2B4CL 2EEOB 3QDGA 1U3JA 1MELA 1K8DB 2YR3A 4PCSA 5IQ9B 1K2DA 1XB6A 3SPGA 4PJIA 2LFGA 4PJ8B 2KL6A 2UZYB 5DZPA 5AG8A 3MRPA 2Y5EA 4X6EB 2XXMB 4YIQB 2JI2A 3O6KH 1HOCA 3HRZB 1TZIA 1DJZA 1AYOA 5PCYA 1OP5H 3TO4B 2YXMA 1OAZH 3WYRA 2W9LA 2NY6D 4PTTB 1KIQA 3KVQA 5IQ7L 1U91B 4UBDD 2VDQH 2AV7B 1F4XH 4NJAH 1A14H 5F2FA 5DTFB 3G08B 3MNWA 2YPLD 4FLOA 4OLUL 5HGGS 2WZ0A 4JR9L 5E9DB 2CO6A 2MEJB 1R5VB 2YD9A 4OW6A 4YO0B 1C16B 5DFTA 3ZPDA 4AQEA 3OB0H 1M6OA 2PCYA 4NUQA 5JPNA 3U2SB 1CTNA 3CH8A 2Z31D 4OGXH 4PB9L 4IBYA 5K9JL 1XCXA 3RNKA 2YAPA 5D7SH 1MNUH 3LEXA 4MKMA 3TESA 4LLUB 3HN8A 1LO0L 3ESPA 5FFGA 4GG8B 4PRAB 1RK0B 1KBKA 3A5VA 3PYCA 5DYOB 4UTBL 4GKNB 4BH7A 4R90H 1ES0A 3G5ZA 3TNMB 4P59L 3VWKD 1P5UB 43C9A 5JPMA 2OJ1A 3QSKB 5H2BA 1XIWB 3I75A 1B0GB 1U3HA 3S8FB 5EDXA 1AZRA 4WNQA 1E2WA 3CFCL 5DYFA 4GG6B 3H0TB 3PGDA 4FXKC 4GMSH 3WU1A 1T4KB 3CCHB 2X41A 1A14L 3BP7B 4FG2A 4L3CB 3HG3A 4OZIA 1FRGL 1VIWA 2K7PA 3OX8B 1WD9A 2YS4A 1RXLA 3ARFA 1VFMA 3I2CL 3L1OH 3C5SA 1BZ8A 1OGPA 1T83C 3V6OC 3BP4B 4FKKA 4HIXH 3QI9B 4M43L 4FQXC 4PGCA 2FBOJ 3BH4A 5LN4A 3G5ZB 4W68A 2WQUA 1HXKA 2QADD 2UVFA 1G7LA 3VYPA 1NCAH 4G5AA 1C5DB 4OFQA 1OTUC 3FT0A 1HSBA 3OXSB 3H3PH 3HLAB 5SV4A 4CBPA 2HLFD 4KITB 3AMKA 1NAMB 2YAOA 2ENGA 1S5HA 2J6EL 3U0TA 3EADA 2ESVB 1DO5A 4UF7C 1P5VB 2IGTA 4H0LC 2F58L 4XP4L 4KNSA 3QQ8A 5F1NA 2QQKL 3B37A 4RISH 3RRQA 3D25A 2KQMA 2VJ8A 1FA4A 5GQBA 3GXUB 2R29L 3L9RB 1KXQE 2WN2A 2ZXWB 2B1HL 1F42A 1DZBA 2OX5A 3C9NB 1PQZA 4YXHH 4MJ6A 3ELAT 1G5AA 4JQXA 4LSRH 3V0IA 1OT1A 4OFKA 1ACZA 1JPEA 1AKJB 4N8CH 2R1XA 2A77L 5L6YH 1TETH 2R2BB 1VCBC 1T6BX 4AIZA 1UJ3B 1X7SA 3MQIA 2DZEA 3PWLA 1X4XA 5FDWA 4AWJC 1E5ZA 2Y1ZA 2OR7A 4URTB 2WLLB 3ARBA 3R4RA 1L9MA 3IR5A 4R2GC 2EVFA 2XN9A 2CBTA 4W9FC 4N1EA 4BZ2H 3ECUA 1KIUA 5A2AA 4P5RA 1O7DC 1D3CA 1U21A 3TBTA 2NR6A 5ESQA 2VAAA 3HFML 3SGDH 3V4LA 3VWKC 5ICZB 3D34A 2PWGA 4GXFA 1NGXA 4KNTA 3AT9A 1J9CT 1BQUA 3MACH 1MWAA 1U3HC 4IJ3C 1S5IL 5MEPA 1TQBC 3KWVA 5IVNA 5E08L 4E9VA 4YHIA 3PFQA 1GR7A 1WICA 2EH7H 3TN0B 5L2KA 4ZUSA 4NX0A 3RFZA 3WTXA 2W9DL 5EPMB 4MLIA 3TN0D 2EACA 5TF1H 1URZA 1JGIA 1JNLH 2EKJA 4MNQE 3VQ2C 5IY5B 5I1DA 1C9SA 5EC1B 3UERA 4ADGA 5ICUA 5B38A 4KTEL 1OAQH 1UKSA 4QRUB 2V8LA 2QHRL 1WBZB 4N5EC 2OMBA 2ZCHL 3EDEA 5D2NB 3T3PB 1KXVA 2EYTB 1UJ3C 2WAQA 4AE1A 3HUJE 3IMBA 1YJDH 4HJ1A 3GZOA 3IGKA 4O4YL 1IT9L 4RBPH 3VI4A 3WJJA 3ZMEA 4AQZA 1NLDL 3UZQA 5IB5A 5FA3A 5CR1A 4I77L 3HU1A 2HXAA 5CEYB 2CCLA 3NABH 1FF5A 2IGFH 1RZJC 3NESA 3N1MC 2JB6A 4WO4D 4K3DH 4X80L 3GS0A 2P9RA 4NWTL 5EO1B 4UANA 1CMOA 1M7IA 2EQDA 1HEHC 5D4IA 3B3IA 4GRWF 3ZKXC 3ZTJG 2EH7L 4RFNC 4EXKA 1T5WB 5BV7H 1JK8B 3EDKA 3L3OB 4NQVB 4X6DA 1NCOA 5IK3B 3F5WB 3W56A 1IL1B 1TZHB 4IRJC 4X7TB 1CDIA 4M8RA 3ZQWA 1R17A 5EUOE 4ZBJA 3BUDA 5AW2B 4M6OL 4FG0A 4GP4B 4M6OH 4MTMA 5ICXA 5BUPA 5MEND 2CJSA 5LBVA 3DX6B 5FO9B 3QJSB 4PREA 1OSZB 5EG6C 5SX4H 1T1WA 3TEUA 4R4BA 4YE4H 2BY3A 1X5GA 2IDTA 2O1AA 4ELMB 1YJDL 3FKUS 4LVNB 5L2KE 3ILDA 5I30H 3FUIA 3MJ8B 3PP4H 5DVPA 4FLSA 5CSGA 4PJBB 1OARH 4MMYA 4NIKB 2IANB 1DVFD 2XACC 3DTXA 1KNOA 1T80A 4OZGB 4M5Z