3D30A

Structure of an expansin like protein from bacillus subtilis at 1.9a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
MAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Peptidoglycan-binding protein
molecule keywords Expansin like protein
total genus 52
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3d30A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3d30A02
2GAEA 1WHOA 4FERA 4JCWA 3SULA 1HD5A 4FFTA 4JJOA 4FG2A 4FG4A 1BW4A 3X2LA 2HCZX 3X2PA 4ZM7A 2KQAA 2G6GA 3CZBA 4AVRA 1WHPA 2PJJA 1N10A 3X2OA 2ENGA 5GLXA 5H4UA 3SUJA 2PNWA 5GM9A 3X2IA 2VXQA 4JS7A 4L48A 2PICA 2PI8A 1OA7A 3SUKA 3X2GA 2BH0A 3ENGA 4JP6A 3FT9A 2G5DA 3M3GA 3X2MA 3D30A 5GLYA 3X2HA 3FT1A 1L8FA 2JNZA 1OA9A 3X2JA 4ENGA 4JP7A 1BMWA 3X2NA 1WC2A 1BW3A 2AE0X 3X2KA 3SUMA
chains in the Genus database with same CATH superfamily
1T0PB 3DV4A 3T2PA 5E9DE 4RRPM 5EF1A 1GS6X 3BRDA 1DN2A 1WWBX 1JDCA 3EADA 2AGJL 5B1JA 2FO8A 1T7XA 4FTVD 4UT6L 4Y9CA 3W9DB 2AI0H 2PN5A 4RGNC 4KQ4H 3ENEA 1VJSA 1YG9A 5JW5B 4APQA 2H2PC 4UTAH 2FB4H 3UAJD 4Q2ZA 3C8DA 2NCMA 3FO1A 4PCSA 2B15A 1IC7L 3O0LA 4F8QA 3ESUF 2FWOA 4AJVA 5JOPD 5D2NE 4BHUA 4WWKA 1EXUA 2IDSA 2I26N 2JB6A 1DUYA 4FEIA 4M1CD 1YN6A 4YXHH 4KRPD 5F7LB 1LK2A 4WEBH 5DHDA 3RQ3A 4JL2A 2IPKA 5AOKA 3DX7A 4HC1L 3SKJH 1X6LA 3VVWA 1ADQH 3IDXH 1E30A 5EU4A 4ZUTB 3ROLA 3V4VL 2AQTA 3DHUA 4XGZA 3O2VL 1MFAH 1PKQA 5CEZE 4U1JA 1RZIA 1YSOA 2G4EA 2AW2A 2HJFB 1DQQB 1RVFH 3RDTC 3O8XC 5TE7L 3Q06A 3WIFB 1NCWH 1H3VA 5F9JA 3MJ9A 3VA2C 3U2SA 3I9PA 3U4AA 1QASA 3IRCA 3N3EA 3DARA 4KI5D 1DLFL 3HUJB 1CFTB 1LP9B 3HB3B 1DP0A 5KSAD 3BGMA 3H9HB 4H4NA 4WNQA 1IVLA 3UGEA 4WTQA 3MZTA 4KXBA 2K8QA 4CSZA 3PJSB 5C0AD 2QVTA 1GTNA 3TBVB 4K9JA 1D5XA 4LHUB 4PIRF 2QV2A 4QPEA 4XP6L 4ZSOB 3NG5A 3P4MA 4JO2L 3VTAA 5FDWB 5T1JA 1DQMH 1TZIA 3TBSA 4Q58C 3G3LA 4IOFC 4Q52A 4C2MA 1Y1VA 4LB8A 4IGBC 2I7SA 5HHPB 5JIPA 3KD4A 3PP4L 3L3KA 5CMAA 3WHXA 1UXSB 1R5VB 4A39A 4BH8B 4XPGH 2V45A 4XZUB 3ZT6A 3QXVA 4N8VA 5IVXF 3VE0B 1I8MB 1XXDC 3QUZD 2VERN 4N2LA 4UM8B 3F7QA 5CD3B 4GI9A 3VWKD 2R56H 4FA7B 3U79A 4FG2A 1D2PA 2AK1L 4ZUWB 1G7IB 4S1SL 4NT6A 2EEOB 1P7QB 2Z31B 2HFFA 3L1OL 5MEQA 1KJ2L 4U1IB 3LEVH 5A40E 3T0EB 1ZLUH 3VQLA 5HHME 3HG0A 1XD0A 4HJGA 1W72A 5FB8B 4XP6H 3NK3A 2EDFA 4UTAA 4EN3A 2I5YH 4UM9A 3NAAL 2WXIA 1SXNA 3CFJB 4W9CC 4LGSB 1TT6A 2V7HA 4RDQG 3CSYB 3L4WA 4OCMC 4PRIB 4H1LG 4KO6A 1LD9B 1RIHL 1WS7A 4KK9C 2EABA 4QYOA 3EDKA 4HJTA 4MSWB 5AYQA 4Y9FA 5I0DA 3HLKA 1N5AA 4XN9A 2VB5A 4PPTA 4PSPA 1QSFB 1ZHLA 2JTYA 1NFAA 3VXQB 1L7IL 3ZW3A 3CVHA 1D5MA 4OJYA 4AMKH 4HEME 3I6KB 1I3UA 3R06A 3LQAH 5A7EA 3L1OH 3QHFH 2A2QT 2X40A 3ZYZA 1FUNA 1OM9A 3HN5A 1XSIA 1N8ZA 5ISZB 3NVQA 5L8KB 1AQDA 3C9NA 1FVDB 3IGFA 3ISYA 4NZRL 4O00A 5DWUL 3WOVA 5C3LD 1GGCL 4NC0B 3T6ZA 1A25A 2WO2B 1NLBH 4M8UA 2DLHA 3TEZA 5F88B 1IAKB 3GUTB 5T1KA 6FABL 2BWDA 1PQHA 2YPLE 3N1QC 3NDZE 4XRCB 5I1IH 1Z9SA 3SDAD 4BKTC 4EUPG 1KXVA 4I3RL 4K73A 1CFNB 3EF4A 1AGBB 2J1ZA 3FU9A 2EDEA 5BMFL 3BZ5A 2VDML 1IM3A 4Q4IA 3NIDE 5FYLH 3RGVD 3ZMRA 4J2XA 1JWMA 4H0IA 5JZ7D 3EGXB 4WHYH 2A74C 2G3ZA 4U3XA 3MUGB 3FZUD 5AWNL 1YEGL 1TJIH 2BJML 1XGYH 3GI8H 4PVLA 1GAFH 1FL5B 1TOXA 3BKMH 3HFFA 5FPIA 5F70A 2ZSVA 3KLAB 1JZ3A 1P1ZB 1HIMH 1IAIH 1X5XA 4NZTL 1TF4A 5HPOA 4JANB 4PRHD 3JV6B 3SKUD 2A6ED 2IALB 4CMHB 3K2IA 4R4NC 3WS3A 3U9PL 4QY8A 1U0QA 1UH4A 3AGVA 2ZG1A 2JFCA 5D71L 4XPBL 1D6VH 2ADGA 2QPFA 4MKMA 4U1MB 1S7TA 2J1WA 2K45A 4W9IC 2EQDA 1P5UC 2OXGA 3ULVH 4M5ZL 3GLEA 3BYYA 4N2NA 4RZCB 3BVNB 3ZBMA 2WKLA 2DWXA 3PWPA 4FMVA 5AVSB 5KSVB 5DFAA 5BMFH 1UM6H 3M1BA 4JZJB 4RWHA 3TO4D 3EFOA 4PS8A 1BJ1J 3UAAA 1JHKH 1SMAA 2OM5A 1EZSA 5EZPA 3HE6D 3P9LA 1GAFL 5E95B 3QCVH 3DV6B 2WXOA 4KVPA 3G04A 1JCKA 1MRDH 4PRDA 4OU3A 1J48A 1IAMA 5IEHB 1INQB 1TLKA 1XB8A 3A67L 5CWSB 3WE6B 1LEIA 3HI1B 4P2RD 3VRIA 1KWKA 2IQAA 4LVNB 5D2LA 2P52A 3WELA 3II1A 4IMLB 5IOKA 1T1WB 1TMQA 2YEZB 1OPOA 1DE4A 1IFHL 1HSBA 3BQUB 4N2FA 4ZAKA 4OF0A 2UZXA 5D2NC 3SBWA 4C83B 2NCEA 3LRHA 4EUPB 1E60A 1RUAH 3RL1A 2XZAL 3PQYB 4OCNC 1COBA 4OCYH 1TCMA 1VLXA 4PTUA 4HETA 2HWZL 4AWJC 2UY7A 5D7IE 4LNRB 2GUYA 1GC1C 4KDWA 4C4KO 1J1OH 3QIWD 3VRJB 5FO2A 3AREA 2L7JA 3LEXB 4PRIE 3DJZA 4JDTL 4OQ1A 3OMNB 3WMSA 5KSUA 3UC2A 5D4QA 2A9MH 3X2IA 4QGTA 1GIGL 2F5BH 4Z7VF 5JW5A 1ZV5A 1KBPA 3HAEH 1JMXA 4P4KA 1FPTL 1NL0H 2PTTA 1I4FA 2AEWA 3TT3L 5GLYA 2F54A 3GLZA 4OZ4B 1LM8V 3UZEA 1PNCA 5FCUL 1SJMA 4XX1G 5K9OA 3KGRA 4JM0A 3MLSL 4Z77A 1U8HA 2VM9A 4NNYA 3HMXH 5HDBE 3DSNB 3ISWA 3POCA 2O61A 1P7HL 4OQTL 4GG6F 5EU4B 5DK2B 4ZUTA 1W0VB 1SYSA 5BV7L 4GS7C 2C3WA 1K8DB 1K8IB 3BAYA 3CFMA 3SDYL 3PWPE 5CLWA 2R69H 4OLVH 3B5HA 1X9QA 5HD8C 3RIKA 4LP5A 5TGBA 1JYXA 1OVZA 4WGWB 3LXCA 1U95B 3GO1L 3R18A 1MI5A 3PDOA 1U92A 4ZS6D 5F7UA 4GW4B 2D7TL 5H4ZA 1UXSA 2EO7A 1MCWM 1OCWH 1HH6B 4JKKA 3OHXC 4QTHA 4ZMQA 1RSFA 4DOHB 3CZGA 4NJ9L 2ZF9A 2XBTA 3INOA 4YHNB 2CBOA 1VRSA 1A7OH 2WW8A 3MNMA 4GO9A 3GXTA 1AG6A 3TBSB 4KI5E 1ZHNB 2AANA 1H3PL 4H26A 4XWGL 5C8JA 1P7QA 2NT1A 1QPXA 1Y1UA 2Z31A 3LHPL 3M45A 4FABL 2DYSB 4KROB 4P2RA 4QRUB 4RRPG 4QO1B 4WW1A 5E8EB 4I87A 2QKSA 4OZHF 1T7VA 2EE9A 1JZDC 3Q2WA 1JCVA 4N8VB 3VE0A 5EPMA 5I1AA 2JIXD 2W92A 5IMMB 3NUKA 3RGVB 4PY8I 5I9QB 1MJ7H 4C56A 1U6AH 4LCUA 4CMHC 1R7RA 3SPIA 4Z7OE 4OLEA 1XAKA 1G4MA 2BHZA 1NBQA 1F90H 1URZA 4MMZC 15C8L 1KYFA 4BFEA 1O75A 1I9IH 1IBHA 2IPUK 4PY8J 5GGSB 3RVTC 2IPKB 2PPDA 5DEGA 1CC3A 4JPIA 4JRLA 2FGWL 3HAEA 4QRFA 4HIJA 3PWLA 3BUDA 1C8PA 3PE9A 5HYSA 4FJZA 4ODSH 3AQXA 2OLDA 1QCSA 4A2LA 1U93B 4RQQB 4WFEE 3DK2A 3MRQA 2IWFA 4PJAF 1T04B 4H0HB 1GJUA 1JIBA 2OMTA 3ARYA 3F12B 1IEHA 5FECA 4AXWA 1KTJA 3HE7A 4PGCB 3RVXD 2IBZY 1E6JL 1FVDA 3K6FA 4U33A 5IF0A 3QARA 1UC6A 5HVFB 3KWTA 5IW3A 1T5XA 3PHSA 2NVYA 1W0VA 3G5XA 5TPWH 3TO4B 5ALCH 3BWSA 1QEWB 2J55A 2XTSA 4HMDA 4XVJH 4OT1H 1EHXA 3DV4B 1GXEA 3BEWA 2BY1A 3ZZSA 3KPPB 4AEEA 2GJPA 1CE6B 3CLEH 2IF7A 4LF3B 1IGIL 5JO5A 1ETZB 1TPXB 2BMKA 3BVDB 2Q7AA 4YHPB 2PTVA 1L9PA 2FGWH 2Q7YA 1WDAA 3W57A 1BD2E 1BOYA 4KTYA 5CP3H 4LPVA 5ALBH 5H8DA 4NN5C 5E1QA 1DVFB 1LD9A 2MCG1 2J6EA 4XMXA 2NDGA 1M6OB 2CXGA 2VLJE 3JXAA 4QHKJ 4R26H 3D0LB 1ZE3C 2WTPA 4XOEA 4GSUA 2X2JA 5ISZE 3DV6A 4NZUL 3SE8H 1LXMA 3QDMA 3AXIA 1P9MC 1V3LA 2VWEE 4IKIA 1M7DA 2O93L 4B7IA 3D0VB 3ZUCA 1HEJC 1DVQA 5CUSH 5KZCB 3MLXH 4FYQA 2R0ZH 5BOZG 4OJCA 5I6MA 2BXZA 2APWA 4Z95L 1R47A 5SWZD 2ICWI 3UAFA 3VXUB 4HJIA 4CMMA 4RFEA 4XVOA 1EAPB 4YLQT 1IJ9A 1TPXC 3MRRA 2G9HA 1CUOA 1ORSB 3CG8A 4R2GD 3D4ZA 2YD1A 3WFBL 2YUJA 1K8IA 1E42A 4OIAA 4LLWA 1R6VA 1SMYD 1MAML 5BUGA 5E6IB 2BSRB 4JJ5A 1RD6A 3A4AA 1U8QB 4G7VL 4JO4L 5DK0A 2AV7A 1WP6A 3AWEA 5CILL 4B50A 4WO0A 2Y36L 4K7PX 1BX2B 4P5TD 4UV4H 3MUUA 3MRFA 1LGVA 3W11D 5F93C 1P1VA 3VMOA 4OCWH 4UILH 4MS6A 3KAAA 1A8JH 4NZFA 3FQ4A 4NFCA 5I82A 2EDWA 1U8JA 2DQIH 4MCZB 3X3FL 4HG4K 5D93C 2AHIA 1MQ8A 3EYFA 1PDKB 4UAOB 1NEZA 3TWCL 1OP3K 4D8OA 3ZR6A 3WSQL 3BGMB 3VVVA 3WYRA 1FNAA 4UQCA 2F15A 2LAAA 1N64L 5DUPL 1J8SA 4UQ2B 5CU5A 5IOPA 3AITA 3PHQB 2HT4C 1VZIA 4POZC 5F7EL 4F2FA 1J8HD 4Z3HA 2YMXH 4P57A 3MR9A 3UABA 1YZZA 1CO1A 3NIFB 2FHFA 2X38A 3DUSB 4AITA 1A6AB 1SDDA 5CGMA 4IBVA 2GI7A 4ZAKB 1YEHH 1V27A 2D7PA 4LLDA 5AW3B 4HGWA 5E8PB 2J6EH 4TLUA 2I25N 2DMGA 5J1SC 2UVEA 3IN2A 4KKZA 4X4YA 3O3AA 4HS3A 1JV5B 1ZVYA 4G7QB 4AT6B 3GTKA 2FYVA 2VR3A 5FEBA 1FG2B 2ZT9C 2JIXB 4GKSA 1JGVL 4NP4H 1AD9B 3VRJA 2I9TB 2IGFH 3GZKA 4YBLB 1AYRA 2XN9E 3QQDB 3VFMB 5JQ6H 5DHMC 1NOAA 1NEPA 4KOBA 4OZIA 2QZQA 3WUWB 2L7UA 1VKXB 3MRJA 5I5MA 2XTJC 2B59A 3BPCA 1HL4A 3UC0H 4LSRL 3WY2A 3NSJA 4UDUB 3ILPB 1DHKA 4HKJA 4PJIE 3UP6A 1ETB1 4RZCA 4HIIB 4CS0A 3QDJE 3RGBA 4F58H 3TN0B 2DQEL 1DVXA 2EDNA 1ORSA 4PRAB 3KHOA 3CFDB 3RG1C 4RCAA 2QFPA 2NXZC 4PJIB 1JDDA 5IVXB 2DZEA 3BT2L 2O5YH 4WI3A 2N7AA 2V8MA 4YHKL 1KBKA 3QCTL 4K5NA 4XVTH 1MZZA 3MJ7A 5DJ6A 3GMOA 5C0JA 4FQQA 4MDRA 1KB5H 2CXKA 1NFIB 2E7MA 5I6OA 2WLNA 3F85A 2LTQB 2BWQA 4MX7B 4N22A 1J1PH 5F9AC 1GGUA 2FVNA 1EFXD 4K3DH 4PG2A 1A1OB 3EYSL 3MFFB 3P2TA 1JYVA 1G7JA 1A7NL 3HC2A 2VYRE 1X5YA 4OW6A 1UA6L 3BLBA 1C9SA 1JK9B 3RFZC 1ZWIA 3E6FB 5CZXC 4Y4FB 2WNWA 1OD9A 3QO0B 8FABA 2XG4B 3CCHB 2O5XL 1XCQB 3P3TA 5FUCC 3QDJD 3QVAA 2PW2A 5FF6A 1L9MA 2VN7A 3ZX1A 2AJUL 2L7QA 1YMMA 3FUIA 2DQEH 3KPQA 2R8SH 2UUDK 2QKIA 3NPSB 3AY4A 3WJLC 4OI7A 3FQRA 2A1WL 1RFDH 3VXRB 4P4RB 3ZTJH 1ETZA 2WXNA 1FRGL 4LLDB 4XMUA 5MERA 3IDIA 2FTAA 3EDFA 1JZJA 4UBDC 4X6CF 3ARDD 3FO9B 3T0WA 4H1LB 1ECYA 2WTRA 4LRIA 5L8JB 2P80D 4J3OH 5HHOE 2Y69B 4FQXC 3W81A 1BMGA 1TZHB 4OZIE 1H6TA 2JKLA 1G7LA 3BH9A 3EFFB 1DJIA 2WQWA 4WU5B 2MHAB 3UCQA 1E67A 5IVOA 1PT0A 1K83A 5T3XD 1WV7T 1C08A 1INQA 4MNQD 5CWSA 3VI4F 4PVBA 3RNKB 3CZUB 2LFEA 4QT5A 4X6DA 5ESQA 4KJPC 3TZVB 3DMRA 3AAZB 3UC0L 1PZBA 5I6XB 3LD8B 5DQJB 1XSOA 1DVFC 3W39A 1A9EB 4D0BB 4KI5C 4FXKB 4OFIA 3PUUA 1ILUA 4LBEB 3DECA 3T8MA 7TAAA 1MJ8L 3UBXB 1CR9L 4JDZA 1F97A 1WICA 3ETTA 4C83A 3BC9A 5I0ZA 3GSRB 4KMQA 3BPNC 4ZTOL 2J88L 3QWOB 2EC9T 1PD1A 2PP7A 4P9HL 3RL2B 1Q90A 2CSPA 3R7QA 4Y2DD 2F18A 4FLOA 3L5XH 3U9UA 4LLWB 3UJJL 1M42A 2GUOB 3H54A 1Z9NA 2ZWLT 3MRHA 4N87A 3QZBA 1ZA6A 1DSFL 4JLRB 4OLUH 1QFWI 3MRGA 4JQIA 5EUOF 2FEJA 2H32A 2NY4C 5D7JC 1SQMA 3OC5A 4U0RC 4A6YH 3G6JA 3LTVA 4WI7A 3MRLB 5LWYH 1D3CA 2W81C 3FTGB 4N0YH 5J89A 2KKQA 3AU1B 1N0XH 1NGYA 3QORD 4CRYG 4GRLC 4HUCA 4I18C 1S9YB 4Z7NF 5BQ7A 4GQPH 3IFLL 3SYQA 3OF6D 2XIBA 3MNZA 3QJUB 5F1IA 5HVHB 2HMID 4DERA 3PFQA 5HHMB 1PL3A 4GLRH 4HA1A 4DUWA 2LU5A 2I69A 2DMCA 4DH2A 2EVIA 4GEIA 1YNLH 5F7WC 1Y4ZA 1M7IB 3N41B 2IBGA 4FI7A 4PJ7F 5T1MA 3C5JA 4RMWA 4IM8A 1HDMA 3WL9A 3BPLC 4XVJL 5GRVK 2R2CA 2X9ZA 5E6SB 3T2LA 5KVGH 1Y07A 5B39A 5AAWC 1XGZA 1SUJA 4QOKE 3OV6A 4U2ZA 5TF1H 2NSXA 4F2EA 1HQ4B 3LIZL 5DJ8B 1PVHA 2WXJA 3C60C 3GSQB 1NCCH 3ARFD 2YD4A 4W9EC 2PNWA 2MCMA 4WU7A 1TWCA 4HFWB 4P2QE 1BBDL 2F53B 2NNAA 1TQBB 2UX7A 2NPLX 2J8UA 3LKPA 5I0WA 4DT2A 2EUVA 4IRJC 5CZKA 3C8HA 4A7SA 2C1PA 3CAFA 2NZ9D 2GIMA 3DROA 3GB7B 4XPFH 1AAJA 1X5AA 4PJGF 2EE2A 3RP1A 3RY6A 3KLLA 3JWNE 3SPGA 2ED9A 4PJ8A 4HP5A 4QOKD 2J88H 4KRLB 3QJZA 3CZFB 5T5NF 2XWZA 3WN6A 4FXGB 5C0DB 3L5WA 1L8FA 1TVDA 3L5XL 3GXUB 3QR1A 2WKOF 3WEXA 4KH9A 1KLUA 1SMOA 4J6IA 3H3BC 2GK2A 3QYNA 4UIMA 3VX1A 1B4JH 4P49A 1YYLL 4H8HA 3FT3B 1K4DA 3LH2H 2IDUA 3Q2CA 5DMIL 3VFNA 4DP5X 4JFYB 4I2XE 5CD5C 1HEZA 2OL3B 1BSIA 1YCSA 1E6OH 4RGMB 2EXTA 3PJLA 4DIXA 4HOXA 5FYJE 4LSDA 4FTDA 4CVWA 1DFBH 2HP4A 1RJZB 2J57A 5G4OA 2B2XL 5DFVD 4ISVA 5CCHE 2ROYA 4MXWH 4DVRL 4HWBA 3UOAB 1MCLA 4JFDA 2YKLL 4P04A 2HX9A 5F71A 1MY7A 1XAUA 5A16B 2NYZA 3D9AL 4ZFOB 2R9HD 3L54A 2BNQD 3B3IB 3NESA 2VDLL 4DP8X 2XFXA 4YLCA 1CL7H 3E7JA 4ODWB 4Y2DA 3OKDA 4BD4A 4ZFGL 4J3TA 4JKNA 4UYQA 3RBSA 2CGRL 1PLBA 3U0TA 4GRWH 5L0QB 3KPSA 2G0LA 2EXWD 5HDOA 2EYTB 1ZV9A 4G6ML 4QRBA 1NAML 5FOBB 5J9PB 3TN0D 2WNXA 3NACL 2O5ZL 5D1XC 4M7JL 2ZE0A 4RMTA 4F1SA 3TIEA 3FCTA 2UYLA 3GZQA 4HH9B 1OM3L 4DO4A 1I1YB 3FU7A 3L7EA 3LX9A 3O3EB 3FCSB 1QBBA 4P4KD 2JE8A 3L7FA 4P99A 5DSCA 4Z76A 3PWUA 1X7SA 2EIEA 3GYRA 2OL3H 3LMJL 5C7XH 2K6YA 1LDPH 2X3CA 3TZVD 1MPAL 4KKAD 2AEPH 1CICB 1QLEL 4PRAA 4IBZA 5PCYA 5AUMB 4CA4A 3DPBB 4NGHH 2GUOA 1SVBA 4H8WC 5EUKA 2F74B 1JHLH 3MMEA 1E18A 5C0FB 2KI8A 3AQYA 3QNYB 5H37G 3VAEA 4PVMA 4Q9QL 5GM9A 1XZ0B 4BGDA 4M9PA 5B3JE 4YSRA 3QC6X 1BQHG 4J8QA 4RMQA 1MHPH 4PLOB 3PGFL 4PS4H 4QRQB 4AG4L 2CD0A 2NY2B 1G84A 2N01B 1QZ1A 2XXCB 5CLTA 4OB5L 1E5ZA 4K8RD 3V6BR 3DHMA 4NLHA 4B5EA 4HXAH 5J0BA 4LOFA 2NTFA 3TNMB 2HX7A 2AFNA 4YVUA 4WEEA 2IV9A 4V1DB 4I1NB 1BLNA 2ZUSA 4URKA 4A04A 3CHPA 5DS8A 3KVDD 5D7LD 3L3JA 1QWNA 2P5WA 1F45A 3HE6A 4G1MA 4UTBL 1J5CA 3K91A 3WS6C 5I1KH 4BFIB 4NQDE 2LE9A 3VYNA 1HC1A 4OZGA 4P23B 1KYAA 3DKHA 3N0AA 4PV1C 3V0AC 2L04A 4BKSC 5M95B 5TE7H 3MLVL 3E2HB 4LLMA 2WXGA 3IWVA 5BV7B 2NW2A 5C1MB 1VEPA 3KLKA 3WEBA 4G7SB 3K2UH 3RDTB 1JPST 3I3EA 3MBWA 3PGFH 3Q01A 2BP8A 1NGQL 3MRQB 4G9DB 4MSWA 2XZCH 1KIPA 5IHWA 5JMOC 1TWGA 1T2XA 4P3DA 5DYFA 3M07A 1K85A 2FEDD 3NZ8A 3QNZA 5F7DB 3P4NA 2HRPL 1TMCB 4AW7A 4Y4FA 2G60H 4B9KC 5D71H 1I1FA 4WGVB 2XBZA 5C3TA 2XG4A 4X50A 2ESVA 1DQKA 1CTNA 5TF0A 3H8NA 4LSSL 3B9KA 5DCCA 3D39D 1AHKA 5BRZE 4YDMA 3GEFA 3DGCR 5EBWA 5E5LA 1MEXH 3OB0H 1W72B 2CO2A 1UCBL 5CEXB 1S8DB 4Z7WE 4V2BA 3IKCB 3JVGC 2VXTL 4GO8A 3JV4B 2NMSA 4QTIL 3QYCA 3ZKXB 1HNGA 2OR8A 4DP2X 3RRQA 4UB0L 5FFLA 4GFTB 1FN4A 4Y4HD 4G43B 1HSAB 1I8MA 3ZKXC 1ZVSA 2VZSA 3FRPB 4K3EL 4ZXBA 3FHAA 1SJEA 2YK1H 3L5IA 1LP9E 2VRQA 2R29A 3X11B 3SO3C 1VEOA 1KBWA 3N1FC 4PRBB 3D4YA 5HI3D 2NTSP 1S9XB 4XC1L 5K69A 4HBCL 1GZHC 1BFSA 4ATWA 4L4TA 1X6NA 3C2AH 1KACB 1E90A 2X6CA 2G6GA 1AYOA 3AW5A 3O0RL 4MNHA 3V7AE 1O9WA 4NRYA 1I7ZA 4OCXH 4EI5A 3PXLA 3D33A 3KPRA 4JO5A 2FR4A 3CX2A 4GKZB 1VF5C 5EO1A 3K81A 5H94B 3EDDA 1YNTA 1MHHB 1WZ1L 5HBBA 1LO0L 3BPNB 4JM2C 1WHOA 3IMRA 2QPSA 1BLIA 4WU7B 4QF1B 4MMYB 4P23C 3O6KL 2XFGB 3J27A 1OT1A 5FA3B 1BWMA 2IH3A 4KDLA 2V5SA 1E2ZA 4L8SC 4PJXA 1BZEA 2V7NA 2NY0B 1ECZA 5EUKB 3EW3B 3K6NA 5F6IB 1THAA 1J9QA 3SDXA 2WLIA 2V9UA 3V8CA 1S6NA 4ZMWA 3W9EB 5JXEA 3FTSA 2YLKA 1GVIA 4RFNB 4W9HC 1WC2A 2NY7L 4QIWA 2AVGA 3RA7L 3OLDA 5F6IC 3WE6A 4YXHL 3GJEB 2AAAA 4LEOB 1PYUB 1AG0A 4FNLH 2AEPL 1R75A 5AW5B 3IAGC 5CJQL 5LCVL 2BDNL 4WFHE 1M53A 1ZLSH 3TEXA 4I3RH 4ZDHB 2YAFA 1GC1L 4PMEA 2DYPB 3RDJA 4O2FA 4K23H 3W9DA 1LNUA 1Q9WA 5BRPA 1R3HB 4QUOA 1KTLB 4O02B 3P77A 1NCIA 3BW9B 1FL3B 4ADGA 1YEEH 1MNUH 1PG7L 1Z7JA 3FXIC 2R2BA 4ZZFA 1VDGA 2X6AA 2DICA 3TYGH 2FO4A 2HTLD 2PCPA 3EFDL 3RWHB 5KSAB 5DVLA 2QGDA 3ESOA 4TM9A 2DQDH 1YECL 4HCFA 4HIEA 4YL9A 1RZ8B 3CSFA 3IFOA 5TDPB 4JL1A 3TBYB 4AE0A 1A64A 1N7ML 1E5VA 3MJ9H 4WCYL 4G6FB 3HRPA 3FQXA 3RA7H 1SM3L 1UWGL 3HI6L 5MHSD 3QR0A 3SOBH 3BUYA 2O5NA 2FIKB 2OP4L 2VAAA 4R4BA 1E4XL 4PWGA 1JF5A 1R19A 4U3HA 1S5IH 4NOFA 1QTSA 4N3UA 4Q56A 1RZJL 4XPTH 5FHBL 5BO1L 5LDSA 1MCJA 4PGBA 1TWHA 3GLAA 1FVEA 4A1RA 3MA9L 5KANG 3WGVB 3V4LA 1PJWA 1IAII 2IFFL 2APBA 3WNLA 3HA0A 4Y4HA 3TVMD 1WHPA 4M5TA 4GSDL 7FABL 5KAQF 3SOTA 2EYRB 3EFDH 1J87A 3CU1A 4WWKD 2AXFB 5GJTL 3QUMA 1G7LB 1HH9B 2R0WL 1G6RL 4X7SH 4APQD 3KPOA 4WCYH 1ZTXL 4BV1A 1F4HA 5HHXH 1JS4A 2DMRA 2VR5A 4MVBC 1TO5A 4BDVA 5KVFL 3KLAA 2IDTA 3CMOH 2W0KA 1VGEL 1AOZA 3KXFB 1I3QA 3BZ4A 4S1QL 2ADJB 3CXHJ 4Z7QB 1M56B 1NC4D 1PT1A 4Y16C 4JR9H 4QKTA 1A7PH 4DVRH 3NJIA 1MFEH 1BF5A 1DANT 5AL8A 1B2YA 1OALA 3L2MA 1N8OE 5D6DC 5IFHH 4M61A 2XYCA 5H35B 1EMTL 2FSEA 2DW5A 1O6TA 3C87A 2BVYA 4HXBL 4KI1A 3O6FC 5EDSA 5GJTH 4IKNA 5LNGA 1AO7E 2VT0A 1NMBH 3DX6B 3VD4A 3DTXB 4UTCA 1NCGA 1KCUH 2NY5H 4X8GA 5A43C 2H2PD 1EBPA 2JKTM 4H20H 3TH4T 3DPBA 3EBAA 5TH2B 1KUMA 3DXAA 5A2JH 4P2RE 3HHSA 2NZ1A 3RVUC 4OCSH 1Z9MA 2Z7WA 2F2HA 3QT2A 1QSFA 3N43B 1H19A 4LAJH 3TA3B 4P2OD 3RKDC 5I6PA 4YDLB 4FI8A 4F7PB 4P3CL 1RUQL 4JPWL 2Z8WC 4R4FL 4P2RB 1QUNA 4QRUA 5JHMA 3CF2A 3SBPA 3MLUH 1R3LA 4HF5L 4O9HH 3ZKNC 4LKXA 3IM1A 2OXHA 1FGVL 3FCSA 5EU7C 5IFHL 4AAYA 5B7FA 2MQCA 2YZ8A 1I85C 3P02A 4IBTA 2N56A 3LRMA 3DBSA 1U36A 1JWUB 1IAIL 2Y6SD 4K9EH 2GIYA 4H8QA 4DN3L 1QFUL 2BSRA 1A5FL 3CH1A 1PCSA 4HXAL 4AEHH 1QKZH 5IREA 5JYMA 3MRGB 1OGTA 1HD5A 2C8NA 3O6FA 5DHYB 5JW4R 3PAYA 1TFHA 5EN2A 4U1LB 2CA4A 2GJZA 2EJ1A 4XMTA 4GAJL 2WC7A 2W88A 3ABLB 4ZK8A 4N9GA 5T33L 4NJAH 3QIWA 4YDLC 2YPKA 4OLXH 3GS0A 4RGNE 3US9A 4KUCD 5JPMC 4BINA 3LV3A 5C0DA 1T0MB 5LGHH 2ZXQA 4MDIA 3AT9A 1J1XH 1RY7B 3OTTA 3ZLQC 3VFRA 2X4SB 2Q86B 3FU6A 2XZCL 3TCLB 2P24B 4YDVA 1V10A 3IAQA 4G70B 1T3FA 4KY2A 5F1OB 1Z9SB 4DETA 4MJIA 2QLVB 2FATL 3TEYA 2EDMA 2Z4QB 3LEVL 3GSWB 2X1WL 2BRRH 3QJFA 3UAJC 2DD8H 5T5FH 4X7FC 3UCRA 3MJ6A 5I9QC 5H37A 5LN8A 4AZDA 4EBQH 1E8YA 3VXNB 4R84A 1T80A 1PLAA 5IHLB 2AS5M 3UL4A 1EQWA 2JIMA 3BQUD 2APVA 4ZUSB 1VC3B 3JV0A 1NKRA 3OKYA 4G80B 4B97A 5EZIH 4HEMA 1HQ4A 1B3JA 1CZ5A 5DJ8A 3BVUA 5BXFB 2E6PA 5KVDH 1D5RA 1CGWA 1F8TH 5EORL 5JR1H 4IU2A 5DTFB 3C5SA 3TO4A 2VO5A 2AQNA 4F80A 2H0FA 3JUYA 3X11A 1XGYL 3DMMD 2X70B 5B6CA 4R5VA 3CK0H 3MX0B 2R0KH 3BLKA 1OGYA 1S9WB 1G8KA 1T1WA 2A4CA 3CSBA 5BCAA 5FTLA 4RMUA 1T04A 3M7FB 5FHAL 3N50A 5TFSH 4A55A 4PJBA 1NQBA 3N9GL 4JMNA 3IRZA 4CC0A 1Z9PA 4FHBD 2CLVB 1MUJB 3IKCA 1ND0A 3F05A 3L3HB 3ARFA 3BZDA 4YN3A 4Y5VC 3ELAT 3QUGA 4LP8A 3PGDB 2XWTA 2LW3A 1G6RA 1FL6A 4M6AA 4NN7C 4PRHA 3NCFB 2ZOLA 3QPXL 1QFOA 3KXFD 4U7SA 5C09A 3S96A 2WBKA 2ZXBA 4LU5H 3D85A 3PHOA 4HUVB 2EAEA 1OSZA 1U8QA 5IB2B 3B1TA 4H8PA 2WANA 3ZKMD 3PQYE 2HG0A 1CXFA 3LN5B 1MWAB 3MRIB 2E76C 4Q14A 1BVKA 1Y7VA 1L7TH 3QRLA 5KBNC 2YXWA 3V4VH 5JIDA 2EZ0D 4Q9RH 1JV5A 3W2DL 2R0LH 4FYSA 1ZLUK 3A5VA 4KC3B 3TJHC 1JOIA 4NO2A 3DXAB 3FH5A 3SPVB 2MPVA 3UEQA 1G43A 1OZUA 3L3OB 2ZCHL 2CJ3A 3FB7B 1A7OL 4OLWL 1X4YA 1MVUB 1X5FA 1O7DC 1Q72L 4R4ND 4X6BB 4ZMVA 3F5WB 1SEBA 4O2FB 2BSBA 3K4AA 3OHXB 4LLQB 4QAWA 5PAZA 4LVHB 2DD8L 1FAIL 4GKLA 3FFDB 3MOQA 2JIPA 4QI3A 3UGXA 1RUPL 5HDQH 3WTUA 3JTSB 3N04A 4CVXA 2Q2EB 1LO5B 4JPSA 4O58H 4PAZA 4GRWE 1Y0LB 4OD3L 2CA3A 5FK9A 1YPZF 4NO3B 4J3WA 5F44A 3ZTNL 1LMIA 2IVFC 2PWGA 3PIQA 1SYVB 4D3CH 4ETQA 1G7PB 4FG4A 5JR1L 1VIWA 2DQUL 4ABWA 1IKFL 1U8MB 3QJHA 2XA8H 4JY5L 5DZPA 3NEXA 4NYLA 5ESAA 1DJGA 4N2CA 5BUAA 4BQBA 1AJ7L 5CBEA 1FJ1A 5DMGD 4WO4C 2J56A 2ICES 1ROCA 3UYRL 1PKQB 2XXGA 4KKPA 1WFTA 1I1RA 3PV6B 2AK4E 3AB0B 3I6SA 4K5OA 4TQPA 5HVGB 2QTVA 3UIYA 5IHUH 3P11L 1T03H 1S7XB 4L9LB 4NN5B 4QR7A 2HX8A 1K6QH 1M7XA 4YFLF 5D7IA 4GO6B 4M8QB 2XN9B 3FQWB 1E40A 4RISH 1ZE3H 5IWLC 3RBGA 1JMZA 3QWQB 4Z23A 1EJFA 2C9VA 1CLVA 2E7DA 2XZAH 1ZGLB 3MV8A 1KELH 4XO4A 4Z95H 4Z8FH 1U8PB 3KMDA 4WWPA 1XTLA 1WTGT 3SKMB 1E8ZA 2A99A 1MAJA 1FQ9C 2ZPKH 3LRLA 3QDMB 1UYWL 4N2KA 2ED7A 4TQEH 4ZW3A 3OLEA 3U30B 1EZVY 3FMGH 3IEAA 4DGIL 1TLMA 4BE5A 2DMBA 4YXKL 1FO0L 1U3HC 3DGDA 4JQXA 2O6EA 2OXHB 4FQ1L 4LVHC 4F27A 4WDIA 1F4WL 1KIPB 4LMQE 3E8VA 4LPYA 2EXWC 3WXWH 2NDFA 4Y4FC 4JO3H 1CDJA 3EGSB 2CIIA 3U46B 4EN2A 3EH5B 4CAGA 1YNKL 1DO5A 2EIZB 2A6DB 1UWFA 5GIRB 5C86A 5CIPA 3V79C 3CMOL 3KPPA 2OMWA 4PGDB 4PWEA 5GGUB 5IY5B 2GTWA 2HLFD 1IEAA 4HAFA 4NNXB 5L2KA 4YHIB 3LSOB 4RNRA 4HW6A 1BYPA 4UDUA 4MB1A 4G72B 5AW6B 3EH3B 1KGWA 4JDZB 3KPSE 2OZNA 3ATEA 4HZLA 4MS8D 2Z8RA 1U3YA 1UKSA 2A9DA 3HE6C 1WISA 1EX0A 1I8UA 2NXZB 3OUGA 3MYJB 4TVUA 4N2GA 1CXIA 4ZS6C 2C3VB 1X7TA 2J1YA 4FXLA 3U2IA 4LHUA 1U93A 4RQQA 2IQ9L 3HFMH 1CIUA 1FG2A 1LHZA 1AQKL 4GKSB 4IBYA 3VFVA 5ADPH 1O9VA 4K3JH 5BJTB 3S5LB 3KLQA 4KK5D 1HIML 2IADB 4A67A 4O5LH 3QEQD 4LEXL 3MBEB 2XTJB 2KBGA 3GSVA 2E27L 1VFMA 5L7XL 1ZJBA 4EVNB 4NUPA 5DURD 1BDYA 1F58L 3EYOA 4XNUH 4K2UL 5FAAA 1H3TA 2FJGA 1GSMA 2YSSA 1GYUA 2MNWA 3JWNG 4HK0B 3VH8A 2I27N 2YOCA 3BAWA 4FXGA 5T3XL 4KVNH 4EJ1C 1AGFA 1WH0A 3UO1H 1IC4H 4FZ8L 5KOVC 3G5ZA 4LNVA 2ZKHL 2JCCA 2FR4B 2VLJD 3U4BH 1TYJA 3APNA 2H3XC 5FTMA 1YNTB 2CCLA 1M7IA 2OV0A 3KLDA 3RHWK 1A1NA 3P3SA 5C0NC 3HC3H 1R17A 2NY1D 4BQ8A 2ERJB 1KN2L 4NRXA 4E9TA 2QQLL 2WXMA 4PY7A 1CFQB 2W0FB 4N20A 1ZS2A 3FJTA 1XH2A 3FQTB 3ZDYB 4EZLA 4MQSB 4RFOH 4NUJB 2F5AH 1FCCA 2NY4B 3WDHA 4AQ8A 2D31A 1EFXB 1KDJA 3VXSA 2QADC 3DRQB 1A5FH 2C4FT 3QIBC 1MCWW 1MJUL 1P2CA 4BA0A 4R96A 3FH8A 5CIPH 4L29B 5FM5M 4PP2A 2FH6A 1KN4L 2C4FU 4NOBA 3MRHB 3EAKA 4D3CL 2DQMA 1RU9L 1XSJA 4HH9A 2BINA 4NWUH 5JXED 5F8RC 3JVFC 1N26A 1X5IA 1FLRL 2ARWA 3GDCA 5INCA 2BHYA 5ERWB 1DVYA 4CU7A 1OY3B 4BWWA 5CSGA 3IDNA 7CGTA 2K7PA 3ARVA 3ARUA 4NO5B 5DFTA 3Q5OA 1NGYB 3RY6C 3ZU8A 4XNAA 5KBMA 1A14L 1M2OA 1J9RA 4NQVB 1WC7B 1KFGA 5HJ3A 2FEEI 4G5ZL 2Y2YA 3G5YB 4K7PL 3HEIB 1P4LA 4HIXH 1XMEB 2ADIB 3NH7H 1G7IA 4FADA 3TX4A 3L4YA 4ISVB 4EUPH 1KB5L 4N9OB 2F19L 3AMLA 3PWJB 4UINH 25C8L 2PABA 5LB1A 1X7QB 5FUZL 1I3RB 1NMCC 3WIHA 4RX4D 1MOEA 1XGRA 3ECBB 4NZ8A 1BD2B 3QUYB 4L2YA 2X88A 1A6PA 4HFUH 3C08H 4P07A 4W81A 3OC8A 1TZOA 1DEEB 2AE0X 4Z9KB 4A2EA 4RWYH 4J6RL 4WSGA 4M5YL 1WPCA 5BNXD 1X5HA 2YHGA 1KGXA 2AJVL 1KB5A 3KDMB 2J2ZB 5D96B 4LCWB 4L3EB 2DTSA 4ODVH 2LV4A 3D8MA 3K0WA 3RVTD 3US1A 1YNND 1IGMH 5E4AA 3P4MB 1UWXH 3F6IA 4HPYH 4MMXC 4NKOA 1DTUA 1A7RL 1QEXA 3LRSB 4WHTA 2DI9A 5IQOA 4R0LA 3N0PB 2XWBA 5HSFA 2ZWYA 3FF7A 4HCIA 2MKWA 3MYJA 3WY4A 2NUTB 2VZUA 4N3TA 1H8OA 1O0VA 2W91A 3HS8A 3NFSL 4L3AA 2ZUQB 3RVXC 3GI9H 4ZD3H 1U2HA 2C9PA 4HJUA 1TNMA 2K3HA 2HVJB 2DBJA 1I1AC 1ZT7B 1TNNA 3BD4A 4KXZH 5BV7C 3RLSA 2HWZH 3ECWA 1FE8L 1RIVL 2ZX8A 1HYRC 4GKOA 2R2EA 2WHVA 3NCYS 1C7SA 3PNWB 4JDEA 1DBBH 5G55A 3U6XA 3VXQA 5FO9B 1CE1L 2CMRL 3EH2A 4IJTA 5D70H 1JI1A 5I8KL 3IDGA 3GRWA 3UPAA 4YK4C 1A4KA 4FEMA 1X44A 4UI2A 3CC5A 2KS0A 2GJJA 5DQDL 1FFNA 1FIGH 4QRPB 2YMXL 1B4RA 3JV4A 1HZHL 3VQ1C 2V7HB 3FN0H 5E0QA 3IYLW 2FIRT 4HEPA 4KJYA 2YBGA 5D7EA 1YNLL 3U4EA 1FL5A 2ZNXA 4X5XB 2ICWB 1F11A 2OX5B 3LNIA 3QDGD 3ZSTA 3L17A 3P9WB 5B1KA 2ZQKA 1PCXA 2F7OA 4C59B 4W4NA 1UA7A 4KHTL 1ZLEA 1TKWA 4XCCL 4HBCH 1X3DA 3WIHH 5D1QA 3O5AA 2F68X 3AS1A 1YHPA 4M48H 3TPUB 5SWSD 5I1GL 4IDJH 3ZHNA 5IMOB 1RI8A 1E4JA 1OAZL 4JRXE 3U0WH 3QDHA 1JNNH 1B4LA 1H0DA 5M94B 4S1DD 4I4WA 2R8SL 5AW8B 4EMZA 4L9LC 1XSKA 2F7QA 3LD8C 4B3EA 5C18A 2H32H 4FKKA 4U6XB 1RFDL 2LAGB 1JGDA 2Y7QA 5A2CA 1E43A 2N7BA 5HI5D 2QKIC 1AIFB 4PLJD 5GGQL 4JVUA 2MCAA 3QUHA 4JN1L 2P9RA 3PYCA 4QF1A 4K8RL 5C9JA 3QJHB 2HKAA 2NYYC 3MBEA 4MVBD 4M6NH 5CGYC 2XWBB 3GKWL 3BIKB 1JD9A 4N8UA 3F7VA 3X14B 2C7UA 3ULVL 1S7QB 3QQ4A 1J8RA 2BNQE 4LCVA 4CKQA 3UBGA 2BWIA 3F6LA 1JFQH 4R90H 3CN4A 3VFSB 4MD0A 1FNLA 2JJSC 4PFEA 5IR1B 4M6MH 5BRZA 4ODXA 3Q05A 4NCDA 2VLKE 1YC8A 2CLZB 1DBBL 5CZXD 5E51A 1E5CA 1XF5B 3HOGA 4BH7B 4XOBA 1YEIH 3QWNA 4RGMC 4P5MA 4R5TA 2F54D 1XR9A 4B9IA 3WLWD 5FDYA 3R0NA 1LO4L 1YO4A 5MEQB 3B37A 3BO8A 3HCVB 5BW7C 4YDZA 4IMLA 1JZ2A 3F6JA 4ZMLA 2CNZA 5LXGL 3C5JB 1PPIA 1BZ9A 3GMPB 3FFCB 2BS9A 1J5IA 5FWRA 3ARED 1CYXA 1NJ9B 2AJ3B 3TNMA 2EE0A 4GMSH 4DUVA 5DUMH 3OM3B 3KPRB 1T7ZA 3QUZB 3PL6B 4QRAA 4OF8A 2VQUA 4FLSA 4RH4A 4L8BA 4QCIB 2HPTA 5D1QE 3S3DB 4DEPC 2ZXGA 3MCKB 1J86A 5CP3A 4BKLB 5C08D 4YPGB 4DGWC 2TAAA 2CUAA 3A23A 4HKBA 3FDWA 1HZKA 3PJNA 5AKVA 4MJ6A 4LSRH 4XNQA 1XFPA 1GH7A 2FGZA 4M6OH 4QHLA 1T21A 3POHA 1WSST 1DFBL 3FQUA 2ADGB 2DWDA 4L5FE 5GHWL 2DLGA 1WWWX 2VXTH 1A4JA 5EC1A 1NL0L 1PF3A 4LLYA 5D1QD 3ATAA 5AOIA 1Y6NR 4QRTA 3OKKB 2LLGA 4JPQA 4F7MB 5IJCC 1X9UA 3APCA 4XP5L 32C2A 4DF9A 3H6JA 1DJYA 5DMJB 4GW5A 3WUZA 4OV5A 2PWDA 4ZPTB 5B4MC 4P9HC 5HDLA 1SY6H 4JK0D 1DANU 1HEZB 4PJ5E 1AOHA 1ZAGA 3K8LA 4HWBH 5TQ2L 1WQVT 1KC5H 1KENH 4GFXA 4HUVA 2VSKB 4UUJA 4NOHA 1DQDH 4AL8H 5KTEH 1D9KA 5DZ9A 4QRRA 2XBDA 2GSGB 1IM3B 3GSVB 2VIRA 3V0GA 1OK8A 3FQTA 3O6LH 4OR1A 5DVPA 5EA0H 5KYXA 4JRYE 1I4FB 2PTTB 4GAGH 2NUTA 1CJYA 1NGXA 5DLML 5GISL 4HIHA 1XHHA 1JK8B 1Y6KR 4RGOL 5B1AB 4BQCA 1N2RA 2VC2L 5GRWA 2CQVA 3CQFA 3GRGA 5C0CE 4DKFH 1AZCA 4YAQB 3X12B 4GRLD 2EUWA 4JHWL 1QSEE 4UU9B 4L3EA 3UTTE 1AR1C 3TVMA 4YIQA 2YPVH 1ZVHA 4MTMA 3EJQA 3CXDL 5HPMA 4JFTA 3BO8B 1OPGL 5DRXB 5F72S 1DFXA 3UYPA 5L2KB 3MV7A 3TBWB 4UV4L 5EFIA 4YOKA 2E9WA 1LO3L 1DSYA 5ESVA 5IQ7H 2GG1A 1DEEA 4PJ8C 3QG6B 2XV0A 5K9KA 2VZVA 1TVBA 5J6HB 2CO6A 4HKXB 3V0DA 3MJ8A 3MRKB 4KRPC 5EO1B 4JGJA 1K3IA 1ZGLM 4C47A 1R34A 3VXOB 3MDJA 1QDNA 1I82A 1OANA 1FHNA 2X0VA 2ZCLH 4KTDH 4DFHA 1UA6H 1WC7A 5I2IA 3DMMC 1P9MA 3G04B 3GSOB 3C75A 4WJ5B 1NCCL 1OGAB 5CEZH 1GW0A 3EXJA 3IMUA 3ULVF 1A6VH 2O5XH 4FFYA 1JFHA 4PQXA 5F3HA 3WEMA 1M7DB 1KYUA 2XV6B 2X2YA 2AK4D 2VITB 5GHWH 5C6PB 1A22B 2ATPA 4NRZA 1MRFL 3QIUD 4PN6A 5DRZB 2VAAB 2VDOB 5AKSA 5I71B 1CG9B 4WI4A 2BOCA 4HKZA 1JE6A 4AYFA 3QZWG 5INDA 1UZ6E 3NJKA 1K5NA 2E59A 1E9PB 3GTPA 2ROXA 5DUBA 4PWJA 1MLBA 1TQWA 1RULH 3PDOB 1FFQA 4H8UA 4P0DA 1MFUA 3LRGA 1IAOB 5GS0H 2EXSA 4WAFA 4NO0A 4DKEH 4K7FB 1I50A 4QRRE 5GSVB 5A2LH 1MWAL 4OUUB 5F96H 2MIZA 5T3ZL 1DYZA 1F6LL 2WSDA 4RMRA 3P2DA 3KPRE 1T6BX 2HVKA 3CIAA 4OF5A 5I19H 2J72A 1T66D 4EN3D 2CBMA 1R3HA 3WHE1 4TUKL 1N0XL 5IIEB 5A7BA 2PYFA 2X12A 2YQBA 1FL3A 3ARDA 1GYCA 4BFGA 4WK0B 2YARA 3NCJH 5FYJD 1UH3A 5FLUA 3T0EC 4R8WL 3L4XA 1QABA 3L45A 1QMUA 2VDKH 4MD0B 4K0OA 1NWPA 4JS7A 1UB5A 3P4NB 2VKWA 2OMXB 4AQOA 3WMQA 2YPVL 2V5RA 1IC1A 4AY0A 1BREA 2XYBA 1S7WA 5L0QC 4ZNCD 3QPKA 1BGXL 3DBXB 4I0PD 5KN5B 5IJBC 5F9JB 2CDGA 1CYWA 2VM4A 2ZXAA 3LQAC 4GAFB 4HLZH 1RUKH 3WO4B 1OZTG 1A6AA 2PXYB 5GLXA 1YA5A 4JX0A 4MMZA 4HUWA 3KVQA 1SFDA 4JGMA 4NNPH 5JDJA 4ALAL 4HLEA 4A68A 4HAKA 4ABVA 4QWWD 3G5WA 3GXDA 1DUYB 5ECJE 3UTZA 3FT4A 1MFEL 2GT9A 1BHGA 1AR1B 2WLYA 4U6TA 4AONB 5IMLB 3UJTL 3FQ2A 1XGTA 1NGQH 2V3DA 5I23A 4XNQB 1QSEB 3AJ7A 4NUQA 2CPCA 4BSVA 3MV7D 4AGMA 1BIHA 1EPFA 4NKMA 1PX4A 4MB4A 3WKQA 4WI5A 3DIFA 2GSIA 2B1HL 3ARBD 3DX1A 3S36H 4I1PA 4U1GB 4PREA 4G8EA 2FBOJ 4PLNC 3OLGA 4KPHH 32C2B 4XOCA 2BVTA 3FQYA 2N1TE 2DIAA 4UQIM 3VJ6B 1B9KA 1JVKA 4FFZH 4ODTH 2H6OA 4G3YH 1IKOP 3HBGA 4DK5A 3Q6GH 2Z7YA 4YR6A 2R92A 1BFVH 4R5XA 3EJYC 5LCVH 5FYLE 5I28A 1RK0B 4FQCL 5I1LA 1RERA 3M1OA 2BSED 4M4RA 3MRIA 3W37A 1KT2A 3VUAA 2OMBA 1NAKL 2H0PA 2R0LL 3H53A 1BJ1H 4NKIL 2WXRA 3WNOA 3VACA 4OGQC 4GSDH 1LE5A 4KY1L 4ZPVA 3NJHA 1PFOA 5D7LE 5FUCE 1CZ8H 1DR9A 4XNZB 3KNBA 4JVPA 4UZGA 1RP9A 4LEEA 3ZZLA 3ULVE 1TEGA 2QPDB 5E5MA 5LGYA 3D3VD 2GITB 1OGAA 4FS0A 1EXHA 1ES0B 2VDQL 4LDLB 3MNVA 3X13A 3QQDA 5MI0C 1T4KA 1U8OB 3MROA 3V6ZB 2FB4L 4Z3FA 1MLCA 1ZT4A 4P4KC 3O0RH 2Z1PA 4QRPE 1MIMH 3QZNA 3FFCA 3CFNA 1UWGH 4RFNC 3TCLA 1LDPL 4E5XA 3KW8A 1MXGA 4OCXL 4AGOA 3MODL 4IIQB 1P4BL 4JHVA 5E24E 4H88L 2GW5A 1CD8A 4MMZB 4LDCA 3W3BA 1IGFL 4B6ZA 2VDMH 4P5TA 5FYLL 5K1NA 2DH3A 2W9EL 2OR9L 3MAWA 2CUMA 3SQBA 3FOMA 1QACA 5HYJD 3VXRE 3EDJA 5ACLA 1KPVA 1JZ8A 3Q5TA 1PYWA 1G6VK 1CFVH 1ZVNA 3VD3A 2Y7OA 4Q97A 4UU9A 4NYLB 4LPXA 3QNFA 4WUUE 1I7TA 2IAND 3VFMA 4GMSL 3TVMB 1QRNB 1CL7L 2DKMA 2XNAB 4POUB 2CKBH 3MGTA 2EDTA 3QS2A 5F7AA 4HD9A 4L4VD 2AERT 2IMNA 4D0CA 3QQ7A 3BP6A 3HC4H 3IDMB 3HHRB 4CU6A 5KG9A 4MZ2A 1CFSB 2EICA 2Y5EA 4JEGB 4BFNA 5SWZA 2WQ8A 4OTXL 3O41A 1MIML 3E6FA 3EYVA 1LQSR 2FQDA 3DETD 3MJWA 3O2WH 4QDGA 2WTOA 3FO9A 3H2QA 1ZS8A 4JHAH 4ZFFB 3DGGA 1DUZB 3AY2A 4OLZH 4X6BA 3B8YA 1F4XH 4JVWA 4AMXA 4GW5B 4OV5B 5CN3A 1AR2A 4N28A 4WHCA 1SVZA 4U1LA 3F64A 4Z3IA 4PR5B 2IANE 3DVGA 3HG1A 3NOIA 4MA7H 1C5CH 1H5BB 2ICCA 1P84K 4WI0B 2RFXA 1NC2D 2YGNA 2WQVA 1PAMA 3C8KB 2X4TA 3M46A 5IM7A 5JTWA 3CSTA 1PW3A 2AK4B 1M7UA 5BVPL 2GCYA 1BFOA 2IDFA 2P5EA 4LCCB 2VDPB 2A7BA 1CR5A 1RP8A 2ED6A 5DJYA 4LDOB 2BVOB 4H20L 4DTGL 4JO1L 4PV9A 2XPGA 5HJDA 1RUAL 3T0EA 1QFWH 3D18B 5JIMA 3BGAA 3SGDI 1NKOA 4D2NA 2W65A 3TA3D 5IB4B 4FQQB 4MZ3A 3VI3A 4KX7A 4H8VA 5LO7A 4IBQA 3T77B 4H88H 1OQOA 5T1DH 3VD5A 2ENPA 4XNMB 3NA9H 4MQ7B 4OVUA 4ADJA 4JPKH 4HBQA 3N1PC 4U1HA 3HUJA 4XTRD 5DJAB 1G94A 3K1DA 3MJ8B 3MRKA 3X2PA 1AS8A 1SGKA 2DQHL 4Y88A 5ILTL 4DZBA 3B7RL 1DBJL 2VR9A 4WW2A 1UFUA 4HD5A 2UWEF 4MXVF 1UWXK 4F33B 1HINH 2OL3A 5LQBL 1MCPL 2NUPB 4B41A 3GBML 1KTDA 4OSUL 4Y16B 2CKBA 1M6UA 3IPFA 5FS5A 5MEOB 3KEHA 1LE9A 4U0QB 4ODXB 3CN3A 4PJDE 3ROLB 3E1F1 2V0AA 2VKXA 5GRZA 4OD1H 2WINA 5CFHA 3HMXL 2NY6C 4P4KB 1CTOA 3GHEH 4I9XA 4ORGB 3ECUA 1ESOA 4Y0GA 4I0PB 3SOBL 2COQA 2ZCZA 4Y1AA 5CEZL 1GSKA 3DMMA 3B6SA 4H7VA 2MQ3A 1S5IL 1MFAL 1SXAA 1WFIA 1SOQA 1ACYH 2D9CA 3O3DB 4HWZA 2B8OT 3UTQA 1OAJA 1NBZB 1ODUA 4JAMB 3QGVA 4QRPD 2W07B 2X4PB 4ONFL 5T5MD 1TEFA 3GMQA 3DX3A 3HG1E 5AVTB 3F5WA 5IROA 3S5LG 4B95C 4PJDF 5JORB 5FYKL 1VSCA 5E9AA 5EOCH 5HP5A 1FJ1B 1NFDF 3ELQA 2IH1A 4H8WH 2NY2D 3GBNL 3K6SB 3HB3D 3GBLA 1M71B 4MXVE 1MVFA 2YXVA 4KZDH 1HAWA 4NQED 1J0YA 4PJFE 3WV0A 1U33A 3AT0A 2Z34A 1MJUH 5CM1A 1ZYRD 3D2UD 2OW6A 4JGUA 4N0UE 2PWHA 3BRGC 3HU3A 4ZUUA 3DX4A 3EYQC 2R2HA 1A4JB 2RTTA 3HG1D 1R5IB 4W9GC 3N06B 5DEFB 5DUBB 4GRMA 3GXNA 2NY3D 1KN4H 4PRDB 1JVOA 2Q20A 5C8JB 2YEVB 2GQHA 2Z91A 4GIOA 4N0FA 5L2KE 4DKAA 1K4CB 4GQQA 5JHLL 1IGFH 4ACPA 4IIZA 4OH2A 5H37H 3MLRH 1FFPB 1INEL 3QIBA 3GTQA 4TSAL 1A21A 2MEJB 5AAMA 3C09C 1GIGH 1ZIAA 4FXKC 1MDTA 3PWPB 1S5HA 3CDZB 4XPFL 2VOTA 4GW1B 4G7YL 1BZOA 1QQDB 5E2WL 4GW4A 2NLJA 3O6FD 2L8AA 3JWDL 2V2WA 4IOSD 1A47A 3PL6A 2JWYA 5EUOA 1FN4B 4ENZA 4MQXC 1PX3A 4QJ3B 5B3JF 4E41B 1XVSA 3NH7L 2NQ3A 4P46B 1XCTB 4U4BA 4ERSL 4QTFA 2I5YL 2IALA 4PD4K 3QJVB 3QPXH 1QHOA 4ZOAA 1R3JB 3GHEL 5HHOA 2KQAA 1E4XH 5AVVB 1FORL 4MZIA 2OMVB 4ZI8A 2WIIA 4F2MB 3CC1A 3TXAA 1UKQA 1QLFA 1F4XL 1MG3C 3TL5A 4XPTL 1I3GL 2CDGB 4CVZA 2F54B 4OZ4A 1INEH 1X5MA 1YEGH 4UQ3B 4PRPD 3F3HA 4AEIL 3VFPB 1R24B 4NQXA 1P5UB 3O41B 3QZLA 4XHQA 2JKIS 3B6SB 3PNRB 2GI0A 3Q9PA 4K23L 4NB7A 4NJ9H 2NTFB 1BM3H 3FYIB 4JCWA 1IC0A 1A6ZB 3GIZL 5E9NA 3FFCD 4Z7WB 5EBMB 4NIYE 2ZAHA 3GM0A 3H4HA 3DO3A 4FMFA 4WWKC 1JYWA 1UHEA 4KZEH 4UDTA 2EDXA 2JI3A 2Y6SC 3ML9A 5JO5B 3UJIL 2UY7B 5CGYD 1ORQA 4AIEA 3BWAA 4Z7OB 3QULB 4C4KT 2JA5A 5HVWA 3LN9A 3VXSD 5C7ZA 3MV8E 4BFIA 2IAMD 4BUHA 3FL7A 5BVJA 4EVNA 5BV7H 5KSBA 4L37A 3L81A 3QXUA 2LTQC 4WKXA 4M7KH 5FA4B 1U42A 4O58L 3D25A 4OLVL 4WFED 4PJHB 2CRZA 3MV9D 1L5GA 4A63A 5FECB 4PGEB 3MLXL 4MBOA 3IDXL 1B9ZA 4F3FB 5IJKC 2BSEA 4WEMB 3MBEC 1BPLB 1S3KL 4NN7B 3B2VL 2BNRE 3QO1B 3V4UL 1KB3A 3PU7A 4WNSA 3FRUA 4R7NA 5GRUL 2FNWA 4BHUI 4LNRA 5DYOA 3EKCA 3IU3B 1HINL 4O2CA 5LQBH 1U3HA 2XJLA 1BF8A 5FB8A 4XH2B 4XXWA 3CFBA 2HFTA 4MJJA 5ERWA 1MCDA 4LCCC 3O4OB 4PJGE 3IDNB 3VGAB 5KBLA 2LU7A 1RPUA 1T2JA 1Y6MR 1LMKA 1PY0A 5IBLC 1IM3D 3T4YA 2CZNA 2DJMA 1RLBA 3Q1EA 5I1JL 1C1EH 2OFQA 2B1OA 1YUKB 3NIDB 4D9RE 4QHMA 3IBEA 4O2EB 4KHTH 4XCCH 2R4RH 1RHFA 2AXWA 3IFOB 2GIXA 4G6KH 2Q8AL 3RKDD 3TBYA 4UMGA 2PNDA 4H5SB 2X9XA 4FA8A 4PP2B 5A2FA 4N1CA 3WS3B 4OCRH 2V3FA 5EO0B 1B2WL 2XTJD 4GRLB 1VFAA 3D1MC 2BY0A 3E3QE 3PV6A 2VSMB 3C6LD 2YD0A 4I48A 2EYSB 4LLAA 1J5HA 4NKMB 3BEVA 5LBGA 3VXPB 1N0LB 1AVAA 3DIFB 3DSFH 2X44D 3KLHC 1BFOB 2YAQA 1IBGH 2FEEL 5FHAH 3KWXA 3MZGB 1USQA 4F92B 4PJAE 4PB0H 3KW7A 5EBMA 3E9UA 3WXWL 2ARJB 1I1AB 3F7YB 3AWFA 5DFWH 1MCQA 3BVWA 1ZKAA 4XRCA 2VJ8A 3OMIB 1FNHA 1I7RB 2F1BA 3CFTA 4HIJB 3VH8G 4LLMB 1D6EA 2UXTA 1FSKC 3DC0A 2WAQA 3IFNH 5C0CB 1ZSHA 2NY4D 1EVUA 5LN4A 3RX7A 3EYOB 3OR7B 3TO2B 4Y1SA 4UM9D 4JFWA 3EZJB 1S7UB 4QXWA 2VXQA 5CINH 1K2DB 5IESH 1OP9A 3TJEL 4FP8L 4B9PA 5LGHL 3QORC 4JDTH 3O3DA 3TJHD 4JFHE 5ICZA 1TFPA 2YFNA 4OFYD 3FSVA 2C9XA 1OAUL 1OB1A 1IX2A 5FW8A 1JXDA 4PJGA 5ANME 4MCMA 3VI3B 1WFMA 2UYLB 3D6GA 4LSVH 4AGQA 4LDEB 1LQBC 4Z0XB 4A2GA 4RISL 2UV3A 3EJZD 3N55A 2FT8A 2IFGA 5CZVL 1DCEA 1EWHA 4JKPH 4WUKH 2XQ0A 5J6SA 4LSPH 2DQFA 1VA9A 3RE0A 4FQXD 4QGYA 3FOMB 1V54B 1XGPB 1EK3A 2AV1B 3UROR 1YRKA 1A1MA 5EV7A 2AK4A 1AZVA 4BFBD 3REWB 4JJ5B 1BVNP 1QYGH 5DR5L 1RZFH 5K59E 4CL7A 2EDRA 4L1BA 5DJDB 4J23A 3EGSA 3O2DA 3KDPB 4JFVA 1OW0C 1S7RA 1BW8A 5DMGC 2WXKA 3UO8B 1K8DA 5I18L 3NFNB 1QTYT 1YEHL 1OAUH 3NRQA 4QXVA 1QFPA 2X9WA 3B2XA 3DDFA 5AYTA 4KRPB 1WBXB 3FHEA 4IK6A 3G08A 4ADIA 3U9PH 3KJ4C 3CHOA 3GMNA 2VLLB 1ZS8B 3C6LA 3H3KA 4RA0C 2VR4A 4ZX5A 5FM8A 4DPBX 3CLFH 2CNYA 3PF2A 2FX8H 1A9BB 5F1SA 3L4ZA 2FT6A 2X6BA 4N26A 4NQCB 4F7CA 4LLUA 3CHXA 5JPNB 1OCCB 3OKOA 4FHKA 5JIIA 4JW3A 3KBHE 5GS2D 1RZFL 4LIQH 2PMZA 3DVGB 4JG9A 1AI1L 1OGPA 1S3KH 4P46D 2GYSA 4PYGA 2Q7YB 1LL1A 1KXQE 2AQ1A 1M71A 4UIKH 3RWJA 3DURA 2WZAA 4L37B 2BVPB 1CDYA 2H8PB 3QFJA 3OB8A 1IKNA 4L8DA 5F7EH 5EULV 1KULA 3KWWA 5CN1A 2HMIC 3MVSA 3KXFA 1BVNT 1AGEA 2VH5L 1QSED 4Z77B 1UJ3C 3EO1A 3ESNA 3L4UA 5DK3A 1QEWA 5D5MA 3FYEB 2X4OA 4AM0Q 1NEZG 4YFEA 1H15A 1VESA 1ANUA 3QQ9D 5JPMA 4UDTB 1WWAX 1SEQL 4DW2L 4AYBA 1PZ2A 3LPFA 2BM3A 1RSYA 3HR6A 4ZT1A 2AXFA 1BG1A 5BRQA 1U91A 3ABKB 3NSFA 3LRSA 4GAJH 4JQVC 4W4OA 5CU9A 5K9QI 4NQXB 4GQRA 5T1LB 3HAEB 4JFEA 4PHZA 1JFQL 4R90L 4HS3B 4G42B 1SOKA 5HYSB 1AI1H 3CFJA 3ULSB 5FO8B 2Z9TA 3ZTJG 2VTFA 4XCEA 4YC2C 5GGVY 2AKRA 5I6XC 2CKNA 1J1OL 2Y7QB 3ZHFA 4B9GA 3JBG7 4P2CG 2WBJB 4NPYB 4TV3A 1VACA 5DD6B 3SEPA 2XTLA 3UPRA 4Z5RB 1J1XL 2Z35A 1G1OA 3B7TA 5F7BA 5K39A 4PGJA 5TE4H 1QG3A 1HT6A 4UAOC 4KBPA 4U05A 5C08A 1S2EA 1UENA 2ZNWA 5GGTH 4QHNB 3KPOB 4G11A 1BZDA 4MZRA 3BX7C 2FATH 1OP4A 4I9WD 3GTLA 1AE6L 3GWJA 2JV6A 2PXYC 3FTYA 4EBQL 1KPUA 1CDBA 3VXUA 4CMMB 1XH3A 3IE4A 1U8CA 2WJ7A 4JRXA 4J3XA 5F6HI 3ZZQA 4ZD3L 5HHQB 3ULVD 3K7UA 2EXYD 4RA3A 3CVHL 1T1ZB 3EJYD 4NWUL 5J11B 4X5XA 2AQPA 3B2MA 3MRNB 3ZL2A 4ZS7H 3S96B 1IUZA 2E4FA 4GINA 4HJGB 4Y4KC 1GOGA 3PGCB 4MX7A 3Q5YA 4WY7L 3ARPA 4OM0L 5D1ZI 1KGCD 5EO0A 4ANWA 4DZ8A 6TAAA 2CDFB 3TFKD 2GAZA 3FQXB 3ME0B 1OCWL 1TXKA 1G9ML 2J6WA 1JL8A 2ZUWA 4QRSB 3IF1A 1MAMH 4WO4B 4EDXA 2W5PA 1MREL 1M57B 4LSVL 3UFIA 4J4PA 4KJQD 3H2PA 5D1ZC 2Z64C 3O2DL 4XCYB 4P5MB 5TK2A 4KXZI 3RHWF 1IFRA 4FQXB 5FUZH 3HJEA 2IGFL 2JNZA 3R06B 3CZSA 1BVOA 1XGQA 3KGTA 5ACZB 4N2IA 1TZIB 2DKSA 3M8OL 1ORQB 3ZT5A 3FQRB 1REIA 2MSPA 3GHBL 5DYOB 4EE2A 5E9DA 2B08A 3BAIA 2FLMA 1MFCL 2BW5A 3TZVC 1KPRB 5T1LA 1TQCC 1OE2A 3UERA 3V2AR 2EDLA 2ZG3A 1FGVH 1V7NH 2E86A 4ALAH 3X14A 2I60H 4NO3A 5FV1L 3V8OA 2IGTA 5D9SB 5FTNA 1KYOJ 1F90L 3CSYA 5C08E 5MENB 3DOIA 1R3IH 1ZWIB 4YFLI 1NC2B 2ADYA 3NCXA 4OLWH 5IWLA 4BIKA 3CHRA 3BMWA 3LV3B 4PJEF 4N24A 4OGZA 4ZO6A 5MENE 1D9KB 1T0MA 3BH4A 1UCTA 5SX4H 3GPEA 3SDDA 1IO4C 1NCAL 3UDWC 4U1IA 5DRXA 3EJUA 2D7OA 2QBWA 1SBBA 1MY5A 1UG9A 1AHMA 1N4XH 3NFNA 2A83A 3CFUA 1NFDB 5E5RB 5DZLA 3HS9A 4WUUA 2E9JA 5KVGL 5EZJA 4NO2B 2QDWA 3VDCA 5LGJA 2ORBH 3RTLA 5IG7A 2FJFB 5T33H 1IBDA 4QRTB 5TQ0L 3TCTA 4RFEB 3OKNA 5FGCE 1HE8A 1BQHB 2DB8A 2W0PA 1A6ZA 3HN3A 2ARJA 4UZUA 3SZKC 5D7SL 5C0ND 1NC4A 4GRWB 2FZ3B 3HG3A 1A9BA 4ANUA 5IV2B 2BERA 2HRHA 5ABZA 5I6LA 3CTTA 4D7BA 2J1XA 3FFDA 3VM5A 2CIKB 3R19A 1JHLL 2VMJA 4C56E 2AV7B 1RV6X 4PJ5A 2FL5A 2N3JA 5GRVL 3SJVA 3FTGA 3VSUA 4JFHD 4AM0B 1J11A 1NCBH 2BS71 1VFAB 2BIHA 2WZ5A 4M29A 1WE5A 2YBRA 3ZDWA 1D6VL 1O6VA 1WGVA 1HAUA 4K15A 2DF3A 2FEDC 4BM7A 1QW8A 4JN2A 1DVSA 3TFBA 1N4XL 3H9SE 4P2YA 3QR2A 3HNVH 2BY3A 4LL9A 1WA2X 2DH2A 1IAOA 2H47C 2WVTA 3L13A 1EDYA 3OF6A 1HX0A 3R8BB 3TEWA 3IJYA 1UXWA 3MRPB 1OD7A 4AL8C 2ZKHH 3EBIA 2QSTA 4OJEH 1N64H 3H6AA 3OGOE 1B0RB 1NPUA 2EINB 4B27A 1JHTA 2PCFA 4Y5VA 4PTTA 4GAYB 1IW7D 2B0SL 4MWFA 4EF3A 3IFPB 1K9TA 4ONHB 3UBXA 1D6EB 4OZFG 1GY1A 2VABA 2OMZA 5J1AB 1GJIA 2OK0H 4Y2OB 1C12A 1NBYB 1D7CA 1KJVB 5I74C 3RI5F 3EJJX 2XA3A 5IGXH 3L3HA 1YPZB 1DDHA 3DO4A 4WSKA 4DMRA 1VGKB 1OPGH 4RX4A 5MENA 2CALA 3T9WA 2V3VA 3MACH 4TVPH 1SXBA 1TJMA 3ZK0A 1IBFA 1FH5L 3VG9B 3BH9B 3NK4A 2OMXA 4KI5F 1ROWA 2V8LA 3QAZC 3UTZB 4G6MH 1CWVA 5DWPA 1FYTE 5AW7B 4AGNA 3I74A 1NMAH 4MAYD 5AALA 1UURA 4LSQH 1TIUA 4KH2A 3ARDB 3LEYH 1I1CA 5JQ6L 1IRAY 1FYTB 4ZOBA 4L8DB 5LWYL 3RUGF 1R3KA 3VD9A 2V5YA 4OCLC 2V9RA 5FW7A 5D4IA 1YQVL 3CFCH 2APTA 2O6CA 1CLOL 1RIUL 2CIIB 2KZBA 4F7MA 4S1DC 3V0WL 5JOEA 1NANI 1S7WB 1SYVA 1O5PA 1ZT4B 2FBJL 5K9JH 1DJWA 3OLIA 2JSFA 3KYOB 3F7RA 3GMMB 3SE4C 2WKGA 3OKOB 4FQJH 2XQBL 3P4OB 2WNGA 4Z0BH 2L7EA 4F7CB 1KCVH 2NVXA 2EE6A 1HVXA 3K2KA 5BS0D 3SE8L 4K7PH 4K2UH 1C5BL 1Q0YH 4EN3B 1ACXA 1UQSA 3VSTA 4F7TA 4BZ2L 3O3BB 5LJYH 1TEYA 2YXMA 3EFOB 3OGCA 2UXVA 3WN5C 4CGTA 5IJVA 3SULA 4G71B 4M7JH 4ODUB 3NPSC 1AHWB 4HYTB 2GK0B 3N85H 2YPKB 4G8AC 3CGTA 1T20A 4PJ9C 5B38G 2NOYA 2JH2A 3LNFA 2Y2WA 5TF1L 3H1ZA 2VXSH 1PLGH 4G3YL 3STZB 4UOW1 5CXPA 3VG0H 5IEKA 3IPEA 5AG8A 3S37X 4N0UA 3NIDF 1O7DE 4NAMA 2OULB 4Q7DA 4WV1A 4Y89A 1EHLL 4B53A 1OGAD 1C5DA 4LF3A 4JPVH 2HJKB 2A5UA 5KS9A 5I30L 4HOZA 3IVKA 3LY6A 3CDGA 4WTZG 3ILQC 2ARJQ 1DUZA 3D51A 4NUGL 4S0SD 2K4WA 1I8IA 4GB9A 1PKQE 1FH5H 4TVPE 4WZ9A 5JYLA 4YHYB 3VDBA 4ODHH 5K5YA 2KLSA 4E9YA 2VN6A 3AU1A 3O6MH 1FG9C 1YQ2A 1FDOA 2FH8A 4ZXBD 5LDUA 1EERB 1TZ8A 1G9EA 1QA9A 2LLLA 3K71A 3BUTA 4NRXB 2OW7A 5CBAB 3O6LL 3S88H 2J8OA 1QHQA 1QI4A 1M9WA 2CHNA 4W6WB 3V0VA 1Z32X 2ZXWB 3T1FB 4XBEL 1MEXL 3SUMA 3MCYA 1WCQA 4FJYA 4ZW7A 1KDIA 2KH2B 4BQ9A 3BMVA 3KR3H 5HYJE 2JJTA 1P4BH 2JELL 3MV7B 3TBWA 3K74B 4YXKH 4EUPA 1PSKH 4HUXA 1JRHI 3QNXA 2J73A 4NNYB 2QL1A 3D39A 3OJVC 4IJ3B 3UP1A 1FFRA 4M56A 2WUBH 1JPTL 1KXHA 5GGQH 1NBZA 4ZTOH 3BVTA 5DS8B 4UT9L 4WK2B 1UM4L 4J3OD 1MHHA 5EZOL 2AXJA 2NYYD 5DVOA 3BKYL 5FYJL 5IBTH 1GPOH 1CYGA 4HGKC 2PKDA 2ZAIA 2FDBP 5D1XE 3NABH 2OMYA 4WHTB 2EVFA 1XBRA 2K7QA 4PWFA 1S9KC 1MWAA 3A6CH 2VISB 2FJHA 3PWLB 1T1XA 3C2AL 2F53A 2NNAB 4PP1D 4XWOC 1QI5A 4XPAL 2VDOL 4AM0A 2QHLA 1BAFL 1QLEB 4FFZL 4ODTL 3ETSA 4UT7L 3NIGB 2QSCH 1J8HA 4ZW5A 1KPVB 3HU2A 1IQWH 4KDIA 1XT5A 4FQLL 5E4IA 4Y16A 5EEUA 3VFWA 5DA4A 1XIWD 3ZDYE 5D7LA 1CB4A 5HHQA 3HZVA 1DSWA 3A4EA 4DN4H 3ETBJ 1YDPA 5CIPB 2BCKB 2B63A 4L0ZA 4Q9QH 1BPVA 2D7NA 3IJ8A 4K7FA 3AWGA 2HH0L 1AR1D 3K5RA 4HUUA 3VGBA 2VN3A 4GSRA 4WUUB 4Z3TA 3UTPE 3L95A 4KDTA 1L3WA 1QHPA 2E46A 3PXHA 4OB5H 3U7YL 3DX9B 4P5RA 1MI5E 4XPAH 1FYTD 4L5FH 3DIDA 3ZQWA 4DP7X 3I85A 4BWUA 5HYIA 2V33A 1D5IL 5TJWK 1YY8A 5DD3H 2WQAA 3I3BA 1KLGA 4G6JH 1BIIA 3H0TB 1CFQA 2W0FA 3C6LC 3LMJH 1RURL 3RDTD 3THMH 4EIGB 5C7XL 1CURA 1XGTB 4J39A 2EH8H 2C9SA 5DMKA 2H5UA 4WI0A 1S7RB 1KQFA 1R3IL 3WEOA 1C7TA 1J0KA 1WZ1H 4OLYH 5EZJB 2BMKB 2RMNA 1IGCH 4X5WA 5J3HD 4W4OC 4R7XA 1Z5HA 1KCRH 3IJ9A 3TN0A 4HCRH 5A6IA 4XI5D 5AEAA 3V4PB 1W9XA 4OBSA 2EIJB 1LK3H 2AEQH 3KPSD 4X42A 3S37L 2O61B 2WQSA 4MA1B 1KLUB 4A66A 2ID5A 4OBRA 4PEEA 1TITA 1TTAA 3PABB 2KI6A 3BEWB 5FIEA 3PL6C 2HLAA 5IHZA 1G4RA 1MWAH 3BWAB 1TCRA 3L5JA 4M48L 4U6YB 3SKNA 4PJFA 1CFNA 5E8NB 2FJHB 2VISA 5AVRB 5I19L 5DLMH 5C07B 4UT7H 1ZT1A 5D7SH 3MUZ1 4TUJB 1WA1X 3C09B 1YPZA 5J1TC 1OE3A 1Y1WA 1ZLSL 4G82A 4MXWL 3H42L 1BF2A 3OL2A 3WFEH 1KBGH 1WRFA 1KJMB 1WEJL 3T3PB 3CDFA 4JM4H 2W94A 3BRFA 2MTPA 1KY6A 12E8L 1ITCA 3GKZA 3GSUA 5IQNA 1KCRL 5LAXA 1WG3A 3VWJB 5HYJB 5LNDA 2CHDA 2NQCA 5GRUH 2GBTA 4MA3A 2OMVA 3D85D 3HNTH 4K8RH 4XMPH 1GOFA 1IV8A 2BC4A 4V2CB 4XP5H 5EIIA 2OMWB 1O6SB 2H26A 4LKXB 2ILLA 1ZA3A 3GHPA 4PJ8D 5GRJL 5BS0A 5AW2B 4I0PC 3FT2A 4G9FE 1QLRB 1OIOA 2W95A 4BK5C 4XNMA 2YR3A 1NCUA 1UGNA 3PWUB 3U7YH 4MCNA 1L9RA 4DNLA 1FNSH 2WP3T 3CFDA 4YEFA 2GAZB 2W9DL 3ME0A 4JM2A 3FO1B 1GGTA 3GBEA 4W6YB 4I3GA 5IROC 5LAPA 2OL3L 1ZLWH 2VSDA 3CPUA 5FR3A 4F15B 2C3VA 4K71B 3JV5A 2E2HA 1BWWA 1H3GA 1VADB 1M05A 2HPOA 4N90E 1WEJH 2CK2A 1O9ZA 3ZE0B 4Y2LA 3LQZB 4JHWH 2FIKA 4DEWA 3QQNA 3GI8L 2VDNH 4LOUC 4FLRA 2WZPA 4NAJA 1WZLA 3IDMA 1WWCA 3DPDA 3EJCA 4Y2NA 2ZX9A 4BUGA 1O5DT 1F3DH 3BP5B 3SBQA 5AW1B 2O4EA 2D0HA 2XN9D 3VO0A 1FV1B 3MLTA 4RAVB 3QZWB 4X7EC 1MHCB 2KUTA 5F3FA 3KYNB 1TUPA 3BUIA 4UV7L 3QJXA 3G5ZB 3ZO0A 1HHHB 1SFOA 1YDPB 5T1LD 3SO5A 4WFGD 4O02L 4U1GC 4GG6A 1A9VA 4NBYB 1MFNA 3BISA 1JD7A 3QWRA 3P4LA 2FK9A 1OAKH 1HYSD 2DEWX 1ZHBA 4QXTA 4F15C 3O9WA 1J5DA 3X1GA 4A6YA 4CJ1A 3CVDA 1CGXA 4LRIC 2XZQL 2EIMB 3FPYA 3DVNA 4B3VA 2P48B 2NAPA 2ZWNA 3MXWH 3U7WL 1XCWA 5DYGA 2FBJH 5H2BA 1JYNA 5MEPA 3IETA 4XP9L 4Z18A 5BZXA 1HZHH 4X0KA 4LASL 3SGJC 3EYFB 2X05A 2E6JA 1CZ4A 1P5VB 5GRYA 1RK7A 1TENA 1N2RB 1U8JB 4KRNA 3K71B 3QQ9C 1V7ML 1BIIB 4NRYB 2JK5B 1CZ8L 2F61A 1BGXH 2JF1A 3KPTA 3OAWA 1OLLA 2VRAA 4XMPL 3WTXA 1QZNA 5F7KC 1JGDB 1YEKL 3KS0J 2VDQH 1FH2A 2IOIA 1XGQB 3MR9B 4PJ5D 5DJCA 4OD1L 4PJEB 1JHTB 1ZXKA 2PCFB 5BRZD 5ES4B 2YUXA 4I1RA 5DK0B 2MCPL 2ETWA 2DWTA 1WAEA 3CQPA 2DQCL 4HT1H 2HJKA 4X8JB 3RWEB 4L3EE 5DZOA 3UTTA 1CK0L 5A1AA 2ALWA 5F21B 3G7TA 2OAAA 3QPQD 4U4IA 1USZA 4QWWC 4FNPA 4YUEH 3KJ6L 4IRZL 4JBSA 4X8CA 2CJUH 1MRCH 2JJUA 4BFRA 8FABB 2Y6TE 2H3KA 5J6GA 4N8CH 4WO4D 2WBWB 4G8IB 2P8MB 3N1MC 2P80A 1TKWB 1FO0A 3RWDA 3SQOH 1WGOA 5HHPA 2AEQL 1JTOA 1UACL 2X28A 3S37H 4KK5C 1VKXA 4KFMA 1A1OA 3S5YA 1Z1WA 1S7SA 4L3CB 1IBYA 4OM1L 1FGNL 2K9UA 5KOMC 2Y24A 4PM1A 3LAFA 3MLSH 4ZMYA 3PAVA 4KRMB 3L3OA 2EILB 1QOKA 1TVHB 2EXYC 2NSMA 3SDCA 3HS0B 3KWUA 4HJSA 3T3MB 3HN8A 4YHLH 4K3GA 3H9HA 4PJIA 2VGLM 3BIBX 3VGFA 3TONA 3L6FA 5B8CA 1Y1DA 5EORH 4PG9B 4TRPL 3EOYG 2XWJA 1W72L 1ZA3B 2B20A 2E7CA 1L0PA 1OAXH 2EKSB 2FO4B 3EDEA 4FQCH 3V4PH 2N0KA 4OLZL 2UZIL 4U7MA 3D3VA 5E9DD 3TFKC 2B9AA 2HA1A 2N1KA 4B9CA 2ODIA 3QDGA 1Q9OA 3HZMA 2PYEA 4G59C 5GRXG 3TASA 1V3KA 1HL8A 3GEWB 3MTXA 4JREC 2Q1EA 3IMBA 3MCLL 4OGAC 1QNZH 4B7LA 4HXBH 5DHEA 3ILDA 4A37A 4FXKA 4N86A 5JHDE 3ARXA 4JG1L 3VFUB 1CPUA 2CAKA 4ZUSA 2XX1A 3GBMH 3K4ZA 2QQNH 2CDEA 1LLAA 3WD5L 3ZIYA 3B3IA 5FTJA 4KKNA 1L6PA 2EUXA 3OD3A 4AGLA 4MB3A 5DEFA 3CPLB 1J0ZA 3DI2B 4C54A 3ZYJA 5F0MB 2I9LB 3PDGA 2X4RB 3B9EA 5E4EB 3FN9A 3RNKA 5GS3A 3QRBA 1PZ3A 1W0WA 3BYTA 4NENA 2WYIA 5BPPA 2P24A 1IM9A 4YDVB 4E68A 4DTGH 4G8FA 2X4SA 1U41A 43C9B 1TCRB 4LLQA 1OTUC 4IBWA 5JOFB 1N8ZB 5ISZA 2F58H 5E1IA 5CNHA 4R8WH 3BP4B 1JHKL 2F1AA 3KPNA 3T6QC 5T1DL 1KOAA 1Y5IA 2E9GA 4GG6B 3CFKA 1J88A 1J0IA 4JREB 2A0LD 1OTTC 2UWEA 1JNLH 4TULL 3L4CA 1FO0H 2QQNL 1XL4A 5T1KD 3QJOA 1MHEA 3LPOA 1ED3A 1SY6L 3L3DA 4AC2A 3JUZA 4OKVA 1RMFL 3KCPA 5IEHA 1LEIB 2YD9A 1KGUA 4IOIA 1KLGB 1KGYE 3T0BA 2HVBA 4KKLD 4S11A 5MEPB 1EBAA 3ARWA 4E9WA 2YD2A 1C1EL 3H7LA 5MHSE 3ULUF 1U3HB 5DD3L 4HWEL 3SKJL 4NNPL 5DD1L 2IWGA 5KS9B 3IVKB 4I5BB 1RJLA 3RUGE 4ELKB 2ZUUA 3ARGC 2DMKA 2FCBA 4N2DA 1VERA 3NMEA 3QUYC 3QUXC 5DD5H 3V5KB 3VRLE 4B9ZA 2X9YA 1SVCP 4LAQH 1YAZA 2PYEE 3ALWA 4PG9A 4JFED 1YLBB 4FDWA 3IE9A 5C6WH 1N3NB 1AO7B 2CWRA 3U0PB 5FO7B 4GXVH 5IW1B 3V4UH 5J06A 1OGTB 2OZ4A 4NKQB 2DBLH 1MNUL 1OARH 1W91A 4EEEA 4KNSA 4DZ8B 2QVFB 3F58H 3NRPA 5CMAB 1G7MA 2X4QB 5DHXB 3T0XA 4CC4C 2RB8A 4X2UA 4JGNA 5KVMC 1SOSA 5BVPH 1RH8A 3K5SA 1JZGA 4N8VG 3WUWA 4DGYL 4HG4J 1XGPA 1N59B 4XBGA 4I7ZC 4LVOB 2KZ1B 2V2TB 4G80A 2XFXB 3PLXB 1ZOXA 2YQ3A 1CD9B 5DD1H 4NLAA 3GSOA 1U8KA 3EYQD 3QFJD 5J57B 2I7OA 4GIAA 3KWVA 4V33A 1UM6L 3HVDA 5AOMA 2NY3C 3VWKA 5FYKE 1HILB 1UWEH 3BN3B 3OR6B 2APXA 2DKUA 5EDXA 4HSCX 3GXMA 3BPO