3D30A

Structure of an expansin like protein from bacillus subtilis at 1.9a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
b'MAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin like protein
publication title Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Peptidoglycan-binding protein
total genus 52
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3d30A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3d30A02
1WHPA 4JCWA 3X2PA 2GAEA 3SUJA 2VXQA 2BH0A 1BMWA 2HCZX 2KQAA 2ENGA 2PI8A 4FG2A 3X2LA 3X2GA 4AVRA 3SULA 1OA9A 4L48A 4JJOA 3X2MA 1WHOA 3FT9A 5GM9A 2PNWA 3FT1A 2G6GA 3ENGA 3X2JA 1BW3A 5GLXA 5GLYA 3X2HA 3X2IA 3X2NA 4JP7A 3SUKA 1OA7A 3X2KA 3SUMA 3D30A 4JS7A 4ZM7A 1WC2A 4ENGA 4JP6A 3CZBA 2JNZA 1L8FA 2AE0X 2PICA 1BW4A 2G5DA 1N10A 5H4UA 3X2OA 4FFTA 2PJJA 4FG4A 4FERA 3M3GA 1HD5A
chains in the Genus database with same CATH superfamily
1KB5L 4RFOL 1INQA 1MHEA 2VLLA 4JKWA 5HHXH 4YO0B 3VGAB 2WUBH 5E9AA 3GIVA 2IPUG 1GC1C 3G5ZA 3LN5B 5E5MA 5HI4D 5JHMA 1NINA 1ASOA 1SEBB 1D5MA 4J28A 4Z7OF 3QRBA 1Y1VA 4Z0XA 4YO0A 4LAQH 1B9ZA 1GZPA 3BDYH 4OGYH 3IM1A 3GSOA 4M5ZL 3SPCA 4W4OA 5FA3A 3ECBA 5TE4H 4K5MA 4MAZA 5KYYA 3PGFH 4LQ1A 2UY6A 4A2HA 3QQNA 1UM4L 4N1EA 4N0UA 2AEPL 3WNOA 1AMXA 1B6UA 1ZJBA 1WWCA 5I1CL 2CGRH 4HCRA 3UTPE 1E3ZA 5EU3A 1S3SA 2H0EA 5GLYA 2FJFB 3IJEA 4KBPA 4NP9A 4JO1H 3UMTA 2CLRB 3V0IA 2UVFA 3M7OA 4HS6B 1F3DH 2DQGL 2DIBA 3ULVH 4LMQI 2F5AL 1UOKA 1JGIA 2FJFA 4X5XB 3VWKA 4NFBA 3BT0A 4JANA 4FMKA 4HS6A 4RH4A 5I71C 2GSIB 3CFEB 5I8KL 1QWNA 1MHCA 1G7QB 3PHAA 3SEPA 4OTXH 3MA9L 2XJKA 1ZOXA 3MKGA 4WI0A 2FT8A 4AYDC 3CFEA 2YUZA 4BFIB 1XGYH 4A6YH 4WAFA 3O9WC 4YBQC 1U8KA 2P46B 4YUEL 3K91A 4DQAA 1AC6A 1AI1H 3HAEB 5JHDA 4NQEE 5D7KE 1QRKA 4ZX3A 4L1TA 3DUUA 2Y6SD 3IU4H 1HJBC 3GLZA 2DTML 4WI5A 4M02A 5IQ9A 1DBKL 5H4UA 3TT3H 1AGFB 2E86A 1X9QA 2ZUUA 3WD5H 3CMOH 1LEKB 2NY6C 5DA4A 1IARB 4WSJA 3ZE2F 5JDSA 3GZOA 4U1LA 1GW6A 3A5VA 4IEFB 5GZOC 2MCMA 1X5HA 3U30C 1UOLA 5C0AA 3WFDL 3T1WA 2JQMA 5IGXL 1CCZA 4NAQA 1BLNB 2HKHL 3OKDB 3KYMA 3HTLX 4FQQB 3TV3L 4RAVA 3IGKA 2I5YL 3LN9A 3OKMB 5C0IA 3DDFA 4H88L 1BQKA 4Q7DA 4CA4A 4BWTA 3BLKA 1S7RB 1RCYA 5AENA 4NFCA 2ZWSA 3GSQA 4GYBA 1H19A 5DJ2B 1J8KA 1NKOA 1RMFH 3BX7C 4PU2A 2NQCA 1AHMA 3GTOA 2D7MA 3TNMB 1YAZA 3CQFA 2X70A 1MZZA 2WAQA 3FQ1A 3JUZA 2EDXA 5DJ2A 4I18C 4RIRA 4DKFL 2VE6B 1UM5L 5IG7A 2K6ZA 3V4VL 2LFEA 3NCYP 4KTEL 5H4YA 3SDDB 3T8MA 3DUHA 1RK7A 4OF6A 1B88A 1C5BH 1JPST 3KGRA 3P40A 4WW2C 1AD9A 4ATTA 4UQBA 4WUUD 4NERA 3MYJA 1S7QB 1UCBH 4Y1SA 1MI5B 3GUTA 3OVUB 4JFFE 2VDRH 2J8HA 3W39B 1PQEA 3EADA 1KLUA 4Q14A 3BMWA 2G2RB 1OEZW 3IXTB 5K9OA 4QD2E 2HUEA 5GS1B 1UH3A 1CFVH 5SWSB 5FTJA 1BXUA 2P26A 1BZ7B 3HFML 1C9SA 1P4UA 3IXTA 2X88A 1FCCA 5GS1A 3WTVA 3O6MH 3ESUF 3HC0A 2Q5BA 3CFCH 1NAMH 5E24E 4GG6A 1IM9A 4JFVA 2AK1H 4PREA 3B7YA 3GUFA 4XAKD 3FB8A 4NUGL 3ZK0A 1SJVA 1AQKL 3UFIA 3O9WD 5F6IB 5IFAL 4HALA 1IIIA 1U4FA 3FRUB 4S1QH 2FQFA 3P0GB 5EZOH 4YXKH 1MQKL 2CHXA 2I69A 1URZA 2NCMA 5B4MD 1TQCC 4ZPVA 1R3HA 4HIJB 1M53A 4DP6X 2A83A 1MJJA 2EDRA 1WC2A 4MNQA 5G4OA 1RJCA 2OXGB 4APQA 4XH2A 5HGHA 4XMLH 4TOYH 3HUJB 3PCYA 5IVXF 3P69A 4HIJA 5LBSL 4YH6A 4EUPB 3AU0A 5I75C 1XFPA 2Z31C 3O2DH 3EOTL 4Y5VB 5GZOD 3ZMRA 3MBEB 3FQYA 4KI5D 2FSEB 3OHMB 3GTPA 3NZ8A 1ZV5A 5K9JL 3HC2A 2VITA 5GGSA 4XVUC 3VVVA 4Y5VA 5IIEA 2QQKH 2VZTA 5BQDA 2OAAA 1S7WB 3A67L 1CG9B 1B0RA 3JBG7 4QI3A 5CEZH 4P5MB 4ELKA 3GMPB 4IMLB 3I75A 4YGVA 5LQBL 1N4XH 1E9QA 2Q8AH 5ALBH 5KAQF 2XXMB 5C0CB 5JHLA 1BIIA 3QZLA 4PLNC 3RX8A 2YRZA 1BCIA 1D5IL 4XHJD 4IMLA 5T1MA 3F8UB 4JO4L 5DJDA 4WU7A 2BINA 3L5IA 3WMQA 1HEZB 1W9XA 4LEEA 4GXUM 2IDTA 3DXAA 1TVBB 2VT0A 3SDXE 4BSJA 2X28A 1JZFA 4JKNA 1GC1L 1HEZA 1AGBA 3BFOA 3KPRA 5DZJA 4D0DA 4JPIA 1HL8A 4ZFFA 5ADPH 1ZVSB 1BJ1J 1TVBA 1QWHA 4LPCA 5CZXC 4YEEA 4X5LA 5C0JA 5J5EA 5DVPA 4DP8X 5L4MA 4PJIE 4OQTH 1ZVSA 3ARBB 2HLFC 1GKEA 3QAZB 4D8PA 3V6FA 3S8GB 2FD6L 4LIQE 1XGQA 5BVJB 3HU1A 3EDDA 3H3KA 1Q1JL 4WV1C 4Y4KB 3D9AH 5DD0L 1J1PH 2ADGB 4GRWH 2XVKA 3N44B 1MDTA 1OAQH 1P7KB 3L1EA 3NQIA 3U4BH 2XQBL 3ARBA 4HS8L 5TGBA 2LLNA 3B2UC 3MLWH 3ARDD 1KWKA 2JTDA 4GQRA 4Z5RA 5A6MA 2O93L 3WDJA 1KCRH 1OZTG 4N8CL 3HPLB 3NH7H 4NJ9L 5AW9B 2WZ5A 3FT3B 2QZQA 1RH8A 2QT6A 3FMGL 1FZMA 5CILH 3VMNA 5I1JH 2R7EB 4JPWL 2OK0H 3HPLA 1R3KB 2Q0ZX 4PWHA 5E4EB 2EYRA 1OK8A 4NZTH 4F8OA 3LTVA 4RX4A 2XN2A 4Z3IA 2QZ5A 4K9EL 4OUOA 2NY0C 4AVRA 1I8LC 3HAEH 4GFXA 3QUML 3ROOB 3H42H 4K73A 4QRTA 2IPTH 2G3MA 3QORA 3X2HA 2QQQA 5IK3B 3O6FA 4NQXB 2Y36H 5KSAD 2Y5EA 3UP6A 2Z31D 2R0WH 3H9SB 3QEQE 2F61A 2JNZA 4QXTA 1CU4H 4K07A 4P07A 1SJHB 4PLKC 5IK3A 3TEUA 4DO5A 3ZRSA 1IGFH 3G6AB 1YMMA 3N85L 4R96B 4CU8A 2GIMA 4PIRF 3D05A 1O0VA 3CPLA 3WCYA 2BHYA 5GJTH 2YRPA 1AIFA 4R96A 4ZNEA 1DHKA 4K3EH 4N0RA 4PW3A 1ASQA 4X0KB 5KVMC 1BLIA 1E30A 4S2SB 4S11A 1HHGA 4R0LA 1AHKA 4LPVA 4F8NA 3QARA 4B9YA 2WWOA 1FO0H 4AT6B 1RPUA 3CFBB 1TJIH 1SLUA 3WFZA 3MLVL 5BS0B 3AQDA 3ARQA 3G08A 3H6JA 2XYBA 5DRNB 2N0KA 4KHXH 4AT6A 2Q3XA 1CLZH 2BWDA 2G0LA 2NXYD 3S4SG 5GGVH 4W70A 2XXFA 4A7TA 5DRNA 3U2IA 1ID5I 2F58L 2IBZY 1KTJA 2I60H 3HCVA 5KBLA 1QTYT 5CZXD 1D7BA 1RU9H 3E6HB 4XNUH 4TNVK 4GIPD 3MJ7B 3TC9A 3IN2A 3E2HC 1G7JA 1S7XA 1MVUA 2CZNA 2HLFD 4NZDA 1CI3M 1A6TB 3IDMB 5D7LB 5E1HB 1AW8B 4LL1A 3E6HA 1G8JA 2UVEA 5I16A 3D39A 1BZ9A 4GMSH 1KB9J 1KELH 3ESVF 4Z3EA 5ACZA 4ZSOE 3O0RH 3QFJE 4QRRE 1JHTB 1SRDA 4UILL 4Y16B 2XPYA 3SGJC 5JLZB 2ENYA 4N25A 4KHTH 5IMKA 3S5YA 4PD4K 3LXBA 2XTJB 1OD9A 2Q8BH 1DEEB 2H5UA 1JHTA 2IVFC 5I15L 1YNLH 1NFDF 2FNWA 5DQDL 3B7SA 2C1PB 5IFHL 5FYLD 2OMTA 1TFPA 1G1KA 1JGVH 4LPTA 2PW2B 2FIKA 2BM3A 3W5MA 3GJFA 4ETQB 2NY0D 5DEFA 2JJTC 3QQ7A 2VDOB 3BUTA 3QXWA 4G6MH 1YQ2A 1P4BH 4XNMA 3AWGA 4DTGL 1R4XA 4R26L 3QCVL 5LNGA 2CUHA 3PQYD 3L1OL 4XN4A 2J5LC 1QHPA 3QHTC 4X80H 4OLEA 3HB3D 2GJZB 3U2SA 5DFTA 1L9MA 1NFKA 2WVVA 2VR7A 4EUPH 3WXVL 5EB9A 4PJXB 2ZXEB 5CINH 5FTLA 2IGTA 1PLGL 3DTDA 5E5UB 5AOIA 4UF7C 5HYJE 6FABL 4FJYA 4JHBA 3WUZA 3NIGB 1ICTA 3MLUL 2NRDA 3MLRH 5D93C 1TEYA 3NTCL 5E6ID 3ZYJA 4JDTL 1J18A 5J11B 2W95A 1QBLH 4Y4HC 4O58L 4IU3B 4QOKD 4R97C 4N1HB 4U1SA 3MGAA 1K8DB 3KDMA 4H7VA 4WKXA 2OL3B 3CZLA 1IZKA 1T0NB 3BPCB 1FC2D 1YMHB 5GRYA 2EIKB 3HI5L 3HMXL 2XWTB 3JV4B 1QAWA 2E2HA 4JHWH 2KERA 1A8JH 1MRDL 1RZFL 3QH3B 1EK3A 1T0NA 1WIOA 3GXPA 3OMAB 2C7FA 2NY4B 2QKIB 4HT1H 5J13B 3SE9H 3ISYA 1IAKA 1JNHB 1UQSA 3SSGA 1WC7A 1EAOA 3U46A 4DPBX 2UWEA 2PJHB 1QFUL 1JV5B 4HFUL 4QY8B 1TZGL 5A2CA 4IJ3C 1M6UA 4JQIL 4PRID 1A6WH 1WAAA 5HHMD 4UOZA 4XX1G 3G9AB 2GITA 2E56A 3KL0A 5E00B 4WHTB 4BK5C 4BE5A 3MRNA 4FYSA 4BD4A 1FE8H 3A24A 5L2JA 4Y88A 1ZVHA 2ERJB 4PP1C 3VWJA 5DD3H 5JPNA 1GGIL 1R5IB 3NEOA 3OD3A 4PS4L 3JTSA 3WTTA 3MROB 3IDNA 3TBWA 4RLDA 1R5IA 1X6LA 3N3EA 1PYUB 1MFEL 1QO3B 4DK6A 3VVWA 1JPGA 1ZANH 3MROA 4YHPB 1JGDA 3C5JA 2OFQA 5L6YH 5EIIA 1R24B 5IEHA 3BH4A 4HC1H 3MRHB 3GHBH 1Q4NX 2DI8A 4PWKA 5TE6H 4M7LL 1F1GA 1MLCB 5LCVL 5AVYB 5HTSA 2DL9A 4A55A 3KEHA 3VD3A 5C8JA 3M17B 1LEIB 1AR1B 3PPEA 5FYLL 3QNZB 1TNNA 5EBMA 5GZND 2Y24A 2O1AA 3M17A 1YSOA 1LEIA 5EC1B 5DUML 2DQCL 4D9LL 1BG1A 4JM2F 2ICEC 3GM8A 3QNZA 4X4KA 2BNRA 3NBNA 4FFWC 3TLRA 4TKWA 5C0EA 4FG6D 4FA7B 5DEZA 3HG1D 4GQ9H 3X2QB 4BBWA 2V9TA 2MIZA 3BCFA 4DESA 1SM3H 2PYEA 4EIGB 3ARFB 4WO4D 1SFOA 3B9KA 2X4RA 3BKJL 3O3UN 5KVGL 2O6DA 1JRHL 3CU7A 2DD8L 4HAKA 1GGYA 1XL4A 4M8QB 4XPTL 3O3AA 2UYLA 4M7KL 5KOMC 4FD0A 3KR3L 1BVKA 1K2DA 4HEPA 6CGTA 3A0OA 1KSRA 4LL9A 2VDNL 3KPQB 1JBJA 1P7QD 2NT1A 4CU7A 1ADQH 3VGGA 2WXKA 2VPZA 5CJXA 3UAFA 1MKFA 1U93A 5CZVH 2EDJA 3C6LA 35C8H 1Y6KR 3D8MA 5DQ9B 3QJFB 2AHIA 3QQ8A 3GSNA 2PO6C 5T33H 3EYFA 3NZHH 4LDEB 3X1EA 4YLQT 3VO0A 4F57H 3R06B 4XWGH 1QBML 2OSLB 4F8QA 1HNYA 1KXVC 4OM1L 4AEHL 1MI5E 4GKZA 2EEDA 3VXRD 4FYTA 2ISDA 2FZ3B 4EIBA 1OAZL 1VZGA 4D0CA 3FYEB 4CVZB 4KNTA 1IW7D 2VR6A 1ODAA 1BVLB 2P5WB 1COBA 2D3LA 3QI9A 3UADA 5SWSE 4UT6H 1YEWA 4HX1B 2Z64C 4Y2LA 3QRFM 4K5OA 2I9LA 4OM0L 4R4FL 4H8HA 5IHWA 5KSUB 2Z4TA 1JUFB 2EKJA 5INCA 2NYAA 1KZYA 4HK0B 1DLHB 4HX1A 5T3XH 2OR9H 1TNMA 3CTTA 5KSUA 5EA0H 5I5JA 5DVKA 1IZJA 3SKOA 5KBKA 1DLHA 2VRKA 3X11A 3ZDZB 3VH8G 3RFZC 5BZWB 1MW2A 4TVPH 1Q9KB 2A4CA 1ZLVH 2EDYA 3EBIA 3HNSH 4KQ4L 1C08A 2V2WB 4PJGA 5K39B 3I9IA 4IK7A 2XOTA 2CDGA 4OLUL 5EU7E 5BZWA 1XCTA 4UI2A 1Z7JA 2VDOH 4OZGF 5DK0A 4EKXA 3HUJE 7PCYA 4X6CF 5FYJD 4WY7L 1F5WA 3QQ4B 2D7NA 2C9AA 4WTZA 4E68A 2MQGA 4OJEH 4Z0BL 2W1NA 3UZVB 1OGAA 2GK0B 2QVMA 4JG5A 3RGVC 1CR9H 1NBVL 2GBUA 4YNYA 5EUOA 2H26B 2H6OA 3FO9A 4DEWA 5A2FA 2NZIA 1DQKA 1I9IL 2YEZB 3GS4A 1KENH 3DJZA 3N0PB 4OD1L 2O5XH 1Y18B 2J57A 3HI6L 4G72B 5B38B 4G8IA 5C0CE 1AGCB 1A1OB 4J3OF 4WNSA 5CU9A 2Q20A 2X4SA 3SODB 4G9FA 4OZHF 3LZPA 3FOMB 3BN9C 3KGSA 1Y18A 5F6HJ 4OZIA 3GTVA 1SMAA 3SCMB 2YMXL 2OL3H 5IMLB 1U8PA 4KGJA 3NPSB 3U1PA 4HGKC 5TDNB 2OYKA 4MMXA 3S97C 1GOHA 1K9TA 3ARRA 5EZIL 4ORGB 3UTTE 3H6AA 5DI8A 5ABAA 3UTSA 2PO6D 4S0SD 2FJUB 4JKMA 4QHKI 4FNPA 4IDJH 4ORGA 4JZJB 5IOPB 4X6FA 2O5YH 1MWAH 5SWZD 3SQRA 4NXSA 4HWBL 4YGAB 4GKOA 4Z8FH 3C5ZB 1J5IA 4CMMB 2JJSA 4NT6A 4ADJA 3V55A 1QUNA 2VJ0A 5IOKA 5F7EH 2YPKA 4R3SA 1A1NB 2O5ZH 4F7PA 4JN2B 3C5ZA 1JNLH 3ZDXF 5FGSA 3A6CL 1HC1A 4F8LA 3ECUA 3CVHA 2J55A 3S37H 2WBJC 2VZOA 3OAYK 4RRPG 2CXKA 4JN2A 4M9PA 4MHHI 5MP6H 5C70A 3C09B 3OHXB 3BQUD 4HD5A 3T04D 5J6SA 2X3CA 2VPXA 2TSAA 1UATA 1ZT7B 2B59A 4BCYA 1R47A 1YJDC 2JIXB 3LKOB 3I6GA 4QO1B 3WIHA 3P77A 2HTKD 2PCFA 3U83A 1X5ZA 3NQKA 1VJSA 2GW5A 3B3IA 1SYVA 4AH2B 1NC2A 4FFZH 3M46A 3WUWB 5FM8A 4PJAF 1VHPA 5IHZB 1P0SE 1DCEA 2JIXA 3LKOA 4KK6D 4MD4B 4OCLC 4YDZA 4BSVA 1SHWA 2FQGA 2Y9RT 4A7UA 1IVLA 3VX0A 5JR1H 1YQVH 1TIUA 2IPKA 2CUAA 4I0CC 4HH9B 5TJWK 3L1FA 5IHZA 1J8RA 4UTBH 5IHBA 4RMWA 3GHEL 3H9SE 2BHFA 4IOSA 3W0WD 3QRLA 4HH9A 1C7SA 1EUUA 1S3KH 4AYID 1O6TA 2GCYA 4MFHA 4IRZA 2YO3A 4UV4L 4L1LA 1CTOA 3K8LA 3PHOA 2XN9B 2YMTA 2AEQL 4JFED 5FYJL 1DBJL 5BNXD 4ISVA 4XPBL 1WHOA 2XZCH 2VQ1B 4GSXA 4H0HB 1HIML 3V0WH 3IDJA 2EDDA 3A6BL 3CZGA 3WI9A 4M9OA 4U3CA 1VGEL 3K1DA 4JRWA 4ONFL 4R7DB 4AY0A 4MLSA 5BS0E 3S88H 4MAYD 4IRJD 4WHYH 1UXLA 3BQVA 5FECB 5IQMA 2VLKA 3FK3A 4KKBD 1HSBB 1BZEA 2QGBA 2VAJA 1NGWB 4ANKA 3KPOB 3A47A 5FTNA 3UH8A 4M43L 2EDBA 2K4AA 4DVRL 4NBZB 5GM9A 1AA6A 1HSBA 1K5NA 3NIDB 4E2OA 5LKNA 3POHA 3DK0A 3QFDB 5DJYB 4XVSL 4AC2A 4AMWA 5K1VA 4P5KA 4OZFB 1XF1A 3JV6B 3BFWA 2DWDB 4B9JA 5D7LE 4E9XA 3DHPA 5T8IA 2WZPD 5I0WA 3RURA 3VXSB 3N1GC 2WLKA 4QYOA 3WL9A 3Q1SH 2NVXA 4OZFA 4ENZA 4KVNL 4L8SC 3BPNB 2DL2A 2ZYRA 5HVGB 4ZUWB 4N2OA 1GZQA 3TA4D 3HHRB 2BIOA 1DQQB 2WXFA 2XTJE 4LASH 2VDPB 2XA8L 3KBHE 3NCWA 4AJWA 3PP3K 4BQ9A 3QQDB 4JGUA 2YXWA 4O2FB 3S3DB 3O3EB 1CB4A 2ED8A 3MRLB 3L9EA 2A5UA 1DQQA 4NGHL 5DSCA 1MCNA 5B3JE 1J0JA 1PDKB 3BH8B 3F3HA 4TVPE 2RTTA 1B90A 4GIOA 3RZCC 3UROR 3O3EA 2XV0A 5IB2B 2M83A 2EE2A 3WJLC 4YOKA 4XB7A 4RNRB 1SY6A 1PDKA 2BZDA 4DEPC 4F7KA 1E4XL 1FV1B 1KCSH 4ZX4A 1YG9A 4M5YL 2X4QA 3S3PA 4P5TB 3FSAA 1QG3A 3UO8B 2YBGA 5TE7L 2NYYC 5INDB 5JOFB 1ZTXL 3TN0C 1MUJA 4Z95L 2ZXAA 4GBXC 3GTMA 4Z7UA 4PJXE 1P5UC 1XH0A 1NEZA 1Z6JT 3S5LA 1RP8A 4N9GB 4RETB 5JOFA 1JXFA 3FO0L 4M03A 4PJDB 4L8CB 2P42B 4XXWA 4NO2B 2RJMA 1SZNA 1Y1WA 1SMOA 1N0XL 1KIUA 3NIGE 3TJEH 1X6NA 3CSYB 3DOIA 2KPNA 1GYUA 3STZA 1I75A 4WDIB 4PJDA 3GSXB 3D7PA 3H0TA 2BJMH 3WIIL 1DJWA 4GAYB 1F00I 3MLTB 1EO5A 3SZKC 3THML 1FORH 1F13A 3I9PA 1ZVNA 3GSXA 3FQ4A 2BSTB 5B39G 4NM4L 3K6OA 1MCEA 2P8LA 1OP5K 4U3XA 4NZ8A 3VFOB 1C5DA 1UWFA 3MLTA 1EDYA 3PWUA 1AZRA 3QDJB 3QUZD 4MCYB 4K3JL 2BC4B 5C0GA 5FV2A 1TMOA 2R9HC 2R83A 1HHKB 3PP4L 3UYPB 4CBPA 1XSJA 2W65B 5F7MC 2VC2L 3EXLA 4BWWA 4ELMA 4MCYA 1U2CA 4K94C 1UT2A 2UV3A 1ZHLA 4QDGA 2NNRA 1FRGH 2ENGA 3P4NB 1J1XL 2P80D 4GAFB 4LCUB 3BSZL 4CADB 3SPIA 3BPLC 4QIWA 3NZSA 4FQ1L 3BUIA 4PMFA 3BRGC 3E1F1 5I6NA 2E59A 1KN2H 3BUQA 1B2WL 1QSFB 3P4NA 4HEMA 4HJ1A 4JFTA 2A2QT 4L4TD 4LSSH 4YE0A 2CBPA 4IIZA 4Y4FC 4AGLA 4OLXH 2HG0A 4AJ0A 3UOAB 1MEXH 2R2BB 3KL5A 1WQVT 5FCSH 3PJSB 5EPMB 4ZFOA 1MNUH 4DVBB 5EOQH 1X5AA 2R29A 2EVJA 1R5VB 1CE1L 8FABA 1SXSA 3M88A 2IO5A 2XBTA 4JFQA 4G6KL 1OSYA 1OY3B 1INEL 1J7VR 3DGGB 2A6HD 5DF0A 3ZIYA 1PS3A 4A2DA 3RZCD 3QXAA 3GKWH 4J3SA 3DV6A 3MRFA 5C2BL 1N0LB 4HBCL 2XWRA 3MO1B 4PJ7B 4BKSC 4JHUA 2W80C 3WJMB 1FZOA 3DBXA 1NCUA 3V4PL 2V2TA 4YHOH 2ZSWA 4FA6A 1A6UH 4NO3A 1FAIL 4K7PH 3VXUD 1SHXA 1NEUA 1X3DA 1YJDL 2JCCB 4EZMA 1YLEA 1DQJA 1LM8V 1PX3A 3WJMA 2X7LB 1T7WA 5I18H 2YK1H 3EH4B 3KNBA 3HMWL 5FUZH 5AB0A 4GBXD 4RFNC 1JPTH 3K3QA 4WGWB 1WH0A 3F00A 2X7LA 4QCIB 3RYMA 4N2HA 3OGCB 2IAMA 3MV8B 2ZUTA 3CNKA 1YECL 1XR9B 4XPAH 5HHOA 1D7FA 4ES9A 5A2JH 4IKLA 3LEVL 2R8SL 3LAFA 3P4OB 3IF1A 4QR7A 5IHHA 4P0DA 4IJTA 2EDHA 3MV8A 3V6OC 4PVBA 4S1SH 5FDWA 1XR9A 4UBDD 3DARA 3LS4H 5A16B 4O02L 4TSCL 2OMYA 2FO4B 1UJ3B 1YEHH 4JRXB 2A1WH 5AKTA 3ZQ9A 4O2EA 3BGFB 1EHLL 1K3IA 4QRPB 2ED7A 1JMXA 3AREB 4NI6A 5HDBB 5A16A 4YDLB 2FO4A 1WFMA 4KAQL 1RUAL 1UJ3A 1AXTL 4JRXA 3GGWA 1H3UA 3FTUA 3IDXL 3HPJA 2BCMA 4QRPA 5CIPB 2R9HD 2ZUVA 3QEUB 3ULUF 2YSSB 3O8XA 3D3VB 1KXHA 3OLEA 5L0QC 2QR0B 3FHEA 4KKAC 4W9HC 1UUSA 4CJ0A 4EMZA 7FABH 3U36A 1E6JH 5F0JB 3VRIB 4G8FA 3VSVA 1V10A 3JWNE 2YSSA 4JX0A 1IBGL 3WNIA 1PG7X 1ZTMA 5BO1H 4POZD 3RE0A 1JPSL 3QYNA 2BX5A 2CPUA 3VRIA 3S3SA 2X4OA 3G6JB 3K8KA 3IS0X 4HU8A 5IQ7H 5J1TC 2P5WE 1NCAL 1KJMA 4HAFA 4Y4FD 3VXMB 5JQ6H 5KYWB 4FQ2L 3WLWC 1NCWL 2QV4A 4PM1A 4B6ZA 5E1AA 2NNAB 3GPEA 3VXMA 5JIHA 3CDZA 4LSQL 4Y7MA 3U7WL 3TTYA 4P2QD 4FQCL 1KIRB 5D2NB 3ENEA 3EO1B 3QZNA 4P57A 2G75A 5T3ZD 4HIIB 3ZDZE 3COOA 4NP4H 3FQTA 5DGRA 5H35B 3NGBB 1CYXA 4P3DB 4V1DD 3EO1A 4B3EA 2VXVL 4AYGA 3DOSB 3D25B 4AJVA 3B5HA 1NWOA 2Z4QA 2MOQA 4FFYA 4J3BA 15C8L 2CW0D 4QXWA 3QO1A 2DQIH 2F54D 4X8XA 3EFDH 3U0WL 4G80B 5K59E 4L9LB 2CMRL 5EUKA 3ZTNH 5D71L 4AYMC 3D0AA 2O72A 3GINA 4NJAL 3MRGA 5IZ7A 3ATAA 4J4PD 3NOIA 3NDYE 4LSUH 1IGTA 1RK0B 5EOCJ 5T5FH 5ID0A 1WK0A 1ZGLA 2OI9B 3NSXA 5AVQB 2GT9A 3LH8A 2JIQA 2CAKA 2HLAA 2P44B 4JMNA 3SIKA 3WY3A 4G71B 5D2LA 4PJHA 4YHLH 3FU9A 2ADIA 1RK0A 4TQPA 2BXYA 4AZUA 4YXHL 2ICWI 3LD8B 4J3OD 5I0DA 1RUKL 3EUDA 3RB5A 2APSA 1ZT1B 4N2LA 1M57B 1CIDA 2J1XA 5G55A 3KPNA 3KW8A 2G5RA 1NA8A 1QQDB 1ZEAH 2HFGL 1UWEL 1G5AA 1PG7L 1NIFA 5D9SB 1A9EB 4FQXA 5A3ID 5D70H 5JXED 4WJKB 2N0MA 1RPQA 3LJ3A 1HHHB 3T3MB 2R0KH 4KKAD 3X2IA 4B7IA 5JMRA 3H53A 4FCAA 4LEOA 2X4UB 3TVMA 5C07D 1KJ2B 2DWEB 2I7SA 3CVDA 4ZO9A 5ALCL 3L3OC 2FUQA 1HHHA 3OC8A 1KFAH 3GRWH 4P4KA 5E8EA 3PGDB 3WTXA 3OLDA 5GGTL 3DROB 4PHZA 1U8QB 5IHUL 1KJ2A 3K4AA 3MV9A 4HGWA 4XPFL 4AYFB 2WLIA 1CDCA 4RV0A 2X1WL 3WFEL 4HJTA 4Y19A 4K94L 5F44A 3ARZA 3WLWD 5A6LA 3ABZA 1X7QA 4FG2A 3DMMA 4KNSA 5DJ0B 4FTVA 4GQPH 2VMCA 3FCSB 4WUKH 4BH8A 2IWKA 2GI7A 4U1JB 3OR6A 3QQ3B 5DZLA 2JMRA 3CFDB 4AEIL 1BXAA 4DGVH 3ZRFC 2KI6A 3HRZB 1Q8MA 1BFVH 2GTWA 3HS0B 4BKLB 3FCSA 1IGMH 2WB7A 3PDDA 4LXFA 2HT2D 2RBLA 1MFNA 1X5JA 4LOEA 2RCSL 4AJYV 3CFDA 4HSAC 1T4WA 4ZTOL 3VCLA 3C5SA 3L4ZA 4Q52A 5J12B 3B34A 2D03H 2WP3O 5HVWA 4EI5A 5AYQA 3HC3L 2EUVA 3Q7JA 1R27A 2R1WB 5DTFB 4JDEA 2J73A 1W72L 3ORJA 2YD3A 4WCYH 3WLBA 2DLGA 2ZP0T 4U6VL 4ZOBA 3GTQA 2D0GA 4MQSB 2A9AA 4P5SA 4HPHA 5CKAA 5DTFA 1S9XB 5A1AA 2B1HH 1UYWL 3DV4B 2GBVA 4PJ5B 1WLHA 4XVTL 2YGVA 4I9XA 2AABL 4LLMB 1YNKH 1UJTA 3DX7B 4YHYB 1QZNA 4I3SH 4HIXH 2A6IB 4BK8A 2WQVA 4NM8L 1O5DT 1GMEA 4OSUH 4TUKL 2XN9E 3QXDA 4I85A 3WXWL 3DX7A 3VRLE 2CU9A 1HCZA 1MRCH 4KU1A 1AANA 1L9QA 3EYOA 2X10A 3ATEA 4OB5H 5C2UB 3NFSH 4UQEA 1H3WM 4HJJH 5T5NG 1HVXA 1M2VB 2WVUA 4L9DA 2AXFB 4XBEL 1C5CH 3MGTB 5EBGA 5BV7H 1LQSR 2V17L 5AAMC 3SO3B 5ECJE 3KPTA 3UJJL 1BQHG 2OMVB 3IWVA 4PJ9D 4AYBA 3UABA 3TEXA 1N7MH 2GFBB 1M7XA 3VSQA 5CIPH 2RQ8A 3RX9A 3VQMA 4XCNA 3KLSA 2NY7L 2OMVA 3NIDE 1FGNL 5IJVB 5E2VL 3ZN6A 4UU9A 2V4LA 3ULSA 1F18A 1SFHA 4N85A 5DFAA 4YHKL 2EE9A 3VDAA 4FEIA 4Z3JA 1Z3GH 5DS1A 3W57A 3VXSE 3OAUL 4NQED 1U36A 1WEJH 4ZS6C 1CZ5A 5CGTA 5D7KD 4ZQTA 3LSOA 1UZ6E 4XO5A 2JA7A 2G9HB 4NIYE 1RJYB 4P9HL 1KYOJ 2KQMA 3E9TA 3X1BA 1GAFH 2X4NA 5LBVA 3RVVD 2XFXB 3CBKB 7PAZA 3UCRA 1RJYA 2DQEH 2J12B 4N86A 2EDFA 1EZSA 4Y7OC 2N1TE 4A2LA 3CQPA 3BVDB 3KPSB 2B63A 4Q6IC 1OPGL 1D9KA 3TBVB 3QZBA 4TTDC 2J7LA 2CRYA 2DH3A 2F8IA 4KDVA 3M45A 3CHSA 2ZKYA 1EGJA 3OXSB 2YA2A 3MYZA 2G3ZA 4PCYA 1JK8B 3FH5A 4DUWA 1R9FA 5HY9A 3L3JA 4ALAH 3WG7B 1WA2X 3RTQC 3NT0A 4LCVA 1JK8A 2XWJB 1J9QA 1JF6A 2GJPA 3EFOA 3S2CA 5IBUB 5I1KH 3O4LB 3MNVB 1CFQB 2ZOUA 5AWNH 3QIUB 2XBDA 2Y2WA 3Q43A 4PW9A 1UA6L 1QLEH 3MNVA 1MCKA 3JWDL 1ZWIB 1AE6H 2OW7A 1THAA 1UC6A 1IC5H 3DPDA 1XF2B 4E0RB 5GGVY 1KTRL 1XGUA 4FQLL 3VXNB 1KDJA 2VXQA 4JFFD 4EN3A 2PXYD 3FOLB 5KVFH 2HFFB 2YBRA 2R4RH 1XF2A 5HI3C 3SDAD 3LRGA 1KBKA 3X12B 4F9LA 3ULVC 2YOAA 1S5HB 2WK2A 3CZEA 2E7ZA 3HBQA 3KLKA 5A7EA 3QEHB 5FHAL 3FOLA 1VFOA 1BVNT 1KYDA 1OT1A 2GTQA 4JQVA 2CDEA 3HI1B 4GG6F 3QDJE 1F6LL 4JFPB 3X12A 2BXZA 5CU5A 5HHQA 3PWPA 2VDKL 1KDIA 2B08A 1F3JA 4DGYH 5KBPA 2EINB 1YVLA 3FUIA 2VM3A 4OD2A 1D7DA 5BPPA 1ZHBB 2K8QA 3KBPA 2E7HA 4L4VA 5KJRH 1UOWA 3IJ9A 2APTA 3VXQA 4WNQA 2BIQA 5BZZA 1P1VA 4A2GA 1OCWH 3H7BB 3EJZC 1KTKE 3BKYL 3LEXA 5F8QC 3TBTA 3OSVA 1NDMB 1L9NA 1AH1A 3MNZA 1QSFE 2FECI 1T1ZA 3QUYD 3H7BA 4HQQH 1DE4A 3PDOB 2A73A 1NDMA 3RWFA 5BZXA 3F6IA 1I7UA 1XCQB 4MXWH 5E9DA 4YQXL 1A7RL 5ESVA 3T0ED 3VFRB 3IDGB 4ZW8A 3D2UA 3TURA 4NZJA 3T77A 4LPUA 3KLHC 2E7MA 1WFOA 3PDOA 4X7EC 4HU2A 3LIUA 3UERA 3G5XB 1FL5B 3PL6B 1WCQA 3ARGB 5LWYL 4ZO7A 2GJRA 2WXMA 3VFRA 2EYSB 1PZAA 1VLXA 1YDPB 2BNUB 3P54A 1VEMA 4KOBA 3G5XA 3ARGA 5EMYA 2ARWA 2Y06H 1SDDA 3ZR5A 3LHPH 1RAMA 3OZLA 2EYSA 4PJ7E 1Z5YD 1YDPA 2NXZB 1KB5B 4UMSA 3OLGA 3RAJL 1X5IA 4E36A 1DCLA 4TUOA 3TBSA 1V05A 3OF6D 1NMCB 2JCCE 1EJ6A 4S0TD 3WDHA 1KB5A 3RTQD 4EI0A 4R9HA 1W0YT 4MTMA 5ISZA 3SYPA 3FB7A 5DZNA 4PJFB 1YNND 1HDMB 1PCXA 3JYBA 1BQ5A 2XVLA 4HJ0C 1K3ZA 2C5DC 3PREA 4KKLC 4MDJA 4V11A 1TQUA 5DRXB 5TK4A 1BW8A 2XC8A 2BNQA 2WWMC 3F6JA 3H0GA 5K9KB 2IV2X 4IGBD 3V5KA 2WXPA 2F08A 2XPGB 1T7ZA 3BMVA 2Z7ZA 3UJTL 2W88A 1UWXH 4PTTA 2YWYA 4KTDL 3ZU8A 4D3CL 5ES4B 4HUVB 3ILPA 3QDMA 2J1YA 3WFCL 5A6IA 5IR1B 5CJOH 2DIJA 3AG4B 4JRXE 1S4IA 1RZ7H 3HE6C 1XXDC 4OZ4B 4QRPE 2JIRA 1YY8A 3N44F 1J48A 4AM0A 3OZ9H 4FDWA 4Y2DB 5HDBE 4X9FA 5CLYA 4MAUL 4N3TA 1P2CA 2EC9T 4BQBA 4KODA 2V7HA 1S7VA 3I6SA 2DAVA 4OZ4A 3ULUD 3FUHA 4ZS7H 4N5EC 3D3VE 3L8QA 1TJGL 2Q2EB 3RDTA 3CG8A 2OTUA 4L8BB 4AZ8B 2VAAB 1AS8A 2UZYB 1DVQA 1CXEA 2IAAC 1DBAL 4Z7QB 4OV6F 3CN4A 4M6MH 5D7JB 3SE3C 4L8BA 4M6NL 5FW7A 1YEGL 2UZYA 4OCSH 4CSSA 4RWYH 2W0KA 5FM4A 3CBRA 3T2NH 1MCLA 3G6JE 1LEGB 1T22A 3D2TA 4P23C 5E99L 3INOA 4UB0L 1FFPB 5D7JA 3M7FB 4MNGB 3VXME 2ZNWA 3KPMA 4XMKH 5I26A 1NUDA 5C0BA 2X05A 2FCBA 3P30L 4F2MB 2QV2A 1P9MC 4JG0H 2BOBB 4O5LH 5DVNA 3T6ZA 4U0QB 4CRYG 3QEQD 4ZUTB 1FLRL 5IW6B 4DP1X 3P0VL 4PJEB 1A3LH 3FUDA 5D2NE 4JPQA 4H0GA 3ZUNC 3K2KA 2VABA 2VDMB 3GJEB 5TQ2H 4ZMAT 1CXKA 2FWSA 4YMPA 1EXUA 3LZRA 2WQUA 4P3WA 4DKAA 4MHHG 4YBLB 1U3HB 3EYSL 2GJ6D 3MHZA 2HJFB 3IKCB 4P46C 2K6WA 1KULA 5LO7A 1CDJA 3ZTDC 3VGAC 4X7DC 5DMJB 3NP3A 5AB1A 4FF9A 1MFDL 3KYKL 3RIFF 4OCXL 3WFBL 1AZBA 1U3HA 1MFCH 3NPZB 1UD6A 1TKWB 1OTUC 4UYPA 5CLTA 3TP4A 2CO4A 1TLMA 1FVEB 1YZZA 4FFTA 2C9QA 2ZOKA 3CK0L 4KKLD 3WKPA 5BZDB 3CF2A 1J5CA 2BHUA 5HHXL 2WUBL 4EKJA 2NLJA 1TKWA 5T1LD 4G42B 4QMEA 3NDZE 2EC9U 3HVDA 5D1XA 1HINH 1JZDC 5F89A 5HHVH 4AQ1A 1TVHB 3PIQB 3MBXH 5KVEH 4LAQL 1HNFA 3V4VA 4XCYB 3BDYL 4OGYL 2VWEE 3GPSA 2X53A 1T1XB 3PNWB 6PAZA 5JW4R 4I13B 4BZYA 2E47A 4A1RA 4XWOD 3CC5A 1OB0A 4X7TB 5EZJB 1VZIA 3ZGHA 2BZCA 1J8SA 2EIJB 4LAJH 3EBHA 2KLSA 4QHLA 1UT9A 5CD5C 1HOEA 1Q9OB 3SO5A 1ZC1A 2D3VA 2CGRL 3TEZA 1A4BA 1GA2A 4JO1L 4J6RL 4ZOAA 1EAPB 3S8WA 3NSJA 1Q9OA 4LIQL 1NJ9B 3T3ME 1KXTB 5C08A 3RA7H 1BREA 5EOCH 1OAJA 3TGXA 3GBDA 1JYXA 1JOIA 1X5GA 4MD5B 4AEEA 1H6FA 3JWOH 5LXVA 4MA3B 2ODIA 2DMKA 2XRAH 3PWLA 5IV2B 2Z8SA 3Q8CA 2R69H 4ICWA 4FNUA 2QGEA 4MD5A 3A23A 3OKYA 2ADYA 2X5PA 1KTLB 4I2XA 3I6LE 4MA3A 2MQ0A 4R84A 2CBMA 4HBQA 1XGYL 4EIZC 4A6YL 4DNLA 4Z7VA 1HXMB 1IAMA 3IK2A 3QW9A 4ZMTA 3NESA 4JDZB 4IBLT 3FL7A 5SX4H 1GS6X 4PUBH 3QJZA 3UPRB 2HN7B 1HXMA 3N5AA 4RA0C 3GMLB 3IU4L 4J3WA 2H8PB 5HYJD 5LBSA 3TCTA 1GTNA 4KROB 3UPRA 2HN7A 3TT3L 2W38A 1J8HB 3NIGF 3QJTB 1QEWA 5JW4M 3HHMA 4X7CC 4IMKC 5DEJA 5T1KB 4LLYB 1XMWA 2AQ3A 4OLVH 1J8HA 1C7TA 1TDQA 3MREB 4OD3H 1CD0A 4M8VA 4JZNA 5CMAA 1EHKB 1YYLH 2WGNB 3MUUA 4Z78B 3DOHA 1UD3A 3S36X 1II4E 5MEPA 4CKVX 1WTGT 4PV8A 3MREA 4PJ5E 4I1PA 1HCYA 3EJSA 3V5HB 5CCHE 1MJUL 4TPRH 1VRSA 1X7TA 3QCTL 1RMFL 4C57C 1DVXA 4WHDA 3SDDC 2UWEF 1EU1A 1ZGLM 3L9RB 2YZ1A 4UQ2A 1KG0B 2JKXA 3GSWA 3KGTA 4ODSL 5E1IA 4ABUA 4BM7A 1HX0A 1OE3A 1OGPA 1WAAF 5I1GH 4JNXA 1ML0A 5F21B 1W0WA 1JF1A 4FNTA 3ZR6A 4JG1L 3UTZB 5AYUL 1KG0A 5L4FA 3ZHKA 4QIRA 3KS0H 4RBPK 1ORQA 1C5BL 4R4BB 5C3LD 2PPCA 5K9QG 5JDJA 3MR9B 3PV6A 4ZFZB 3QIWC 2F53B 4PRNB 2OYPA 4GY4A 4D8PB 3ABMB 1F1DA 1DQVA 3ES6B 4MJ5A 2IDSA 4U3HA 5DD5H 2VDRL 5I1LA 1NCDL 2DQFA 3HZKB 4RISH 3QIBB 3S4SA 5DFWH 5BUAA 3Q6GL 4N2AA 4PRNA 1URLA 4XB8A 4WWOA 4R5XA 5AQ0A 4FXGC 4F3FB 5JHDD 4FXTA 2IFFL 4DP7X 3FUKA 2HJKB 5I71B 3GXNA 1GZHC 3O6ML 3CFCL 3RTLA 1NAML 2PR4H 4G8GB 3ESNA 4F3FA 3U0PB 1KT2A 1R34A 4HXAH 3WAJA 3RWEA 5CSZA 4UDUB 1UADC 2F8XC 3VACA 1IL1B 5GHWH 2VXTH 4S1QL 3NVQA 5I1HH 4YXKL 2WLLA 3E8UH 4K2UH 1H15A 3QUMA 3B37A 3IMRA 3QZWG 3BKCH 2R2EB 3L95B 4NQVB 3MBEC 3O9WA 3KXFB 3V52H 3HLAA 4NQSB 2YJQA 5DHEA 4E41B 4XMLL 4TOYL 4XCFH 3LDBB 2V2XB 5F9OH 1A3ZA 3KPSE 4ODBD 3HZVB 4ZAKB 3O2DL 1X9LA 2Z93B 1J1OH 3OPUA 2NY6B 2OJEB 2QGDA 2VLJB 4YHNB 1LD9B 1LK3H 4B0MM 3HZVA 2OJZH 4XO9A 3O2WH 5GQBA 2QQKL 4FJ6A 43CAB 1JZ8A 2VLJA 1P6WA 2ZG2A 3LV3A 4YHNA 5GZOA 4WVRA 3AADB 1JZIA 4CN4A 2C34A 1N4XL 2Q8AL 4ELDA 1HAUA 2XWBB 43CAA 1KV3A 3O4LE 4U1IA 2OMZB 4UT9H 5GRUL 3WKMH 2EP6A 2RFXB 4AVIA 2IQAB 2VN3A 2H7WA 2Y1AA 1T83C 2OMZA 3Q3GA 1DDTA 3CX5K 4HFWA 1FZKB 4P2OB 1PX4A 2HJLB 2Z9TA 1MI5D 2IWEA 3X1GA 4F33B 4FNLH 4PB0H 2V9QA 1E65A 3GTGA 1FZKA 2XV6B 2YEQA 3Q0HA 4Y4KC 1A4CA 4I18A 4AMXA 5I0YA 4WW2B 4YSPA 4N8UA 1Z5LB 3K2MC 1H0DB 5SWSD 2L04A 43C9A 3QULB 4OQTL 5D1QC 2IDUA 5FWQA 3MPCA 1OVZA 1DMSA 1P4LA 1T66C 5INDA 3DMRA 1W8EA 4WW2A 4KFMA 3A4AA 2EIEA 3RNKB 1Z5LA 2PWGA 1H0DA 2AV1A 2VXSL 2OXHA 3FU7B 3D9AL 3TBBA 3AY2A 3QE5A 2XZQH 3PWVB 3GK8H 1HL4A 4ZYKB 6TAAA 2R15A 3JVGC 1E7UA 2K0RA 3MLWL 3GTKA 1OOAA 2FEJA 3FU7A 2X9YA 2BVYA 3ZDZF 5E4EC 2HTLC 5IY5B 3S9DB 4MNQD 2XICA 1KCRL 2YEVB 3DX6B 4TL4A 4ZX6A 3NH7L 3SHSA 3MJ9L 1GYVA 4UT7H 1F58H 3B1TA 3JTTB 1M71B 4NQDB 5I1JL 1FZJB 3EGXA 1A3RL 2RHEA 4RQQA 4XC3L 3MRKA 5K59F 4NZTL 4KGLA 1F2QA 1CZ8L 1IGJB 1WF5A 4MQTB 3FTWA 3C6SB 5DHYB 2IPTL 1L0PA 3ULAB 1G87A 5BRZB 1P1ZA 5IT2H 5IWLC 1V3KA 2FIRT 2J44A 4LPYA 3A22A 2Y36L 3WN6A 1E28A 2YAFA 3BJLA 3F7VA 2R0WL 2CO6A 1BEXA 3A3YB 1TEGA 2EXYD 5F7KC 3F83A 1KGCE 3AG3B 1QACA 4FNSA 4HHAB 3WO4B 2WP3T 4UUJB 1IGFL 4HAGA 2P8MB 3MRPB 1G7PB 2Z31A 2OR8A 3N41F 1CD8A 3FH7A 3II1A 4HHAA 3QT2A 4LNRA 3H2QA 4UUJA 5GJTL 3HOGA 5I1AB 1Z9LA 5F88B 5IROC 1RHHA 2WJ5A 1DN0A 3MRPA 1PX8A 4K3EL 4PJFE 4U05A 2PP9A 4E41E 3CDYA 1LNUB 4R2GD 1G8KA 3MCLH 3H9HB 2DQTH 5I1AA 1MHPL 5DMYA 3HMXA 1KC5H 5FCUL 2D7TH 2DYPA 1PBYA 1FO0L 5EEYA 1TJIL 4B41A 1LNUA 5KJ4A 1ETJA 1BXVA 4BFBD 3H9HA 4FLHA 5IB3B 1L8FA 1JP5A 5I6MA 2ZP9A 3DIFA 2CIIB 1DUYB 4KHXL 3VXOB 5AAWA 2CBQA 3FONB 1CLZL 3ARBD 3OGOE 4TSAH 4Z7WB 2NZ1A 1WBZA 3LRHA 4TLSA 1FI8C 5AUMB 1NFIA 1I7ZA 1DUYA 2CIIA 4L18A 1PEWA 1NPUA 1RU9L 1TZAA 4JQIA 3D6GA 4XN8A 1AXSA 3FN0L 5GRZA 1OAUH 2WXOA 3DX9B 4Y16C 3FZUD 5DD1H 4ZUVA 4TRPH 2E46A 2XTJC 4OT1L 2FJGA 1ZSDB 1EH9A 4X9BA 5HDOA 4GMSL 2PKDA 5LGHH 3OXRB 4O51A 1JD9A 1KELL 3INUH 2OM5A 4RX4D 4OV5A 5DFVC 4H8WL 1WCBA 4KHTL 2AJUH 4QTIH 2FYYA 4H13C 4WV1A 3HAEG 1RVFH 3OXRA 1QX1A 4XP4H 4BUHA 3SGKC 4KX7A 3QORD 4HWEH 2LU5A 1DO6A 3C9NA 3A4FA 4OY9A 3KW7A 2J25A 3ETBF 4MNGE 1AOHA 5FC9A 4F2ME 1Q38A 1ZSHA 5LCVA 3T2LA 5E94A 4NWUH 2DMRA 5CN3A 2FEDC 4K3GA 5C3IA 2ITDB 3D12B 1INDH 4K7PY 4ONHA 1S7SB 2EDQA 4G6ML 2Q7AA 1P4BL 4PJEE 4E9QA 1CXHA 1MCIA 2A0LD 4XBGA 1SHSA 3VH8A 4HG4J 3VD9A 5D1ZI 2J4WH 1D5XA 3P3YA 1I8LA 2NZ9C 2EDTA 5TD4A 1YY9C 2A9CA 4HWZA 4QAMB 4R7VA 1JXDA 5ACLA 5J11C 4A63A 4WNJA 2EDEA 3PQYA 2VH5H 3ABLB 2TRYA 3FFOA 3QEGH 5D6CB 4XP6L 2O61B 2VZ1A 3FCTA 4G9DA 1GH7A 1OM3H 2F8OA 1H9VA 4QTFA 5D72L 4AKOA 2VDNB 5BS0D 3HS9A 2ZAIA 1RUML 1TJHH 3GSRB 1L6ZA 4GAGH 3VI3B 3SYAA 3CQZA 4C58B 2JKRM 4GKNB 1YN6A 3RUGA 2UXFA 3BAEH 2NY4C 2QKIC 5J13C 1WV7T 1DQDH 3GSRA 5F9WC 1EWHA 3KVQA 4F37F 3KMDA 1F97A 4QOKA 1FNGA 4RSYA 3D39D 2CO2A 5I1IL 3UC0L 5GSVB 3SUMA 1LTXA 5KUMA 5D7LD 2UZPA 1LQBC 3SE9L 3TH2T 2Q76B 4MB4A 4X6DA 4UOW0 3DO4A 4ZDHB 1M1XB 3TJHC 2VR4A 3L3DB 1UZ6F 3BEWA 1EAJA 3PRZA 3MRQB 3HW7A 2ZWKA 2ERJC 5HPMB 5I0ZA 1WFJA 1A6WL 2XTJD 5JQHC 1CGUA 2NSMA 3WKYA 3L4UA 3KGUA 3LRSA 4FFVD 4J8RB 2ZG1A 1TWCA 3V79C 1FE8L 4JRYB 2Y2TA 4Z1PA 4M4RB 4UZUA 4K23H 4PJBA 4PRIA 4X4YA 1WA1X 1TMQA 3QFGA 4QXUH 3D85B 3CPUA 5CZRA 3E7JA 1DJIA 2L7EA 3Q9QA 5DLML 2WQXA 1G0XA 5AG9A 5ESQB 5BQ7A 1CDBA 1HWWA 3OLIA 1CBVH 3D85A 2YPLA 4N1CA 4GT7A 4M1GH 4OJFH 3SGJA 1V7ML 1J0HA 1ZANL 1WAPA 3Q6FB 4HKXA 3ZMEA 4FADA 3PGCA 4XI5C 1AR1C 4Z7UF 3STLB 4L48A 3HJ0A 4EUPG 4HC1L 4RRPA 5C0ND 4QRSA 5F7DB 3GHBL 5TE6L 2A38A 1PLBA 2Q7YA 4AV0A 1H9DA 4TQ8A 2OJ1A 5EPPA 2FL5B 1FN4A 3NFPA 5TFSH 1IFHL 2ATPB 3OG6B 2EO9A 4XNAA 5I23A 3ZZQA 2YN5A 4PJDF 2J5LB 2NZ9D 1G7LB 1RY7B 2JJTA 4TUUA 3TZVC 3ARFC 1IIKA 1IJNA 2ZOOA 4LOUD 2B14A 4YHZH 3WIAA 2J71A 4KOCA 1M05A 4PH8A 4PEEA 2W94A 1MG2C 5CLZA 2QPFA 2AQQA 2FHFA 2M2DA 2DWSA 3GMRA 2L0DA 3BP5A 4U1KB 4CSZA 3QNYB 2WCGA 1JCKA 2XKNB 2JB6B 4QHUB 1YEJL 4Q89A 1YNJD 1FFQA 3KWVA 1E5CA 5LBGA 4KLNA 1KJVB 3ZKMC 4ELMF 3HG1A 2JB6A 3WNMA 4YPGA 5TH2B 4R4NC 3QWQB 3BESR 1NGYA 1J10A 1CLCA 2YARA 2ZUQB 3JUYA 3V0AC 5E4IA 1MCCA 4JQXC 4Y4HA 3GIZL 4TNEA 1JVKA 1SOSA 2J88H 5T1DL 1ADQL 4UQDA 2OTWB 2W0LA 3F7RA 3CFTA 4RMTA 5ESAB 4CVUA 5CZVL 4QRUB 4FQJH 3FBKA 35C8L 3PNRB 4KQ3H 2A9MH 3VFPB 2I85A 5T33L 5IJCC 1P7QA 3ASNB 3LZQA 4F57L 5SWQB 3TJHD 2EEXA 2QHLA 3BDXA 2F53E 4HWBA 3PHSA 3LQAL 3VFPA 1GVIA 2MTPA 1SEQH 1G7HB 5F96L 5I5RA 1XGRB 1HCVA 3N06B 5SWQA 1EPFA 2R1YB 4IJ3B 5JORB 4BFNA 4MA7H 4J7RA 1ZLUK 3SKUD 1G7HA 5L8KB 2X9WA 1KLGB 1S9YA 4UT6L 2R1YA 1Q0YH 3ZE0F 3VXRA 3TM7B 3DSFH 1W16A 3IFNH 3ML1A 4JHZA 5HHPB 4YSSA 3B1UA 4PG9B 4BK5A 1HU8A 4DP0X 2EE3A 3BVNA 3AW5A 4G8GE 3HR6A 2BPBA 4PJ7F 5T3XL 2OR9L 4XP9L 1OP3H 4IDLA 1IAIH 1OK0A 3D52A 2NSXA 5A2BA 1K8IB 5EA0L 4GO8A 5DHXB 3X2OA 1Q1PA 4JB9H 1AR1D 4XI5D 2JCCF 3HE7C 4HJGB 4DCQA 4TVPL 5E08H 4HULB 4KDLA 1QUPA 2RMNA 3IGAB 3HNSL 1K8IA 5CWSA 1H3XA 1FNEB 4Q8BA 4R83A 1TZHA 3ZLQC 4EQ2A 3C8KB 4IBSA 1UD2A 3KXFE 1BW3A 4XP1H 2VDOL 4UIMA 2EVGA 3FFCA 2H32A 1IO4C 1EEZB 4A66A 5E2JA 4BUGA 4KTYA 4KZEL 2V5SA 3ARFD 2DWYA 3CVHH 1TFHA 1D5BA 4PY7A 4KK9D 1BBJB 4XR8C 1D6EA 1EEZA 4NRZB 1IM3B 1AO7A 1BG9A 2YUWA 4G7VL 1I4FA 1CR9L 4CDGC 5IVXA 5LG1A 2V7NA 5E1GA 5J3HC 1PZ5B 4HV8A 1KENL 3SCMC 4F58L 3EGSA 3IRZA 3RDJA 3UDWC 2ICEA 3OSKA 4WEBL 3NPSC 4MWFB 5IMMA 4M5TA 3N1PC 1E3FA 3O41B 4TVUA 5HBBA 1KBWA 1T5WA 4GT0A 3ZZLA 5BXFA 1KEMH 3FQNB 3PUCA 4AIZB 5J89A 3ETTA 4F15C 4R4ND 3Q5OA 3W11C 4X8GA 3O11B 5FUCE 4LSVL 1ETB1 3EW3B 3O41A 2EZ0C 2OL3L 4NC0B 1XB3A 4IIQB 1MCFA 1LXMA 4N87A 4JZJC 1S2EA 2VDLH 5B39B 2CBTA 4BV1A 4PRDB 4JN1H 4XCCH 1J0ZA 3MV7B 4IRZH 1U8LA 3G6JF 3F6LA 5B39A 3UGUA 3QHZH 2P5WD 4PRDA 2CKBB 1JTPA 2O5YL 2VNCA 1EO7A 4KDTC 4NX0A 3KD4A 4XXDA 1FL3B 2PO6A 2PLTA 1VFMA 3KJ6H 1BJ8A 2AVFA 3NN8B 4PGJA 3ZL4L 3C09C 5F7EL 3OHXC 3V8CA 1W0VB 1U8NA 1FL3A 1KXVA 5SWZA 3UGEA 3L2NA 1JNLL 3AAZB 3CLFH 4U6HB 3WEMA 4JCWA 4O4YH 1JS4A 5FKPB 1MLBB 4BXSV 4NCDA 3V7AE 1UASA 3IRPX 4U6HA 1AYOA 3SGDH 2C4XA 4ZD3H 2X6CA 5FKPA 1PQZA 3D18A 4L37A 1MLBA 2F0CA 3RJDA 1NH6A 3ZVVA 2OULB 4NQDE 1QFOA 1OGYA 5KBDA 4OI9A 3S96A 4PGZA 1OAXL 3U9PH 4GRLB 4XCEA 4H20L 1CDYA 2XN1A 1Z9SB 2YD7A 4JM0A 4J1UB 1MJ7L 3GJFK 2EYTB 1SUJA 4YDVA 3HU2A 1TQBB 4MX7B 4C8XA 1EEYA 2A74A 5JR1L 3RFZA 1YQVL 5BRZE 1Z9SA 3DNKA 4PJHF 4CW1B 2CO3A 1XR8A 1M9SA 5JYLA 4X5WA 1WFTA 1XF5B 4QRQA 2D8KA 2X44D 5E1QA 3QGVA 1OE2A 1T04A 4M48H 3HHSB 5TQ0L 1MIMH 5CP7B 4GQZA 1YEKH 4CW1A 3FO2B 1S3KL 1HHJA 2ZONA 4FZEL 1I3GH 1XGTA 4YXLH 4GMTL 3ISRA 3D69A 3LKNB 1EFQA 3OAZH 3RGVB 3U4EA 4PJ8B 5IP4A 5J3HD 5DZ9A 1B0GA 2AZUA 3HHSA 4GLRI 5CP7A 4DO6A 4ETYA 1R3LB 3FO2A 5ICXB 4HJIA 4GG8A 3W0WA 1SJEA 1WO2A 2WLNA 3BCDA 2R51A 2XXCB 5GIRA 1G5GA 2XZCL 3AMLA 2PETA 3QO0A 1HXKA 3RGVA 3UTSD 2DM7A 3V0WL 2UY7A 1FFNB 3TV8A 1R3LA 3PXHA 2V5TA 4JO8A 2EADA 4JFEA 4NENB 5TPWH 2EZ0D 5KSBB 1JVLA 1FFNA 3IAQA 3VFSB 2ESVA 3P4LA 3S88L 1Q72H 4MJ6A 4LOVA 1NL0H 3UJIH 4ENGA 2XZAH 3DX0A 3I6KB 3TYFA 1T89C 3K4DA 2KKQA 2PNDA 2I24N 1MAJA 1QEXA 3C5ZD 4Z7WE 5JO5B 1WZMA 1E27A 2MH4A 4L4JA 3LX9A 1KBPA 3ROLA 5CCKH 1GTFA 3O3BA 3SOBH 3BSZA 5L2KB 1BMWA 1GSMA 3SPHA 2DEWX 1QBAA 3BPNC 3DHUA 1THCA 3OX8B 5DJ8A 3CVIL 1BF2A 4NHCH 2PNWA 4JKLA 3N42B 4MJIB 1K6QH 3OC5A 5DS8B 4MVBC 5L2KA 3TIDB 3VXTA 1R46A 4AMKH 3Q1SL 1T5XA 1FFOB 5IF0B 4MB5A 2ZX5A 3LRKA 2IWFA 5T5ID 1BXXA 5DS8A 2JIXD 2WINA 7TAAA 3K5SA 3SDYH 2WHVA 2AVGA 2IANB 3KYNB 4LASL 5IF0A 3W5NA 2WBJB 3GXUB 2AKRB 2C7UB 3DLQR 1MPAL 4Y5XB 2ZX6A 3GNMH 4QRFA 2KQAA 1NAKH 4YN3A 1K85A 5CD3A 3C5XA 1WZLA 2WXQA 4XO4A 2VXUH 5FO7A 4NC1E 1GOGA 2Z7YA 3CFKA 4P5TC 4NPKA 3V4PA 4G3YH 3K6SB 2KLRA 2WBXA 3ZZ1A 3SDCB 1FLTX 4KO7A 5FAAA 1IKOP 2BMKA 3SE6A 3EYUH 4N8PA 2ZQKA 1Q9WB 3GI8H 1IRAY 2XN9D 32C2A 3GLAA 5C7XH 4NBYB 2LHAA 2AF2A 1DQML 5DHVB 3CDGB 1Q9WA 2WANA 4BKTC 4KY1H 3IU3A 3CCHB 4TUJB 2DQUL 3BZ4B 3GZKA 4JZOB 5GISH 3BP7B 1TPXC 4IOFD 4O02B 2SEBA 3QJUB 4AQEB 4PIBA 1RURL 3CDGA 4WEEA 3KLDA 4F92B 1VGKB 3TJEL 3L4CA 5BVPH 3EDKA 4WHYG 4ZPTB 1JZ3A 3GXDA 1AC0A 3CCHA 4MSWB 4PRHB 2D73A 3BP7A 1S7UA 4O02A 1I7RB 5D1ZC 4AQEA 4GO6B 3MRMB 4FERA 3VI3E 1LO5B 1OF2A 1PLAA 1UZ8A 3FT1A 4HDIA 4LSTL 4MCZA 4K55A 4MSWA 5C09B 1TQVA 1T3FA 2MNWA 1FORL 1CQKA 5LB1A 5I24A 2IH3A 1I3RA 3F58H 4Z3GA 1F56A 1Q16A 2K78A 3EYVB 1BFSA 3DI2B 3D07A 4HJSA 3MNWA 4UV7H 5SX4I 2WNKA 1G7MA 5GGUA 1FBIH 5GS0H 1M7UA 3OMZA 3RY6C 4LCYA 2VR8A 4H2AA 4RGOH 3VXSD 2YD8A 2ZX8A 3V6ZB 1HI6B 2XTLA 2P9RA 2O6PA 2WKGA 1KNOA 4PRBA 1FYTA 4MYPA 1QR1A 2CKBH 5H94B 4AOFA 5ANMA 1G6RB 4WI6A 3TIEB 1BQUA 1CGWA 4KVCH 4OJAA 2XQ0A 4GKSB 3AITA 4JPVH 4K15A 1KN2L 2GSMB 3V9CA 3HC4H 5H94A 2ETWA 1J0YA 2FJHA 4JRYE 4LSSL 4D94A 2P80A 1DFBH 4POYA 4L8SB 4YWGL 2DM3A 3F2LA 4NQUA 4OLXL 1AP2B 3KE0A 5HDLA 2H3NA 3LQZA 2Z92B 3X13A 2N7SA 3PABA 2OMUB 5AD0B 3TCXA 4E9WA 4F7TB 2NT0A 3P9LB 1AP2A 1MCOH 5HGBB 2OMWB 1MCSA 5GGRA 1E32A 2HG5B 4HKBA 1ILUA 2AXJA 2JJUA 3QDGB 3FFDA 5AD0A 1NIAA 3ZBMA 4P5TD 3GKWL 5I6XB 2OMWA 4I5BA 2HAZA 1L0YA 5EF0A 2XX1A 3ZGIA 3VNYA 2ZWNA 3REWB 3SBPA 2AEWA 1N19A 4YHOL 1U8JB 2BO0A 3CUPA 1R17A 2ITEA 4YHIB 3RZCA 3V8OA 2DLFL 3VTTA 2QLYA 3QJXA 4KX8A 3WJLA 4G8EB 2F8VA 3PHQB 5I18L 5I0VA 2YK1L 4RDBA 1N10A 5D7IA 3N6YA 5FUZL 2EECA 4HMEA 5B38G 4UQ3A 4X5PA 4BEIA 3TN0B 3WNLA 1XIWB 1JPTL 3GSVB 5J1SC 4J23A 4KMTH 3ALXA 4WFGE 2AJXH 3G5VA 4G6FB 5EU6B 1D2OA 1DSFL 2GSGB 5BV7C 4U0RC 4KC3B 4XPAL 2V9UA 4XVJH 4ANXA 3TN0A 5J6GB 3LZFH 3BGFC 4GBXA 3W1ZA 2D3JA 3VQ2C 1OV8A 2Y7QA 2HFTA 3PJLA 4M6OL 1P5UA 2DWXA 4LCIL 5EBLA 5AVWB 4KJWC 5EU6A 5HYSA 4YS4A 1ZLEA 2GSGA 3AREC 1Z0NA 2F19H 3IDIA 3QDJD 5CR1A 3LS4L 5ID1A 1HQRA 3AC0A 3LXUX 1FUNA 5E6ZA 1YEHL 3CBJB 4J12A 4XODA 1E9OB 2JJWA 1QVOB 5KYXA 1F90H 3V0FA 4CN6A 1KOAA 4IKNA 4LLWB 3QG6A 1E9OA 1OP3K 1RIHL 1BQHB 3DVGA 3LH2H 2O6CA 3PE9A 5HGAB 3K6NA 3UBGA 1N5AB 7FABL 1E6JL 1VIWA 1YUHA 1CQYA 4LPWA 1R3JB 3K6DA 1E40A 1A4JA 3C60B 5EU4A 4DUXA 1LO3H 1BQHA 5GGTA 3HR5B 3ISWA 3US9A 4Q9CA 5C1BA 3CAFA 5BO1L 4WTWA 1GYWA 4BYHA 2IGFL 1U58A 3BPLB 2NR6C 2XNAA 2AZAA 5IQ7L 2APFA 4XMVA 2YAMA 5JQ6L 2WVSA 3L2MA 4HIHB 1BFOB 2E9JA 5D2NC 4XAWH 2A6JA 4H1LB 1OANA 1XBDA 1F4AA 1PL3A 2R23B 1OWRM 2G60H 3W82A 2E7LC 3T0AA 4JFDA 3NP4A 1OA7A 4HIHA 3BN3B 1KJ3H 3DSNA 4WI3A 4Y4FA 1VFUA 2ROXA 3MJ8A 3FB5A 4GW4A 2Q3AA 4K7FB 4LESA 1S78C 1GXEA 1HILA 4ALAC 2XG4B 2GEQA 1WUNT 1PIFA 4NP4L 3NJKA 1BYPA 3H2WA 4RRPM 3DETC 4L9LC 5KANG 4D7ZB 4P2QA 2BVQB 3RL2A 3BHBB 1W72A 4YR6A 3EOYG 3AQXA 5GRJH 4B5EA 5PCYA 1W6LA 3DYMA 1R6VA 2K70A 2F1EA 3FW6A 3MV8D 1UZGA 4V1DA 1HFUA 1RI8A 2P8PA 3ZTNL 3QJQB 3CZKA 2JF1A 1YPZB 1LE9A 3FRPG 3VB8A 4IK6A 4U6YB 3OBAA 4LRIC 2VWEC 2F54A 5DHVH 1AD0B 1U2YA 2BSRA 2PW1A 3LD8C 4OZGA 1XBRA 2HUHA 3T1FB 2X09A 1YPZA 5FR3A 3EYQC 4RAHA 1T2XA 2X42A 4JRXD 5E0FA 4QRPD 4HLJA 4KJWD 4JFYA 3ARED 2WQSA 3MRDB 3NCFB 1NZRA 1D6VH 2BWQA 2Z7WA 4PTUB 4PV1C 3U7YL 5C92A 1MCBA 1UUNA 3GM0A 3KYAA 4IS6A 1EEQA 4JO2H 3FPYA 4IKKA 3MRDA 2XSKA 3V6OA 3OTTA 4APXA 2ZXWB 1ZEAL 2VERA 1QFWH 3W56A 4Z7QF 3M8OH 4OZHA 5CHNB 4BH7B 1UHDA 1OXYA 4PD4J 2BRQA 4MB3A 3UZEC 4FQHA 1A5FH 2E8ZA 4NHUB 4N26A 2YHGA 4NO0B 4RMQA 5A2KH 4I4WB 3MV7E 3DJ9A 4G1EA 4NWTH 2EJ1A 5CHNA 1N12A 5C71A 1GRWA 3SKNB 3VXMD 4UQAA 3AVEA 1VFAA 3ZHFA 2ATAA 1KFAL 5KS9B 1F6AB 4F37K 2PYFA 1WWBX 2G5BB 1G6RH 1DVTA 1FVCB 3LNIA 5EO9B 2HH0H 1ID2A 4XT1C 3FUEA 3US1A 4ZTPH 2WCPA 2FX9H 4BDVA 1JN6B 1NIDA 3HRZC 2CUMA 2EH7H 3HS0C 4HCFA 4QWWD 3QZOA 2AI0H 3N1MC 2G5BA 5EBWB 2W0FA 1H8OA 1FVCA 1L4IA 1QRNB 3C8DA 2JIPA 2LLGA 4LLVA 5EO9A 3SBWC 2Z1KA 4AM0Q 3AWFA 4KJQC 3SKJH 3E38A 5J12C 2J20A 3FTXA 3RFRA 1WGOA 4FKEA 4DGVL 5C9KA 1FIEA 2IJ0C 4AIOA 1QRNA 1EERB 1JZ6A 1BFVL 3EBGA 1IGML 3N9GH 1GSKA 3C12A 3N40P 5KYUA 1ERNA 4OGXH 1MFVA 2X9XA 1O7SA 1O6SA 5IBTH 1CN4A 5I0XA 4BQCA 2GY5A 3Q01A 3D50A 3B5GA 3VU2A 4WCYL 1U95A 1F3DJ 1YEFL 1YNTA 4H26A 4ANWA 4W9IC 1R7RA 2B1HL 2WXGA 5BUPA 3L7EB 1X5FA 4YLCA 3KWWB 2UZXB 2D7OA 1YYCA 3NIFB 4GAJH 1YNKL 3VMPA 5MHSE 3WEOA 1ZS2A 1QPKA 4B50A 4I3SL 4LK4A 4TSBL 4W6YB 5IQNA 4RMRA 3EYQD 4CMHB 5CUSH 1JTTA 1KIQB 1IKNC 4N9OB 4UNUA 4FQXD 4OSUL 4DIXA 3UXFA 4L0ZA 3T9WA 1MRCL 2JV6A 3IE9A 4TVSa 5FLUA 1SIWA 3EDEA 1WICA 3SO3C 1KIQA 1UKQA 3QXVA 4OB5L 4RMVA 2WLMA 4N6RB 3D48R 2H9GA 3TVMD 2N1KA 3NFSL 5CP3A 2VDKB 4HJJL 2WYZA 1S7TA 1QZ1A 4KDIA 2RD0A 4PYHA 1C5CL 2JKSA 5BV7L 2IF7A 4UM9B 3ZPDA 5KSBE 3MGOB 4BCXA 4C56B 4OJDH 2J8UB 3IPFA 2QQLL 2ZX9A 2O6FA 5JZ7D 1XMEB 5ERWA 3UX9B 2WIMA 2HVJA 2XWCA 1N7ML 1G7IA 4NOBA 4XNXL 2GUOB 2VQTA 3DMMD 3ME0B 4OIAA 4C2MA 4FTVD 1ZT4B 4YDMA 1NUFA 3K81A 1E2ZA 1KY6A 4UQCA 1RZ8A 4J2XA 3I6LD 3KLAB 5AZ2L 2CGZA 1OCRB 4JL1A 1Z3RA 4RGND 4XMPH 3KWUA 1LWJA 2CM5A 4MJIE 5FYKH 2WB1A 3QA3A 3WV0A 3QHFH 1Z3GL 1T2QL 2MMXA 2VISA 4B9ZA 2ZKWA 1WEJL 3BZFB 1FVDA 1TWHA 3I85A 3EHBB 2CJTA 3L3OA 4LQFL 1IEBB 3MX0A 3U0TB 2VSMB 3WU1A 3QPXH 1CIUA 1GAFL 3FT0A 2IANE 4TXVB 2X1XR 1KFGA 2DDQH 2DQEL 2XXGA 5DJXB 1VENA 4JFZH 3U0TA 1E50A 2MEJB 1X4YA 1XH3B 4O2CB 2H0PA 3ARVA 2B3RA 4WFHE 1P7HL 5D6DC 2C9UA 3TNNB 3IXAA 3DVNB 3PWNA 2AJZA 2CH8A 3D87B 1XH3A 3EJUA 2ODHA 1RJZB 5J1AB 1IEHA 3MRIB 4IBTA 1KPUB 4PJ5D 4LSDA 5AW7B 1JXJA 2VL4A 2A6ED 3AJ7A 3LPGA 4MMYB 1OARH 2D31B 5J1AA 2ZCKH 5CSBA 1N8ZB 4XMZA 5H8DA 3T65A 4ALAL 3QIUC 1PY0A 4OLWH 2ZT9C 3OKEA 4NUPA 2EKSA 3MUY1 4MMYA 2D31A 5B7MA 1KCUH 1XF3B 1L6PA 5ITBH 3FS9A 1I85C 3FTSA 5I1KL 4LVOB 1KPRB 2V9RA 5AWNL 1NGXA 4OGAD 4PV9B 3B9VA 3L9BA 1WITA 2J6WA 1I9RH 2EDLA 1AXIB 1FG2B 2FO8A 1QLEL 3H4HA 1JZ4A 1AE6L 2DI9A 1IC5L 4PRHE 3EF4A 3GMQB 2E4FA 5DJAB 2EEOB 2QHRH 5CEYB 4FXLA 1OAKH 4NKOB 3SYCA 3DKHA 4I1RA 5C09E 5KVFL 4X98B 1CGTA 2BDNH 4ACPA 5DJAA 2DJ4A 4GI9A 2MPAL 1AFVH 1JDDA 2DMBA 1IBYA 1SBBA 4UM8B 3IJSB 4RFOH 3S48A 4JFFA 4X98A 1BQLL 1WBYB 4DN3H 1H3GA 1OGTB 2UXTA 3SE4C 3ZO0A 4OUUB 4L3EB 3VGDA 3L3KB 3IBOA 5AAMA 4JFHD 1KLFA 1T20B 3D0VA 5J6HB 2FE0A 2QVFB 1HE8A 3EFFA 1WBYA 5KJRL 1I1AC 3CZFB 3L3KA 5E23A 3GKZA 3FYIB 3VFWB 2YOCA 5J6HA 2IH9A 3TU6A 2CE6A 2WSPA 2AQRA 1QATA 4YAQA 3CZFA 2NY5C 4NPYA 5BCAA 5JIQA 1UM4H 3H3BC 3VFWA 5JOPE 2BY1A 2AEPH 3D1MC 3VRJA 1J11A 1U0QA 2DKUA 5I8CB 3KPSD 3ZKSD 3G5YB 2VIRB 2BVPA 2CCWA 2OZNA 2IALB 3V0EA 3OKKB 4AWJC 3P0YL 1GGBL 1SLXA 4ZFGH 3QUYA 2DQGH 5DJ6A 4WUUB 2BSSB 3OKOB 2CKNA 1WTLA 4AKQA 2GBAA 2C3HA 2VIRA 1FQ9C 3OJDB 4GSRA 3QDGE 4XO3A 3WEAA 4PCKA 4U3SB 1QHOA 2BSSA 2AQPA 1NOFA 2EXSA 2BP3A 3GFUA 1RZQA 3ZJAA 3ZTJH 5D7HA 2IADA 3LKPB 1FJ1B 3WAKA 3TO4B 2B9AA 2WIIA 4HIPA 3O4LD 3U25A 5DC2A 5MENB 3OWRA 2BSBA 4Q6IA 3WEXB 1FAKT 1AQHA 3QIUD 1KTDA 1NPJA 2QTVA 4YUEH 4W9GC 4ZQKA 4BCZA 2OW6A 4JY6B 3FO1B 4ABWA 5MENA 4A2FA 3GXMA 3WEXA 3IETB 4EDWH 4J2QA 4C83B 5LN8A 3TEWA 4GUPB 3OF6A 5IB1B 1MCQA 2VMFA 1HXYB 2FR4B 4NRYA 5EU6E 1CXIA 1DBKH 3RTQA 3FUMA 4DERA 3SDXB 1E7VA 5LLIC 5IB5B 3UBXA 3C2AH 4DN4H 4NRXB 4WW2F 1HXYA 2HVKB 1J5DA 2FR4A 1A9VA 3GLEA 4NN6B 4PAZA 2LV4A 2W07A 3HS8A 4Y2DC 4LL4A 1E42A 3SDXA 4F80A 3FQXB 5ITFB 3BZEB 3WFDH 4DP5X 1HZKA 1S5IH 4L4VD 1IAII 5CEXB 1CXFA 5FWRA 4GFTB 4XTRC 2EXWC 2CR3A 2E0PA 3TV3H 5B6CA 2R1XB 4F27A 5KUKA 2XN0A 2IBGA 2ZWYA 3FQXA 5HJ3B 5ITFA 5K5YA 4C59B 5I6LA 4PJIA 3OZ9L 5FO9B 4H8QA 3RNQB 1UKSA 3BWZA 1EZVX 2R1XA 2PWDA 4F1SA 1U33A 1TQTA 4ZS7L 1PD6A 4P4RB 2R2HB 4KPHH 3R4DA 3MUJA 1A21A 4L2LA 3RNQA 4LSPL 4OR1A 1SXAA 3CXDL 3D2UD 1ANUA 4FE9A 3VXPA 4QXGL 2ARJA 5TTRA 4PGCA 3FQUA 2R2HA 1A1MA 3SQOL 3N04A 3V4VH 4Q2ZA 3VFTB 3UEZA 1JL8A 4OCSL 4RWYL 4K5NA 4XN2A 1ETZA 3CU1A 3T2NL 2AGJH 3UAEA 3PL6D 3RWHB 1DN2A 1EAQA 3ARGD 4A6YA 3ZSTA 4Q0XH 4AL8H 1V55B 4XMKL 5HD8C 1GJIA 3QUXB 3GB7A 4WEMB 3MXVH 4JG0L 3VFUB 2YQ3A 2CO7B 2FH6A 3B2MA 4FQIL 2D3NA 1N6QH 2NXZD 2C3VB 3BAYA 1A3LL 3CV5A 2P43B 4P2CG 3LN4B 2C3VA 3KM2A 3QEQA 5I76B 4BGDA 3QZWA 2QJDA 4FLQA 2TAAA 4YDIH 5DD6A 2ENJA 2CHZA 3P9WB 3QDAA 4E41D 3LN4A 4YJZL 2BP8B 1JWMA 4DGWC 2YLKA 1RHFA 4Q4IA 5DMIL 4BFOA 1MQKH 1A6ZA 3NFNB 2GBTA 4E5XA 2QADC 1YPZE 5F7FA 3LHAA 1XX9C 2X4PB 1Y7VA 1A6AB 1TR7A 2VR5A 1DQLL 2D0FA 2BY0A 5KVEL 1HINL 4MA8L 4XRCA 4XN1A 5HHVL 5LBSH 3MBXL 2A6DB 2JVUA 1D7CA 2LGNA 2X4TA 1G94A 1MG3C 3PU7A 3VTMA 4I9WE 4X7SH 4Y2DD 1RK1A 2EXTA 2VL5B 3SGDI 3EOBA 1BIHA 5T1LA 4EZKA 3SBRA 4DFIA 3PWJB 2EXWD 2QLVB 4F2EA 2XVGA 2A9DA 2VL5A 1YEDB 2WLHA 5DMGD 1WD9A 3P11H 3HE6B 4LHQB 2ZWLT 3KPPA 5IVZA 2A6KB 2VM9A 2YD9A 1WFIA 4P59L 1VF5C 5D7JD 3EJYC 2Y4SA 1YEDA 2G5UA 3HG3A 1OZUA 1DBML 2G2PA 1I7TB 5I1EH 3ARUA 4JO4H 3RA7L 4ZSOA 2AQTA 3IJYA 3QFJA 5EOCL 3SPJA 1MVYA 4QRRA 1ZA3A 3FF7A 5AOMA 3V2AR 1LE5B 1TTAA 2AITA 4YSTA 2FX7L 1NAMA 4HLZH 2WZ6A 3MN8A 2XRAL 5KS9E 1GC1H 2BVOB 1CJYA 2R69L 3DRQA 1B0WA 5AW3B 2XKSA 3BP4A 4X9GA 3DDGA 1LE5A 4PRAB 4FNRA 2HPOA 3T3PB 4P23B 4EDXA 1EJOL 1JGUH 4AAYA 4MD0A 5HD8D 4YBHA 3SE3A 5SV4A 2ZPKH 1QRNE 3DC0A 1GPOH 2FD6H 2OQJA 1LK2B 2C3GA 3QQ9C 4P23A 5DEGA 1Q1JH 2LTQB 4PB9L 4XNQB 1RERA 2NY5L 1ZDQA 1U3HD 3QG7L 1F1AA 3CFJB 2N3JA 3Q2WA 2V3VA 2YUJA 2OZ4L 4JP7A 1PFCA 3OKLB 4JCMA 4B9FA 3SY0A 1P9MA 3O2DA 2F74A 5HGDB 2CIKB 1F0LA 3D4GA 3N1QC 2FO1A 3OKNB 4JBSA 4QGYA 2IOOA 5IQOA 1U3NA 3ARYA 5D1XD 5AVSB 2G3XA 3FMGH 4P46B 3B2VL 5TDOA 4RA3A 4OLVL 2AW2A 4ODUA 5I1DB 4U6XA 4OD3L 1BVOA 4UCFA 4KXCA 1DDHA 1V3LA 4P46A 3MJGX 4G7YH 4K9EH 1DQTA 1MFAL 3Q2LA 5DHDA 5B1JC 4NOHA 2H47C 3LN5A 2EE0A 3NIFE 3QUMH 4K5LA 4CC0A 4EO5A 2IH1B 5CF3A 4X6DF 1SEBA 1DBBH 1SXNA 4YFLI 4HPOH 5IREA 5I66B 4AOKB 4CDHA 1IFRA 4BFGA 3U82B 2HT3D 5AVXB 5I1GL 3ZDWA 3MOAH 3WE6B 1HYRC 4PCTA 5I66A 3BVXA 5J9PB 5C08D 1T0OA 3N85H 4KY2A 2JB5L 2IPUK 3ZUCA 3J07A 3WHE1 1YN7B 4HZLB 4PJBF 3QIBC 2NY3B 2C4FT 4OQTA 5I5IA 4GRWB 5B3SB 4C56E 1R0AH 2J8UE 4WRLA 1JFQH 1YN7A 5FUOH 3ZKND 2CLRA 2WXLA 5L9DL 4AE1A 1G9NC 1KPVB 4OKDA 2ICWB 2BCKB 4JO5A 1B6DA 1OW0C 3A21A 4YSCA 3RVTC 1R5WB 3FU0A 3GMNB 4LLAA 4PWIA 4X5XA 4HHGA 5IJKC 5C0RL 3B4NA 4NDMB 2GSIA 4LVNB 3U6XA 1SVBA 1KPVA 2ICWA 1G7QA 1N6VA 5AKVA 4DJMA 2H6PB 4PRPB 3RGBA 5FFLA 4JM4H 3MJ9A 4F9PC 4XC1H 2IMNA 4X99B 2PR4L 5DRWB 5E8PB 2F58H 3K71B 5F1NB 2MCAA 3UP1A 1FCGA 4G6JH 4K5PA 4BFIA 2DQJH 2H6PA 2Y2YA 4FP8H 4TN9A 4WKZB 4R7XA 2A7BA 3OZKA 4KROD 5E8PA 5I1HL 3K71A 1K4CB 5F1NA 3LDBC 3E8UL 3HAEA 3RKDD 3ZDYB 5I17B 5JPNC 1J8HD 2QEJA 4ZAKC 1JHLH 4ODHH 4XPHH 4KQ0A 5T1KD 1AZCA 2C1OB 4PG2C 3CHRA 3T4YB 4YSAA 5LDUA 3OL2A 4XCFL 2HFEB 1ILSA 1AGFA 5F9JB 5HHMB 3SBQA 2IXQB 1LEKA 1P4IH 2VDML 3PLXB 5L4IA 4B96A 2ILLA 2W60B 2C1OA 1J1OL 4IEFA 1F4WH 5F7HA 5F7YC 3RWGB 1JDCA 3EIFA 2HFEA 5DQDH 2CJ3A 4WTQA 1M6OB 1TOXA 2X9ZA 3OB0K 2WUCL 1A65A 1BLNA 2W60A 3OKDA 4FQQA 4LDCA 1HQ4B 3OKMA 2COQA 2DQDL 5FK9B 4IMKA 5FUCC 1FO0B 2C4FU 3MRRB 4P99A 1S7RA 4X4XB 1OSZB 5DYIA 1C1EL 4ZMXA 2HRGA 1T21B 3C08L 4P2OC 2NQDA 3EGDB 4UT9L 1FO0A 1DVZA 3TNMA 3L1OH 2PCXA 2DLIA 4H8UA 3M86A 2VSKB 1MAMH 2DBLH 1FSKB 3EGDA 4NKIH 5FM5O 2VE6A 5D8JH 1EMTL 2FATL 2F53D 3WXVH 3B43A 4DKEL 2ZAHA 3SDDA 1IC4H 3WGUB 3ZIMA 4EVNB 3QIBD 4PB0L 4KMLB 2JFCA 3MLUH 4OKVB 4YVUA 4PS8A 1MAKA 1X9UA 3NTCH 5TDPB 2FX8L 2YGOA 1S7QA 1MI5A 3QIWB 2B2XL 3W39A 4ZODA 2WKOA 2AXHA 2Q6WB 4OKVA 3KLQA 1DUZB 4I3RH 2G2RA 4L3EE 4Y1AB 1H5NA 1K83A 3PAZA 3HN3A 3QIWA 4G8GD 5D5MB 4YDKL 1WT5C 1TCRB 3GK8L 5SWSA 5SX5K 2Q6WA 3KLHD 1BZ7A 1DUZA 3HMXH 3L45A 4HJUA 4WWNA 5JNYB 5I30L 5L4JA 2BIIA 3Q2VA 4FXGB 1BYOA 1RZFH 4YBQD 3TYGH 2JKNA 1XGPB 3BDBA 2GAZB 1NLDH 3NCEB 4JMXA 3P3RA 4FXGA 4UT7L 1F58L 3CZSA 2ENPA 3KXFD 3KYOB 2HRPH 1XGPA 1BOGB 1QFUH 3FRUA 1E4JA 2CHWA 1NCTA 1TZGH 3CSBA 1GZHA 4JQIH 3J8F7 4CRZA 1TO4A 1MREH 4ZAKD 4HUMB 5AOKA 5EZLB 3MRCB 1SGKA 2NY6D 3MOBL 4WUUE 2VLJD 2PJJA 3WO4C 2OXGA 2X89D 5IT2L 5IBLC 2H2PC 3HUJA 1XB6A 5AVVB 3RWDB 1RLBA 4QLWA 3OB8A 4EUPA 1S8DB 2WBWB 2J56A 4PS4H