3D30A

Structure of an expansin like protein from bacillus subtilis at 1.9a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
MAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptidoglycan-binding protein
molecule keywords Expansin like protein
publication title Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 52
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3d30A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3d30A02
1BW4A 2G6GA 2PICA 4ENGA 2JNZA 3SUMA 3SUKA 1HD5A 4FFTA 1OA9A 2BH0A 3SUJA 3X2OA 2KQAA 3X2NA 1OA7A 3X2MA 4AVRA 4JP7A 2PNWA 1WC2A 3X2PA 3X2LA 1N10A 1BW3A 4L48A 2PI8A 3CZBA 3M3GA 2ENGA 1WHPA 2PJJA 3X2KA 3FT9A 3ENGA 3X2JA 5GM9A 5H4UA 4JCWA 5GLYA 4ZM7A 2HCZX 4JS7A 2VXQA 2AE0X 4JJOA 4FG4A 3D30A 2G5DA 3SULA 3X2HA 1WHOA 1BMWA 1L8FA 3FT1A 2GAEA 4FERA 5GLXA 3X2IA 4JP6A 3X2GA 4FG2A
chains in the Genus database with same CATH superfamily
3IMRA 4UV7L 3O2VL 5FUZH 3MLUH 4G7VL 4JRXD 1ORSA 2UXTA 5IVXB 2BNUB 2B39A 5J6GB 1FPTL 5EBWA 4KODA 2DQJH 4BFEA 4AZDA 1HDMB 3VI4A 1KFAL 5CIPB 3APDA 3FF8A 2PCYA 5DJ0A 3BUBA 1GJWA 3GTVA 1HYRC 2XKNB 4DUWA 4FFZL 4GUPB 3LEYH 4OFQA 4QRUA 4NQXB 4X4XA 5BQ7B 1NBYB 1RZJC 5EUKB 5JHLA 1M7DA 3UGEA 3TA3C 4KZEL 5B38A 1UVQA 1JZFA 5EU6A 4PJ7A 1HXKA 3C2AL 1KGCE 1WQVT 3DMMA 1UHEA 3A6OA 3OF6A 3ARXA 3BKYL 4KK6D 4NZUL 1L7TH 4NPJA 1EFQA 5E24E 1E5CA 5D7LB 4KVPA 4PJBE 4A7QA 1A7PL 4G2AA 2FZ3B 1WRFA 4HUUB 4HXBH 2VXVH 1BBDH 3QBTB 1JF1A 4JFQA 3O45B 4OIIH 5HI5D 3US1A 2G4GA 1WBYA 1P4UA 3Q01A 1MJUL 1ASQA 3O41B 3U6XA 4XNMB 4GRLA 4AIZB 3JWDL 5HJ3B 1IM9D 4LLUA 4QJ3B 3MJ7A 2DB8A 3C5JA 4K7PY 5DS2A 4FQ1L 1K4DA 4HIXL 4JN1H 3QG7H 1FDLL 4QIWA 1HKFA 5L4FA 3G5YB 1HKLH 4FNUA 4L3FA 4DP5X 2GSGB 4N0UE 1GSMA 2P8PB 4YE4L 1NFDA 4ODWA 4Z95L 4B97A 1Q9WA 3OR6A 5DCCA 4ZX6A 1AA6A 2JIXD 1TZAA 2P44B 4S11A 3EW3B 1UA6L 2CIKA 2GQHA 4JVPA 1OALA 3ASWA 4L3CB 5D2NC 3D9AH 1XSKA 2OR9H 1E6JH 5F0LB 5DRXA 4YAQA 3ULVE 1UD2A 3SY6A 3FFCA 4JKPH 5LXGL 2NY7H 3AWEA 1FUNA 3IGLA 4MBRA 1QSFA 2BOBB 4IBSA 4WEUD 2B1OA 4AZ8B 2GTWA 3F7RA 4P5TD 4RRPG 4JFWA 1F6LL 3TOPA 4XCYB 4ZX4A 1H6FA 5F7HA 1ZCRA 5LNDA 3LEVL 2ZOLA 5GRWA 4WDIA 5FB8B 1ZLEA 4L37A 2A4CA 3D0AA 4MAYB 1J87A 1XQ4A 4NZRL 2DD8H 4XN9A 1ETJA 1RFDL 3RGVB 1KCBA 3QZPA 4LRIA 1EHKB 2CLVB 2R0LH 2VCOA 3BLKA 3FUKA 3L5WA 4GXFA 5K39B 3LH2H 4UT7L 4JFYA 4L2LA 1BJ1J 3M86A 4NRZB 5I73B 4A55A 3GMPB 4F7MB 1S5IL 3GMLB 2KC0A 3H9SD 5KG9A 2CALA 2E6PA 1MVUA 5DJ8A 4AGOA 1A65A 3I85A 1S9VB 4Y5VB 4WLCA 3Q3GA 3QNYA 4HK3N 4KI5F 4WSGA 5FM5O 4FADA 1KEGL 1FVDB 4N2DA 1T1XA 4XRCB 3P73B 4NAQA 3HS0C 3FH5A 2XI9A 3BAEL 4O5LH 4QCIA 5FCUH 3SPGA 4RFNC 3TT3H 5EUOB 5I1EH 1BVNT 5ICZA 5I8EB 3BRFA 1M1XB 2QTEA 4JDTH 4M3JA 1F90L 4CKQA 1FYTA 1USZA 3BAIA 4GQPH 1T80A 5IB4A 2F54D 5AENA 2WQRA 1AKJB 4ZSOB 2YSSA 3HC2A 3NRFA 2A6IB 3IEAA 4Y9BA 5BRZB 4J3VA 5I1JL 5FO7B 1XH3B 1YJDH 4JRXB 1ERNA 3QEGL 4OM0L 3UYRH 2D0GA 1FL5B 2BK8A 4LPCA 3RVWD 3F12A 1OKEA 2C9VA 3JWOL 5F6HJ 4XNZC 3UTOA 3BSHA 3IDXL 1F4XL 3QDHA 4WI4A 4WWKA 3UP1A 4GSUA 5D7IE 2E7ZA 5C3TA 3QDMA 2DJ4A 4G72B 1QO3B 3D09A 1FRGH 4Z3FA 1JRHI 4HS6B 4QXUL 5IK3B 3DMMC 3DTXB 4OZGF 3K4ZA 3K2UH 5DHYA 4GIPD 5ICUA 4YSPA 1HCYA 2WHVA 4HCFA 1D7CA 3DYOA 3IWUA 3N50A 4H26A 4G1EB 3UTSE 5HBBA 1JD7A 1IC7L 5F9OL 4IU3B 4R4FL 3VQLA 1JNHA 1QG3A 2R1WA 4L4JA 4XPHH 3V0HA 2ZOKB 2WZPA 5IHUL 4MD5B 1K3ZA 5DS8A 3GSXB 3WJMA 1JWSA 1KPUB 1FNLA 3DX2A 3FF7A 5EU7E 5C86A 4BWUA 4GA5A 2H3NB 4OJFL 1R27A 2ESVD 2Q3AA 5EIIA 3NJXA 4NAMA 1IM9B 1XGTB 5ADPH 5KZCD 4U3SB 2BRRH 1FNFA 2ZUQC 2VM3A 3NH7H 3P9MB 2E75C 4CBPA 3V6FA 1NINA 2K7QA 4MVBD 5SWQB 3CVHH 1QLFB 3GHBH 3WO4B 4PG9A 3NSDA 4LLVA 5FCSH 5D1XA 2XQYG 5GLFA 4YX2L 2NY3D 3FQYA 3FTXA 2R9HC 3OKDB 4I3RH 4XC3H 3KLQA 3ZDZB 3JYCA 1WAAF 2IDFA 3IFPA 4HS3B 5KBLA 2JIXB 2DQMA 2Z34A 2XPGA 3QEQE 2OK0L 5DD5L 3DIVA 2ARJB 5DD1H 5AZ2H 4NT6B 1W8OA 4EDWH 1VGEH 2H0PA 5G5DA 2MPVA 1CF8H 4FYQA 4ENZA 1OWRM 2DQIL 2QSCL 2YLHA 4C83A 4XBEH 1DJIA 2HXAA 2WBJB 2JIPA 4N8VG 1MUJB 5HYFA 1OAYH 3TCLA 5EPMA 3LDBC 4L1SA 1CDJA 2Z4QA 4GINA 1DQMH 2Y36L 4MB4A 3O0LA 3WFZA 3D7PA 4KJYB 3DV4B 3S4SB 4EIBA 3SUJA 1G6VK 5L2KE 2IWEA 4KKZA 4LRIC 3UJTH 4K9JA 3H2QA 2ISDA 3H9ZA 2QR0B 4HMEA 2W59A 3P0GB 3H9SB 1UM6H 4ZS6C 4E9TA 1JSYA 1AZNA 1RZGA 1SMOA 2AGJH 4Z0XB 3RZCA 2A0LD 2CLRB 4YBLB 3AROA 2FO1A 4MA1B 4Q4IA 3MODL 5IHZB 2GG1A 1EEUA 2EYTB 2E3VA 1KCUL 3MO1A 4FL4C 1D5XB 3L17A 4I48A 2LT9A 3TXAA 4APXA 5CEXA 3WTTA 3TLRA 1M3JA 2O5ZH 5B21A 4TUKL 1EJOH 5GHWL 2DBLL 2K0RA 2BP0B 3F6LA 1AO7D 1Y6MR 2P9RA 2B9AA 3TBWB 5C9JA 2GAZB 4XAWL 2VDRB 3HE7A 2AXGB 3NQKA 2R39A 2V17H 1I8MB 1DR9A 3EG9B 3H54A 3PGFH 4YFDB 4D9QE 5FHAH 2F54B 1H15B 1R17A 1G87A 4QAWA 5HXMA 1BX2A 2EDRA 4JY6A 2W07B 1HHJA 2BDNL 5H35A 2IH3A 3WE6A 4OFIA 4N87A 5MEPA 2YU9A 1QUNA 4JZNA 5GZNA 3RWDA 2FT6A 3M17B 3Q7JA 4AYDC 2XIDA 3NTCH 1PJWA 3H4HA 4JLRA 3X3GH 1H8NA 2BVPA 1TWHA 2E76C 3E0GA 2YRBA 1BAFL 3RVUC 4F33A 4PRIA 4M9OA 5IJDC 5JW3L 1GJIA 2R9HD 1RKRA 1YDPB 5DMGD 5HYQB 1DQQA 4OI7A 3F62A 5D2NB 1SN2A 3IYLW 1A4KB 3QB7C 1IKOP 5F3HA 2WLNA 3UTPE 4I4WA 3S36H 5IW6B 3KR3H 4IIQA 1I9IH 1NMAH 2W94A 4GIOA 4F1ZA 2VUKA 2BY0A 3NJKA 5J89A 2WOBA 5JPNB 4FS0A 1O75A 3TC9A 4N5ED 2ESVB 4HC1L 2VDPL 5J5EA 5KANG 5I17B 1MG3C 1HAWA 1YEDB 1N12A 1INEL 5KZCB 2QBWA 4Z0BH 4OCLC 2JSFA 1U8JB 2Z7UA 1YEFL 3QFJA 5DD0L 1XBDA 4OFDA 2BCKB 5F96L 3TNNA 3ULUL 4TQHA 2NY2D 2X9XA 1RZFL 1Z9NA 5D1XC 3DSNB 1ZVHA 1VADB 2NY3B 3CZSA 4ZTPL 3QDGD 2LABA 4JE4B 4A67A 4FZEH 3WIHH 3P0VL 2HWZL 3GS0A 4ZS6D 5CZXD 3BMVA 4L8CB 3QXTA 4DN3L 2EH7H 1AOHA 3F05A 1WWBX 3APFA 4JB9L 2PTVA 3ABKB 3OD3A 3O6FC 3MBWB 4OD3L 4HJGB 4R90L 2QVTA 2ZXDA 3RPIB 2J88L 1XEUA 4LARL 3MXWH 5C3LD 2QEJA 2XG4A 3F3HA 3WYRA 4AQ8A 5ICYB 5ANMA 1QPPA 3SCMA 2A73A 2Z8SA 4J3OF 4ENEC 4AITA 4H25A 1W72H 1SMDA 2A74A 2FATH 3GRWL 1OZTG 1DBBL 2V3DA 1NM9A 4MCZA 3VFMA 3VMNA 4FC3E 4AE0A 4YDLC 4RMBA 5AL8A 2FJFA 1SOQA 2XTJC 1FBIH 5D96B 1NCDL 2NX5D 5ESVB 4M7ZC 5LLIC 1E4HA 2EXSA 4XNDA 3GXDA 1JZ3A 3FB6B 4MJIA 3I9GL 3OGOE 4NQQA 4PS8A 2J6EL 2PKDA 5PAZA 2DICA 4GG6B 2PF6A 4NSKA 1ZVYA 2KI6A 1KEML 1AO7B 4X4KA 3HW7A 1QFWI 1FO0L 3DXAB 2NY5L 3NIDB 3BAKA 4OFKA 4JRYE 3G5VB 3HE7C 5KVFH 2AJVH 4KXBA 3GD1C 1DANT 2Z31A 1U8KA 4AQEB 4QOKE 4X9IA 2XQYA 1JPFB 4AQOA 4HJJL 2Z35B 1KN2H 4U6HA 3D50A 2HKFH 2WCPA 5CD3B 3DWTA 2OFQA 5HHVL 1V7ML 5GZNC 3WTWA 3L3JB 3TT1H 2E0PA 5I2IB 2DQCH 3OMAB 3RWJA 1SFDA 4HW6A 4FULA 5HVWA 4RZCA 3TH2T 1KTKE 3ULSA 3B2DC 5FA4B 2EXWC 4P2RE 2ZUQB 4P2AA 1GMEA 2HRPL 1ZHBA 4NYLA 1DFBL 1UASA 1MFNA 4FKHA 4UZSA 1JGEB 3GNMH 1R5VA 5F7DA 4D9LL 3BWAA 5BVPL 3PP3H 1D5ZA 4R7VA 4NIKB 3W1ZA 4F58H 4X83A 1YECL 1NFDB 4CA4A 1CK0H 1H9DA 4CVUA 1OCWH 3CSTA 1Q9WB 4OZIF 3NP4A 1CD0A 2IXQA 4XVJH 4YWGH 4W4OA 1ACYH 4BGLA 2IOIA 1KTBA 3CSBA 4GUQA 3LKQB 4KTGA 3K74B 4WAFA 3FAXA 5B4MC 2WSPA 5JQHC 1E4JA 4IS6B 1QNZL 4E41A 1L0QA 1UT9A 2FBRA 5GSVA 5C07A 3O6FD 2E7MA 1X4YA 4J3SA 1E4KA 4UIKL 5KBKA 1IB5A 2QLVB 3PWVA 3LDBB 3HC0A 4H20L 3WD5L 4XCFH 3KYMA 1MY7A 4PV9A 4LL4A 5EBLB 1QFPA 3NFNA 3ULVD 4OCRH 4XO5A 1NEZB 1YUHA 1WTGT 1B4JL 2NY2B 4TUUA 4FNRA 4PV8B 2VXUL 5DEZA 3SDXF 2XQ0A 3QDGB 4OUUB 2VDOH 4IIZA 3NIFE 4WUUE 4A7VA 4JFYB 2WY3B 4GAGH 1MCQA 3QULB 1GPOH 4LSTH 2Z92B 2BIMA 3CHSA 4K71C 3DETD 2XKSA 3VXTA 4LKCB 1TQBB 5BNXD 5DJ8B 1SYVA 5JR1L 2OZNA 1P4IL 1I7UB 2RCSL 2XZCL 1C5CH 1WK0A 1HT6A 3E9UA 3KVDD 5E1IA 4Z7NB 2WQ8A 4RAUA 1DN0A 1HHGA 2OMWA 2WLLB 3Q2LA 2MNJB 5J1AA 2RH0A 1A7OH 4F7EA 3L3OA 2J8UB 1S6NA 1V7NL 4ZUTA 4Y9CA 4ZFZA 4AQ8C 3BPNC 1M1SA 1D9KD 1EXUA 1KC5H 2VH5H 3ARWA 4X8GA 5EZOL 5E4IA 1RK1B 2WLKA 4YHOH 2BZCA 4Y2DD 2A77H 2IJ0C 3UJIL 1UJ3B 2ENPA 3TJHD 4OZFA 1DYZA 3KPPB 5AW6B 4G70B 4K3DH 2IPTH 5KSUA 2NX5B 3NCYP 2VMDA 2IV8A 5IBTH 2B1AH 1AMYA 1ACCA 1H9VA 5JYMA 4GXUN 4E2OA 4UV7H 1L6XA 2JFCA 3VXOA 1TTRA 2WO4A 3BUQA 4G7VH 1B4LA 3GXPA 2BFVH 1PQHA 3DVIA 4JJ5A 3V4PL 1VCBC 1FPTH 2M83A 1N4XL 1UXWB 3QPQD 2IQ9L 3S9DB 3BIKB 4MWFB 2N7SA 1C1EL 1KFAH 2ZSWB 5GRXG 3VXMA 3RVXC 2Y1ZA 4F37F 1KPVB 2PW2A 2UZIL 1IW7D 4FFZH 4X9GA 5JZ7C 2YEZA 2O72A 2Z31C 1SXAA 1Q1PA 4O2EB 4QDGA 1L0YA 2QVFB 3QH3A 4BE6A 3FQTB 1JNHB 2NNFA 4KZEH 1BIIA 1RLWA 3QC5X 3ZGHA 3ML1A 1UXSA 4X6DE 2D2OA 3BKYH 4NZUH 1KXQE 2Y24A 3QE5A 5E2TL 2NQCA 4GT7A 2OXHA 3F2LA 7PAZA 1A7PH 1Q8MA 4PJBB 1HILB 4Y4FD 3UTSD 3TGXA 3KWWB 1QDNA 5SWSE 4Y9FA 3KNBA 5L4JA 1QWHA 4E36A 1BFOA 1A6AA 1OTTD 1KLFA 4BRVA 1IGFL 5FDYA 2JKSA 3D39A 3A5VA 1M9SA 4WJ5B 4BELD 4HWEH 1BXVA 2XQBL 3V7MA 5IESH 3NAAL 5EZPA 3JWDH 4L05A 5B22A 3H85A 4ONFL 1FL6B 1ZHNA 3EO9H 2BS8A 5EEZA 4FQ1H 4W4OC 2DKMA 5DGQA 5AW3B 4HIXH 1F4YH 1IBBA 1EGJL 3VNZA 4N2MA 1GGBL 2AQRA 3F7PC 5G5DB 3TBSA 1XIWD 3RDTA 2HN7B 4N0UB 1QHPA 3FL7A 4W9HC 4FNPA 4JO5A 4Z95H 2V2TA 3O6FB 4CNIB 1YN7A 5DZOA 1G9NL 1U2YA 4OKVA 1QSEA 1UA6H 3VXUA 4ONHB 5I0XA 3QEQD 3KPRA 4HWZA 4CU7A 4AYGA 4XXDA 3CN3A 1SUJA 2FGWL 2WWKO 3CSYA 2ICWJ 1N59B 1MWAL 1NIAA 3U36B 2EUWA 3GB7B 4GI6A 4HWNA 4NUJA 5BO1L 5LXGH 4MDIA 1X7TA 4NN5B 4HLEA 2FRGP 5IMLA 1DVXA 5GSRB 2GW5A 1OSZB 4NWUH 2XVLA 3M7OA 3LEVH 4QXTB 4QLWA 3HI1B 4O02L 2VR4A 2BSTA 4NZRH 4M7ZB 1CURA 3BP4B 3MBXL 3FONA 3WEXB 3NEEA 1A7NL 2J1KA 2EAEA 3K4DA 1Q1JL 4HH9B 1P5UB 2FIRT 1KACB 3ARDA 4UT7H 4BK4A 2DMKA 3H9YA 4QHNA 5DVLA 4KQ4H 3DUSB 4WSKA 4GRMB 1JI1A 5SWZE 1C16B 4N28A 2CLZB 1G9HA 3HE7B 2D3JA 3RVXD 1D5RA 2CHXA 4IOIA 5GGTL 4QHLA 5ERWB 1OARH 5DZJA 2FVNA 2GFBA 1D9KB 1ZPUA 2EADA 2P24B 3PDOB 3SBWA 1KEGH 4G7RB 4PWGA 1XHHA 4G80A 5EHFA 2DLHA 4GW5B 1F6AA 4TUOA 4PJAE 3HRPA 3ZIYA 3BAEH 1U41A 4J3OH 5DO8A 1CBVL 2V5YA 3O9WA 5IQ9B 4Z7WF 3TFKC 3EDJA 5E4OA 4XMXA 2QJDA 2YXFA 4AAYA 3DV6B 3RFZA 2RFXB 2XCMC 5TJWK 3SD2A 1X5HA 1KB5L 2ID5A 4PY8J 1JWMA 4D9QD 2GJRA 4EKXA 2MPAL 4GS7C 4JFOB 3CLEH 1AYOA 1T89A 3OAYK 1UG9A 4H0LC 3QPXH 3JV6B 2G3NA 4KNSA 2HZHA 2JVUA 5I1JH 5GGRA 2Y3NA 2AITA 3ZL2A 3QEGH 4OM0H 3Q8BA 5K1NA 5H4UA 4V1DE 2DQHL 1IL1A 1T2QL 4PRIB 3ZX1A 2D03L 4P48A 3JWOH 4DWHA 2BZDA 3ESUF 3IDXH 1E3FA 1F4XH 3F7VA 3PAUA 4IQHA 4TNWK 3AW5A 4KJPD 2C34A 2Z64C 3FN0L 2QHRL 1HS6A 3QXUA 5D7IB 4XX1E 4FOMA 1S4IA 2JLLA 1I1AD 1W0WB 1BXAA 4BH8A 3GZOA 2I9TB 1LEGA 4CVXB 3IN0A 4OF5A 4QXUH 5TD4A 2C1OA 3KCPA 4M5SA 4EVNB 4JANB 1Q9LA 2B4CH 2WIIB 4RCAA 1JXJA 1LEIA 4Y4FB 1IC7H 2LFGA 5F9OH 4R4FH 1GL4B 2HT2C 2VRQA 2D7QA 1M57B 1SYSA 1NGPL 1SMYD 1A64A 5IHUH 2WXHA 4DNLA 3EGSB 3VFPB 1MJJA 2A3TA 3UTPD 1NL0L 1QA9A 3QHFL 1GGYA 3QXDA 2DQEL 3QG6B 3UO8B 4GKNA 2ARJQ 5D1ZD 1BQLL 3G5WA 4XN2A 1V3LA 3BYYA 4R97B 4HPHA 4UAOC 4NQCE 3U25A 1TNNA 3CVHA 4Q58C 3MGOA 1DHKA 3OQRA 3MHZA 1JXKA 4GAYA 4DUVA 3RL1A 5ANHA 1K5WA 2W65B 4XPAH 5TDNB 2N1KA 4MXQD 1ADWA 4YX2H 1XIWB 1E61A 4JPKL 3RDTC 3TNMB 2WSDA 2EYRA 1E4XL 1EHNA 1WFMA 2CQVA 2G3ZA 5CSZA 1A47A 5CN1A 5AW0B 2ZYIA 3QGVA 3GT6A 2DJUA 3TEYA 2OK0H 1X9UA 1JV2A 3QEQB 4MJ4A 5DD5H 2CSPA 3I6SA 1IEBA 2Q5BA 4OZHA 4B3VA 1J86A 2ZJSL 3PDDA 4ZFQA 2DQIH 3BPNB 2QSCH 2FQGA 4KK9D 3NRQA 4ZQKB 2D7NA 4H25B 3ATAA 2ZUSA 5CJBA 4Z23A 3HJEA 1PDKA 5B39G 1OPOA 3RX7A 2GTZA 3FOLB 4LCCB 4NKOA 4Q52A 5CLZA 5FYKD 3TFKD 2Y36H 1VHPA 1CG9B 2H2PC 3TEUA 4XBPB 4MXVF 1E90A 5CP7A 4BH7B 1RJLA 4JJHA 3ZE0B 2ICEA 2B8OT 2HVKB 2X89D 3MRFA 1G84A 2VNCA 3ARDC 4APQA 3K91A 1A2YB 1BLNB 2NXZD 4UNTA 5D9SA 3FYIB 3ARFD 4HHAA 4KI5E 2DZEA 4U2ZA 5BV7L 1OGAE 1KXTA 3CAFA 4ETQA 2ZX7A 3HA0A 3O3DA 2OMYB 1XB6A 2A5UA 2IOMA 4L1BA 3DVGA 1KCUH 3SBWC 3ZTJH 1MAKA 1HINL 1W0VA 2DBLH 4N2NA 4CW1B 5E70A 1AQKL 3NEXA 3BUIA 4Z6AT 1DBML 3KJ6L 4XAWH 4AW4A 4F80A 4R4BB 3O9WC 5D5MB 1H8LA 4HSCX 4JRYD 1XO8A 3CDZB 2WP3O 2F68X 2HYMA 4BXVA 2WYHA 4CN4A 4U3HA 3RFZC 1B0GA 3EUUA 4S0HA 3AAZB 3QQ9C 4QOKD 1IGYA 1P2CB 2FK9A 3DK2A 2BDNH 1CGSL 1YJDC 3S8WA 2VN6A 4PSPA 3GTGA 2V5RA 3E3QE 5DQJA 4N8VB 3OR7A 1QFWM 2EIMB 3LMJH 2KDGA 4QLRA 1L5GB 2VQ4A 5HYEA 3W5NA 4L18A 3BD3A 3G5XA 2B63A 2V9UA 3GKWL 1ZA3B 3O3UN 3DHPA 4NKMA 3EOYG 2IXQB 2P48B 4JG1L 4P2RD 4FQ2L 2D3VA 4OZGE 1I1AB 4K5OA 3VD1A 1BAFH 3CH1B 1GXEA 2FBJH 4PGDA 3V55A 1A14L 4E9XA 1H19A 3NN8A 2Q76A 1WCBA 3RY6A 1KT2B 4AVKA 3V0AC 3MLZL 4RAVA 4WI2A 2YC1B 1ADQL 2CA4A 5GSVB 6TAAA 2VDML 2WZAA 4KHXL 2CE6A 5BXFB 4S10A 5T3ZL 1ORQA 3HB3C 3I2CL 4MTMA 3JTTB 3C6SA 4P2OD 3KZ8A 5KSAA 3CC5A 4PV9B 5IROA 4A6YB 1MEXL 1BEYL 2KL6A 3CFNA 4B9JA 2V8LA 4Y2OA 1T66C 2E9BA 1NCBL 2R23A 5GGVL 2VLLB 3EGDA 1Z9SB 2CKNA 2IANE 4LCWA 5GS1A 2IWFA 3BFWA 1W0YT 4HC1H 2VDPH 2PR9A 2WXFA 1W91A 4PS7A 4UTBA 4Z3TA 4DOHE 4EI6B 3GSVA 3Q2VA 5DD0H 5LGJB 5F96H 2Y1VA 3TPUB 1WAAE 4UT9L 3ULUH 1QFHA 3C75A 2E2HA 1F0LA 2XXFA 3Q8AA 4ZTPH 2FX8L 4F93B 1OGTB 2C3VB 5CBEA 3J2PA 3WIHA 3OHXA 2IG2H 3TA4D 2CCVA 5DJ2B 3C5ZA 3C8KB 2D7OA 3SKMB 1IC4L 4ODVL 5FFGA 1GW6A 2ZOTA 3F6JA 2GEEA 4ANUA 5J1AB 3SE4C 4JB9H 3VDBA 1BMZA 4AUYA 2IH8A 4ODUA 1REIA 3B5TA 3RKPA 4YPGB 4B9FA 1EXUB 5AVRB 4H8WH 3QHTC 1X5FA 4P5KB 4R90H 1OIOA 1DVTA 2J88H 1QTPA 4LARH 4BCYA 5HGBA 4H1LB 5J13B 4WU7A 1S46A 2WLJA 2M26A 3BH4A 3NPSC 1CT8A 3MJ9L 3ELQA 1IFHL 2IDTA 5AZUA 3VXPB 3GGWA 4X4YA 1W72A 4PIBA 2NSMA 4X9FA 3GRWH 1OAKL 3QQ9D 4GS7B 4MNGE 1DBBH 4YHKL 4ALAL 3BGFB 1A1OA 2ICEC 1GIGL 1SJVA 5IHWA 2AEQL 3LXUX 3UBGA 1P1VA 2NXZB 4APQC 4PS3A 4H0GA 3ARFB 3LHPL 3WU1A 1NCDH 3UMTA 2H0FA 3CFDB 4MA8L 2V4LA 1PZAA 1CB4A 1OF2B 4MCNA 5TF1H 3QJFB 4ZMXA 1XGUA 3I9GH 1JN6A 1LO5A 3LZNA 2AXWA 1AD0A 4M5ZL 3W9DB 4GO8A 2YRLA 4PMEA 3ZRSA 4X6CF 1FO0H 2NY5H 1KYAA 4KI1A 5D72L 5IHHA 4JRYB 4Q89A 4EEEA 3ZDYF 1XF5B 1MAMH 4F3FB 2FHCA 5JHDA 1AHWA 4XE5B 4QOKB 4XNUH 2A68D 4HJJH 4XBMA 4R7NB 1MW0A 3CFTA 4DP7X 1J8SA 3SOBL 3IDNA 5HHVH 1V7MH 2COVD 4R2GD 2BNQA 4LSPL 4W9LC 5IEKA 2O61B 4X5RA 3L3GB 4AYMC 1YEGL 2HJFB 2UY6A 3H56A 3L16A 3HKFA 4FZ8L 4PJIA 1OT4A 3BT0A 3UXFA 2AVGA 2MHAB 4UAOB 5KTEL 1MHEA 4JHUA 2FO4B 2HRPH 4P2RB 5SWSD 5JHBA 1DFBH 5DC2A 3PQYA 3F01A 4AM0A 2ZUYA 4HQQL 1SJXA 1ZS8A 4D9LH 4HH8A 4KRPC 4TQEH 4D0BB 1J8HE 4WI0B 5BVPH 4NNPL 3GIVB 4W93A 1CVRA 1F11A 2CDFA 3X13A 4J3OG 1ZY9A 5DJYB 3RG1C 3K6NA 3BEVA 2RACA 1QVOA 2A9DA 4MCMA 3WXWL 4B5EA 2APFA 2J56A 4LK4A 3VXUB 4I5BB 3H2PA 4TULL 3PWPA 2XFXA 4LDCA 4P2OB 4C4KT 1FH2A 1JHKL 1NUDA 1FF5A 4XXDB 4P3DB 5EO0A 5HDBB 5KUMA 3MFGB 5H37H 5IROC 4UNIA 2A9CA 5E6IA 1ILUA 1QNZH 1IQWL 4WW2F 4IJTA 1M53A 5FLUA 3ETTA 3UIZA 2F8XC 3MUGB 4G6ML 4UIKH 3OLIA 2KH2B 5DJXB 5AOZA 1PX4A 1SQMA 2HLFC 3IB4A 1ND0B 4H20H 3WD5H 1R1CA 4P49A 3M07A 3E6HB 3QCUL 3BAXA 4I87A 2CXGA 2X3AA 2CRIA 3D85D 4D9RE 1J0YA 4HGKC 1HZHH 1KLUB 2BNRA 2DQDL 4B9CA 2DPKA 3H3BC 4XXCA 3S3JA 2HPOA 3NIFB 3OHXC 5I8CA 1EV2E 4QHNB 2COQA 3ZDXF 1DZBA 2V8MA 3U9UA 3C5ZC 2APSA 2FSDA 4K8RL 4WK2B 3ARBD 4X80L 4XC1L 4XBGB 5BUPA 1EEYB 3V0DA 3VXNA 2ENSA 1P4IH 3V0VA 2E46A 4QTHB 2RCSH 3IJEA 2XZCH 4GKSB 1FA4A 4NN7B 3T4AA 3FSAA 4YBQC 5CKGA 1QQDA 2KDYA 3QIWA 4JPSA 1S9KC 4RMWA 3VH8G 4CADA 4PVBA 1WIPA 3U0PA 1DEEB 1HNFA 3IDMA 5SWZD 4XP1H 2DS4A 1Y18B 3TM6A 1AP2A 3FU0A 1UEMA 1V7NH 4KUCF 5F9WC 1ML0A 3GINA 1JPGB 2CO4A 4M4RB 3T08A 5EZOH 2AFNA 3MACL 2HCZX 3UYOD 4CDHA 5IFJA 1M05B 1UGKA 3BC9A 1OLZA 3UJIH 3NJLA 4M8UA 4JGJA 2PO6A 4YZWA 5AVYB 4K07A 1TVDA 1Z0NA 2AEWA 2ZNWA 2HB0A 2OI9B 3MRHA 2DEXX 3UCQA 1NEPA 3T65A 2NY6D 3QUGA 5FGSA 3VFTA 1OTUD 2NXYD 4YO0B 1PEZA 4G8EB 1SBSL 4UV4L 1CI3M 1KUMA 4WFHD 4XPGL 3SQRA 3HLAB 5I9QC 3DX8B 5DUML 2ZUUA 4NHUA 3V4PH 4TVPE 4KRPD 1DBKL 4BH8B 4E9SA 1M6UA 4EN3D 1TXKA 2G60L 2IQ9H 1HHIB 2QQLL 3KLDA 4P0DA 4V1DD 1C1EH 2ZSVA 2LVEA 1VAHA 2HLAB 2F19L 2UZIH 4FFZA 1Q9LB 3CX2A 4LLMB 3JBG7 2YBRA 1MN4A 1OP5K 4ANKA 6FABL 1LEIB 1AHWC 4JQVA 4RFOH 4X5PA 1F3RB 2OSLB 4LOEA 5J7CC 3MCKB 3CFJA 1U8HB 5F88B 1SYSB 4DVBA 3WS6C 2Y5TA 4FABH 5IW1A 2FX7L 2XBTA 4NC0B 3NFPB 4PCYA 3GTLA 1A7QL 1CXFA 4G8FB 4R2GB 4UQAA 1QA9B 3AT9A 4L48A 3EJTA 4L8DA 4U49A 1TZHB 5E2TH 1SEQL 4WNSA 2VDKL 2OMTA 2AXJA 4QXWA 5DMKA 3SKOA 3HN5A 1TQUA 3ES6A 5DDHA 3PJLA 4M8RA 1IGCH 5E94A 4HJ0D 4N20A 5SWSB 4OZIE 4ZW5A 1A7BA 4PN6A 5KJRL 2OCJA 3ZTJG 2J6WA 3NIGF 4L1LA 2AQTA 4Z77A 2OM5A 2EE3A 1XFPA 2HMIC 4LCUA 4R8WH 1U4EA 5CS7A 4QHUB 3OGCB 3D52A 4NQUA 3NAAH 5KS9F 2EYRB 3IK2A 4ONFH 4NWTL 2NTFB 2YXMA 2YIHA 4WENB 3S8GB 3LKRB 2VTFA 3CX5J 2ZWNA 4NQCD 1P6FA 4FMVA 1EGJH 5BPPA 1WD8A 1X7QA 5IOPA 4G9FE 3IWVA 1GGBH 5C08E 4OZHB 1QBLH 3SDDA 3BVWA 1MI5A 2XOTA 5LXVA 4RWYL 5M7QA 1EUUA 1EWHA 5E6IC 4LLAA 1UCTA 3RWFA 1N5AA 1ULVA 1B6UA 4DZ8A 1G9NH 2UXVA 2ZKHL 3KPSA 5DYOB 4X4ME 3TL5A 3MUUA 3SZ6A 3BFOA 1WV7T 2ZYHA 3ZZQA 1TTAA 3FUFA 5SX5K 1UB6B 3RWIA 2ZXBA 1R24A 3MSPA 3SDXE 2FGWH 2Y6SC 3ECQA 1MWAH 4JGUA 4I9WE 4POUB 3D85B 5BO1H 3UC2A 3ILDA 4X6FA 3H6JA 4B3EA 3A0OA 3IVKA 4UMGA 3S36X 2AK4E 1IAOA 4QYOB 4IW4C 2WWKT 4XXCC 5CJXA 2WKGA 2P28B 4QRRE 2B9BA 3X1NA 4JY4B 5HDOA 3OKOB 5D9SB 5I82A 3SYOA 5C92A 3ARBB 3MBXH 1A7NH 3WLWC 1Q1JH 3AG4B 3WIFB 1XF4A 4C55A 4OGZA 5CU5A 3UGXA 4WWID 3QO1B 3QIWC 1AGDB 2NZ1A 2NNAB 4DGIL 2VLJE 4GIAA 3PWLB 4KI5D 4U1IA 1HL4A 1OGAD 5SWZB 4BQ6A 2ZF9A 2Q10A 1I82A 3PRZA 4KDLA 3FO1A 1S3KL 1TR7A 2M8XA 3GSQB 1BFVL 4IKKA 3NYKA 4X5QA 3DC0A 5T1KD 3FH8A 1OE2A 4N2FA 3UDWA 1E40A 3MLRL 2XQYK 4RQQB 6PCYA 2AXFA 4JFXB 4PJAB 1CUOA 4NKDA 4PRAA 2YOAA 1CBVH 2I26N 3SO5A 2CPCA 4JR9L 3HE6A 1RIUL 3VRJA 3Q05A 1CFNA 2NY6B 2HRLA 4BE5A 1T1ZA 2NXYB 1WHPA 2MPAH 3ARQA 1FLRL 2YD3A 4TQIA 2FDBP 5DWPA 1NCNA 3ZTEA 4JZJA 1WHOA 2O5XL 4IBUA 4PTUB 2AV1A 8FABB 2DWDA 4KRPB 2DQHH 4EN3B 1NCWH 1T2QH 4XI5D 2D03H 2VIRA 2HMID 3V5DB 4K9EL 3U4EA 3INUL 4PJ5E 1I9JL 5B8CA 1QZ1A 5C0CE 2IV2X 1FZMB 2P43B 3TWCL 3V0WL 4MS6A 4UQ3A 2P26A 2X9ZA 1KJMA 2B1HL 2VABA 2YAQA 2B0SL 4NNYA 43CAA 3FQXA 2MWCA 3LIUA 3T2NL 2YSTA 3AS0A 4XODA 2ATPB 5FGRA 5KOMC 2DM2A 4YEEA 1FN4A 1UKTA 2EE9A 3MRLA 3K5RA 3WIAA 4AL8L 4Y5YC 3SB3A 4HEMA 2DBJA 3QDJA 5J6SA 3ZSSA 5IBLD 2EDNA 4MSWA 1GZQA 5J57B 3TM7B 2Z7WA 3PXHA 3STZB 3HZVB 4UINL 1BIHA 4F5CE 4HAFA 1J5CA 3VH8A 3QHFH 1TJGH 2HFFA 4P4RA 2DQEH 5LCVL 3AY4A 1MPAL 4AEIL 5I1GL 4Q9RL 4LEXL 1TMCB 2IAND 1BQLH 1UWGH 3JWDC 1F02I 4NN5C 1HX0A 4BK8A 2R27A 2XN9A 1OANA 3OHXB 5I1DA 1NCHA 1DDHB 1H0DB 3MRBA 4NQCB 2OTUB 1DANU 5CCHE 3NK3A 4WTXA 2ADGA 2IALB 2ENJA 3KPNB 4YSAA 3NZUA 1ZEAL 3WLWD 2Y7LA 1PYUB 4EXKA 5SX4H 4JPKH 5AW8B 2QADD 2AJZA 1RPQA 3MGAA 1E4XH 5DQ9A 3U7AA 1EH9A 1MLCB 3KPLA 4WU5A 2BSRB 4M7KL 4WV1C 3LN9A 3OB8A 2CDEB 3P77B 4U0QB 2WVUA 1OAXL 1A1MB 1QP1A 5DHMC 3JZ7A 5F9WB 2ZJSH 4EPSA 1AGFA 3OPZL 1S7QA 1KTDB 3IETA 5AEAA 4EI5C 2PPDA 5EEXA 1A1OB 1GS7A 4O4YH 4W9EC 1MY5A 2UVEA 3FRUA 4PW4A 1U6AL 3JTSA 4GPVA 2YD5A 1J11A 4XHQA 4AEEA 5C0JB 3DX0A 2FHBA 3A6CL 2QL1A 3IFLL 2L7EA 5EC2B 3Q06A 2GKIA 3C8DA 5IW3A 4I89A 4Q74A 1WD9A 5BZDB 2N3JA 5JIPA 1Y1WA 5H37G 4JHVA 4KY2A 5I9QB 5DJ6A 1BWWA 1E30A 2WVTA 4FFYA 2ED6A 3CUPB 1PKOA 2ZXWB 1PZ3A 5BV7H 5IFAL 4ETYA 4LLYA 1NMBL 1OGAB 4JFFE 4IKJA 3VGDA 4EIGB 4NKQB 1DQJA 1M71A 3RY5A 4ZOEA 1NWOA 5JHDB 4Z7WE 3BH8A 2YD2A 1NC4A 4LGPB 4NQTA 4M02A 1LL1A 2ZP9A 4W9ZA 3UDWC 3BUTA 1AQKH 3OXRB 4J3OC 1WT5A 1DBMH 1QATA 3IDNB 3KJ6H 3MX0A 3WGVB 2VE6A 2K78A 1T22A 3IFOA 1HWWA 2D4FA 3N0PB 2GB2A 3U30B 3VFWA 2NDFA 3T0VA 5FHBL 2EDYA 1ET5A 3EGXA 3IU3A 3OKYA 1FZOA 1B3JA 1DP0A 5TE7L 1CGSH 1TDQA 2WTRB 4UWQB 1R3JB 4DH2A 2YD7A 5GRJL 1CI5A 2XZAL 2NQ3A 3KBPA 4RIRA 1SIWA 3JWOC 4GQ9L 5B39B 5IQMA 3RUGA 1DUYB 1PD6A 3QARA 1NDGA 2DYPD 3CVBA 3GKWH 1WZLA 5B8CC 3QRLA 5BO0D 3MQIA 3QAQA 4FQ2H 5K33A 4LSUH 2V3VA 4K3EL 4NIYE 4OZGB 3PWPB 3D69A 4KKRA 2ZE0A 3FW6A 1A14H 4JAMA 2IPKB 1J8HD 5FDWB 2JV6A 2WUCH 4QRQA 2BP5M 2E6QA 3CZFA 3MLZH 5CGYD 1ADQH 5AOKA 3L4YA 2J5LC 4KHXH 4LB8A 4L29A 3MN8A 5CKAA 4XR8C 1NLDL 4LOUC 5CGBA 3I2CH 5EBGA 4W81A 4X6EA 1A7RL 5DFVD 3DARA 1MEXH 3FQNA 1BEYH 3P3YA 5I66B 1RK7A 1P5VB 1QOKA 4U1NA 1JAEA 5JA8B 4XP9L 1NCBH 1OHQA 3LH8A 3QUKB 2BSSB 2B2XH 4EI5D 4LLQA 3AY4C 2IANB 2VDOB 4DKFL 1NWPA 1NCAH 2YAMA 4OGAC 4AQAB 4XN5A 4X99B 5FPIA 4V11A 4HWBL 2L7JA 5IUSA 5I8CB 1YZZA 3LKNB 1WEJL 3GSRA 1VENA 3CZEA 3I9AA 5DMJB 4DOHB 2A69D 4UT9H 1PJ9A 1XZ0A 4EN2A 4D9RD 1YUKB 5G2NA 4MNQE 2OSWA 3MCYA 2FX8H 1MDTA 5BW7A 4FTVA 2QADB 1IBDA 3VG0L 4GXVH 2FYYB 4UBDC 4N0FA 1JV5B 4JPWL 2A6JB 1RK0A 2J1ZA 3G5ZA 4JG9A 2CMRL 3I02A 3S35L 4AJYV 4ODVH 3VXSA 5IG7A 1GS6X 2ITCA 4TM9A 1RERA 1KTCA 5ENWA 1RCYA 2W5PA 4QRSA 3FT1A 4MHHI 4UM8B 3VJ6A 3L9BA 1TTFA 2OMVB 2XWBB 1I4FB 3K2IA 2ODIA 4ZW7A 3MRKB 2DWYA 4Y0GA 4GKZB 2O6EA 4YUEL 2GT9B 5IFJB 4YSTA 2OL3B 4TKWA 4MXVE 1WBZB 4MJJA 2R69H 4J3OD 5CWSA 4C59B 4A2EA 2Q6WA 1TFPA 3K6FA 4HFWB 2LHAA 2C4XA 4WK4B 2VMCA 2NT0A 4V2CB 3MJ9H 1IFHH 3UTSA 2X4OA 3H0TA 5AFAA 1XB8A 3V8OA 1BF5A 1OAKH 2J72A 4MNGB 3IAGC 1LWJA 1GIGH 5E9DE 1YNTF 4N86A 4M8QB 5JIKA 2AEQH 3CDYA 3QNFA 5A7EA 1R7RA 5ALCH 2N7BA 32C2B 3LHPH 3MFFA 3NEOA 4KK8D 3AG1B 4TNGA 5D2LF 2X4NA 3PPEA 4DQOL 4YXLL 4HKZA 5C09E 4HIPA 3NZSA 4OT1L 1FV1B 4M5ZH 4Y9EA 5F89B 1ZJAA 4GW4B 1FO0A 4HSAC 1XGQA 2V9TA 4B5ZA 4TVPD 2F53A 4BCXA 1WT5C 4XNQA 5I74B 4FG4A 4P2QA 4KITB 1IJNA 3T6ZA 3IM1A 3RQ3A 4Y5YB 4WEBL 5J3HD 1CGYA 2NOYA 2VXTL 3WDHA 4NZJA 1R3LB 4PJHF 1VSCA 3CGTA 4ORGB 1SXCA 4UIMB 3VA6A 3BESR 3SOBH 3V5HA 2AXHA 4FNLL 4KXZI 3EYFA 5HPMB 1OP9A 4Q6IB 2DKSA 3K71A 3LKOA 4LSPH 1ZT4A 3X14A 4XP4L 3F7QA 3ZHKA 3DRTA 3QUYD 4DUXA 1YEGH 2R0ZL 4X5WA 2DYPB 3BGAA 1INQB 4FZ8H 1S7UB 2L8AA 3DPBA 1ZTMA 5B1BB 4LFHG 5AAPA 1RZ7L 4BQBA 3AU1A 5KTEH 1JHTB 3L4WA 4W6XB 1U8OB 4YFEA 4KH2A 1IBHA 3QRGL 3TO2A 3U2JA 2O6DA 2Q3ZA 5EEUA 1I31A 5L2KA 4KO7A 5DF0A 4PJXB 4PJGF 1J8HB 4G6AD 3W9EA 3LTVA 2IEPA 2WAQA 5EOTA 1ZMYA 3ZKMC 4YSEA 4WV1B 3CIAA 1YY9D 2CW0D 1O9VA 1RMFL 3TV8A 3WXWH 1NGXA 2WQSA 4AVIA 5H2BA 4ANVA 1UWYA 4TULH 4RMUA 2YWZA 3TO4A 1LDSA 2OMXB 1JMZA 1R24B 4HZLB 1JHKH 3RRQA 1NBVL 4Q2ZB 1QW9A 4P8QA 2CKBB 4G9FD 4NO2A 5C08D 4KH9A 1T83A 4U1JA 5CLTA 4OIFA 2W9LA 3UZVA 5DUBB 4EI5B 3X2LA 3OMIB 3IVKB 3F8UB 1W2KT 3DHUA 3AT8A 2ILLA 5F6IB 2F74B 1MJ7L 2BERA 5F1NB 3QCUH 4J6RH 6CGTA 5I28A 5KYWB 2XJLA 4I9WD 2MFNA 3ZO0A 3ULUC 1EERB 1MLBA 2IDQA 3L3DB 3FU7A 3CK0H 2DQDH 3SIKA 1SLVA 4FQXA 3HUJF 1AGCB 4LPUA 2G2RB 4ZMQA 5BW7C 4ELMA 2AK4D 3ZE1F 1AHKA 2YD9A 4C56A 2ADIA 1NC2D 4CMHC 1A5FL 3NZ8A 4QRRD 5AOJA 2WXMA 4K8RH 5KJ4A 5TDOB 4X80H 3OWEA 4IBLT 1U95B 5F2FA 3N1FC 1COBA 3FULA 3FYEB 5ESQA 3JUYA 4GRWF 3P0YL 3EDFA 2RGSA 4H8WC 4YXHL 4JM2F 2LU3A 1I75A 3GHPA 5A2AA 4X9HA 4LVOC 1FDOA 1NDMA 4N6RB 3WEOA 1IBGL 2VLJD 2CGYA 4QKXB 2JIMA 4IBWA 4I18A 4JS7A 2FWOA 2PXYC 3UTQB 2MOQA 3MACH 3VWKA 4GO6B 5JW4M 2NZ9D 1CC3A 2XYCA 3POCA 3MCLL 1XCQA 2Q8AL 3R18A 2APVA 1J0ZA 1NAMB 1S8DA 2VLKA 4YSDA 1T20B 5GGSA 3LPGA 5D1ZA 4NRXA 2Z8RA 1DVQA 3BKML 2VIRB 2AJXL 2HSIA 1SBSH 4UV4H 1WGOA 5DGRA 4ZOBA 2CGZA 5DHDA 4X6CE 2IAMA 4XPGH 3W57A 1YA5A 2VO5A 3D1MC 4B6ZA 4F8LA 3V79C 3W0WA 4Z78B 3V4PA 3BH9A 5DUMH 4IYKA 3ZDYE 1JDDA 4FKKA 5DHEA 2G60H 2NY5C 2CAKA 2J7LA 5AB2A 1D2OA 1DCEA 2NVYA 2MCPL 5CJQL 1YEIL 1M7IA 4PJ5D 2GEQA 5KOVC 3MRLB 3HEIB 4M93B 5C0CD 6FABH 4ABUA 4BGDA 1GZQB 1U30A 4P2CG 2CR0A 5GZOA 1ZJBA 1S9YB 4RVBA 5C0IA 4FHJA 3K46A 3VI3F 3MNZA 4OCYL 1XR8A 5D4JA 3MRMB 4ATWA 3GMNA 3IKCB 4ZMNA 2VPXA 4NBZB 2R0WH 1ZANL 1SEQH 3QUYB 2VDKH 1SHSA 1ANUA 4L4TA 4LF3B 4YGVA 5E5RB 4XVTL 4BWTA 2IC2A 2RALA 5DK2B 4EXPX 4LNRA 1LWHA 2AEIT 1RZJL 2E7DA 4Y16C 4H5SB 3WMSA 3MA7A 2NW3B 3VXRA 2PJHB 4OZIB 3QIBD 3BGMB 1NUNB 1VLXA 1BREA 4I1PA 4HSQA 1UUSA 2WWNA 5BS0E 2KZ1B 3IGUA 4ZYKA 4G43A 4TVUA 2GHZA 5DQ9B 4NWTH 4LASL 3CBJB 3GF8A 1N2RA 3IT8D 4M9PA 4WI7A 2RHEA 1KGXA 5JQ6L 3ARGA 1G8KA 3TO4C 5I0WA 3L4XA 2NVXA 4BUHA 3TV3L 4G9FB 3U1QA 5C08B 4TQ8A 4RWYH 4NOBA 5DEGA 1T83C 1E5VA 4Q0XL 5I0YA 5DFAA 2ITFA 3PPSA 5I71C 2DN7A 2EABA 4PJDF 1JHLL 1BVOA 1KNOB 1L9NA 4KK5C 3JVGA 1I7ZB 3T8VA 1W8NA 2GY7B 2W92A 3U83A 3SDXB 1NLBL 3W3BA 4YE0A 3D4GA 2PXYD 4PGZA 1S7RB 3ZDXE 4MB1A 3W56A 4FJYA 1OOWA 4X5XA 4IGBA 4FQXC 4NDMB 5BZWB 5EG6C 2AK4B 4MYWB 4GLRI 2NYZA 1KCLA 4JFDD 1BZDA 1NC2B 3FCBA 5DJ6B 3VCLB 3WY2A 1DUZB 5DJAA 4KLNA 1TETL 1IQDA 1S78D 4OD1L 4QRRB 4GI9A 3ECVA 3WS3B 4K2UH 5DJZA 5KWYC 4G83A 4FFTA 1G7LB 1KLGB 3AB0C 2X87A 3CHPA 3QIUA 1I3UA 1MCOL 3OKLA 3MRPA 1AQDB 2DWSA 4WF7A 4ZFFA 3BH8B 1DFXA 4CMMB 4NO0A 3TYFB 1UQSA 1RI8A 5D6DA 1WBXA 5A2JH 5DRZA 3MRDA 3MX0B 4L8SB 4MZ2A 2F0CA 4A66A 2MNWA 1OAJA 4FQIL 4JFFD 4UQCA 4FQHA 4AOFA 5HPOA 3IFOB 4HU2A 1S3KH 1CPUA 1AS6A 1BFVH 4I18C 4RMTA 4AENB 3LQMA 4LSSL 4TS6A 5F0MB 4LVEA 4PVLA 4GKOA 1DVYA 2GBAA 4WIQA 3MLRH 3VWKC 3CIQA 3FSOA 3EOBB 3UADA 1VKXA 5BOPA 1JD9A 3AMKA 3OZ9L 3O4LA 4RFEA 5CFHA 2W91A 1MDAA 4JR9H 2R7EA 3O6LL 2XWRA 5EU4A 4HAGA 4JQIH 4G71B 1TEYA 1IM3D 3QCVL 4P23A 2YEQA 1YPZA 4DP2X 4KO8A 1NCTA 2VW6A 3LV3B 4OY9A 2O30A 3MNMA 1ZVSA 2VZ1A 3GWJA 3KBHE 4OTXL 1NUFA 3LYRA 3SBQA 4PJEF 3TTYA 1OK8A 1MCEA 1TJMA 2KI8A 2SEBA 3CFUA 3H4FA 4Y7MA 4HK3J 3D69B 3MYJB 1R75A 1EANA 3POHA 1ZHLB 3HBQA 1IAIL 5C0DA 4RISL 4HVBA 1NGQH 4K9EH 4WUUA 2JIQA 1I9JH 4J3WA 4PJ5B 1PGRB 2NW2B 1A8ZA 1UZ8A 1QFOA 3PHOB 5T3ZE 5C0CB 4F7PA 3ML9A 4OM1H 1OE3A 2HKAA 2B1HH 4JDEA 1A9EA 5JIIA 4HUVA 2FL5B 3T2NH 2C7UA 4DO6A 5GZOC 4QYAA 4MJHA 3R1GH 3C8HA 3QNXB 4U1NB 3J7HA 1JPSL 1JGDA 2XIBA 3CPUA 4MQSB 4KO6A 2X4TA 4MMYB 4HUKB 5ADOH 5F7KC 4TLUA 2VDPB 3L1OH 5D93C 4NN6C 3ORJA 5E2UL 1QX1A 4EZMA 3NIGE 4Y4HD 2EIBA 2EVJA 5AKVA 3V7AE 4G1MA 4PJCF 1DEDA 1TCRB 1FG2A 4G9DB 4W4NA 4YDJB 2WJ7A 5KS9E 5E8PB 1LLAA 4WI6A 1FFPB 3QIBB 4YLBA 3T3PF 1XZ0B 2UXGA 5LCVH 1FZJA 1MPAH 3FZUD 2HG5B 3U0TB 5C0GA 4AEIH 5I1GH 4QRPE 4Q9RH 4K5MA 3VB8A 3ZTCC 1HEZA 2DQ6A 1THCA 1Z5HA 4JFEE 1NBZB 1CZ4A 4NI6A 2UVFA 3ARGC 1OK0A 2NYKA 1EBPA 2ITCB 2WBWB 1CZ8H 1LMKA 3T1FA 1ZEAH 3FFDB 4AC2A 5KBMA 4QRTB 4CBZA 2CBPA 2E27L 1NCJA 2KPWA 4MNQD 2PP8A 2Y22A 5E8EB 3B2UD 4U1MA 1G9NC 1R5WA 3X2PA 4M7KH 1TTUA 3SKUD 2NAPA 1E65A 1MSPA 4UTCA 4N25A 2BMKB 4AGQA 5ETUA 4OUOA 2O4EA 1OCRB 1D2PA 2BVUA 3B56A 1FFOA 3T2QA 2PXYB 1L9OA 1QI4A 5JO5A 5EBMB 2DI8A 2WXKA 5EO1A 2E7HA 4IGBC 1ICTA 4L1TA 1EDHA 3QZWA 1XL4A 3AS3A 4X6DA 2C9QA 1A4CA 1Y6KR 4JFDB 4DETA 3L2NA 1U6AH 3GRBA 4JY5H 3RL2B 2W0FB 1ZXQA 4HHWA 1IVLA 1VGKA 3A6CH 3AXLB 3IFLH 4X9BA 5J9PA 2EYSA 2OMBA 3AXIA 2IH1B 3QIUC 5DK0A 4P5SA 2H47C 1K3IA 5E9DD 1DTUA 3M7FB 4PP2B 3QO0B 2G5BB 2H6PA 3PHAA 4KY1H 5IFAH 1NMBH 1XAKA 1HH6B 4I0KA 3FT2B 1RZKL 2FIKA 2MTPA 2VMEA 2DYRB 4OCSL 2J2ZA 2N0MA 5CO1A 5C09D 4A2GA 2ICWA 3P30L 4RMQA 4B7LA 5E6YA 3GMOA 5CBAA 4Z7WB 2OV0A 4E0RB 3APNA 1TKWA 3MROA 3VX1A 1B9ZA 2AJ3A 1E9OA 2KERA 1HN1A 4F9PC 2CR6A 3GTJA 1UB5B 3QZNA 3V95A 4DGWC 5FHBH 3EF4A 3SQBA 2HJLA 3QAZB 4PYGA 3OG6B 4Y16B 5TE7H 2K3TA 3BUYB 2OTWA 1XSJA 5C0EB 5GS0D 2JF1A 4Y89A 3KGRA 2PW1B 4FQPA 3SKNA 3UO1L 5GRJH 3VTMA 5IMMA 1QLRA 2WXLA 5HY9A 4U05A 4IBVA 4ZO9A 3W37A 3EJYC 1LYQA 1AMXA 4KFZC 4YSUA 3IF1B 1FLTX 3W5MA 4IBQA 1HZLA 3L3HB 5A6MA 2NYYC 3HG2A 1TSRA 5LAPA 2MSPA 3F7YB 1UM5L 2GCYA 1X5JA 1SJHB 2VSMB 5H2BB 4K3EH 3FB7A 3TO4B 5IMOA 1LJMA 4AH2A 1OY3B 3GXUB 4BFIA 2UZXB 2XZQL 1ADQA 2NT1A 2VERA 3FFOA 4S1DD 4U1JB 5I71B 3AQDA 2AQ3A 3DIFB 2I07B 3GYRA 3CFMA 4GG8B 1ET7A 4RA3A 5HHPB 4Y4HB 1RIHL 4N2LA 4AJ0A 4TNWF 2JQAA 3ILPA 4AV5A 3D18B 4ANXA 1A7RH 1KYDA 2E56A 3H3PL 1TG8A 3KDMA 3PWNA 5I6NA 3FT3A 3S5YA 4EUPH 2DLEA 1MLBB 2YA1A 4XP9H 4NJAL 4LKXA 3ZE2F 4FQXB 5IIEB 4N9GB 1A6TB 2FH6A 4DKFH 4IBZA 2J43A 2ATKA 1G7JA 4HWBH 1O7SA 4G6JL 4KNUA 5FGCB 5I76B 3X3FL 4UT9A 3X2OA 1BGXL 2EKSA 5KSVB 1C5DB 3AB0B 3FDWA 3G9AB 1A6PA 3E7JA 1RZQA 1VZIA 3V6OA 4MNQB 2N1TE 2PYEE 3RFRA 3VG0H 4PGEA 1IGMH 1GZPB 4S0SD 1QHQA 1V54B 4JPWH 3PIQA 4QF1A 3Q13A 3S35H 4BFGA 2CMRH 3VFGL 3QORA 2CWRA 3FUIA 3RIFK 4JDZA 2BOCA 3M1OA 3BE1H 4BFKA 1CCZA 4ZUUB 5JUEL 1TVHA 4S1RL 2FEDC 1FNAA 3BWZA 1DQLL 4R5XA 3VWKB 4YUEH 2XBDA 3U6RB 5HVGB 1WUNT 1SN0A 2R69A 3L2MA 4Y4KA 3ZYOA 4KX8A 2XN2A 3GJFH 3AREA 2DQFA 2WB7A 3GLDA 2VLKB 3IAQA 1IT9L 3DOHA 3LD8C 3B7RL 2H8PA 3MJ9A 2WYZA 2VRAA 2DEYX 2H0JA 1S5HB 1HH9B 1JZHA 5IBUB 3U46B 2DDQH 1G7HB 4L4VA 5H4ZA 3S34L 1T04B 5E9DB 1V10A 2IBZY 4WHTB 3EYSL 2UZPA 3V4PB 1CTMA 1ECZA 2ROXA 4CJ0A 3S3BB 5BV7C 3CXDL 1X5KA 2GVYA 4YHZL 2ZXEB 4DQOH 1AS8A 4YXLH 3UG4A 12E8L 2VXQL 2WANA 4OT1H 3VD2A 1EEZB 2BW4A 2VR5A 4FQJL 4C54A 1LE5A 1DVFA 1G9ML 3L08A 4HX1B 3QFGA 1CYXA 3CTTA 4M43L 1MRDH 3WV0A 3TURA 1IU1A 2KMWA 1SFOA 3MNZB 4J1UB 1PS3A 4DKAA 3GMNB 1KBGL 2IBZX 2R0KH 3V4VA 4Z7VA 4X0KB 5IQ7L 1N18A 3AUVA 3MTRA 4WEBH 4BZ2H 2XVBA 4YGVB 5C6PB 3C5SA 5D93B 3S3DB 3BWSA 3CU7A 4AXWB 2M2DA 3VI4F 4JFPB 1T4WA 4XB3A 4E9YA 4X4ZA 4FNLH 4HUWA 2J4WL 5CSBA 1OM9A 4ISVA 3APMA 1FIGH 3TBYB 2EIDA 3K8LA 4L8BB 4XP4H 4ZAKC 1OF0A 2R0ZH 1E9QB 3QUZD 1AS7A 3T0WA 1CDHA 4PJ7F 3CV5A 1AR1D 2A2QT 3CDGB 3DMRA 1KDIA 1RZ7H 1Z5YD 3BCDA 5ACZA 3LPFA 2EINB 4NM8H 3DUUB 3QWZA 1H5BB 3KAAA 3QZLA 3VSQA 3QRGH 1JK9A 3QUXD 1MCNA 4ZW8A 4KAQL 3MRCA 3HVNA 5AVXB 4YEFA 5BS0D 3O4OC 2WWMD 3Q6FB 3QW9A 4M7LL 1KCVL 3IXTA 2WC7A 1RMFH 3ENGA 4WHCA 5IJVA 1BCIA 3P11L 1DBJL 3HPLA 3HBGA 4M6NL 3DJRA 3SULA 1NBVH 2E7LC 1MWAB 2VSCA 4G8AC 2AV7A 2WTOA 3RX8A 3MREB 5EMYA 4ZPTB 5AW5B 2DQUL 3ECBB 5FS5A 1E2WA 2WSKA 2D8KA 3ZSTA 1VFOA 2NUTA 1M56B 3IDUA 5KVDL 1NANH 1P4LA 1MJ7H 4U1GB 1E27A 1NFDF 2A9AA 3NFSL 3P4OB 4FYTA 4O02B 1TT6A 3QJTB 4PYHA 4QAMB 2BIQA 3QNZA 4DK3A 3H7LA 1T1WB 1VRSA 4K55A 5DJZB 2D0FA 2J5WA 4IMLA 2I27N 4OD2B 3P02A 5HI4C 5I8OL 4UUJA 5DSCA 3A4FA 1E5UI 3V6OC 4O51A 3CBKB 3I50L 3N2JA 3EYQC 1A5FH 3EH1A 1K8DB 3KYNB 1PW3A 4X42A 3U0WL 2ZCKL 3BQUD 1E32A 4PJFA 3RVTC 4WTQA 3MRNA 1OB1B 3SCMD 3VWJA 3FJTA 1B6DA 1SY6H 3PS6A 4FD0A 1T7VA 4FQHB 1G0XA 2ICES 3L4UA 3V0GA 3P0YH 4WO4A 3QQNA 4Y1AE 5IVZA 2ZAHA 2WLIB 3FCSB 3ATEA 3DRQA 4KUCD 3QHZH 3H7BA 4E5XA 5FYJE 3U1PA 4OCXL 1U8NB 4IOSD 4X7TA 2WCSA 3I6GA 2K8MA 4MCYA 3DVNA 1IBGH 2ZCLL 4RFEB 3AREC 5I6MA 4UOZA 2JJSC 5CEYB 2XG5B 1KB5B 1KTLA 2E8ZA 2OSYA 1MXDA 1OAQL 8PAZA 4Z7UA 1JZIA 3GDBA 4KWUA 1ZLDA 1NGWA 4A63A 5D2LE 3ESOA 3JQOB 4NQEE 2BH0A 3MCLH 3K81A 5EA0H 1SGKA 2X4RA 1GVIA 4IDJL 4IHOB 2PP7A 2Q8AH 1U33A 3V52L 2JA7A 1PLGH 1EHXA 3N3EA 4P46D 4ZAKD 5E4AA 4CC4A 3BKMH 2B08A 1U58A 3KLAB 1DQVA 2LQRA 3GBMH 2AJXH 1QMUA 2PCPB 5C0DB 3K80A 3HG4A 4P5MA 2FECL 5I1HH 3NCCB 1B2YA 4X6CB 3IU4L 2Y3AA 4TMPA 1GHFL 1XL6A 3MJ8B 1DVFC 4BKLA 1LDPL 2WKLA 1F3JA 3DGGA 4TTGA 3UG3A 1RURH 3LZPA 3GUFA 3ZDYB 2VDQL 3S96A 1BQUA 4HIJA 3KVQA 3L5IA 3V10A 5JOFB 2R83A 1EJFA 4L1DA 3TZVA 2MCPH 4PJHE 1YEIH 4ZG1A 5BQDA 1TITA 1C7SA 4KMQA 2V2WB 2HRGA 1CIDA 4FE9A 4UQIM 3BX7C 5T3ZD 1FIEA 3NK4A 1ACZA 2HFTA 1MCFA 4JFSA 1WITA 1U8QA 4G1MB 4NC1E 4OQTH 3WFHB 2FO8A 5DFWH 2VPWA 1FVCB 2V5MA 4F2FA 3UJJL 4OZ4B 2LLGA 4PRDB 1U8PA 1K8IA 2DQTL 3B5GA 4KKCC 5JPMA 3QUZB 4XVTH 3ZQ9A 4MMZA 2YN5A 1AR1B 3KXFE 1UC6A 4PJGE 2QHLA 1BQHG 4GP5B 1RVFL 1FL3A 1KIUB 2OJEB 2Q1EA 5DZNA 4NCDA 4UI2A 1ZV5A 1NAKL 3QUXB 5ITBL 3NACL 4NFDA 4R3SA 2L3BA 4IJ3B 4LSRH 4OQ1A 1A3RL 3MNVA 1R5IA 3FQUA 1U9KA 5KVGE 4PGBB 4BSWB 1OT1A 2EIEA 4OF6A 4QRPD 4NENA 5ESAB 1E3XA 1YLBB 4LASH 3PAZA 4OF7A 2OP4H 2WNKA 4PLOB 2K6WA 4WW2B 2XU9A 4TRPL 5JQ6H 2W81C 4JVWA 4A7GF 3G6JA 2VLRE 3NUKA 4KV5F 3TV3H 2CBOA 3KPQA 4XWGH 3SUKA 4XMUA 2PWGA 4KU1A 1KIPA 3VFRA 1MCSA 4I88A 1RLBA 5AW7B 3SGDH 3V6ZB 1PSKL 5KW9H 1FFNA 2X1WL 1JHLH 1JPEA 4HXAL 3EYVB 2DM4A 2H7WA 3RWGB 3IFNL 2DQGL 3EUDA 3HC3H 1OD7A 1KGJA 1P7QD 4AIXA 2D31A 3HUJE 4OV6F 4WKZA 4F91B 1I8IB 1NLBH 5FR3A 1VJSA 1DVUA 1S7SA 4JHAH 3ZE1E 5DD6B 1KY7A 3ZDXB 5CCJA 3RTQD 5HJGA 5DK0B 4FG6C 4U1LB 4OLZH 2Q86B 5KN5A 4F2MA 1UATA 5GISL 2EKJA 1PX3A 4ABVA 3BQUB 1TETH 4GRWE 3I3BA 1R33A 4OD1H 4K8RC 3CZKA 3PYCA 3SCMB 4JO3L 5HGHB 35C8L 3VE0B 3SYPA 5DRWB 2B59B 2FIKB 2CUHA 3IDIB 1W16A 3QQDA 1MFBL 5EO9A 4WO4C 2EDQA 4MLSA 4EUPG 1GYUA 4PWIA 2X12A 1Z1WA 1ASOA 2H2SC 3FTSA 3FOMB 4C57C 3LQZA 2AQSA 3F65A 4CVZA 2CH8A 5HDWA 5CGMA 4KXDA 4NXKA 3APCA 2D2CC 4IRZA 2QSVA 2J73A 4LP4A 4OSUL 4LSVH 4LSSH 1I1FA 1ITBB 3OKKA 5CEZE 4QD2E 1MHCB 2IWGA 3S8FB 5EZLB 3WDIA 4JZOA 1S7XB 2CCWA 3BKCL 3OZ9H 3W39A 1AI1L 1PX8A 1X9RA 4KJWC 4XHJC 4P46B 3O6LH 4JQIA 4HBCL 3VFVB 1ETZA 3QCVH 4XZUA 4ZAKB 3LPOA 3TEXA 3VQMA 4QXGL 4CC4C 5F0PB 2EIZA 5IMKA 1C9SA 3OAZK 5ITFA 1KG0A 3R8QA 3ARUA 3WN6A 4EDXB 4I85A 4PMFA 1TENA 2ZPKH 1LD9B 4ODTL 5HHNA 2NMSA 4KRMB 4NO3A 5IMOB 4MNHA 4FQQB 4PWFA 3UH8A 1Y7VA 4JP7A 1IAIH 4YQXH 4RISH 1AQHA 2PCFB 1PZSA 3O4OB 5B7MA 5L0QC 1NCIA 2VDMB 4YL9A 3VI3E 5I6XB 4BIKA 1X6LA 5GXBB 1IBYA 3UZQA 4XTRC 3UACA 5EC1B 2JIRA 1R3HA 4LLDB 3X12A 3PWNB 2DQJL 3MLVL 3T0EE 5L6YL 1JPSH 4LKXB 4JFTA 2MCAA 4Z76B 3UTTA 5EU5A 3E1ZA 3L54A 4RX4A 2FR4B 3EF7A 5JPMC 5E2UH 3HPJA 3LEYL 4FA8A 1G7JB 3NIGB 1KBWA 4HIEA 2BVEA 3QJHB 2YKLL 4P99A 5IB1B 3TJEL 4R7DA 3B1TA 1JFHA 1XSIA 2J20A 4KXAA 1Y1DA 1WIUA 3EFFA 2VM9A 1E6OH 3GBEA 1LEKA 1KIRA 3FHQA 1YC7A 4QRPB 4YHPB 3EO0B 15C8L 1DJYA 2CJTA 4P3WA 5F7AA 3BRDA 5E9NA 3PIQB 3PWJA 4AMKL 5IF0B 4CN6A 3HZMA 2CR3A 5FTJA 1BBDL 5D4HA 4A2LA 4UQ2A 2MCG1 3NJJA 1EFXA 4YHIB 1RHHB 3SYAA 1GKEA 4OIIL 4HIIB 3QISA 4N0YL 3EHBC 2X6AA 4PJDE 4QY8B 1KF9B 2E27H 4I0PA 4FNQA 4QGYA 5JHMA 4GSDH 2PYED 2RD0A 4M29A 4PS4L 1S7VA 4DO4A 2R2EB 1D6EB 1KYOK 2XX0A 4FI8A 1XVSA 2X70B 3PFQA 4U6YB 1P7HL 1VERA 1P7QB 3K72A 1A21A 4LSQH 1MFAL 1D3CA 3AWFA 3ML8A 3QG7L 2H8PB 3IDJB 3D25B 2I9LA 1IBFA 1G7QA 1PZ5B 3CU1A 4WKXA 4JHWH 2NY1D 4UTAH 3RTQB 5EZJB 1HESA 5LJYH 3NSFA 4U1SB 3REWA 5LGYA 1CFQA 4PY7A 3K6SA 4RLDA 4RDQF 3GSOA 3ZQXA 1E6JL 3UIYA 3DBXA 4POYA 4ZUSA 2R8SH 3EFOA 3P54A 1ROCA 3OSKA 1Z9MA 4FG2A 1ZA6A 3HHMA 3MRRA 4KKAD 4AY0A 5CSGA 1J1XH 1I7RB 4IHBA 3P9WB 3VNYA 5H94A 4XP6L 1QLEB 4LHJB 3SPVA 3BD5A 1P7KA 1RZKH 4HA1A 2DD8L 1TWCA 1XF3A 3RHWK 5HDQH 4OCSH 1Y4ZA 1KCSL 1X5ZA 4TVSa 3EOTL 3P30H 3KD4A 5EOCL 2BLFA 2VR3A 3N5AA 4QO1A 5DVKA 1PKQE 5E0FA 5F8RC 3THMH 2MCMA 1P6AB 1TJHL 1IKFL 4WK0B 3ZE0F 4FXKA 1QRNE 3KH3A 2PTTB 1K4CB 4HUCA 4N90E 1U93A 4EJ1C 1TYJA 1IGTA 5ES4B 3Q5OA 3HI5L 3EOAA 1OB0A 2VZSA 5C0BA 5CAYB 4ZFOB 5J4MA 4WHDA 4PJEE 1D5IL 2A83B 3KE0A 1A3LL 5KVMC 2VITA 3M1BA 4XCEA 4NQSB 5C71A 3RX9A 1OLLA 1SOSA 3UO1H 3HCVB 2WXRA 1JFQL 4BSJA 1HZKA 5C0ND 5I75C 4K9EC 1DE4A 3IPFA 1TQTA 1FCCA 4ZUWB 2DMRA 2V7HB 1NGYB 4M8VA 4XX5A 2EEOB 1HNGA 3IS0X 3V0JA 2G9HA 3IXTB 2PWHA 4K3GA 5D5MF 1X5LA 4ZSOE 3SDAA 1UM5H 4P57B 5BRZE 4I8DA 3KCWA 5BOJA 4V33A 2PNDA 2H1XA 3I75A 3Q2CA 4WI3A 1U8CB 1PZ2A 3N0AA 2QPUA 4H0IA 3U2IA 1CICD 3KGSA 2XZQH 3RWEB 2F18A 5E4EB 5IM7B 3GK8H 1E0OB 3IJHA 3QWOA 4PJCE 2CO7A 4KDVA 4OVUA 4AL8C 1U8IB 1I3QA 2VLJA 4BA8A 3Q43A 2NUTB 4NLAA 4HOXA 25C8L 3S98A 3T3PE 1RIHH 1V8HA 4QUOA 3MPCA 1QEWA 3H3PH 2FE0A 1EIBA 2P5EE 2IGTA 3MBED 3ROOB 4DCQB 4JP6A 5FF6B 1CXIA 3ZL4H 5DUJA 1Q9OA 1EZVX 3K2UL 4UUJB 4KQ3L 5AVTB 5IEHB 4AOKB 2OMUB 2X7LA 1A6ZA 2AP2A 4HWBA 4AT6A 2LU5A 3HAEB 1GC1L 3SPIA 5T1MB 1BVNP 3E8VA 4G6JH 4D0CB 1F97A 5EV7A 4FQCL 3X3FH 3O8XA 1BGXH 2A6KB 1GAFL 4JO8A 2H26A 4PCTA 3MUJA 2YAFA 2PYEB 1PMYA 4O2CA 1SXSA 1ZV2A 4PJ8D 1P1ZA 3IR5A 2OZ4L 3BP5A 3P3RA 3PU7A 4KKNA 4PRNA 4BV1A 5I15L 3NH7L 3IJYA 1X9LA 4PGCA 1ITCA 1NJ9B 3F58L 3DOSB 1BBJA 4OV5A 3GHBL 4MAZA 1PCSA 4S1RH 5HYIA 5JORA 3WNIA 2YFOA 4HEPG 2WGNB 1H8OA 4FNSA 4OFVA 4XN7A 2G3XA 1VDGA 1OE1A 4Y1AD 3FO2A 4L5FL 3BZEA 4P59H 3GJFA 4HIHB 4ZPVA 4YOKA 1IGIL 2C1PA 4YFLI 5FYJD 5FKPB 1IT9H 4JO2L 5DD1L 1FZKA 1C08B 3ULAB 4YC2C 3ZTNH 3HZ3A 1CF8L 2ED7A 1H3TA 3SE3A 5ISZE 1KPRA 1LNUA 1ES0A 1OM3L 2NZIA 3S34H 2YPLE 4NQED 4LU5L 3JV0A 3EYSH 1F3JB 3D8MA 2IADB 4NUGL 1ZT1A 3CXDH 1E5YA 4YHZH 2NR6A 3VGHA 2XY2A 4K23L 4JM2C 12E8H 2VXQH 3V5KB 1ZE3H 5IB3A 5DMYA 3GS4A 4PJ9A 4FQJH 1O7DC 1D5MA 1G9MH 1MFDL 3RWHA 3B9DA 3BPCB 2CRMA 4LIQL 4LQFL 2DWEB 4M43H 2X9WA 4MD4A 2H45A 1RHFA 3JV4A 3H9SE 4FXKC 4FMKA 1UM6L 4P3CL 1PQZA 3GFUA 4H7VA 1KBGH 5JXED 5IQ7H 1B3IA 1WG3A 4BZ2A 2VDKB 2I32A 4JK0D 1SBBA 3BO8B 1N6VA 1JVLA 2OMZA 1MRFL 1X5IA 2PWEA 3A24A 3BDXA 5I19H 4HJTA 1WC7B 2O5ZL 2D4DA 5E1GA 1EJOL 3N41F 3C09B 1T5XA 3L6FA 1XWVA 1BECA 4FGMA 3C9NB 2WN2A 4MJ5B 4H4NA 3SE9L 3WNPA 3MRQA 4OLEA 2V17L 5F6HI 1IGJB 1KWGA 5ID1B 1BPVA 2OQJB 1BQSA 3IMBA 3FRPA 1GZHC 5HHOA 2VL4A 1O9ZA 1G7MA 1EAPB 1IE4A 4PRPE 3VRLF 2GIYA 3KXFD 3PV6B 3UBXG 3SDAC 5C70A 1HK6A 2X4QA 1TMQA 3CFKB 4EOWL 4N8UA 2ZOOA 1GOGA 1NDTA 3PL6D 3EHBB 1KGUA 3U48A 4KAQH 3FUNA 4R0LA 3OXSB 1CICB 2IF7A 3OJMB 2PJJA 4GSQA 1S9XB 2BPBA 3QT2A 3DURA 2HRHA 4D7ZB 1CE6B 1KCVH 3GM8A 1B0IA 2BY2A 4M7LH 3BCFA 4D8PB 3MV8A 1LWRA 4HG4J 2AE0X 2JJUA 1YAIA 4M5TA 3BVNA 1DBJH 3P11H 3TP4A 3HNSL 2VPYA 3QI9A 4Y19E 3D3VA 3PFUA 4M6NH 3ZE2E 1Y5IA 1EK3A 2VLRD 5DHVA 4HU8A 2EDOA 2IGFH 3MBEB 3R06A 4J8RA 2DQUH 3M88A 4KMTH 4N2AA 1H3XA 1XGRA 4RSYA 5J12C 1AQ8A 3Q6GL 1SF5A 2J57A 3LSOA 3O3BB 1M6OA 3D2UA 3QR2A 4G8GA 2UUDK 2EVFA 4GQRA 4CVWA 1RAMA 1I7TB 1OP5H 3QR1A 4MZRA 1IM3A 4WFFE 4AUJA 4ZI8A 1AGBB 3QEUA 2OX5B 3BAJA 4LO9A 2IH9A 4ZXBA 4MA3B 1BPLB 1A9BB 5INDA 4B9PA 3VFOB 1U42A 3R0NA 1I9IL 1NMAL 5F9JB 4NAJA 3DDGA 4DW2L 5I8OH 5IY5B 5KYYB 4PH8A 1LE9A 2JCCA 3WTUA 5HDBF 4IRSA 1S2EA 4J8QA 4PP1D 2ETWA 3GQFA 4PJ8B 3I50H 4AJWA 3U0WH 2ALAA 2ZCKH 1RUQH 4UTBL 2P8MB 4UCFA 4L9LC 2NNCA 3EH2A 4YPJA 4CVZB 3H53A 4JREC 4N2KA 1SY6A 3RE0A 1Z9PA 2GJJA 4JM2D 1SLWA 1HSBA 1AIFA 4J2QA 1G6RB 5E1HB 4B53A 3X2JA 3QQ7A 4G8IB 5B38G 4Y1AB 3HZYB 2Y7QB 3JT0A 4OCXH 4YGAB 4HIQA 2CDGB 2L7UA 2ZCLH 2MJWA 1WIOA 1BAWA 2ZD0A 4D7PA 3HRZB 5K9JL 1E5AA 1N0LA 1YNTB 4RH4A 2QKSA 1OAQH 5D7JA 5LN8A 1CMOA 4XWOD 3SE3C 4X2UA 1VC3B 1OA7A 5CEZD 5D2LB 4NQEB 3FSWA 1PEWA 4AC4A 4IDJH 3MV7A 1K5NA 5HHNB 1TZOA 1A1NB 2FGZA 3DTUB 3N43F 3DO7A 2WZ0A 5I75B 1XF2A 2NR6C 2ITDB 5H8DA 5BVJB 3BW9B 4N8CH 2GUOB 3WFCH 1W72L 2A1WL 2H1LM 3IU4H 2GJZB 1GHFH 1I1CA 4PJ9C 3KPOA 5A7BA 1LDPH 1YY8B 5T5NF 1JVKA 1MCWW 4BWWA 2ATAA 1DN2A 1S7WA 1OXYA 3HR5A 3LEXB 4HWUA 3VI4E 5LWYL 4PJHB 5K69A 4JKKA 2GJ6A 3TVMD 1MWOA 3HN8A 3MNWA 4XNBA 1KTJA 1T0PB 3EJQA 4YDKL 1N68A 4GY4A 1UFGA 1MCBA 1I1YA 3RA7L 2QGCA 4OQTA 4OFYA 3M6DA 1AW8B 1XXFC 2LAGB 3DXAE 3MUHL 5EU6E 2F5BL 2CU9A 4PJ7E 3UJJH 1EMTL 3T0ED 3AXHA 1JMXA 1G1YA 3UAJD 1BDYA 4PUBL 3C60A 4LVNC 2DQTH 3BIAX 3GHEH 5KVFL 5MEQA 2DM3A 2AJVL 3X1BA 2X4UA 3T1WA 1CFSB 2PPCA 4XOCA 3KXFB 3PHQB 5DA4A 4BSVA 4EE2A 1RVFH 3GC3A 4RA0C 5DEFA 3F5WA 1NAKH 5ITBH 4LAQH 2HKFL 1SDYA 3MMEB 1EFXB 3NACH 3PL6B 1EVUA 4AQZA 1CLZL 1CGXA 3AITA 2WINB 4R0LC 3TT1L 1FHGA 4GMTL 3FO9B 2AW2A 1ED3B 4ENGA 1RZ8B 4ORZC 3RNKA 2VAAA 4Y2LA 4GBXA 1U3HD 4Q6KA 4ODXB 3GZPA 3H9HA 2MQ0A 5C09A 3PE9A 3QI9C 1C12B 1IEAA 3FTZA 2EO9A 1V55B 3GNML 5AVZB 5I24A 5CJ5A 2V5SA 3LKPA 3U7YL 1G7QB 3GO1L 2X1QA 1NFDE 4RNRA 3OJDB 4F58L 4X6BA 3CFEA 1PSKH 1UZ6F 4P05A 4YWGL 4HXAH 2QMJA 1PQFA 1QABA 3IFNH 2DQGH 4J4PD 4ZS7L 2DH3A 3K6SB 3HUJB 3KGTA 2HVJA 1GGIL 1SJEB 4J7RA 4MDJA 1NIFA 3WLBB 4ZXBC 3ZE1B 3FFCE 3RPKA 1T0NA 1QSFE 4I9XA 4OZHF 1JK8A 4IRSC 1Y0LB 2BSED 2UY7A 4E42A 2Z6FA 3ERXA 4DZBA 1AHMA 3IPEA 3QA3B 2V0AA 4XCFL 3GZQA 2EDFA 4EQ3A 4GRWB 5ID0A 4JO3H 35C8H 1E50A 2XFGB 4JM2B 1BQHB 4UM9D 4BUGA 1P84J 2ZP8A 1B4TA 3CSPA 3TX4A 3BHBA 3T4YB 1J1OL 5C7ZA 1IRAY 5AG8A 5KVEE 1MFBH 1YYLH 3VG9C 2H9GB 4MJ6B 4TSAL 3FTGA 4LESA 1E28A 4PR5B 1BG9A 4AYID 3MOAL 1AJ7L 1PD1A 1YN6A 2XNAB 4L3EA 2AZAA 3MTXA 1MCHA 1IAKA 3BZ4A 1MIEH 3Q1SH 4OSUH 4XOEA 5D7JC 1CLOL 4B9IA 2P80A 3QUMB 5I0ZA 3EJRA 5KUKA 3II1A 1C5CL 2X4PB 4NQDA 5CN2A 4LEOA 3GBLA 5AAMA 5AKRA 4R4NC 4YR6A 4AK1A 2C7FA 1AI1H 1QRND 4BZYA 1J10A 4Z77B 3NP3A 4N90D 4JPQA 5C8JA 1SDDB 3GBNL 5EIIG 5HGAB 1FYTE 4QXGH 5AYUL 4QIRA 1CDGA 2TSAA 1AVAA 5TGBA 1ID2A 3KHOA 1KC5L 1QYGL 4UDTA 4DAGL 4JCMA 4YHOL 3SDAB 3C6LD 2C45A 3CFBB 2FJUB 3AU0A 4YN3A 2CM5A 4F8TA 2Z93B 2PWDA 5E8NA 4YSQA 4ZUVB 2QQQA 4JPIA 4GFTB 3W2DH 1KIQB 1U2HA 3G04B 4K3DL 2IPTL 3WNLA 3TASA 3SY0B 3BPOB 5IBTL 3TVMB 2OXGB 4R7LA 2O5NA 1FNSH 1LP9A 3H0GA 1WJ3A 5BRZD 2Z1KA 4XMVA 2C9RA 3I6LE 3QDME 2QTVA 1ZSDB 2BFVL 5GJTL 2C9SA 4G42A 2WQWA 3MLVH 5SV3A 4EUPB 5FECB 5J12B 5TE4L 5L6YH 1ZKAA 3T0EB 4KKLC 2XHNA 3HG0A 4AQ1A 1WH0A 3C60C 5ABZA 2Y72A 4FI7A 3GMMB 2O5JD 3FBQA 1AACA 3F6IA 2DTML 5MI0C 3ZW3A 2YKLH 4WGVB 1OAUL 1BOGA 3TJEH 4N2IA 2F8IA 2OW7A 2P5ED 3EH3B 1JWUB 1UH2A 4PVMA 3VXQB 2FWLB 3HG1D 4GP8B 1Q0EA 4OI8A 5GPRA 15C8H 4KV5E 1TMOA 2BP8A 3P2TA 1HHHB 4AMKH 2FHFA 5J8OA 5I16B 3ZJAA 3L7FA 4L9LB 5D1QA 3VDCA 4C2MA 1D5BB 1SOXA 1U3HB 4WEEA 4JREB 3WUWA 1ZLUH 2PLTA 2Q20A 4G7QB 2EEXA 5LHDA 3IJSA 4N0YH 5K9OA 1XSOA 4PJDB 5D1XE 3LX9A 1L9SA 4MHHG 5LGHL 4Z5RA 4HDIB 2UYLB 4HWEL 4PS4H 3E2HB 5IESL 4UDUA 2EDHA 3DO4A 4ODBD 3EO9L 3R0MA 4R96A 3IGAA 3BZEB 4KTDL 4OFPA 2CHWA 3D0LA 1X5XA 5I1IH 1F4YL 1MFAH 2UZYB 3AWGA 3WFDH 2CZNA 2X10A 4LOFA 2K9FB 2BC4A 1J0KA 3N1PC 4OAWA 4UTAA 3TN0D 4U1HB 2EE0A 3CBRA 4Y5XB 5AG9A 4ZMAT 1N10A 2FWUA 4UU9B 5J56B 4R4ND 4M5YL 5K9KA 2WUBH 5IB5A 2Z1PA 1QBBA 1T4KB 3NPZB 1MRCH 1ZHKB 3HZKA 1NH6A 5D6CA 2XIIA 1FNEA 4IRJA 4TSBL 3GJEA 4UM9B 4ZDHA 1USQA 4K7PX 4FFWC 3WY4A 5ISZD 1JIBA 1BZOA 1Z5LA 4HZAA 4LMQI 3A22A 5EU3B 1GSKA 2FEEI 2WBJD 3ZU8A 1U92B 2YPLD 4ELKB 4ODHL 4CS0A 4HETA 4K7FB 4G7YH 4I13B 4MX7A 2XTJE 4NWUL 1V3MA 4XP6H 4Z3HA 3KS0H 3HIZA 1T21B 3W11D 3FK3A 3IDGB 2PYFB 3IBOA 1SF3A 3UPAA 3VYPA 1KCSH 2OS7A 5D7KE 3EOTH 3GMRA 3QWRD 5EOCH 1J9RA 2KLTA 2UX6A 3K0WA 1CD1A 1PKQB 5AAMC 1TJHH 1IKFH 1UWFA 1ZWIA 2A9BA 2NSXA 3WHXB 1LTXA 4KQ4L 4A7SA 1DSYA 2F7RA 3PABB 1QRNB 4TUJA 3MDJA 3FB8A 3L9RB 3L95A 5CUSH 43C9B 2QQNL 1WICA 2BY3A 2P49B 2QGBA 4FDWA 3HI5H 3ELAT 4LVNB 2Y7NA 3MRQB 5GS2D 3MRJB 1D5IH 1OARL 2A6DA 1A3LH 1T6WA 4PJEB 3AC0A 4BK5A 4CRYG 5JIDA 2IFGA 3U2SA 1JBJA 2IVFC 3ROLA 4YHNA 3C6LB 1DJHA 3BZFB 4HKJA 5BZXA 1J05B 3TA3D 3L3KA 1UKSA 1JFQH 3AZUA 2HFGH 2ZZUT 4GA6A 2ZCZA 4F7KA 3X11A 1LGVA 2OPCA 5L8JB 3CG8A 2Y07H 3QCTL 3NA4A 2P7TA 3B9VA 4PRPD 4WI5A 2YAPA 3GSNB 3CLEL 1T0MB 5B1KA 4MJ2A 2E2IA 1DLHA 3QPXL 2FB4L 1UM4H 3ETBF 2MQGA 5SX4I