3D30A

Structure of an expansin like protein from bacillus subtilis at 1.9a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
MAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin like protein
publication title Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Peptidoglycan-binding protein
total genus 52
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3d30A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 3d30A02
5H4UA 3SULA 2PNWA 4FFTA 3FT9A 1HD5A 1BW4A 1N10A 3X2PA 2VXQA 3X2GA 2KQAA 2PJJA 2HCZX 4FG2A 3SUMA 4ZM7A 2G6GA 1WHOA 4L48A 1WC2A 3CZBA 4ENGA 2PI8A 3X2NA 5GM9A 3SUKA 3M3GA 2BH0A 2ENGA 4FERA 1WHPA 3X2JA 3X2MA 3X2LA 4JS7A 3X2IA 3X2KA 2JNZA 1L8FA 5GLYA 1OA7A 1OA9A 4AVRA 3X2OA 4JP7A 3SUJA 4JJOA 3FT1A 1BMWA 2PICA 2G5DA 3ENGA 2GAEA 4JCWA 2AE0X 1BW3A 4FG4A 4JP6A 3D30A 3X2HA 5GLXA
chains in the Genus database with same CATH superfamily
3VXPB 4APQC 5DD0L 1SM3L 1MIEH 3PJNA 4RH4A 1JGVL 4PP2A 1DQLH 3MNWB 1H3UA 3MOAH 1FCCA 4QHMB 3JWOL 3T65B 3GXNA 1N5AA 1TJIH 1YN7B 1NCDL 3ARDC 3WNOA 4D9RE 5AW8B 2DIBA 4XVTH 3HFMH 5I30L 5AFAA 4DP0X 2BSEA 1S9YA 4JG0H 4PJIF 1EEYA 4L18A 1F8TL 3WMPA 1Z3GL 2DWSA 5D9SB 5FGCB 3C6LA 5F7EH 3K2UH 5GS0L 1V7NL 5CEZL 4TVPL 4AIZA 2WQ8A 5I76A 3OKLA 3F12A 3HI1A 1L7TL 1T1WB 3G5ZA 3R18A 5C0ND 5DMYA 1E8YA 1BX2A 2R56L 4DKFL 3AXHA 2CCVA 1XGRB 3CPLB 4WWKC 3FT0A 1BD2D 3UYPA 3B8SA 5J12C 1IARB 1FL6A 3K0YA 4IOIB 4I85A 5EEUA 2OI9C 3VG9C 2H7WA 5GGQH 4ETQA 5IFJA 3DX9A 5BOPA 5JW5B 1BZQK 4QHKI 1KBPA 5D1XA 1MI5E 2JCCF 5E7FA 1CFSA 4LFHD 2WWMD 2WLIA 2VR5A 1DBML 3KLDA 3ZIMA 3DVGA 4XNZC 3HOGA 1RZFH 3BAKA 3MFGB 4ZX4A 1QUNB 4FXLA 1A8JH 2VLKB 4OZIA 1BM3L 4KVCL 3G6DH 4FXGA 4FNLL 1HL9A 2APVA 2ARWA 3FXIC 4GSUA 3T0WA 3IRPX 4K8RD 2F53D 4MGXA 2Z31B 1C5BL 2QGBA 3A4DA 3QUXB 5H4YA 1PD6A 5I1HH 3O6FC 4TS6A 2AEQH 5L2KA 4RA0C 4IJ3C 2WN3A 2XA8H 4JRFA 1WG3A 4NO3A 2CKBB 2FQGA 3SKMB 2GIXA 3PQYD 1QBMH 3T2NH 3QZNA 1QBAA 3AU1B 3ZDYB 4HOMA 3CBRA 15C8L 1SRDA 2CLRB 2CLVA 2WQSA 5J5EA 4JJ5A 5JUEH 1DQDH 2X1XR 1WFIA 3TBVA 2VNCA 4HK3J 5L2JA 4OGXH 5MEND 1U3JA 3QEQA 3TZVA 4N6QA 2MCPL 5TE6H 2FX8H 3ULVD 2CO2A 3U9WA 4LCYB 5C0IA 5D1QB 4MBOA 1CE1H 2W65B 3LCYA 3QJRB 3Q1SH 5GSRB 4M1DL 1O5DT 2AEPH 5DRNB 1R4XA 3X2LA 4QXGH 4M4RA 2BOCA 4GRMB 2WJ7A 2PW2B 4H26B 1OKEA 3S35L 1KXQE 4PI0A 4OGYL 3L2LA 3S3DB 2F9BT 2H9GB 2Q10A 1UWGL 1VFAB 3RWGB 3IFPA 4PRID 2X7LA 3U2JA 4JFVA 4PVMA 4S1RH 1JDDA 1X4YA 2NY2B 3H7BB 2G4EA 4MAYA 3RYMA 1TETH 4NO5A 5ID0A 2BSRB 3D0AA 2LV4A 4RAUB 1G7PA 4U1GB 1WLHA 3KCWA 1G9NL 5BUGA 3BP7B 5KS9F 4TVUA 4HP5A 3I9PA 4W9LC 1WVZA 1A9BB 5MEOB 5CCKL 2EDDA 4N22A 4FQHB 5LXGL 2UY6B 5I1LB 3MLSL 3PAUA 4RGND 3KLKA 4Z3JA 4Z7OE 2BS8A 4Y1AE 4PGCA 1QBLL 1A6ZA 3MJ6A 1PNCA 1IIIA 2ATPA 3KYOB 4IOSA 5HPMA 5FM5M 1MRFH 1YNJD 1A6AB 1OAYL 4LCWA 1Q72L 1D6EB 4N0CD 4IRSD 2AP2A 5C6WH 4AQEB 2CDFA 1I9JL 5FM8A 2NT0A 1LO2H 2P5EA 2GSIA 2AK1L 1M2VB 2PPEA 4NPKA 4P23C 1RFDL 1NC4D 1X4ZA 2E7LC 1K72A 4XMWA 4M7JH 3WG7B 4C47A 2ZSWB 3BZFB 4JKMA 3GMOB 1YEFL 4PCTA 4NO2B 4CKVX 3O9WA 1AIFB 4Z23A 4LLUB 4LIQE 1JV5B 1SEBA 1PY9A 1XGPA 3OGCA 1A02N 2GABA 2ZPKL 3WFDH 4ZAKC 2VYRE 5H35A 1B0IA 5IOKA 4EN3D 3GMNA 1LWRA 4RZCA 4JHBA 3QDGD 1W80A 4KKAC 1A6VL 3ATFA 2C9PA 3MGTA 2DBLL 1KTRL 3HI5L 3OHXB 1INEL 4YHKH 3X1BA 4B6ZA 4B97A 3LKPA 4IBZA 4P48A 2WIMA 4BFJA 2C1OA 4F8OA 3BKML 4JQIL 2CQVA 2XNAA 3GMQB 1U8CA 3UAJC 1C9SA 3L81A 1QHOA 3HE7A 3UG4A 4BJLA 3BZDA 3ERXA 3GTQA 1BREA 1QKZH 4L4JA 4POZC 3VDCA 2FJGA 1KPVA 4AWJC 3BN3B 3MV7A 4HXBL 2GSGA 5L9DH 4QRRE 2GJZB 3IWUA 5DJ8B 1Z5LA 4N2GA 5D7JC 1LEIB 2DLTA 4PJ5A 5FF6B 1D9KB 1XH3A 4ZD3H 3BQUB 4MCNA 2ALAA 3QJUB 3QCUH 4U1LB 1JHKL 5KZCB 3D25A 3QJTB 4GBXB 2G3MA 4JZNB 1FZKB 4IHBA 5INDA 1AC0A 2JMRA 1XL4A 3PIQB 5T5FL 3WHE0 2ZOLA 5A6LA 4U1IA 4D9RD 5KSBB 1MCJA 4J12A 2K3TA 2A77L 2QPUA 3QQ9D 5ANMB 3WJMB 2O5NA 5HTSA 4YDKH 2WTOA 2W9LA 2AXGA 2VSKB 4JQIA 5EU6D 1Q9LA 4Y1TA 5GJTH 3SQBA 3SGDH 2ZOTA 4PS8A 3L3GB 1HZHL 1A3LH 3VTTA 2ZWYA 2Z91B 3H9SE 5HJGA 4KHXL 4PJXA 3MRMA 4YEFA 3IAGC 2WXNA 3D9AH 1KJ2B 3IF1B 4M9OA 3ZW3A 2R0KL 5D71L 4FABH 3GJEA 2PCYA 2X6MA 3F5WA 3EO1B 3QJOA 2PXYA 3HS8A 1G4MA 5E8NA 5CJXC 3L4XA 1QA9B 4PLOB 3L2NA 3HHMA 3AS2A 1U8PB 5D7SH 4WFGD 1U58A 4LSPL 1I8UA 3ECVA 1R3IH 1TZHA 5DC0A 1E18A 4DZBB 2AJYH 4ZUSB 2A7BA 4UZSA 2OTUB 2F5BL 4JY4A 1IEBB 1KXVA 4ZW5A 3KXFA 4HCRH 1MVUA 4AQ1B 2FSEA 4B50A 1AQDA 3MREA 4K3DH 2I9TB 3UBXB 1DQQB 3GLAA 4RQQB 3QUYB 1YY8B 4HKBA 4JM2D 2XTJB 3TEZA 1MLCA 4CRZA 1N8OE 2DLFH 2L0DA 5ICYA 3MSPA 2ZE0A 3GSNA 3U1PA 3SD2A 3ZT6A 1X4XA 5CEXA 1ZA6A 3ARQA 4O5LH 3CFBA 3W9EA 1B88A 3ECBA 4W6XB 1E6JH 5JOFA 3QZOA 4F8LA 3UIZA 3VQ1C 1J5HA 4HX1B 1UGKA 1Y1DA 2WQVA 1P7QA 2XVKA 4NO0B 4AZ8B 3IFNH 5I5IA 3QIWC 1CDGA 1UQSA 5DUPL 4HOWA 2XQBH 3N50A 1BMWA 2FJFB 3E8VA 5IHWA 3H2QA 2IF7A 4N0FA 1QFWI 3GD1C 3OXSB 5F7KC 4ENZA 3CDFA 3BDXA 4FFZL 4UMGA 2F58L 2LU4A 4QT5A 1VRSA 1JPEA 4PWGA 5HHXH 3OX8A 4AUJA 2DDQH 1EIBA 2ALWA 5I0ZA 4HHAA 4PB0H 4KITB 3N85H 32C2B 5HJ3B 5IJVB 2LGNA 4XMLL 4KK8C 4ODVL 4FX5A 3WY4A 4TKWA 5H37G 1P6AB 3N1FC 4P4KA 4YFLI 4IDLA 1UWYA 5D7IE 2P8PA 3SDXF 3DARA 3NCXA 4FTVA 2L7UA 4FEIA 5CD5D 2IOIA 1CFBA 1A66A 2IDSA 5FKAA 4HU8A 3WEBA 3WGUB 3M1BB 5CINL 5AOLA 5SWSD 1J5IA 3MRLB 3W82A 1FAIH 4DGVH 2CNZA 2X1WL 1U3NA 3T4YB 1WZAA 1RVFH 4MB4A 4UUJA 2G9KA 5AVWB 3UO1H 2V17H 5I74C 4D9QD 5I71B 4YFLF 1JF1B 4A6YB 1LEGA 3QAZC 4QLWA 4HSCX 3L6FB 1FRGH 3KPNA 4P9ML 1SFDA 2OMVB 2O93L 3B5GA 4NBYB 4PJGE 5KYYB 5DC2A 3VXSD 2XC8A 4WI7A 1N6UA 2X12A 3L3OC 3P4MB 1HK6A 3DBXB 1ETA1 5HDBF 3V7AE 3BVNA 4AGPA 3MHZA 1MWAL 3MJ7B 2LW3A 4QNPF 4YNYA 3OUGA 1A0QH 1SQMA 4LPCA 1MZYA 3IMSA 5JXEA 2OS7A 3BW9A 2A2QT 3PDOA 2NZ9D 2XZZA 1C08B 3MV8B 4GYBA 3HG5A 4AGNA 3SBWA 3GM0A 4WW2B 2YD0A 1ZHKA 3SJVA 3GUTA 5IB2A 3N41B 3HN8A 2AV1A 2DYPB 3W5MA 1ITBB 4PRBB 4HGWB 3BKCH 4IIQA 4BGLA 4X7CC 3UGUA 4HG4K 1E8XA 4N68A 4S2SB 1VZGA 3OKMA 5ABDE 3MLXL 4FOMA 4Z9KB 2YXVA 5HSFA 3V4VL 4PJFF 3HG0A 2J88H 2OMZB 4XP6L 5HI3C 2XVBA 1T5XA 4HH8A 2C26A 4KGJA 2EIZA 1RUPL 3T3PF 4DKTA 1VFUA 2RBLA 1DUZA 2VDPH 4N8CH 4NWTL 4PJBE 4AV5A 1E2ZA 1G9MC 4PY8J 1KLFB 1OSPL 3KH3A 4PREA 2BP0B 3IDNA 1BMZA 2QQLH 3RZWA 3I6KA 3EYSH 1M6UA 4ODWA 3U2SB 5KVGL 1MCOL 8CGTA 1XH1A 1XSJA 4GKZA 4ZZFA 1N2RB 4BSWA 1HOCB 1H3WM 2OYKA 3WV0A 2D7MA 4XMVA 1B9ZA 2VCOA 1PLGH 3FQTA 4X9FA 1ODAA 4C58B 4B0MB 3MUGB 4DK5A 3KLHD 4D2NA 4OT1L 4RETB 3A6BH 1R9TA 1ZHLA 4LVHB 3D09A 2EDXA 5L0QC 5LJYH 4QRRD 4FQIH 3MLWH 3NG5A 5BRZA 4W9CC 2O5ZL 5GS0D 4TVPD 4GO6B 3QDJE 3PL6B 4NQDA 4LLVB 4C56D 3LZLA 4GKSA 1HHKB 4BFBD 1BVNT 4MVBC 2G9HB 4F9PC 1TWHA 4G59C 4Y5VB 3GXMA 1M7IA 4CRYG 4DP1X 3CFEB 4Q9BA 3VI4E 3KBFA 5IB1A 4HUXA 2OSYA 4M7ZB 1NGQL 2V3VA 1JRHH 1NCAL 1UYWL 4KFMA 4JNXA 4UU9A 2DKMA 3FFDA 3EYFA 1PYQA 4LSSL 4XCYB 2V7HB 4BYHA 2WXQA 4LCCC 5IFAL 1QNZL 5EU7C 3NP4A 2IAAC 2BC4A 2IJ0C 1YAIA 1HKLL 1T1XB 5EEVA 2R7EB 2W0FB 3DV6A 2AXWA 4YPGA 3H9SD 5D2LE 4X7EC 5I8OH 5HGBA 5FUCC 1AGBB 5C9JB 3QJFB 4JPKH 4UDUB 1CZ5A 1J11A 5E8DH 3RGVA 4Y4HB 2O6PA 4KJQD 4M61A 2XVLA 4W9GC 5I19L 1RZQA 4JPVL 4NS0A 2YAMA 5IY5B 3NIFF 1NC2D 4HJUA 2VPWA 1JCVA 3WS6C 4FADA 1WPCA 4N2BA 4LLMB 4NRYA 1I85A 2J8UB 3RL2B 5C3IA 2XG5B 3S37X 3CXDL 3BN9D 1RURL 1W8NA 3LEXA 4MAYD 3STZA 3V4LA 5DWUL 2AGJH 3TA3D 3H7LA 4GG8A 4OZHB 5MERB 3ZHDA 1OTUD 2VL5B 3WD5H 1XEDA 2IBZY 2DQIH 3K4AA 3GHBH 1AAJA 3MU3A 1K5NA 4M1CD 3WXWH 4ISVB 1EAPA 3A67H 3B2PA 4KXBA 5DJDA 3D2UD 2VRQA 4LLDB 2RR3A 3DRTA 1GYUA 4KK9D 3Q05A 5C8JB 3AAZA 5F44A 3UPRA 3S9DB 2XWTB 3VTMA 4WUUA 4N90E 4LCWD 2WWOA 5JXAL 1F3JB 1HTYA 3JXAA 4J8RB 1WLFA 3APNA 3QR1A 5DFVC 3JVFC 1J0JA 4YDVA 4WI9A 1ZVSA 2C4FU 3KEDA 3KPQB 4M02A 5JNYB 2Z7YA 1QSZA 2P5ED 3AXIA 1BQHB 1Y0LB 5B8CA 4OLXH 4ATTA 4BK5A 5CKAA 1S2EA 4YOKA 1QVOB 3W0WE 4D0BB 4W70A 1J5CA 4HXAH 2E2IA 2CLZA 2OSLB 1EJFA 5BMFL 4HIXL 3MLRL 2AQTA 1ZIBA 5BXFA 3BT2L 3RG1C 3ARGC 1WFNA 2C9VA 3GLDA 3C09C 2Y5EA 4M00A 1IBGL 1KC5L 3VI3F 3KJ6H 1K3IA 4AM0A 1ZGLP 3OJMB 3BJ91 4M7KL 1YJDH 5LAXB 1MCBA 1EHLH 3FSZA 5D7LA 2FHCA 4FXKC 3PHSA 5KVEE 4Y4KA 4W9IC 4FFWC 4Z7WA 2WUBL 2PWFA 5FM5O 2I27N 4L8SB 3R7RA 1F1GA 4J6IA 2YGPA 2BSSB 3M8OL 4J3VA 3U0WH 3A4AA 3L4WA 2CKBL 43CAA 4GUOA 1TCRB 3K7UA 4N8VG 3SDCB 4L3CA 5D55A 3WLBB 4PRHB 1LP9E 1HH9B 4Y2DC 1KZQA 4WO4C 4DKEH 4PUBL 4P46B 4WEBH 4LASH 5DJCB 2JJTC 3I84A 5B21A 1JGEB 2VISB 1T83C 3LQZA 4ETYA 2JF1A 4PJDF 1KTKE 3PHOB 3H8NA 3ROOB 3ZHFA 3GI8L 5E2UH 3C6SA 4PRPA 1DVZA 1YLBB 3TBYA 5J8OA 2JB5L 4ZPTA 3NAAH 4IEFB 2ZCKH 5EZLA 5TF0A 4F7MB 1AA6A 1OK8A 3GRWL 4LHUA 1KTCA 4HCRA 4KV5E 1BBDL 4NC2B 3CZGA 2IPKA 3K3QA 1ZD6A 2FEEL 5E2VH 4BH8A 1KQGA 1F45A 2ZG3A 4OFPA 4JHVA 4JPIB 3RP1A 5F7DB 1BGXH 1YYML 5IG7A 1M53A 1F4HA 4UAHA 4WI3A 5TD4A 4NT6B 3MLZH 5EF0A 2FE0A 3VM7A 3APCA 2IPUK 3OF6A 1NOLA 4MMYA 1G0DA 3U7YL 1RUAH 2E47A 2LVEA 1YEIL 3IXAA 1F1DA 2OQJA 3NFSL 3SDDB 1HHHB 2YAOA 1U36A 2QADC 4KRPC 5HBBA 1MCKA 1ADQL 5LLIC 1NMCB 3EOAB 4PRNB 4LL4A 2ICEB 1XIWA 1FGNL 2XKNB 1NPJA 4LESA 5E8OB 4ZJ9A 2TSAA 2PETA 4P2QB 3DIVA 2OMYA 1MAJA 2OM5A 5GZND 1IGCL 5FECA 4KO7A 1UXLA 2J4WH 3EH3B 4J27A 1OSYA 5FCUL 4ELME 2YQ2A 3QC8A 2XWXA 4OCSH 1ILUA 2MNJB 2P5WA 3K1KC 2JQMA 2BHZA 3QC5X 1OQXA 5F7UA 2NMSA 4OTXL 5C08D 3W81A 1QHQA 3II1A 1UJ3B 1N6VA 2DQHH 5ERWB 1WEJL 4HJ0C 2NNRA 3L4ZA 3TCLA 1S7WA 5A2KH 4HJGB 4JZOA 4NZUL 4I4WB 4LSQH 1CL7L 1EA9C 3CZLA 1VZHA 3SGJC 5J3HD 5DFTA 1WFJA 4XPTH 1JN6A 1RU9L 4EUPG 1ZTXH 4Y8DC 3O45A 1CR9H 1WP6A 1U8OB 2DN7A 5CIPA 3S8GB 2W9DH 1DN0B 4ONFH 4MD5A 1YLEA 4ZNEE 3KLAB 4U1NA 3E1ZA 4YO0B 5GGVH 1RZ8A 2LU7A 3JYCA 4WGKA 3F65A 4C2MA 1RUML 3UTSA 4NN6C 4PG9B 3S4SA 3EO0A 4YFDB 1G7MA 3AQDA 3IU4L 2NX5D 4ZSOE 2HSIA 4KJYA 1GS6X 1QNIA 2X4PB 1DBAH 1OAKH 4IIZA 3FT2B 1UHVA 2A83A 4DN4H 2GTZA 2VE6A 4G1MB 5C0GA 1AS8A 4X8JB 3ZT7A 2QMJA 4A2HA 2OJEA 5FGCE 3CUPA 4ABUA 3SUKA 1CG9A 1RZPA 2E9WA 2CIKB 2NY6B 2YOAA 5C0BB 1R24A 4AEFA 4RMWA 2YD8A 3KVPA 4ZRGA 1T2XA 2DD8L 1NBVL 3ARSA 5D4IA 1MRCL 4TNVF 2R0LH 3L45A 4WJ5B 3TN0A 3WFEL 3QUZB 4Q2ZB 3OXRA 4WHCA 3WU1A 1P5VB 1HNYA 2CJUL 1UFGA 3DX3A 4TYUA 1BEYH 3KPLA 3NPSC 4TVSa 4Y5YB 4DP6X 3T0EA 1VGKA 3BP4A 2F54B 1GZPB 4PTTA 3FFCD 4QTIH 4X7DC 5FHBL 1WAAA 3F7LA 4R8WH 4FG2A 4HIJA 4R4ND 3BZ5A 1OXYA 5EEZA 5IV2B 1A65A 3F7YB 3H6AA 5AB1A 3V5KB 5D7EA 4CKQA 3WNIA 2XXFA 1AMXA 4IKIA 1VSCA 5DMGC 4O02H 1KV3A 3IJHB 5SX5K 2ATKB 3X3GL 3BGFC 2R2HA 3IJYB 2A1WL 1OCWH 2ZCHL 2UYLB 2F1AA 3FTGB 3O2VH 3OKOA 1QX1A 1A4JA 1KJ2L 1RZKH 1TJHL 1I1FA 5DZPA 5G2NA 1HDMA 5FDWB 2DH2A 2EH8L 2V2WA 4FG6D 3S8FB 5MEQB 2GITA 4YK4C 4EDWL 2EIDA 5J13B 1TU2B 3ZDYE 4PJ7B 5BRQA 4G42B 4OGZA 2M2DA 2FWOA 4MQXC 4XZUA 3CFKA 3PWPA 4F1ZA 2E59A 4G8GA 1Q0EA 2JIXD 5T1KD 4AH2B 5C1BA 5DMJB 1P5UA 3FTYA 4G83A 5DHEA 3VO0A 5C09A 1NOAA 1A7RH 3BO8A 2V4LA 4LQ1A 2VN7A 4F33B 1X3DA 5E24E 5KBLA 1T3FA 5E8PA 3DPBA 4AVKA 1Y7VA 2BSBA 2X6UA 4HVBA 2A3TA 2OV0A 4HOXA 2PTTB 1IC5L 5HHVL 3KGSA 1DANT 4PG2C 4AK1A 4QRPE 5JPNB 3U1QA 2CCLA 2XPGA 4QHPA 5C97A 3R06A 2EKSA 5GSVB 2AXFA 1JWSA 4I48A 3B9DA 4NQQA 4Y19A 3V5DA 2G5RA 1O9VA 4WFFD 3VFRB 5C71A 2NR6D 4NFCA 1XF4B 4W9FC 3KZ8A 2V7NB 4XPHL 5TK4A 1HYSD 2ERJC 1HOEA 2YSSA 4DCQA 5FWRA 5IFHL 3QWRA 2QBWA 2GTWB 4JFFB 4NQDD 3KWTA 3DDFA 4OI9A 4TL4A 1BZ8A 3FB6A 3SD5A 1MIML 3OSKA 2UVFA 2Y9RT 2GG1A 4PGZA 3WTWA 2OMWA 1H6EA 1K8IB 2CBMA 4WFEE 4CMMA 5C6TH 1TG8A 5FTLA 2D31A 4EI5C 3HC0A 4I18C 4MS8C 5INCA 2WQRA 1EJOH 4PVLA 1LTXA 3C60A 3FKUS 2WXLA 5B38B 2IQ9H 4RA3A 4KY2A 2IH1B 1A3RL 1TYRA 4EXKA 3CQPA 4L0YA 4U1SB 3TFKD 4TULL 4YDIH 4XRCA 4A6YL 4JRYB 3IFLL 4A2LA 5JHAA 4HZLB 2YU9A 3UYOD 2IC2A 3NZ8A 2RB8A 4X6DF 5I28A 1ETJA 2JELL 4RDQF 3MRRA 5FW6A 5HYJE 5JDSA 1JE6A 1OK0A 1YN6B 3K74B 4OV5A 1EDHA 3RGVD 1D7CA 1UCBH 1QW8A 3KM1A 5DK2A 4HFUH 5DU7A 4BWTA 4CW1A 3JZ7A 4EDXA 3PGCB 1TTAA 4WY7L 4JFDD 1IM3B 3K6SB 2MHAA 1MAMH 1HN1A 2UY7A 2D4DA 3OM3B 3H4HA 5F89A 5BO1H 3T71A 3WTTA 2JK5B 1JWMB 4NKMB 3D5OF 2ZKXA 1KNOB 2FGWL 2WYHA 3NFNB 1TVBB 3MROA 2HTLC 4NCC1 5IVZA 1PD1A 8PAZA 3T4AA 1MHHB 3EFOB 4WENB 2JVUA 2VUOA 3BPCB 3NCJH 4LIQH 3EFFA 4XI5C 3MJ9L 1ZANH 3LXUX 3BISA 1BYPA 2FQDA 4Z8FH 4R3SB 3TH2T 4FQPA 1AOHA 4Q9RL 3QQ4B 4PLJD 2EABA 5DEGA 4YDLC 2OX5B 3K8KA 1AFVL 2X3BA 3DETD 4BHUA 1KLUA 3LOWA 2HLEB 2Z7WA 5FX3A 3UBHA 1CFQB 1AR1D 1SM3H 5GGTL 1IV8A 3K6FA 2BHUA 2YS4A 2J1YA 1IC7L 4I3SL 5C0FA 4BBWA 1JYVA 4YAQA 3BUIA 2V3FA 2Q2LA 7FABH 3VVVA 4XHQA 3TBTA 3WIHH 1XL6A 4PSPA 4LGSB 4XOCA 2EE0A 2IANE 4DQAA 4YHPA 4M29A 4P5MA 2P80D 2R1YA 3LSOB 1OA9A 2HAZA 1V7NH 5GS0H 2J56A 1Y1VA 2APSA 1FL3A 1SOQA 4KJWC 4KVNH 2E7CA 1C12B 3ZL1A 1JHLL 2KZKA 2EP6A 5EULV 1L7TH 1DDTA 4E9XA 2R56H 4DKFH 5EOCH 3GBMH 4G70B 3S98A 5KSBE 4ZMAT 4U1JA 3FO0L 5LBGA 2ZP9A 1FFNA 1AO7A 4OJDH 5CD3B 4Z5RB 5D7LD 3QEUB 2CH8A 3QXDB 2V2XB 5TQ0H 1ZLDA 4LCIH 4GRWB 2V3EA 1FL5B 2O4EA 3AQXA 4NX0A 2E6QA 2FHBA 2XT1B 1WA2X 3TJPA 5DD6B 3FS9A 2F8XC 2EXYC 1X5IA 4HETA 5M7QA 1N19A 2HT4D 3NIDE 1YMMA 3ARWA 3SO3C 5EOTA 5MHSE 2X9XA 3DURB 4BEIA 3JTTA 4XN2A 2D4FA 5IT2H 3UEQA 1CTMA 3UYRH 5I6KA 3TVMC 3FCTA 2JJVA 3LIZL 1MVYA 1VENA 3AG2B 4NNPH 1TTRA 4UM8B 5GGRY 5KANI 1DJGA 1EU1A 4X80L 3SPVA 2WLLB 3VDBA 5FKPB 5FC9A 3QFGA 4TUOA 4G9FB 4RX4A 1DJSA 4OJFL 3HRZA 2BWDA 4XPBH 5IB5B 3SE8L 4PRAB 4P2RA 5BVJB 2VLKD 4G1EA 2H5UA 1OO2A 4APQB 3E1F1 3GKWH 4KROB 5A6MA 15C8H 3WBDA 3TIWA 4QYOB 1SHXA 3GTNA 4JAMB 4BUHA 2XTJE 3VD4A 2B1AH 5LWYH 3SZ6A 2ZICA 3VH8G 1EHNA 2G3NA 4N2MA 2Z31D 3QUXD 5D5MF 3WNPA 4OLUH 4B95C 1VKXB 3LN9A 4CC1A 5C7XL 2X1PA 4ZOCA 3WMQA 2UXVA 4FC3E 3QS3A 3ZO9A 5ACZB 3ARFC 3MAWA 1I1YB 3VD3A 5F7AA 4ODSL 1EQWA 3E6FA 4EEEA 1KN4H 3L8QA 3QDMB 1URIA 3OF6D 1FVEB 2D2OA 3ILQC 3AREB 3N5AA 4YR6A 2WSKA 3QHFL 3QQDA 1CD9B 4WWKB 1ZCRA 3S35H 2BVEA 4YHML 5J12B 3MLVH 1VACB 4FLRA 4TM9A 3FUIA 1ZT4B 1WS7A 2NQDA 4XPGL 4GAYA 1CXIA 4JFUA 4M8QB 5HHOE 4BXVA 3VFOB 4PJAA 2JXMA 4OCMC 4P5TB 4X0KA 5D1QD 2PJJA 4XP4L 3WY2A 4HHWA 3UDWA 4FYRA 4WHYG 3RBSA 3FONB 4JDTL 1IT9L 2WJ5A 3IDJB 3HNTL 3WNMA 1Z66A 1MFAL 4KJPD 2XTLA 5I6OA 2CHXA 1QFOA 4GRLB 3EHBD 3S7GA 3EJRA 4M6AA 5SX5H 4N2NA 3L3KB 4AG4L 1LE5B 3ULUE 2BY3A 5KG9A 3FT3A 1LDPH 2P5WD 3B9KC 3TBSA 3IMBA 2ATAA 4LLQA 1P2CB 4QHNB 4JK0D 3L3IB 2UWEB 4Y5XB 1G6VK 4I1RA 3HLAA 1HXKA 3E8UH 3FPYA 4GKNA 5LXGH 1ED3A 3UABA 2JKJA 5F6HJ 3B7RL 2C45A 2NY2D 1BM7A 1D5IH 3MLSH 2CO6A 3C5ZB 4IJ3B 4JDVB 4XAWH 2JSFA 3VXRE 3BXNB 3QIUA 3B6SB 2VDRH 1I8KA 2V9QA 5IBUG 3FQRA 4UNVA 3V0GA 4BE5A 5DRWB 4K5OA 4NHUA 4WFED 4HHGA 1OTTC 1U8LB 4DNLA 1OAYH 1MJ8H 1T4WA 2NYYD 2C7FA 2PPAA 4YIQA 5GS1C 1XR8A 2DS4A 5IQLA 3HNSL 5IMMB 1PT1A 1T5WA 4QAMB 1OAXH 1I9JH 2XFGB 2FAUA 5HP5A 2VMDA 5IQMA 3ZYOA 1MNUL 3MV8E 3NQKA 5C0AB 2FO1A 3MX0A 2A73A 3FRUB 4WF7A 4ZFFA 2DQEL 2C3VA 4BINA 3DKHA 4ZW6A 4O02A 4Y4FB 2NW3A 1K83A 1BV8A 2AJXH 1MI5A 2XZCH 3CFTA 1ZGLA 3O2DL 2I85A 4IKNA 4JR9H 4N2OA 2WGNB 4PS3A 2J6WA 3GTKA 4P4RB 5HXMA 3V6ZB 2NSMA 1KDIA 1AXIB 4U3XA 4G80B 1E4WL 5D4HA 5EV7A 4ZQKA 3FN3A 3RWIA 2DI8A 4ZFQA 1CK0H 1AD9B 1DJYA 1PQZB 4JRXB 3GI9L 4Q89A 3BKMH 5F9WC 3F62A 3U2IA 1OB0A 1NSNL 2Y1VA 5EO1B 3KL0A 1FLTX 4C83A 1O7DE 4L9LC 3X1GA 4JFOB 3HU1A 4XXDB 1F4AA 1AHWC 4PWEA 2Q6WA 1NBZB 3TNMA 3ZRSA 5F7HA 5DJ6A 4JG1L 4HXBH 3V95A 3BAYA 4WO0A 5BZDA 3IPBA 4UQIM 5AWNH 2IALA 2W07A 2RALA 5E4EC 1E67A 2GBUA 1LILA 4FLSA 2HLFD 3MQIA 4L1SA 4HIHB 3KH4A 3R4RA 1JHKH 4I1PA 3B34A 1CGXA 3RNQB 1XZ0B 4NQSB 4TNWK 4CU8A 2P43B 1WGVA 4OZ4A 3I85A 3RDTA 2R39A 4HBCH 1F90H 2ZXEB 2A0LD 1R3KB 1U4FA 5C0NC 3WAJA 1D9KD 4KPHH 1KB5L 2A77H 2YLHA 3SKJH 4H25A 4ODHL 1F1AA 3BQUD 4U6VH 4WWOA 4FL4B 2CGRL 5FGBC 1F3RB 2VWEC 4XNXL 4AIOA 5KZCD 2B77A 5I1AB 3T1FB 1JPFB 1TJXA 4UIKH 1AXTH 5HVHC 2QFRA 5IMKA 1E6OL 1OP3K 4KHXH 2WWMC 1MREH 3KS0H 3QEHB 2G60H 4UOJA 1LD9A 2EDQA 4QXWA 3NABL 4FA7B 5DEFA 1IGIH 2R0KH 1CIDA 5SWZA 3T9WA 5JQIB 3ZDXF 3OAZK 4FKKA 3ABGA 4LKXB 4WQOA 5ESQA 1RZ7L 1DBJH 1AGDA 1CICB 4F15C 2YAQA 5F9DC 3TH4T 3WAKA 1IZKA 1X5GA 5GGRA 4K8RC 4Y7MA 1HXMA 4L3EE 2VDLB 3P9MB 4WUKL 5PAZA 3JWNG 1PPYA 2BJML 2F5BH 4OFKA 3MRGB 4Y1AA 3HI6H 3RWFB 3SKNB 5J6HA 1KTLA 1KB5A 3GXDA 4J23A 4I87A 3AMKA 5HDWA 3RB5A 3GMPB 4MQ7A 1IAIH 5LBSA 5HYSA 3CU1A 5D7JB 2J8UE 3GDBA 5H2BA 5CJOL 1QTYT 4DGIL 4L4VA 4HK0A 5DZNA 3DMMA 3KGTA 1Y6NR 3ULVC 3FQWB 1V27A 3QQ3B 4F7PB 4NN7C 3DX8B 4G8FA 1RHFA 3TFBA 2BOLA 2OYPA 4X8GA 1KCVL 3QUYD 1NDGA 4L2LA 1BVLA 1OZUA 4NSKA 4F7CB 4UYPA 1M1XA 2CUAA 3ZE1E 2JLPA 4NNXA 1F6LL 3P3YA 5AZ2L 3BCFA 1ET7A 3OC8A 1NDMA 4FFZH 3MGOA 4X6FA 2FIRT 2R29H 1OGTA 1U41A 4MD0A 2YGQA 4UOW1 1LWJA 1MXDA 3ZE2E 4JDEB 2QSQA 3CX2A 1DL7L 2WXIA 3APMA 3BMWA 2EINB 4NO0D 1RPKA 2R9HC 3QARA 4LCUB 1FSKB 1JK8B 4ODVH 4OLZH 4P0DA 1RMFL 3T6ZA 1KGCE 3CFQA 5AOZA 2VAAB 4Q97A 3ILPA 3LRLA 5EBWA 2FNWA 4MAUL 2XLLA 3B7TA 1TMOA 4DGUA 5HGDB 4PLNC 1GYAA 2VLRB 3FUKA 1MHCA 3LN5B 5GIRB 1KOAA 4AOKB 1GC1C 2E8ZA 3EYVA 3I9GH 1P4LB 4DEPC 4PJEF 1PJWA 4K23L 4MSWA 2E76C 5EU3A 5EF1A 5J1AB 4FQXA 4LF3A 1XBRA 5SX4I 1NEZA 2E9JA 4ZX5A 2IO5A 5AVSB 3DX6A 3G5XB 1ZLEA 2C1PA 2NTSP 5IUSA 4BZYA 1T0MA 1VFOA 3HU3A 2NNFA 4NLHA 3PYCA 5FO7A 1S7VA 3RVVD 4LSTL 3X13A 4N0CC 4WCYL 3ZKSD 1MFBL 4L8CA 1CF8H 3TPUA 2QTEA 3MMEB 5KVEH 3KW8A 4LSUH 4O58L 5DRXB 4AITA 4HLZH 1HT6A 2BP8B 1KELH 1BLNB 4GAAA 4Z7VA 3QIWB 4HZAA 1V54B 1T2JA 1PIFA 4QRTB 2PR4L 4ATWA 4R7NB 4I77L 4LEXH 5KVDE 2XQYG 5ESVA 2X4NA 2V5YA 5MEPB 3LZQA 3CZUB 1FE8L 3SKOA 1UOWA 1DSFL 3MLXH 4NUMA 2RFXA 2Z65C 3CHSA 3MV8D 1OHZA 1OGAB 3V4VH 3PRZA 3H55A 1E9OA 2WAQA 2WHVA 3T2PA 3FU8A 5AL0A 1KDJA 1MCSA 5JLZB 3KPSE 4PCYA 4N9OB 2DYPD 5E6ZA 4E9WA 2FR4B 1D5BB 1BAFH 3FQ1A 4YUEH 4MFHA 3I3DA 3JTBA 4GPVA 5LBVA 5EF2A 4S1QL 1OSPH 1MSPA 3ULVF 1HEZB 3MOQA 3VD1A 4LQFL 1G7JA 4IW4C 4OSUH 2G0LA 3QHTC 2XRAL 1I1AB 5D1ZC 3RWEA 5KBNC 1YECH 5D2NC 2TRHA 3US1A 4GMTL 5E1GA 5I74B 1KIPA 1DBKH 1A1OB 1MCPL 1FF5A 5ID1B 4FA6A 1UD3A 2HCZX 1I7UB 3GSUA 3QR2A 5LHDA 4C59B 1KIRA 1AZUA 1RQ5A 4H5SB 4PHXA 3U25A 3J27A 4I2XB 1SDDA 4M62H 2J5LC 4U3HA 1DJXA 2XKSA 1QFUH 1PW3A 1UB6B 3A23A 1K8DA 1OSEA 5E6IA 3N1PC 4PIRF 1OY3B 3QQ9C 4X5WA 5GS2D 4CSZA 2ETWA 4JFZL 3VQMA 1YPZF 3RU8H 4U7SA 5IHUH 2IGFL 1N0LB 3DIFB 5A2CA 2F2HA 2AS5M 3NUKA 3HG1B 4JMNA 1YNKH 8FABB 3ZZ1A 1ZVYA 5LDUA 1UYWH 2NCEA 3NRQA 2AKRA 2F5AL 3LRGA 4URKA 4KQ0A 2OL3B 1NM4A 5D7IA 4N1EA 4Q58C 2VDOL 3ZPDA 3HR6A 1EVUA 3CJJA 3ELQA 4L05A 4E5XB 3WS3A 4HWBL 1KIUB 2JKLA 1QNZH 2X4TA 1HKLH 4QRSA 2CO7A 4OZFB 4LRNL 4S0TD 3ROLA 3FOLA 2YK1L 2QKIA 3QORA 4PY7B 5EUKA 2WQWA 3C08L 1TF4A 1R3HB 4ZODA 4CVUA 3GMMB 2AJ3A 1RULL 4R90L 5AW2B 5I19H 1GMIA 2VB5A 2DM4A 5KYWA 1RKRA 3IJ8A 2ESVB 2G75B 1IM9B 3CDZA 3JV5A 3FSVA 1MG3C 4JM2C 5D8JL 2V33A 2VR8A 3MFFB 4G7YL 4YHZL 4HIEA 1BJMA 4RFNB 1RLWA 3PAZA 3W5NA 5K93A 4YSOA 3BUDA 4KQ4L 5DR5H 3WENA 4RDBA 5FW7A 2VOTA 1RPQA 2ZNWA 3BUYB 4XZ4A 1WBYB 4YGAB 2D0FA 3ZTDC 3V9CA 1JP5A 1A4BA 1FBIL 2D7NA 3MRQA 3SPIA 3B4NA 3DUHA 3S5LG 3OAUH 5C0BE 1KZYA 2KQMA 3UZEA 1E8ZA 1NA8A 1IAOB 3D8MA 2QDWA 4W9KC 4MDRA 3G04B 4K3HA 3CHQA 1HIML 1UWFA 4NN5C 5GJSL 2WTRB 3HUJE 3DWTA 5IHZA 3G6AB 2LT9A 2F54E 1UATA 4U3SA 1RK0A 1EDQA 4YHLH 3UTQB 4ZOBA 2OZ4L 3G5VA 5I66A 2E3VA 4KTEL 3IAQA 4KZEL 2E75C 2DMKA 2WC7A 1KYUA 2A9NH 3K4DA 4PJBA 4WNQB 4AUYA 2X5PA 4BUQA 1JNJA 3PV6A 2ZUSA 4U0RB 2XWZA 4DPCX 5D96B 2Y7QA 2F6AA 4XC3H 3OB0K 3E0GA 2YAPA 2ARJA 3RX5A 4E0RA 2GUOB 2R2EA 5A2LH 3FTSA 4ADIA 4A2FA 1A2YA 3BT2H 2YPVL 1MW2A 4N2AA 4NZRH 5FS5A 1R3JB 1T80A 4YMPA 1M71A 3TTYA 1RSYA 4GUQA 1S3KL 4PPTA 2YQGA 2NOYA 5DFWH 1Z9MA 2L7QA 1FORL 5IMOA 4A2DA 5LXVA 4LO9A 1QABA 3OHMB 2OSWA 4PJ7E 5CLWA 2WUBH 2UX6A 5AW0B 1QQDB 2YXWA 4M5TA 1E5AA 3FHEA 2YBRA 3GLEA 1UD2A 5BQ7A 1XDTT 2DQTH 3IMWA 3M8OH 5DJYB 3QFDA 1NFDF 1PSKL 2NZ9C 4H7VA 3GGWB 3VGDA 2CXGA 2P52A 3F7QA 4PJHB 2OZ4A 3VXOB 4F2FA 2DKSA 3LXBA 4XX1E 1BVOA 3VI4A 3V52H 4AYSA 3VFTA 1NBYB 1D5MA 2BVOA 5DJ2A 2CALA 4LP5A 2H2SD 1F4XL 1E50A 4UANA 4NM8L 4NUJB 4Q6IB 4Z7UF 4FQ1H 3EUDA 2AXHA 3KYAA 3GI8H 4QAWA 4I5BB 1X5ZA 4M43H 1TYEB 3SDCD 4PRHD 1LLAA 4JM2F 5A7BA 3QA3B 5F1NB 2WKOA 3GRWH 4OF7A 5DD1L 4ZFGH 1PLAA 3KAAA 3FN0L 4P46D 1BBDH 3QJHA 3FO1B 3DHJA 1PLCA 2J3SA 3Q01A 4MDJA 2KL6A 2OTWA 3FU5A 2R2BB 1M7DA 2IAMA 3U4AA 2EH7L 2WMPB 1BAGA 1WBXB 2PCPA 3MKGA 3HR5A 3MLYL 1YYMH 3QZBA 1SVBA 4TQEH 3T3ME 1PX3A 4Z3GA 5B7FA 5IIEB 5IHLB 3HBGA 4MMXC 4AC4A 2H32B 1JOIA 4OD1L 3KCPA 1UADC 4HKJA 4ACPA 1CF1A 4MJ6B 2P47B 1CDJA 3U7YH 5HDOA 1H8LA 1YEIH 3C09B 4KUCD 4ZO7A 1ZLSL 3B1TA 3EFDH 3COOA 1BF8A 1M56B 3JWOC 1OGPA 2R69L 3WN5C 2NUPB 4FXKB 1IQDA 5FV1L 3VMNA 3HC4H 2IV8A 4AT6B 1W9XA 5E9DB 1TT6A 2R0WH 3H85A 4N4YB 3GZOA 2ZZUT 3KYNB 4JRYE 5GS0C 1NGZB 4NQEA 5LG1A 1CDIA 3QXUA 3SDDD 4FAAB 1NJ9A 5I0YA 3LYRA 3QQNA 1QYGL 1B4LA 3EH4B 4JY5H 4Y2DB 2F15A 4G6FB 5FDYA 3IE9A 4WO4B 3VQLA 4IHOB 2RTTA 2Y07H 4NPYB 4HS3B 4I0CC 4P2QD 1P4UA 3FN9A 3TV8A 5BS0E 1HH6A 2HG5B 4NJ9L 2OK0H 1WT5A 2JIQA 4HDIB 1NCWL 5T1MA 4X9YA 5T1LA 3FO2B 4NZUH 3SIKA 1A6WL 2B1HL 2FNBA 3W0WA 3QUMH 5A1AA 3MRIB 3AJ7A 3H1ZA 4L5FL 2HT3C 2R69A 3KG5A 2J5WA 2V0AA 4MNGB 2OCFD 4LEBA 5F9OH 3RRQA 4KKNA 5DK3A 3WIIH 4AQAB 3NZSA 4Z7OF 4R4BA 4BQBA 3HAEB 2BDNL 3PP3H 1N6QL 2YXFA 4AYMC 5CUSH 1RUMH 5CWSB 1TWFA 4PJCB 2YPLB 2Q8AL 3S34L 1ONQB 4FQJL 1OSZB 1UCTA 3IU4H 3LEVH 4UOQA 4TUJA 1LO5A 2SEBA 4MA3B 3BN9C 4MAYC 2JCCE 3U46A 3UTTD 1I7TA 4X4ME 2ITCB 2QADB 4KRPB 4P9HL 1T20A 2J55A 1U8MB 3EJCA 3H9HA 3K71B 2VERA 3ESNA 2ADGB 3K4ZA 1CZ4A 4M1CC 5IJDC 1LP9A 3R8BB 3AS0A 3RILA 1QPXA 4I0PA 1DSYA 4N0UB 1I9EA 2NY0C 2AK4B 1NBVH 4M7LL 5JHDB 1EERB 3K6NA 2Z35A 4KK9C 2GAEA 1IB5A 3I74A 1HVXA 3QZWA 4O51A 5DHXB 1EPFA 2NZIA 2VR6A 2DIEA 3BI9X 3RWDB 3WFEH 4N2KA 2B08A 4J3OD 5HHNB 2R1WB 1TJMA 1CD0A 4BQ8A 2Q87A 2Y7SA 3BWAB 1U8NA 2CRMA 3N40F 3OPZL 2NY6D 4GRWE 3GTTA 1YDPB 4F9LA 3QRFM 3GMRB 2YD2A 4P2OA 4DETA 1IVTA 4JO3H 3Q2VA 2WN2A 2WV3A 4JVPA 5SWQA 1JGUL 4X7FC 3THMH 3QUZD 3QRLA 4C57C 1BWMA 3X3GH 3OV6A 1MELA 3Q13A 2ZCHH 2F54D 1KTJA 4JE0A 2NAPA 4H8HA 1G9NC 1IFHL 2ZYSA 3EJQA 4IU3B 2IWGA 5F7MC 2BOBB 2OYLA 4NQTA 2HYMA 2ZOWA 2AJUL 1I1CA 3TEWA 1T21B 4G9FE 1G7LB 4HS6B 2EH8H 4NCDA 2Y2YA 1ESOA 3WKPA 1VF5C 3EJTA 5F1IA 1XCQA 2W92A 4GNKB 1FZMB 2VDLL 1SYSA 1AHMA 5KTEL 1OW0C 1WIPA 3BRDA 2ZJSH 3T04D 2XX1A 3MA9L 4XBEH 4GB9A 1BXXA 3BSGA 1UXMA 2CMRH 4ELMA 1MQKH 2ZXBA 3LRSA 1N3NA 1BQLL 4IU2B 1TQVA 2XZAH 1E27A 5DVPA 2G3XA 3MBED 3QW9A 2FZ3B 3IFOA 2GJ6B 3FHAA 1CBVL 2JB6B 3RWJB 3MXWL 3UTOA 2WP3O 4OM1L 4N2CA 4QGTA 1QZ1A 4QY8A 3WKML 4ZUWA 1N0XL 5AYQA 5K9JH 5EN2A 2H0PA 1GGIL 4I9WE 3IS0X 3WMSA 3UJIH 3GK8L 1MFNA 1XB6A 2Z0UA 1RK7A 5SV4A 4JFTA 5KSUB 3CN2A 2EUWA 4ECNA 2WNXA 3BUQA 3RKDD 1CFVH 4O9HL 3VE0B 1WUZA 3G08B 5HHQB 4WGVB 3SPJA 1MIMH 1GVIA 3GXIA 4A55A 4BFNA 4IBWA 2GHWB 3KVDD 4MDIB 2IWFA 3INUL 1Y6KR 2A6DB 5JR1H 3EGSB 3BGFB 2K6ZA 2ZCLL 1MUJB 1JGLH 3EYQD 2P44B 2UWEE 1H0DB 1TENA 3FU3A 5IR1B 4ZSOA 1D5RA 3FQ2A 1JFQH 5IVNA 4Z3TA 3ULUH 1A1NA 3NFPA 4JFFD 1M42A 3GTLA 4OLWH 2GK0A 2BM3A 2VZ3A 2BY2A 4IKKA 3P3TA 2PXYC 4PJ8B 2A99A 3VFVA 3WJLA 3G6JF 4RIRA 1G43A 3K2IA 3O8XA 4N1HB 2HFTA 3VJ6A 4A6YH 2PW1A 1H0HA 2Y1YA 4W9HC 3P0VH 3QORD 3LRKA 2V5MA 3IDMA 1NEPA 3SCMB 1XV8A 4NJAL 5GZNC 4FNTA 3CFMA 2R2CA 1KXVC 1B0RB 2N1KA 2CHWA 1G1KA 1YNTB 2DQDH 2NTFB 4UT9L 5I8EA 3ZHNA 4WY7H 2A9DA 4L4TE 3WKYA 2XWJA 2WZ5A 2E7BA 4ZMYA 25C8L 3U4KA 3B2XA 1SMOA 3BFQG 4JRYD 4L29A 1EZSA 4LSDA 4X6BB 5HDQH 1KFGA 1P7BA 1D5ZB 1AXSA 1QRNE 4I3RL 2B5IC 1J18A 2XBDA 3QG6B 1LO3L 1X6LA 3X12B 4YQXL 1QOKA 2FB4L 5J3HC 4BH7A 3NJKA 4AZDA 1IM3D 5EUOA 3MR9A 3S3CB 4XCNB 3MJ9H 2IDTA 4GIPD 1UXSB 4U6XA 3IDGA 2Q9OA 3LS5H 4L8DA 1L6PA 1FZOB 1UWEH 1NKGA 4HCIA 1TYJA 2XX0A 3ZUCA 1SUJA 3G9AB 3H3KA 4YL9A 4H2AA 4OIFA 4PJGF 4FKHA 4RDQG 3Q8EA 3GO1H 5LGKA 6PCYA 5GGTH 5E2WL 1E43A 4XMTA 4H8UA 3AT9A 4I3SH 3FUNA 1D7FA 4JO1L 4EI5B 3GLZA 4P4KC 1MFCL 2NSQA 2BRRL 1U8IB 4I18B 5DD5H 2Q86B 7PAZA 5IW3A 1OHQA 4D8OA 2IADB 1A64A 3O6LL 3DHUA 4ZXBA 2HKHL 1DQML 3F85A 3B3IB 3S3BB 2Z92B 3P77B 5CBAA 1KBKA 4Z77A 2Y7NA 5GRZA 2W65A 4H0IA 3EADA 2C9RA 5AENA 4U1HB 4ZMVA 4MJJA 3J07A 4KKLC 4QRPA 1E2VA 4AK2A 1FFPA 1PG7L 3FO0H 1FDOA 3SGEI 4HUUB 5DWPA 1EEQA 1T22A 2IPTL 1BOYA 1MRDH 3ZY7A 1R3LB 2EDLA 5CS7A 1QI4A 3FSAA 5DJXA 1W0YT 5CZRA 4JM4L 5HDLA 4JS7A 2NPLX 4APXA 1ZPUA 4ONHB 5B4MC 4PI2A 1EV2E 2WBKA 5IESH 1QD0A 4N2EA 4Z0BH 2VQTA 2ID5A 1ETZA 2P7TA 4ES8A 1PKQA 4FLHA 5IQNA 3SBWC 2W38A 2C9AA 1JPST 3EO9L 3TBWB 1N7ML 3OJDB 2I07B 3A6CH 3MOBH 4HJEA 2BS9A 1E4KA 4PFEA 5FO8A 1ZK9A 4H1LB 4G6JL 2FCBA 4GG6A 1KYFA 1OF2A 5F7YC 1ZHBA 2F74A 2XBTA 2ENPA 4K5NA 4BXSV 4YDLB 1FJ1B 4LARH 3AXLB 4BDVB 4FG6C 4HQQH 3QWOB 5DC9B 3IKCA 1UG9A 2AAVA 4E2OA 1T4KB 4L9DA 4OCYL 5FCSH 3MRPA 1P6WA 4WEEA 2WB7A 4AIEA 1N64L 1NLBH 3IT8D 1AS7A 1BXUA 3NDYE 3GXUB 4Z7IA 3DV4B 1DBBL 3GNMH 2VKWA 3P30H 4GLRH 3FZUD 4OCNC 4XE5B 5E8EA 5E1AA 3UJJL 3ZJAA 4JQXA 2HH0H 4G9FD 5HYJA 3VFGL 3NZUA 1BZ7A 4R0LA 5DZVA 3NTCH 1UXWA 3CCHB 2ITDB 4TPRL 3S3JA 4BZ1H 4XBPB 5EORH 4KROD 3FQXB 3VXMB 4UQ3B 1TEYA 2I5YH 3MO1B 4ESKA 2EDTA 3QHFH 5LB1A 2C7UA 3QUMA 4FCHA 2KZ1B 3T6QC 4YHMH 1I3GH 1JIBA 1F86A 5EWIH 2VLME 4F2ME 3QO1B 1Z1WA 3GTVA 4Y2NA 1A6TA 4FQ2H 4U31A 3CIAA 4ODUA 4OIIL 5E1QA 1HYSC 3DRQB 3QNYA 1VDGA 4MZ2A 12E8L 3QDMD 4NQED 1WWWX 3LHPL 1Q94A 4FYTA 4U6HA 4JDTH 3ARED 5D2LF 4QNPE 3HNTH 4WK4B 1OALA 1MFAH 1I8LA 3OAYK 4WI0A 1PY4A 2OPCA 2F19L 3U30B 4BA0A 5ICZB 4EI6A 3SO3B 2Z1KA 2N4IA 2MPAH 1GJIA 4P3DB 2VLRE 4G6KL 4X7TA 1NGXA 3MRBB 4P5TD 5TPWL 1GS8A 5E5RB 1XX9C 4X7SL 1L3WA 2EDMA 2HJFA 3LZNA 1CZ8H 1QPKA 1NCTA 1WGOA 3DOSA 3VXTA 2R1XB 4V2CB 5AOJA 4FFVD 5JOEA 5LQBL 4GRLD 2Z3FA 3VG0L 2IANA 5C0CE 5T1LD 3LKRA 3U48A 3SBQA 5C0EB 1CO1A 1IGJA 3KD4A 4MB3A 1FN4B 3UC2A 4GBXA 3QP3A 5B1JC 2AABH 2W9EL 3JVGA 2WNWA 2CUIA 1SJHB 5EBMA 1KGUA 3T3PE 1T04B 4FDWA 3ATEA 3RGVC 5KSBA 1WAPA 3C5ZD 4IBTA 4DFIA 5ITBH 4YSTA 1SXBA 4U6YA 1AY1L 2AJZB 1I85C 3QI9A 5H37A 2XQ0A 1QRKA 2DQEH 3PWNB 2WSDA 4LKCB 2AQQA 4JLRB 5I73C 2COQA 2DBJA 1FDLL 1NGPL 3EZ8A 1BXAA 1F5WA 4K3EH 1MCQA 1RZIA 1KLGB 1L9NA 4HJ1A 5B7MA 1LK3H 1RL1A 4Q4IA 1DZ0A 4HJJL 3PJSB 1OGAE 1E4WH 3K80A 5C0AD 5EG6C 1DFBH 2XY1A 3BX7C 5KVDH 1Q9OA 4KTDH 4RZKA 2AFNA 2OP4L 4LCVA 1XF2A 4Y4FD 1NSNH 1U8PA 2VLJE 5HI4C 3QNFA 4PLJC 4YSUA 2J72A 3V0IA 3HW7A 2P3YA 3DETC 3C5SA 2EYRB 4WKZB 2EDWA 3BVUA 4JG1H 2FLRT 3B9KB 5E56A 1AR1C 5EBGA 4GP8B 1WCBB 3BVXA 4NQCB 1L9SA 3O41B 2A9MH 5DCCA 5IGXL 3DTUB 1WF5A 5FOJA 4JRXD 4WHTB 3KWXA 2XG4B 3C5JA 3WSQH 5J89A 5B8CC 1XGTA 3CZFB 3IXTB 1XGYH 2VDMH 3C8DA 4BK5C 4XXCA 2DMBA 2HUEA 2CKNA 2YA0A 4MNHA 3AT0A 3WHE1 4Q6YA 4PV9B 4W4NA 1T66D 1XF3A 1XMWA 4ZMWA 3FCSB 1JAEA 1J1PL 1KXTB 3F05A 1GGCL 5DA4A 3IU3A 2QV2A 2MIZA 3LHAA 1I7ZB 3N1QC 4DW2L 1REIA 3I02A 2CGRH 2W8CA 1EBPA 1NIFA 1S7RA 1W0VB 2FEDC 1HQ4B 1QG3A 2GUYA 4Y4KC 2WZPA 5JHBA 4UNTA 5HHOA 3NIFE 5JW4M 3HG1E 4XR8C 2P8MB 2YAEA 4L23A 1OCOB 4KV5F 2O72A 3WJJA 4XP1L 3B8YA 4ZW3A 1CGWA 4N26A 5DUBB 4JY6B 4OFYD 3DLQR 3ABZA 4JQVA 4J3TA 5F1KC 1H6FA 5C70A 1FLRH 2HLAB 2HT4C 2HB0A 3DI2B 5K9KB 1GYWA 1MKFA 2BCKB 2GHZA 2ZWKA 2B7DT 3IB4A 4AEHH 4WDIB 2YA2A 1KCRH 5LAPA 4X5PA 3BD5A 2AV7B 3MRLA 2C9SA 4JKPL 5CSZB 4TSAL 5F9WB 2QVFB 1F56A 4IGBA 4RGOL 4UTBL 4JHZA 3CZJA 3HZYA 4JO8A 3LQAH 4YH6A 4GKOA 3BDBA 2R59A 4K5PA 4WV1A 5C2BL 2ED7A 3VA6A 4K7PL 1AHWB 2OMVA 3VXRA 3S96A 3GEFA 3REWA 4N20A 4X5RA 4F7EB 5IEHB 3VH8B 3OG4B 1R7RA 1SXNA 4F3FA 2FUTA 1CICD 4FP8L 3CDGA 4FEMA 2G0KA 4CC4A 5E4EB 1ECYA 2XWDA 4MJ2A 1Y4ZA 1PJ9A 3MJ7A 4JEGB 2O5JD 2Z31C 3QUXC 1RP9A 1A5FH 1Y18B 4FJ6A 4YGVB 3V0FA 1FA4A 4MMZB 2WB1A 1AGCA 4WSJA 1JFHA 3LTVA 4ZT1A 5I17A 4TUKH 5E6YA 2G5DA 1IUZA 2CNYA 1FYTB 4ODTH 2NY7L 2GBTA 4JFEB 4YXKL 3CHRA 1BZ9B 2ZAHA 1PZCA 3BUTA 4XWGL 4B9PA 3VI3E 2PYEB 1DE4B 1XGQA 1N4XL 1QSEA 4GSDH 1LEKA 4UTBA 2YMXL 2XHNA 2YN5A 2DJSA 3Q9QA 4XGZB 3ZKMD 2HX7A 1UVQA 5F0LB 1NCCL 5F72S 1ASOA 2Z4QA 1SHMA 3BAIA 1DL7H 4S1DD 5D1QC 1TJGL 4KXZH 1E5YA 5HVHB 1YG9A 1RMFH 3HZKB 3POHA 2MJWA 1VPOL 3D0VA 5I16A 5AL8A 2V9RA 1GYCA 4W4OA 4X6CF 3EHBC 4MQTB 3RJDA 4MAUH 4X6EA 4HUWB 2ZWSA 5EU7E 2KZBA 4TNWF 2WWNA 5LGJA 2DB8A 2GW5A 4JFHD 1BHGA 5EIIA 4FZEH 1L9QA 1MHEB 3D39E 2K3HA 2HX9A 2NY2C 3E9TA 1F4YL 4V1DA 5FUCE 1O75A 2OYMA 4ONGL 2Y5QA 4XXWC 3MNVB 1HJBC 3VCLB 4BRVA 1KCSH 1J86A 3JV4B 3MUGA 5TDNB 3IKKA 1DQJB 3TONA 1U93A 2PCFA 1ZLVH 5BZWA 3UGXA 2NYYC 2DWDA 1ZC1A 1ANUA 2GAZB 4WCYH 3CPUA 4OVUA 3STLA 1M6OB 1KB9J 3VD9A 1J9SA 3BFOA 5SV3A 1KWGA 1QLRB 3PL6A 2ZAIA 4I3GA 3GSQA 2Y2TA 4LLVA 4N5UA 5KVFL 1UURA 5FTKA 4AE1A 1ACYL 3GSVB 1UWXH 1TTUA 4G3YL 1FG2B 4NN7B 4XPFH 2Z8VC 3L16A 2BE5D 1A3QA 1AQMA 2DQ6A 2Y24A 4XVJH 1P4IL 1H15B 2XN9B 3LKQA 4UIMA 4UQ2A 2EO7A 4XB7A 1JZ2A 1U0QA 4PMFA 5C92A 1HHGA 4PGDB 1DSFH 5FGSA 2JKSA 4NENB 4AYFA 1J0ZA 5DGQA 4CVXA 4LPUA 4BFOA 1TO4A 4GMSH 2DQGL 1GGUA 1TZGL 3VWKA 3WNKA 3L4VA 1LE9B 1GPOH 1TUPA 1JGDB 1Q0XH 4QHUB 3QIWD 4XVUD 3K1DA 5E51A 4EZKA 4P99A 2R4RH 3WEAA 2GFBA 2EVIA 3HZVB 1GKEA 3IMRA 4AVIA 3VW3H 3NJJA 2EVJA 2PNDA 1QR4A 2BMKB 3IETB 2O61B 4L3EA 1DO6A 1WWCA 2WVUA 1CVSC 2ZP8A 4LFHG 4LQFH 2I9LA 3SOBL 3B2VL 4Y4HA 2XRAH 2HVKB 2J43A 1CFNB 2AAAA 4GJTB 2VXTH 4AL8L 1EO5A 1RJCA 3MCKA 3WFCH 4KDVA 1TZAA 2K9UA 2XFXB 4MCZA 4KK8D 1QLFB 1S7QB 4DEPB 2NY5H 4H8WL 2X6VA 4X99A 1C5CL 2R23B 4AV4A 3IDIA 1CDUA 3QEGL 2HLFC 4N8VA 3KYMB 5CFHA 5CNHA 5EC1A 3BEWA 2FEEI 4NRXA 5JQ6L 3GMLA 2EXSA 1FIGH 5CFAA 1PAMA 3CVHB 3D69B 1I1AD 3P4OB 1MFVA 3NMEA 4ZUUB 1AMYA 4AW4A 1C7TA 3GSOA 1SY6L 2A0LC 5JPMA 3O3AB 1FVDB 1D9KC 1J8SA 3FH8A 1WBZA 4AVHA 4ELKB 3R19A 4KX9A 1CR5A 1GCFA 3BQUC 1CUOA 3PDGA 2FH8A 2AQ2A 1HSAB 3CFDB 2XPZA 1J1OL 3W57A 5HYIA 1KEGL 1CXFA 1KGXA 4HKZB 3QZPA 1LVEA 3LX9A 4H88L 5FYLL 1H8SA 1JNHA 2MCMA 1TWGA 1HC1A 4KGLA 2ZWZA 1OVZA 5I1IL 1P5UC 1S7XB 1YQ2A 4HPOH 3S0PA 4EZJA 3JV6A 4MJHA 4IJTA 4H2CA 3NSCA 4HWBH 4JKNA 3REVA 4DAGH 5AOMA 1WH0A 3U7WH 4Q7DA 4DKAA 4ZMLA 1SFOA 1FGVL 1MWOA 1B90A 1SOKA 2R0ZL 3FOMB 5J06A 3HG1D 4AEIL 1QO3A 4OZGA 3S36H 5DVNA 5EZIL 1R5IA 4PB9H 1F3DJ 2YC1A 4MNGE 1O7SA 2BNRB 3GSWB 2Q76B 3V4PB 2B2XH 2WO3B 1HU8A 4A7GA 1FO0L 4JB9H 3RTQA 4JKWA 4PCSA 5D1ZB 3Q3GA 3QXWA 1R5WA 1N18A 2NNXA 4JRLA 5D8JH 5DVMA 5HI3D 4E41E 5FO9A 5ALCH 4C4KO 5I8CB 5I1DA 1CL7I 1VFBB 2LABA 2HVJB 4N28A 3JSSA 4HPYL 4UTAL 1NBQA 3EJSA 3RB7A 5T5MD 4WSGA 3LRMA 4GXUM 5AZUA 4A68A 3O3EA 3VWJA 1YZZA 4AQ1C 2IXQA 1AE6L 1JHTA 3FO9B 3HU2A 2ESVD 1N59A 2FL5A 3QUYC 3EJPA 3L5WA 1PT0A 1SLVA 3G5YB 4N0UE 3NCBB 4OD3H 4PGEB 2G2NA 5ENWB 3R0MA 3WO3B 4HC1H 5C0JA 3WTSA 2BIQA 1QP1A 2KQNA 3APDA 4DTGH 4PU2A 2M8XA 4LEOB 35C8L 5TFSL 3SSGA 3PE9A 1MEXL 1ZV2A 1FH2A 5EU6B 4PEEA 4G8EA 5GJSH 4JVWA 3TIEB 4GW4B 4MJIB 3U4EA 4EUPA 1GJWA 2X4RB 5IHHA 4KHTH 1ZT7A 5DD3L 4YC2B 3KPSA 1HI6B 2ZD0A 1G1CA 1IEAB 4OUUA 4ZTPL 1AP2A 1R17A 5FB8B 2OFQA 1NFDB 4MA7H 4PP1D 4QIWA 1S8DA 4NXSA 4K71C 2H47C 3IEAA 2X1QA 4GRWH 4MVBD 4KXDA 4RNRA 1ORSA 1TKWB 3ML9A 3L3DB 3P2BA 4YDNA 1TLKA 3UGEA 3NRFA 5LO7A 5CMAB 2BXYA 4Q9QL 3US0A 1M9WA 5KN5A 3FDWA 2KPWA 3GHPA 3EYUH 2Q5BA 5ILTH 5EEYA 2V3DA 4AXWA 3QNXB 3QSKB 4Z7UB 3VRJB 4YSAA 1FORH 1UH3A 2WXRA 5DLLA 2KYIA 1G7HB 2QKSA 5CEYB 1UZ8A 2JJSC 3B9VA 3MYZA 5A2BA 4I89A 2CDGA 3O3DB 4XH2B 4FFYH 3RFRA 43C9B 4DUWA 5DYIA 3D3VA 2WVVA 5AB2A 4RAVB 3IGAA 2YO3A 1VAHA 1IGML 5I71C 5JORB 4FQQA 3PWVA 5EZOH 2QSCH 3CZKA 2O30A 5B39B 4HIIB 1YEEH 3MLTA 5BQDA 1A6PA 2J6EL 4OFIA 1QSFA 2IFFH 4M56A 4QKTA 2NY4B 1SXAA 1WZ1H 1T5KA 1F42A 1I4FA 4MA1C 2VITA 2K8QA 2YD7A 4NYLA 1RJLA 2VM9A 1BF2A 4GUPB 5EZJB 3ULSB 2OMUA 1F4XH 1YMHB 4J2XA 1TO5A 1RHHB 4NM8H 3KLLA 4ZQTA 4N2IA 4B7LA 5ERWA 2IFGA 2QVIA 4DK6A 1T1ZB 1UZGA 2QLVB 4X4YA 5C9KA 5GZOD 1E9PB 2FD6L 2FSDA 3UBXI 4ZFOA 4WW2C 2A6KA 1D2PA 4OCWH 1UM5L 1CCZA 3L1EA 3P4NA 5AW4B 1K4DA 1E9QA 4OW6A 4KZDL 1UB5B 2JWYA 4M5YH 1WCQA 3QPXH 4OKDA 3SDAA 3FHQA 1Z7JA 4XODA 1PQEA 2VDKL 5AVZB 3ZHKA 4NQVA 5I1EH 3ZHLA 4MXWL 2FWSA 5FLUA 3IJSA 2WZPD 3FFOA 3HG2A 5F88A 2J6EA 1YEHL 4ABWA 1I9IH 1U92B 5BW7A 3BHBB 4J5VA 5AKSA 4XMKL 5JYLA 1ECZA 5T3ZL 4H20L 3Q48A 1KB9K 4HF5H 5FOBB 3FT2A 4F2EA 3NACH 1WWBX 1ZHNA 5I1KH 4QXUL 3FB5B 3SE9L 3RVWD 2HFEB 1EZVX 4KO8A 4HV8B 5HVGB 2YD6A 2V2TA 1MHPH 1SEQH 3V0VB 2DQFA 1RY7B 5I9QC 2JA5A 1BBJA 2OZNA 5FA3B 5I6PA 1FFOB 3UP6A 2WINA 2ICWA 5FFOA 4LB8A 1DEEB 5FYLE 3VB8A 3OR7A 3S88H 1FFRA 3UMTA 4F24A 3PHQB 3OB8A 4AM0Q 2XIBA 1QYGH 4OB5L 3PDDA 2MTPA 1UOLA 3BWUC 4LVHC 3HUJA 4PP2B 4UT7L 3WXVL 3B7YA 4FFWD 5E9DD 1N5AB 2AJVL 3AITA 3BDYL 1NGWA 1HCYA 1ACCA 4FNSA 1S9YB 5DJZB 1EEYB 2Y36H 3LZOA 1E4XL 5AW6B 2J1XA 3WFHA 3C6LB 3AS1A 2OCJA 1IU1A 1WZLA 1P9MC 4AIZB 5F9JA 3FQNB 4J4PA 4Y5VC 5I76B 3WEMA 2WNGA 3II3A 5B3NA 3OKLB 1AZNA 2ATKA 3E38A 3F12B 2X3AA 3HI1B 3IWVA 4ALAL 5ALBL 3G5ZB 4W9DC 1BX2B 4EVNA 1EZUA 4Y9BA 4PMEA 3UYPB 3TASA 2VC2L 1FL6B 1JBJA 4MJ5A 1N6QH 4PLKC 4MZIA 1CXHA 2Q8AH 1M2OA 2GJRA 4KK5D 4ETQB 5IFJB 3GHEL 1NCGA 3DX9B 4Q74A 4NPJA 5KVMC 1TU2A 3UDWC 5D1XB 3IDYB 1CFSB 1KN2L 4TSCL 2WLIB 2D7TH 3JZYA 1A9EA 3DVGB 3BIAX 5FYKL 4GEJA 4NP9A 3OZ9L 4JHAL 2ADIA 1FPTL 1OPGH 5EFIA 4EAEA 3CZBA 4OZIB 1MCFA 4BCXA 2IDUA 3LH9A 4FXGB 5DYFA 2Q3XA 4WW2F 5L6YL 2YPLD 5MP6H 3N41F 3HKZA 3ZQ9A 3CH1A 4QWWC 4ZTOH 2X4UA 4M7LH 2QJDA 3ISYA 3BZEA 2VXUH 2WOYA 1OE2A 5L2KB 4V1DD 2I7OA 1HJCA 2LFEA 4NO3B 3TT1L 4G2AA 5BVPH 3D33A 3CN4A 3EGXA 2WBJA 3MN8A 2CLVB 3T08A 4JJ5B 3OPZH 4HSAC 3GXTA 1GHFL 4YLBA 3TBVB 1I8MA 5L2JB 2ENGA 3RUGF 2AK4D 3QEQB 1F2QA 3SYOA 5JHDD 3QUKA 3DXAE 3CZSA 3QJZA 3QH3A 2BIOA 5C0IB 2GVYA 4IS6A 2APWA 3L5HA 3BWZA 3FU7A 2JA7A 1BLIA 4E9RA 4C54A 1DR9A 2NXZD 3L5XL 5I15L 4ZW7A 1EUTA 2KDYA 1IFHH 4M4RB 1BXVA 2BOCB 2YQBA 3T8XA 2H2PD 3GJFA 4PRDA 4D9LL 2AJUH 2ZT9C 3MJGX 4DK3A 1H5BA 2Q1EA 3F83A 5EA0H 2VDNB 5FUZL 1F2XK 5KSAA 3BWUF 1W6WA 1IKFL 2X7LB 1W72A 3IFPB 3Q44A 4IMKA 2FBRA 2YRZA 3VYNA 5DDHA 4EBQL 1QACA 1UT9A 5BCAA 6FABL 4BZ2L 3V0JA 3HE6A 2VN3A 5IJCC 2Q3ZA 2WXFA 4MAYB 3MA9H 1V10A 2FATL 3LZFL 4HZLA 4NO5B 4JGNA 6TAAA 2Y1ZA 1KPUA 2IPUG 5ID0B 4FMKA 1G7PB 2BIHA 4CUCA 4XCFL 5DHVA 4U3CA 4HUCA 3R8QA 3X2PA 1DEDA 4NZTL 2FT6A 1U6AL 2VZ1A 3RZCA 2PPDA 3KL5A 2APFA 4OLVL 1PZ5A 1J1XL 2WOBA 1QFWH 2B16A 4H8PA 2NY0B 5FFLA 2PTUA 4ICXA 1H19A 2IH3A 2BH0A 1L9PA 2H2SC 3MBXH 3G3LA 3MXWH 4JPQA 3CAFA 5BS0A 3D34A 4OM1H 3RQ3A 4GLRI 4HCFA 4PGCB 4F8QA 1A6ZB 2A9CA 4UV4L 3R4DA 4PJIA 5FTJA 3BZ4A 4UB0L 2ATPB 5HPMB 4LLYA 2WLKA 1VEOA 1JWUA 2QQQA 4LCWB 3IDXL 4P46C 1K3ZA 1IE4A 5CJ5A 4M03A 1NCBH 4O9HH 2JKWA 2CDFB 2GJ6D 2P5EB 3ASOB 2GSIB 3H4FA 2PO6A 3F3HA 5FYJU 1OF0A 2HJLA 5LCVH 1EX0A 1JVLA 1EFXA 4WWNA 4ZOAA 4NZFA 2HRLA 1H3VA 2WXMA 2ZCLH 3VD0A 4ZTEA 3O9WB 2F7QA 1EZLA 3Q5OA 1BW8A 2J8UF 1IGFL 1X9LA 2JKTM 3BC9A 1JTTA 1SEBB 1XGPB 2JCCA 3OGCB 3ZSTA 4X4MA 4OZHF 5DJ0A 5H35B 3GMNB 4RZCB 3FTUA 1VFMA 4FFTA 2CCWA 1JSYA 3MV9A 2EE6A 1U3HA 2EAEA 1YO4A 1LGVA 3MGTB 3ISRA 3LKPB 4EJ1C 2C1OB 3ZDZB 3B2UD 2LAGB 2E27L 2XNAB 1TR7A 1U8CB 1BJ8A 1P7KA 2Z8RA 3HE7B 3SDDC 3LEYL 5AAWA 1SDAB 1GOHA 1LNUA 2WSPA 3EZJB 2FJGB 1KPVB 3H42L 2GSGB 1EXGA 3PUUA 4PJ8D 1E28A 3X3FH 3BSZL 4A63A 3QZLA 25C8H 2ICEC 1Z5LB 4M1GL 2WD0A 4ZX6A 1JI2A 1XH3B 4MAZA 5FIEA 2WCGA 3SCMD 5FYLD 3DMMC 4WK2B 5F7WC 3VXUE 4GI8A 2FYYA 5F1SA 4K15A 1MCLA 1NPNA 4N6RA 4W6WB 3D25B 2D03L 4KDWA 5B3SB 4YHOH 5I0VA 1Y07A 3SE4A 5INDB 2FX7L 5C07A 4E9TA 3AG4B 3IR6A 2P49B 2W88A 1OZTG 2K7PA 2ZOLB 1BG9A 4U1IB 4JFYB 4M3JA 3QDHA 1UJ3C 4FFYA 1LO0H 5E0FA 2AXGB 1G7QA 1I53A 1Q9LB 4RISH 5JHLH 1P6FA 1RCYA 2XV3A 1MQ8A 3SQBB 1IC4H 1EO8L 1RUKL 3VGGA 5K5YA 2AQ1A 2MNWA 2C3WA 1XO8A 3NCYP 4JO1H 1XR9B 4X4KA 4KH2A 4APQA 4NQCE 3DA0A 1NGYA 4PJXB 3MRMB 1Y6MR 3AMLA 4BQ6A 3QG7H 1LK2A 5GGSA 3ZK0A 4ERSL 3AB0B 3ARDA 1DQMH 3MTRA 4P59L 3CH8A 4V33A 5GLYA 2OXGA 2YRBA 3S36X 3GJEB 2CZNA 3F5WB 2D8KA 2PXYB 5I1JH 3F6IA 1ZSDA 3ZDXE 5E8NB 1IAMA 2Y23A 2HRHA 3GSRB 4UT6L 1JZ5A 1U58B 4TLUA 4YS4A 3QDAA 1E7UA 2JKRM 2OR9H 5KS9A 1JZ8A 1TZHB 4WKXA 1N8ZA 4RMBA 2BFVL 2YGOA 3NYKA 4F7TA 4YSDA 4TRPH 4UDTA 1EGJL 4FQXC 4JY4B 3VXQA 1PG7H 1XF5A 3DX2A 1B4JL 4K9EC 1VB9A 4J8QA 4F57H 2LHAA 1QWHA 1FUNA 2FSEB 3CVHL 1AQDB 2IPTH 3MREB 3O3UN 4J3OC 5DRZA 1VACA 5DTFA 1GY2A 4HKBB 1ZT4A 4DT2A 1I82A 5C2UB 3ARYA 3O2WL 1MLCB 2NY6C 1R9FA 2BNQE 4XMPL 1Q9KA 5HDRA 2M26A 5ICYB 3Q2LA 4KUCF 3V7AG 3GSNB 5GPRA 4JRWA 4DVRH 5CEXB 2BW4A 4B5ZA 1ZA6B 1DANU 1W15A 1SGKA 3W9EB 3ECBB 3FKIA 3MACH 5F7LB 4HU2A 1HCVA 2B5IB 3BH9A 3PWJA 3QUZC 4B9YA 5EBLA 1P7QB 2PP9A 1CXLA 4Y5YC 3SE6A 4PGBA 1UQSB 2JQAA 3Q1EA 4MNQE 5DZOA 3B37A 3SY0A 2OL3H 4LBEA 4X8XA 5IEKA 5A6IA 2EIEA 1P2CA 4N0FB 5TQ2H 5LDSA 3T2LA 1JPTL 4FNUA 5AVXB 3PGDA 2NLJA 2BS71 1WTGT 5EPMB 4MXQD 4QT5B 1XCTA 3O6FA 3OX8B 1KG0A 3SB3A 5LG6A 1F4WH 4HHAB 4OCYH 4OZFH 4AV0A 1KFAL 1FH5L 4G71B 3SN6N 2XY2A 1NCHA 4U1MA 4XCEA 1RXLA 3W1ZA 4P4KB 3E7JA 3V4PL 3KPOA 2P8PB 2YWZA 4FTVB 4UQDA 4OCXL 4M48H 3MRKA 3EDFA 2GT9B 5FKAB 1DVQA 4F93B 2DQJH 3TEYA 3U9UA 2DLIA 3ETBF 3HC3L 4D3CH 1RZGA 1W91A 5J13C 3MRCA 1X9QA 4L4TA 4UUJB 1QFHA 4HMEA 4J3XA 3FRUA 1LEGB 2PICA 3MBEC 3VGAB 3KPNB 3GPSA 2Z7UA 1BD2E 3LQMA 3M07A 3TO2B 4J3UA 1OIOA 1U95B 4KAQL 3BAEL 3EOTL 1L0QA 3QCTL 4KXAA 1QRNA 4L0ZA 3O6MH 2VWEE 3O5AA 1INQA 3BIKA 3BVNB 1Q1JL 1QFPA 3BIBX 4OIAA 3TGXA 4YNYB 4NOFA 3VXMD 1F3DH 4KUZH 3RKDC 5I18L 3BW9B 1B0GA 5JPNC 4OKVA 3PDOB 2YEQA 3V6BR 1MW1A 5IQ9A 2P24A 3ZT5A 2QEJA 1YHPA 3MXVH 1ZHKB 3SJVB 3GUTB 3QFJA 1S9WA 2L8AA 4IBVA 1A7PL 3F58H 2AV1B 4G6KH 1CD1A 4HMDA 4IOFD 1WFTA 1D7DA 5K1JA 2FBOJ 3ZR6A 1BFOA 3D08A 1T03H 4K4KA 2F53E 1QI3A 4IIQB 3N43B 4KXZI 2K9FB 3AVEA 4M8RA 1EAQA 1I75A 2BIMA 2EXYD 4KBPA 4DP5X 3OKMB 5LQBH 5CGYD 3Q8FA 4J3OF 2CAKA 5T3ZD 5F3HB 3AM8A 3PQYE 1T5XB 3X2IA 5I82A 2VM3A 1T0NA 2DQUH 4J2QA 4IK7A 2I24N 3QORC 3CMOL 1DUZB 1LM8V 1UASA 1MWAB 5MENE 3PXLA 4PREB 3IDNB 4KU1A 4IRZH 5IB3A 3H2WA 2HXAA 3I6KB 4KQ3L 2ZG2A 3ULVE 3SULA 4F27A 4P23A 4ODWB 5EDSA 2UZYA 4GKZB 4FJZA 1U8QA 2E7LA 5T3XE 4BSWB 4P57A 1USZA 3VB9A 2ZYRA 2EEXA 3GBNL 4CGUB 1GIGH 1KYDA 1J8HA 3FRPG 2XN9E 2W59A 2W1NA 3Q6FA 1FDLH 3FQTB 1B4RA 1V3KA 3L4CA 3UTZA 1YEKH 3TYFA 2EYTA 1ZHLB 5C6PB 4ZAKA 3SPHA 3BRFA 4LNVA 3F7KA 4JN2A 4R4FL 4PRIE 5BRZB 4R96A 2F8IA 3RFZA 3PGFH 5IW6A 3UTPD 3BKYL 4PHZA 2BVQA 3HVDA 4NQDB 5J9PA 2YWYA 4FHBD 1JZEA 4GKSB 4QRFA 5C0RL 1LQBC 3CLWA 4YHIA 3UAJA 2LQRA 1YPZE 1P1ZA 3BE1L 2UZIH 4LSVH 1M7IB 1SBSL 4Z7AA 1MCWM 5FYJL 5IB1B 4GSXA 1JDCA 2DWTA 4HUXB 1TZIA 4PJ7F 2XICA 1V3LA 3TT3H 4NERA 4OQ1A 3VX1A 4R7LA 3FFDB 4OQTL 5IGXH 2O1AA 3EYFB 5D7JA 3NH7H 3DK2A 1WDAA 4M3KB 3SDXA 3US9A 2H32H 4Y9FA 1DP0A 1TEGA 5IM7A 5FYKD 1A4KA 2BC4B 3FQWA 4FXTA 5I0DA 5L7XL 2UZPA 1B2WH 3DV6B 3E3QC 2LTQC 2FBJL 2X4QB 2ZCZA 2Q7AA 2DTMH 3U0PB 1CT8A 2IMMA 4YPGB 2OMBA 2JIMA 2XQYA 4BFKA 5HGBB 5CHNA 1ZXQA 1GGCH 3O4OC 4I1NB 1AD0A 3RGVB 4DW2H 4M61B 2AVFA 3EG9B 3T0XA 3FSOA 1PY0A 4UI2A 4F2MA 4XC1L 1AGFA 1SBBA 5KW9L 4NRYB 3QRGH 4NUGL 4HH9A 4DMRA 1IBFA 3ZL2A 2MSPA 3LEXB 5AW1B 1QZNA 1JMZA 1HD5A 3NK4A 5DQDH 3KHOA 3V6OC 3STZB 5I73B 3AY2A 3C87A 4GG8B 5CLXA 4LVNC 1OAQH 3JWDL 4HLZG 3PP4L 4YXHL 1F6FB 2FH6A 3DTDA 4NWUL 2AERT 3E80A 4CADA 1K5NB 1PYWA 1ODUA 1EAPB 4WAFA 2VMJA 3K72A 2ZUQB 5DJDB 4JKPH 2OMXA 1CLOH 3DRTB 4XOEA 1RK1A 1X9RA 4YWGH 2VZTA 3AAZB 3M17A 1NMBL 2VH5H 1V7ML 1JZ7A 3UPRB 4K7PH 4X4XA 1AGEA 3QZWG 4WUUB 3KPPA 5C0CA 4PN6A 5EC2A 3WLWC 4BFIA 1TVHB 1S9KC 4KY1L 2XA3A 2O6DA 1EANA 3G5XA 5D2NE 4FP8H 4JZJA 4PJFA 3V0WL 4QYAA 1KGWA 1LMKA 4NM4L 4YDVB 2OMTB 1ZVSB 3FZUC 1DDHB 2EZ0D 3HAEH 3WY3A 2PO6D 1LDSA 4ZPVA 5B8CB 1FNGA 5DYOA 1EFXD 2GCYA 1DVFA 2CDEA 4YX2L 3DUSA 2CLZB 2G5BA 4M9PA 5FK9A 3MUZ1 3TOPA 3ZU8A 3NVQA 2Q3AA 3VUAA 4KROC 2NY7H 4OM0H 5BXFB 3Q2CA 4YXKH 3TXAA 4H8QA 5HYQA 2NYAA 1U8HA 1IX2A 2Z1PA 3BYYA 4OCLC 3WEOA 4UV7L 3N9GL 2CHNA 1Z9NA 2HZHA 4GO9A 2IEPA 5E6UB 4AM0B 3DUUA 2X89A 3SO5A 2YMXH 4BQ9A 3MV9D 5D7LB 4RESB 3ZX1A 1JPGA 5EU6E 1NCCH 4Y4KB 2E5EA 4Z7WB 2QHRH 1TJGH 1FYTD 2YGNA 4LHQB 3B2DC 1J5OL 4JFED 5JHLA 3AWEA 1W16A 3AREC 3KLQA 3SOTA 1BFSA 43CAB 4QTHA 4F58H 2VLJA 5TDPA 1NFDE 1IAKA 2PYED 3GKZA 1AQ8A 2P8LB 1IRAY 3LMJL 4YBQD 1EXHA 4P5TC 2JI1A 1UM4L 3VXNA 1J0IA 5I1CL 3BLKA 3FUMA 4WFGE 3HLKA 2VXVH 3LQZB 2EDRA 4P5RA 4E9QA 4IMLA 4D0DA 2FVNA 1QDNA 1CLYL 5BV7L 1G8JA 4XCCL 2JCWA 3C6SB 2DTSA 4PRPB 1HILA 4FFVC 4Z7UE 1A7QL 4GRLC 3TBYB 1R6VA 3IPEA 4WEMB 5DZ9A 1I7UA 5E99H 4QPEA 4ZPTB 1IVLA 5D6CA 5GRYA 3JYBA 3S5LA 1IGYA 5EZLB 3QIBA 4LHUB 3NBNA 3L3OA 1ACZA 5HD8D 5JZ7D 4MCYA 4XHJC 4Y5XC 3QCVL 3WOVA 1YUKB 2IPKB 4G7QB 4Q0XL 5I1GL 2OSXA 4GW5A 4BH8B 2AXJA 2VDNL 3OKEA 2ZUWA 5IG7B 3C5ZC 1KY6A 2WXOA 4AOFA 2ADYA 2V5TA 4X5XA 1YYLH 4PWHA 3IVKA 2V6HA 3A22A 5F70A 1MVFA 2WUCH 4RVBA 4GRWF 4MMYB 5DQ9A 1RJYA 4A1RA 3SQOH 1P4IH 3IXAB 2OQJB 4OF0A 1PIGA 3EDKA 1KACB 4ENGA 4XPAH 5IBLD 3CXFA 1NKOA 3L9EA 1YEGL 3ES6A 4R7DA 1R0AL 1XIWB 4I0PC 1OOAA 5FHAL 5T3XD 1YUHA 1UZ6F 2H26A 5IREA 1OGSA 1TWAA 2C3HA 2OMYB 4GP5B 4AENA 5FYJE 4Y4FC 2XN9D 4DN3H 3K6OA 5FECB 4PS4L 1XMEB 5F8QC 3EHBB 4PJ9A 2FJUB 3FU0A 2GYSA 1RZJL 3L5JA 2P5WB 3DGGA 5SWSE 3MV01 1E3XA 4AL8H 1S5IL 2QVMA 4NKDB 2YPKB 5E4AA 1G0XA 4KVPA 4F9LC 2R9HD 3TNNA 4D9QE 1OQOA 1CFMA 4XVSL 5K59E 2MFNA 3WFBH 3TCLB 1I7RB 4HG4J 2ZF9A 2DEXX 4JZOB 3VXSE 4QJ5B 4P9HC 2X2UA 3L95A 5CLZA 3RL1A 1JN6B 4DESA 3GJFK 2BSCA 3O45B 4KK6D 4U1KA 1T66C 5CIPB 3H0GA 4MD5B 3O0RH 3FMGL 1ET8A 1IAIM 4LVOB 4L8BA 1RZ8B 5CJ8A 3CFJA 4D8PA 2UXFA 1J7VR 1P4BH 5IQ7H 3VI3A 2EJ1A 1PZUB 2XZQH 4OJEH 4N2FA 3UTSB 1KEGH 5CR8A 1Q16A 4F9PA 2ED6A 3EO0B 3S4SB 3HZMA 1G7MB 5D70L 4QIRA 4H88H 5FYLH 1WITA 1KTDA 3T09A 5IK3A 3M7OA 3NGBB 2FUQA 5E5MA