3SUJA

Crystal structure of cerato-platanin 1 from m. perniciosa (mpcp1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
122
Chain Sequence
AVKLSYDEAYDNPSSSLLSVTCSDGENGLYPKYRTFGDLPGFPIGGSSDIAGYNSPNCGSCYQLTYSSAHTTPKSIYMVAIDRSAEGFTASKQAMDDLTNKRAEELGTVNVDVRKVDFSRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Unknown function
molecule keywords Cerato-platanin 1
total genus 33
structure length 122
sequence length 123
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sujA00
2PNWA 2PI8A 2KQAA 1OA7A 3X2LA 3X2GA 3ENGA 2PJJA 3SUMA 4JS7A 1HD5A 2BH0A 5H4UA 3SULA 2PICA 5GLYA 3X2HA 4JP6A 4FFTA 4FERA 3X2IA 4L48A 4ENGA 3X2MA 4FG4A 5GM9A 1L8FA 2ENGA 1N10A 2GAEA 3X2KA 4AVRA 2HCZX 3X2JA 1BW4A 1OA9A 2G6GA 3SUKA 3X2PA 1BW3A 3SUJA 4JP7A 3D30A 4ZM7A 3CZBA 3X2OA 1WC2A 4FG2A 4JCWA 3X2NA 2AE0X 5GLXA 2G5DA 3M3GA 4JJOA
chains in the Genus database with same CATH superfamily
1TWAA 4QIWA 1OGYA 2PI8A 3HU3A 3IR7A 1E32A 2JIPA 2YU9A 1SMYD 4CS0A 1Y1WA 3X2LA 3X2GA 1PYUB 3GTJA 2PJJA 2VPYA 1SFOA 1TWCA 2KI8A 2PICA 3TM7B 1G8KA 1PQFA 4FERA 3IR6A 4ENGA 3X2MA 5GM9A 1E61A 1TWGA 1TWHA 3X2PA 2A6ED 1PQHA 2JIOA 4JP7A 3QC8A 3D30A 3FKIA 4NOHA 2A69D 2JA5A 1G8JA 1Y5IA 3GTLA 5FTKA 2AE0X 2V3VA 4GA6A 2JA7A 3QQ8A 2VPZA 3CQZA 3X2JA 1E5VA 1UHEA 5DYIA 3GTMA 3ML1A 2PNWA 5FTMA 1KQGA 2VPXA 2KQAA 4DMRA 3HU1A 1YLEA 1KQFA 1VC3B 3GTQA 3ENGA 1HD5A 2BH0A 1YNJD 3X2HA 1PPYA 3X2IA 3GTGA 4L48A 1PQEA 1CR5A 1ZYRD 2PMZA 1N10A 1BW3A 1UHDA 2EEOB 1WCMA 1OA9A 2G6GA 1DMSA 1PYQA 3GTKA 3SUJA 1PT1A 2JIQA 2V45A 2A6HD 2NYAA 3CZBA 5T5ID 1WC2A 3H0GA 2YUJA 4FG2A 4JCWA 3X2NA 5EPPA 5B6CA 2G5DA 3M3GA 3DMRA 2JA6A 1FDOA 5FTLA 1YNND 1Q16A 1OA7A 1EU1A 1R9TA 4CRYG 1QDNA 2IV2X 5C18A 2NAPA 2CW0D 1AW8B 2WB1A 4AONB 4RV0A 4CRZA 1E60A 3SULA 1K83A 1H5NA 2DMRA 2JIMA 4FFTA 3OUGA 4FG4A 1L8FA 2PJHB 3X2KA 2GAEA 1AA6A 1SIWA 4KODA 3SUKA 4GA5A 2R92A 3CF2A 2NVXA 2E2HA 5GLFA 4ZM7A 1Y4ZA 2B63A 4KDLA 5DYGA 3PLXB 2R93A 1IW7D 1I50A 5FTJA 2R7ZA 2E7ZA 5FTNA 2BE5D 4C2MA 3O5AA 1TWFA 2VUMA 2Y0SA 2JIRA 2O5JD 1H0HA 3QQ7A 3SUMA 1E18A 4JS7A 4D7ZB 1PT0A 3GTPA 1CZ5A 2A68D 1R27A 5H4UA 5GLYA 1FDIA 1Y1VA 4JP6A 5T5MD 1CZ4A 3IR5A 2ENGA 1QCSA 1BW4A 4AVRA 1DMRA 2HCZX 3QWZA 3HU2A 4AZDA 2E2IA 1S3SA 4AOKB 3TIWA 2VPWA 1R7RA 3HKZA 4KDIA 3X2OA 5C1BA 1I3QA 1ZC1A 4KO8A 1WLFA 4AYBA 2NVYA 1TMOA 2C45A 5GLXA 4AAYA 4KLNA 4JJOA 2WAQA 3GTOA
chains in the Genus database with same CATH topology
2PNWA 2PI8A 2KQAA 1OA7A 3X2LA 3X2GA 3ENGA 2PJJA 3SUMA 4JS7A 1HD5A 2BH0A 5H4UA 3SULA 2PICA 5GLYA 3X2HA 4JP6A 4FFTA 4FERA 3X2IA 4L48A 4ENGA 3X2MA 4FG4A 5GM9A 1L8FA 2ENGA 1N10A 2GAEA 3X2KA 4AVRA 2HCZX 3X2JA 1BW4A 1OA9A 2G6GA 3SUKA 3X2PA 1BW3A 3SUJA 4JP7A 3D30A 4ZM7A 3CZBA 3X2OA 1WC2A 4FG2A 4JCWA 3X2NA 2AE0X 5GLXA 2G5DA 3M3GA 4JJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNW A;  2PI8 A;  2KQA A;  1OA7 A;  3X2L A;  3X2G A;  3ENG A;  2PJJ A;  3SUM A;  4JS7 A;  1HD5 A;  2BH0 A;  5H4U A;  3SUL A;  2PIC A;  5GLY A;  3X2H A;  4JP6 A;  4FFT A;  4FER A;  3X2I A;  4L48 A;  4ENG A;  3X2M A;  4FG4 A;  5GM9 A;  1L8F A;  2ENG A;  1N10 A;  2GAE A;  3X2K A;  4AVR A;  2HCZ X;  3X2J A;  1BW4 A;  1OA9 A;  2G6G A;  3SUK A;  3X2P A;  1BW3 A;  3SUJ A;  4JP7 A;  3D30 A;  4ZM7 A;  3CZB A;  3X2O A;  1WC2 A;  4FG2 A;  4JCW A;  3X2N A;  2AE0 X;  5GLX A;  2G5D A;  3M3G A;  4JJO A; 
#chains in the Genus database with same CATH topology
 1TWA A;  4QIW A;  1OGY A;  2PI8 A;  3HU3 A;  3IR7 A;  1E32 A;  2JIP A;  2YU9 A;  1SMY D;  4CS0 A;  1Y1W A;  3X2L A;  3X2G A;  1PYU B;  3GTJ A;  2PJJ A;  2VPY A;  1SFO A;  1TWC A;  2KI8 A;  2PIC A;  3TM7 B;  1G8K A;  1PQF A;  4FER A;  3IR6 A;  4ENG A;  3X2M A;  5GM9 A;  1E61 A;  1TWG A;  1TWH A;  3X2P A;  2A6E D;  1PQH A;  2JIO A;  4JP7 A;  3QC8 A;  3D30 A;  3FKI A;  4NOH A;  2A69 D;  2JA5 A;  1G8J A;  1Y5I A;  3GTL A;  5FTK A;  2AE0 X;  2V3V A;  4GA6 A;  2JA7 A;  3QQ8 A;  2VPZ A;  3CQZ A;  3X2J A;  1E5V A;  1UHE A;  5DYI A;  3GTM A;  3ML1 A;  2PNW A;  5FTM A;  1KQG A;  2VPX A;  2KQA A;  4DMR A;  3HU1 A;  1YLE A;  1KQF A;  1VC3 B;  3GTQ A;  3ENG A;  1HD5 A;  2BH0 A;  1YNJ D;  3X2H A;  1PPY A;  3X2I A;  3GTG A;  4L48 A;  1PQE A;  1CR5 A;  1ZYR D;  2PMZ A;  1N10 A;  1BW3 A;  1UHD A;  2EEO B;  1WCM A;  1OA9 A;  2G6G A;  1DMS A;  1PYQ A;  3GTK A;  3SUJ A;  1PT1 A;  2JIQ A;  2V45 A;  2A6H D;  2NYA A;  3CZB A;  5T5I D;  1WC2 A;  3H0G A;  2YUJ A;  4FG2 A;  4JCW A;  3X2N A;  5EPP A;  5B6C A;  2G5D A;  3M3G A;  3DMR A;  2JA6 A;  1FDO A;  5FTL A;  1YNN D;  1Q16 A;  1OA7 A;  1EU1 A;  1R9T A;  4CRY G;  1QDN A;  2IV2 X;  5C18 A;  2NAP A;  2CW0 D;  1AW8 B;  2WB1 A;  4AON B;  4RV0 A;  4CRZ A;  1E60 A;  3SUL A;  1K83 A;  1H5N A;  2DMR A;  2JIM A;  4FFT A;  3OUG A;  4FG4 A;  1L8F A;  2PJH B;  3X2K A;  2GAE A;  1AA6 A;  1SIW A;  4KOD A;  3SUK A;  4GA5 A;  2R92 A;  3CF2 A;  2NVX A;  2E2H A;  5GLF A;  4ZM7 A;  1Y4Z A;  2B63 A;  4KDL A;  5DYG A;  3PLX B;  2R93 A;  1IW7 D;  1I50 A;  5FTJ A;  2R7Z A;  2E7Z A;  5FTN A;  2BE5 D;  4C2M A;  3O5A A;  1TWF A;  2VUM A;  2Y0S A;  2JIR A;  2O5J D;  1H0H A;  3QQ7 A;  3SUM A;  1E18 A;  4JS7 A;  4D7Z B;  1PT0 A;  3GTP A;  1CZ5 A;  2A68 D;  1R27 A;  5H4U A;  5GLY A;  1FDI A;  1Y1V A;  4JP6 A;  5T5M D;  1CZ4 A;  3IR5 A;  2ENG A;  1QCS A;  1BW4 A;  4AVR A;  1DMR A;  2HCZ X;  3QWZ A;  3HU2 A;  4AZD A;  2E2I A;  1S3S A;  4AOK B;  3TIW A;  2VPW A;  1R7R A;  3HKZ A;  4KDI A;  3X2O A;  5C1B A;  1I3Q A;  1ZC1 A;  4KO8 A;  1WLF A;  4AYB A;  2NVY A;  1TMO A;  2C45 A;  5GLX A;  4AAY A;  4KLN A;  4JJO A;  2WAQ A;  3GTO A; 
#chains in the Genus database with same CATH homology
 2PNW A;  2PI8 A;  2KQA A;  1OA7 A;  3X2L A;  3X2G A;  3ENG A;  2PJJ A;  3SUM A;  4JS7 A;  1HD5 A;  2BH0 A;  5H4U A;  3SUL A;  2PIC A;  5GLY A;  3X2H A;  4JP6 A;  4FFT A;  4FER A;  3X2I A;  4L48 A;  4ENG A;  3X2M A;  4FG4 A;  5GM9 A;  1L8F A;  2ENG A;  1N10 A;  2GAE A;  3X2K A;  4AVR A;  2HCZ X;  3X2J A;  1BW4 A;  1OA9 A;  2G6G A;  3SUK A;  3X2P A;  1BW3 A;  3SUJ A;  4JP7 A;  3D30 A;  4ZM7 A;  3CZB A;  3X2O A;  1WC2 A;  4FG2 A;  4JCW A;  3X2N A;  2AE0 X;  5GLX A;  2G5D A;  3M3G A;  4JJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...