3SUJA

Crystal structure of cerato-platanin 1 from m. perniciosa (mpcp1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
122
Chain Sequence
AVKLSYDEAYDNPSSSLLSVTCSDGENGLYPKYRTFGDLPGFPIGGSSDIAGYNSPNCGSCYQLTYSSAHTTPKSIYMVAIDRSAEGFTASKQAMDDLTNKRAEELGTVNVDVRKVDFSRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Unknown function
molecule keywords Cerato-platanin 1
total genus 33
structure length 122
sequence length 123
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sujA00
4ENGA 3X2MA 5GLXA 3SUMA 4FFTA 2HCZX 1HD5A 3ENGA 4FERA 1N10A 3X2KA 3X2PA 2BH0A 5GM9A 2PICA 2KQAA 3X2GA 4JS7A 3X2NA 1L8FA 2AE0X 5GLYA 1BW4A 1OA9A 3X2LA 4JP7A 4FG2A 4JJOA 3D30A 5H4UA 3X2HA 3SUKA 4FG4A 3X2IA 1WC2A 3SULA 1BW3A 3X2OA 3CZBA 4JCWA 4AVRA 3X2JA 2G5DA 2ENGA 2GAEA 2PJJA 3M3GA 4JP6A 4L48A 4ZM7A 2PNWA 3SUJA 2PI8A 1OA7A 2G6GA
chains in the Genus database with same CATH superfamily
1R9TA 1E61A 1Y1VA 5GLXA 1Y1WA 3IR7A 3QC8A 2E2HA 4NOHA 3O5AA 5T5ID 5EPPA 4AZDA 3X2KA 1TWCA 5GM9A 2A6HD 1WLFA 2KQAA 1I50A 4KDLA 1CZ4A 5FTLA 3HU2A 1K83A 3TIWA 1TWFA 2R93A 1KQGA 1PT0A 2NYAA 4GA6A 3D30A 3GTMA 3QQ7A 4GA5A 1I3QA 1PYQA 5GLFA 4JCWA 1CZ5A 5FTKA 2G5DA 2VPYA 4JP6A 2R7ZA 4L48A 4QIWA 4AVRA 1KQFA 1OA7A 2PJHB 1SMYD 2CW0D 3X2MA 3HU1A 1H0HA 1WCMA 1IW7D 2YUJA 1PT1A 4FFTA 4DMRA 3ENGA 3IR5A 3ML1A 2EEOB 1G8JA 1R27A 1TMOA 2WB1A 2BE5D 1E32A 3X2GA 2PICA 2YU9A 3FKIA 1FDOA 1Q16A 1CR5A 2JIMA 2IV2X 2O5JD 2A6ED 1TWGA 2KI8A 4JJOA 5H4UA 1AW8B 3GTQA 1Y4ZA 5DYGA 3SUKA 4AONB 1WC2A 3SULA 1H5NA 2VUMA 1E18A 3X2JA 2PMZA 2PJJA 1TWHA 3QQ8A 5FTJA 3GTPA 1R7RA 2JA7A 2R92A 4ZM7A 2JA6A 4AOKB 4C2MA 2V45A 1VC3B 4AYBA 4ENGA 4AAYA 5C18A 3SUMA 1ZYRD 2E7ZA 2HCZX 1HD5A 1DMRA 1YNJD 4RV0A 3GTGA 5FTMA 1G8KA 1OGYA 2Y0SA 4CS0A 1L8FA 3IR6A 2B63A 2JIRA 1PPYA 1E60A 2DMRA 4CRYG 4FG2A 3X2HA 2JA5A 3TM7B 1UHEA 4FG4A 3X2IA 2JIQA 2NVXA 3X2OA 3OUGA 1UHDA 3CZBA 3QWZA 2E2IA 3CF2A 1ZC1A 3M3GA 2VPXA 3GTOA 1EU1A 2V3VA 1PQEA 3SUJA 5C1BA 3GTKA 2NVYA 2C45A 1YLEA 1S3SA 1PYUB 1BW4A 1PQFA 1SIWA 1QDNA 5DYIA 4FERA 3DMRA 2NAPA 1N10A 5FTNA 4KDIA 3X2PA 2BH0A 4JS7A 1QCSA 3X2NA 1DMSA 1FDIA 4D7ZB 2JIOA 1AA6A 4KLNA 2AE0X 5GLYA 2JIPA 1OA9A 2VPZA 3PLXB 4JP7A 3X2LA 5B6CA 1Y5IA 3CQZA 1E5VA 2WAQA 4KODA 1BW3A 4CRZA 1PQHA 4KO8A 3GTLA 1TWAA 3HKZA 3H0GA 2A68D 2ENGA 2GAEA 1SFOA 2VPWA 1YNND 3HU3A 2A69D 2PNWA 5T5MD 3GTJA 2PI8A 2G6GA
chains in the Genus database with same CATH topology
4ENGA 3X2MA 5GLXA 3SUMA 4FFTA 2HCZX 1HD5A 3ENGA 4FERA 1N10A 3X2KA 3X2PA 2BH0A 5GM9A 2PICA 2KQAA 3X2GA 4JS7A 3X2NA 1L8FA 2AE0X 5GLYA 1BW4A 1OA9A 3X2LA 4JP7A 4FG2A 4JJOA 3D30A 5H4UA 3X2HA 3SUKA 4FG4A 3X2IA 1WC2A 3SULA 1BW3A 3X2OA 3CZBA 4JCWA 4AVRA 3X2JA 2G5DA 2ENGA 2GAEA 2PJJA 3M3GA 4JP6A 4L48A 4ZM7A 2PNWA 3SUJA 2PI8A 1OA7A 2G6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENG A;  3X2M A;  5GLX A;  3SUM A;  4FFT A;  2HCZ X;  1HD5 A;  3ENG A;  4FER A;  1N10 A;  3X2K A;  3X2P A;  2BH0 A;  5GM9 A;  2PIC A;  2KQA A;  3X2G A;  4JS7 A;  3X2N A;  1L8F A;  2AE0 X;  5GLY A;  1BW4 A;  1OA9 A;  3X2L A;  4JP7 A;  4FG2 A;  4JJO A;  3D30 A;  5H4U A;  3X2H A;  3SUK A;  4FG4 A;  3X2I A;  1WC2 A;  3SUL A;  1BW3 A;  3X2O A;  3CZB A;  4JCW A;  4AVR A;  3X2J A;  2G5D A;  2ENG A;  2GAE A;  2PJJ A;  3M3G A;  4JP6 A;  4L48 A;  4ZM7 A;  2PNW A;  3SUJ A;  2PI8 A;  1OA7 A;  2G6G A; 
#chains in the Genus database with same CATH topology
 1R9T A;  1E61 A;  1Y1V A;  5GLX A;  1Y1W A;  3IR7 A;  3QC8 A;  2E2H A;  4NOH A;  3O5A A;  5T5I D;  5EPP A;  4AZD A;  3X2K A;  1TWC A;  5GM9 A;  2A6H D;  1WLF A;  2KQA A;  1I50 A;  4KDL A;  1CZ4 A;  5FTL A;  3HU2 A;  1K83 A;  3TIW A;  1TWF A;  2R93 A;  1KQG A;  1PT0 A;  2NYA A;  4GA6 A;  3D30 A;  3GTM A;  3QQ7 A;  4GA5 A;  1I3Q A;  1PYQ A;  5GLF A;  4JCW A;  1CZ5 A;  5FTK A;  2G5D A;  2VPY A;  4JP6 A;  2R7Z A;  4L48 A;  4QIW A;  4AVR A;  1KQF A;  1OA7 A;  2PJH B;  1SMY D;  2CW0 D;  3X2M A;  3HU1 A;  1H0H A;  1WCM A;  1IW7 D;  2YUJ A;  1PT1 A;  4FFT A;  4DMR A;  3ENG A;  3IR5 A;  3ML1 A;  2EEO B;  1G8J A;  1R27 A;  1TMO A;  2WB1 A;  2BE5 D;  1E32 A;  3X2G A;  2PIC A;  2YU9 A;  3FKI A;  1FDO A;  1Q16 A;  1CR5 A;  2JIM A;  2IV2 X;  2O5J D;  2A6E D;  1TWG A;  2KI8 A;  4JJO A;  5H4U A;  1AW8 B;  3GTQ A;  1Y4Z A;  5DYG A;  3SUK A;  4AON B;  1WC2 A;  3SUL A;  1H5N A;  2VUM A;  1E18 A;  3X2J A;  2PMZ A;  2PJJ A;  1TWH A;  3QQ8 A;  5FTJ A;  3GTP A;  1R7R A;  2JA7 A;  2R92 A;  4ZM7 A;  2JA6 A;  4AOK B;  4C2M A;  2V45 A;  1VC3 B;  4AYB A;  4ENG A;  4AAY A;  5C18 A;  3SUM A;  1ZYR D;  2E7Z A;  2HCZ X;  1HD5 A;  1DMR A;  1YNJ D;  4RV0 A;  3GTG A;  5FTM A;  1G8K A;  1OGY A;  2Y0S A;  4CS0 A;  1L8F A;  3IR6 A;  2B63 A;  2JIR A;  1PPY A;  1E60 A;  2DMR A;  4CRY G;  4FG2 A;  3X2H A;  2JA5 A;  3TM7 B;  1UHE A;  4FG4 A;  3X2I A;  2JIQ A;  2NVX A;  3X2O A;  3OUG A;  1UHD A;  3CZB A;  3QWZ A;  2E2I A;  3CF2 A;  1ZC1 A;  3M3G A;  2VPX A;  3GTO A;  1EU1 A;  2V3V A;  1PQE A;  3SUJ A;  5C1B A;  3GTK A;  2NVY A;  2C45 A;  1YLE A;  1S3S A;  1PYU B;  1BW4 A;  1PQF A;  1SIW A;  1QDN A;  5DYI A;  4FER A;  3DMR A;  2NAP A;  1N10 A;  5FTN A;  4KDI A;  3X2P A;  2BH0 A;  4JS7 A;  1QCS A;  3X2N A;  1DMS A;  1FDI A;  4D7Z B;  2JIO A;  1AA6 A;  4KLN A;  2AE0 X;  5GLY A;  2JIP A;  1OA9 A;  2VPZ A;  3PLX B;  4JP7 A;  3X2L A;  5B6C A;  1Y5I A;  3CQZ A;  1E5V A;  2WAQ A;  4KOD A;  1BW3 A;  4CRZ A;  1PQH A;  4KO8 A;  3GTL A;  1TWA A;  3HKZ A;  3H0G A;  2A68 D;  2ENG A;  2GAE A;  1SFO A;  2VPW A;  1YNN D;  3HU3 A;  2A69 D;  2PNW A;  5T5M D;  3GTJ A;  2PI8 A;  2G6G A; 
#chains in the Genus database with same CATH homology
 4ENG A;  3X2M A;  5GLX A;  3SUM A;  4FFT A;  2HCZ X;  1HD5 A;  3ENG A;  4FER A;  1N10 A;  3X2K A;  3X2P A;  2BH0 A;  5GM9 A;  2PIC A;  2KQA A;  3X2G A;  4JS7 A;  3X2N A;  1L8F A;  2AE0 X;  5GLY A;  1BW4 A;  1OA9 A;  3X2L A;  4JP7 A;  4FG2 A;  4JJO A;  3D30 A;  5H4U A;  3X2H A;  3SUK A;  4FG4 A;  3X2I A;  1WC2 A;  3SUL A;  1BW3 A;  3X2O A;  3CZB A;  4JCW A;  4AVR A;  3X2J A;  2G5D A;  2ENG A;  2GAE A;  2PJJ A;  3M3G A;  4JP6 A;  4L48 A;  4ZM7 A;  2PNW A;  3SUJ A;  2PI8 A;  1OA7 A;  2G6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...