3SUJA

Crystal structure of cerato-platanin 1 from m. perniciosa (mpcp1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
122
Chain Sequence
AVKLSYDEAYDNPSSSLLSVTCSDGENGLYPKYRTFGDLPGFPIGGSSDIAGYNSPNCGSCYQLTYSSAHTTPKSIYMVAIDRSAEGFTASKQAMDDLTNKRAEELGTVNVDVRKVDFSRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin 1
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Unknown function
total genus 33
structure length 122
sequence length 123
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sujA00
1BW4A 4FG2A 2PICA 3CZBA 4ENGA 1L8FA 3X2LA 1OA9A 2GAEA 2PJJA 2KQAA 3X2OA 4FFTA 4ZM7A 1OA7A 3M3GA 2PI8A 4FG4A 3X2NA 4JP6A 2AE0X 4L48A 4JCWA 3SUJA 4JJOA 5GLYA 4FERA 3X2IA 5GLXA 1BW3A 2G5DA 5GM9A 3X2GA 1WC2A 3SUKA 3SUMA 3D30A 4AVRA 3X2MA 3SULA 4JS7A 3X2KA 1N10A 3ENGA 3X2HA 2PNWA 3X2JA 2BH0A 3X2PA 4JP7A 1HD5A 5H4UA 2ENGA 2G6GA 2HCZX
chains in the Genus database with same CATH superfamily
2R7ZA 3ML1A 2JA7A 1CZ5A 1PQEA 3X2LA 2GAEA 2PJJA 1PQHA 2JA6A 1AA6A 1ZYRD 4KODA 1Y1VA 4AZDA 1VC3B 1I3QA 4JP6A 4L48A 1KQGA 2A6ED 4JCWA 3SUJA 3GTQA 3GTMA 2DMRA 2WB1A 4FERA 5GLXA 1BW3A 2NVXA 2G5DA 1DMSA 1SMYD 5FTMA 2R92A 5C1BA 1TWAA 3SUMA 5DYGA 3X2KA 3IR7A 2JA5A 3OUGA 2JIOA 3GTPA 2KI8A 1I50A 4KO8A 2JIRA 2JIPA 2B63A 4RV0A 1UHDA 2WAQA 4CRZA 4ENGA 2JIMA 2Y0SA 3IR5A 3GTGA 1FDIA 1PT1A 1IW7D 2VUMA 4KDIA 3HU2A 5FTNA 5T5MD 1YNND 3M3GA 2O5JD 1WLFA 1PYQA 3IR6A 3TIWA 3QWZA 1DMRA 2IV2X 3QQ8A 5GM9A 3GTKA 5FTJA 1WC2A 4QIWA 1ZC1A 2CW0D 1PPYA 4JS7A 3SULA 3QQ7A 2R93A 2BH0A 1PQFA 4AYBA 1R9TA 4AONB 4D7ZB 4KLNA 2PMZA 5C18A 3HU3A 4GA6A 2A68D 3X2OA 1TWGA 1R7RA 1AW8B 1BW4A 1E32A 2VPZA 2A69D 1OGYA 2PICA 1EU1A 2E2HA 4CRYG 1OA9A 5FTKA 2YU9A 1PYUB 2KQAA 2C45A 1YLEA 3HKZA 3FKIA 5T5ID 4C2MA 1QDNA 1TWHA 1H5NA 3CQZA 1G8KA 4KDLA 3X2NA 2AE0X 1KQFA 1G8JA 5GLYA 2NYAA 1K83A 3CF2A 3X2GA 1TWCA 5B6CA 1CZ4A 4AVRA 3X2MA 1N10A 3X2HA 2V45A 3X2PA 4AAYA 4JP7A 2BE5D 2VPXA 2PJHB 1SFOA 1S3SA 1Q16A 4CS0A 1H0HA 2VPYA 3HU1A 3GTOA 1UHEA 4FG2A 1CR5A 1TWFA 3H0GA 4NOHA 4AOKB 1Y4ZA 1E5VA 3CZBA 2V3VA 1L8FA 1E60A 5DYIA 3GTLA 1Y5IA 4FFTA 4ZM7A 1OA7A 3PLXB 1E61A 2PI8A 4FG4A 1YNJD 3GTJA 1E18A 1R27A 2JIQA 2NAPA 3TM7B 2E2IA 4JJOA 1SIWA 1TMOA 5EPPA 2E7ZA 3X2IA 3O5AA 3SUKA 1Y1WA 4GA5A 3D30A 3ENGA 5GLFA 3QC8A 3DMRA 2PNWA 1QCSA 2A6HD 3X2JA 4DMRA 2EEOB 1HD5A 2YUJA 5H4UA 1WCMA 5FTLA 2ENGA 1PT0A 2VPWA 2G6GA 1FDOA 2HCZX 2NVYA
chains in the Genus database with same CATH topology
1BW4A 4FG2A 2PICA 3CZBA 4ENGA 1L8FA 3X2LA 1OA9A 2GAEA 2PJJA 2KQAA 3X2OA 4FFTA 4ZM7A 1OA7A 3M3GA 2PI8A 4FG4A 3X2NA 4JP6A 2AE0X 4L48A 4JCWA 3SUJA 4JJOA 5GLYA 4FERA 3X2IA 5GLXA 1BW3A 2G5DA 5GM9A 3X2GA 1WC2A 3SUKA 3SUMA 3D30A 4AVRA 3X2MA 3SULA 4JS7A 3X2KA 1N10A 3ENGA 3X2HA 2PNWA 3X2JA 2BH0A 3X2PA 4JP7A 1HD5A 5H4UA 2ENGA 2G6GA 2HCZX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BW4 A;  4FG2 A;  2PIC A;  3CZB A;  4ENG A;  1L8F A;  3X2L A;  1OA9 A;  2GAE A;  2PJJ A;  2KQA A;  3X2O A;  4FFT A;  4ZM7 A;  1OA7 A;  3M3G A;  2PI8 A;  4FG4 A;  3X2N A;  4JP6 A;  2AE0 X;  4L48 A;  4JCW A;  3SUJ A;  4JJO A;  5GLY A;  4FER A;  3X2I A;  5GLX A;  1BW3 A;  2G5D A;  5GM9 A;  3X2G A;  1WC2 A;  3SUK A;  3SUM A;  3D30 A;  4AVR A;  3X2M A;  3SUL A;  4JS7 A;  3X2K A;  1N10 A;  3ENG A;  3X2H A;  2PNW A;  3X2J A;  2BH0 A;  3X2P A;  4JP7 A;  1HD5 A;  5H4U A;  2ENG A;  2G6G A;  2HCZ X; 
#chains in the Genus database with same CATH topology
 2R7Z A;  3ML1 A;  2JA7 A;  1CZ5 A;  1PQE A;  3X2L A;  2GAE A;  2PJJ A;  1PQH A;  2JA6 A;  1AA6 A;  1ZYR D;  4KOD A;  1Y1V A;  4AZD A;  1VC3 B;  1I3Q A;  4JP6 A;  4L48 A;  1KQG A;  2A6E D;  4JCW A;  3SUJ A;  3GTQ A;  3GTM A;  2DMR A;  2WB1 A;  4FER A;  5GLX A;  1BW3 A;  2NVX A;  2G5D A;  1DMS A;  1SMY D;  5FTM A;  2R92 A;  5C1B A;  1TWA A;  3SUM A;  5DYG A;  3X2K A;  3IR7 A;  2JA5 A;  3OUG A;  2JIO A;  3GTP A;  2KI8 A;  1I50 A;  4KO8 A;  2JIR A;  2JIP A;  2B63 A;  4RV0 A;  1UHD A;  2WAQ A;  4CRZ A;  4ENG A;  2JIM A;  2Y0S A;  3IR5 A;  3GTG A;  1FDI A;  1PT1 A;  1IW7 D;  2VUM A;  4KDI A;  3HU2 A;  5FTN A;  5T5M D;  1YNN D;  3M3G A;  2O5J D;  1WLF A;  1PYQ A;  3IR6 A;  3TIW A;  3QWZ A;  1DMR A;  2IV2 X;  3QQ8 A;  5GM9 A;  3GTK A;  5FTJ A;  1WC2 A;  4QIW A;  1ZC1 A;  2CW0 D;  1PPY A;  4JS7 A;  3SUL A;  3QQ7 A;  2R93 A;  2BH0 A;  1PQF A;  4AYB A;  1R9T A;  4AON B;  4D7Z B;  4KLN A;  2PMZ A;  5C18 A;  3HU3 A;  4GA6 A;  2A68 D;  3X2O A;  1TWG A;  1R7R A;  1AW8 B;  1BW4 A;  1E32 A;  2VPZ A;  2A69 D;  1OGY A;  2PIC A;  1EU1 A;  2E2H A;  4CRY G;  1OA9 A;  5FTK A;  2YU9 A;  1PYU B;  2KQA A;  2C45 A;  1YLE A;  3HKZ A;  3FKI A;  5T5I D;  4C2M A;  1QDN A;  1TWH A;  1H5N A;  3CQZ A;  1G8K A;  4KDL A;  3X2N A;  2AE0 X;  1KQF A;  1G8J A;  5GLY A;  2NYA A;  1K83 A;  3CF2 A;  3X2G A;  1TWC A;  5B6C A;  1CZ4 A;  4AVR A;  3X2M A;  1N10 A;  3X2H A;  2V45 A;  3X2P A;  4AAY A;  4JP7 A;  2BE5 D;  2VPX A;  2PJH B;  1SFO A;  1S3S A;  1Q16 A;  4CS0 A;  1H0H A;  2VPY A;  3HU1 A;  3GTO A;  1UHE A;  4FG2 A;  1CR5 A;  1TWF A;  3H0G A;  4NOH A;  4AOK B;  1Y4Z A;  1E5V A;  3CZB A;  2V3V A;  1L8F A;  1E60 A;  5DYI A;  3GTL A;  1Y5I A;  4FFT A;  4ZM7 A;  1OA7 A;  3PLX B;  1E61 A;  2PI8 A;  4FG4 A;  1YNJ D;  3GTJ A;  1E18 A;  1R27 A;  2JIQ A;  2NAP A;  3TM7 B;  2E2I A;  4JJO A;  1SIW A;  1TMO A;  5EPP A;  2E7Z A;  3X2I A;  3O5A A;  3SUK A;  1Y1W A;  4GA5 A;  3D30 A;  3ENG A;  5GLF A;  3QC8 A;  3DMR A;  2PNW A;  1QCS A;  2A6H D;  3X2J A;  4DMR A;  2EEO B;  1HD5 A;  2YUJ A;  5H4U A;  1WCM A;  5FTL A;  2ENG A;  1PT0 A;  2VPW A;  2G6G A;  1FDO A;  2HCZ X;  2NVY A; 
#chains in the Genus database with same CATH homology
 1BW4 A;  4FG2 A;  2PIC A;  3CZB A;  4ENG A;  1L8F A;  3X2L A;  1OA9 A;  2GAE A;  2PJJ A;  2KQA A;  3X2O A;  4FFT A;  4ZM7 A;  1OA7 A;  3M3G A;  2PI8 A;  4FG4 A;  3X2N A;  4JP6 A;  2AE0 X;  4L48 A;  4JCW A;  3SUJ A;  4JJO A;  5GLY A;  4FER A;  3X2I A;  5GLX A;  1BW3 A;  2G5D A;  5GM9 A;  3X2G A;  1WC2 A;  3SUK A;  3SUM A;  3D30 A;  4AVR A;  3X2M A;  3SUL A;  4JS7 A;  3X2K A;  1N10 A;  3ENG A;  3X2H A;  2PNW A;  3X2J A;  2BH0 A;  3X2P A;  4JP7 A;  1HD5 A;  5H4U A;  2ENG A;  2G6G A;  2HCZ X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...