3SUJA

Crystal structure of cerato-platanin 1 from m. perniciosa (mpcp1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
122
Chain Sequence
b'AVKLSYDEAYDNPSSSLLSVTCSDGENGLYPKYRTFGDLPGFPIGGSSDIAGYNSPNCGSCYQLTYSSAHTTPKSIYMVAIDRSAEGFTASKQAMDDLTNKRAEELGTVNVDVRKVDFSRCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin 1
molecule tags Unknown function
source organism Moniliophthora perniciosa
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
total genus 33
structure length 122
sequence length 123
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sujA00
1OA7A 4FERA 1BW3A 5GLYA 3X2KA 4ZM7A 3SULA 3SUJA 3X2NA 3X2JA 2G6GA 2PJJA 1BW4A 2PI8A 3M3GA 2G5DA 1WC2A 3X2GA 4JP6A 5GM9A 3SUMA 3CZBA 2PICA 4FFTA 3X2HA 2GAEA 3D30A 3SUKA 4JP7A 3X2LA 3X2MA 4JCWA 1N10A 4L48A 4JJOA 2AE0X 2PNWA 4FG2A 2HCZX 4FG4A 3X2PA 2BH0A 3ENGA 4AVRA 4ENGA 2KQAA 4JS7A 1HD5A 1OA9A 2ENGA 5H4UA 5GLXA 3X2OA 3X2IA 1L8FA
chains in the Genus database with same CATH superfamily
1OA7A 1BW3A 1PYQA 3GTLA 3SUJA 1PQFA 1PT0A 1R9TA 2O5JD 1Y4ZA 1R27A 1PQHA 2V45A 2A69D 1TWHA 4AZDA 1BW4A 1H0HA 3H0GA 1SIWA 3QQ7A 3ML1A 3M3GA 2VPZA 2VUMA 1PPYA 1H5NA 1WC2A 4JP6A 3X2GA 4DMRA 1AA6A 3GTJA 4CRZA 3D30A 3OUGA 1G8JA 1UHDA 2PMZA 1CR5A 1YLEA 4AYBA 4FG2A 1CZ5A 4CRYG 2E2HA 3X2PA 3HU2A 2VPWA 5DYGA 2R92A 2KQAA 1I3QA 5C1BA 2PJHB 2KI8A 1KQGA 1SFOA 4QIWA 1QCSA 4FERA 1Y5IA 4KODA 3X2KA 4AOKB 1Q16A 2G6GA 2C45A 3IR6A 1PQEA 4KDIA 2EEOB 1Y1WA 3HU1A 1ZYRD 1VC3B 1FDOA 1K83A 4KDLA 2G5DA 5EPPA 3TM7B 5DYIA 3SUMA 1DMRA 1ZC1A 2GAEA 3X2LA 4AONB 2DMRA 2NVXA 1IW7D 1N10A 2NVYA 4L48A 1I50A 1KQFA 2PNWA 5FTJA 3GTPA 4ENGA 2BH0A 3ENGA 4CS0A 2CW0D 1QDNA 4JS7A 5FTKA 5T5MD 1OA9A 2R93A 1CZ4A 1FDIA 3X2IA 4D7ZB 1YNND 2JIOA 2Y0SA 1E60A 4RV0A 5GLYA 5T5ID 1PT1A 4ZM7A 5FTMA 2NAPA 2E2IA 1E61A 1S3SA 1TWCA 1WLFA 5C18A 2PJJA 1TMOA 3HKZA 2NYAA 1E18A 3GTGA 2VPXA 3QQ8A 5GM9A 2JA5A 2JA7A 3CZBA 3CF2A 1YNJD 4FFTA 4KLNA 3X2HA 3FKIA 3GTOA 3X2MA 4JP7A 2YU9A 3DMRA 2JIMA 2BE5D 1UHEA 2VPYA 4KO8A 5GLFA 4AAYA 2A6ED 2E7ZA 2HCZX 4AVRA 3O5AA 4C2MA 2JIRA 3X2OA 2ENGA 3IR5A 4NOHA 5GLXA 5H4UA 1TWFA 1EU1A 1L8FA 1WCMA 2V3VA 4JJOA 1E5VA 3CQZA 2JA6A 3SULA 3X2NA 3QC8A 1OGYA 2WAQA 3TIWA 3X2JA 1G8KA 2R7ZA 1AW8B 3IR7A 2B63A 2PI8A 2YUJA 3QWZA 2A68D 3GTMA 1E32A 2WB1A 5FTLA 2PICA 1PYUB 1R7RA 1SMYD 5B6CA 3SUKA 2JIQA 1Y1VA 4JCWA 1TWGA 2AE0X 4GA6A 2JIPA 5FTNA 2IV2X 4FG4A 1TWAA 3PLXB 1HD5A 1DMSA 3GTQA 3HU3A 3GTKA 4GA5A 2A6HD
chains in the Genus database with same CATH topology
1OA7A 4FERA 1BW3A 5GLYA 3X2KA 4ZM7A 3SULA 3SUJA 3X2NA 3X2JA 2G6GA 2PJJA 1BW4A 2PI8A 3M3GA 2G5DA 1WC2A 3X2GA 4JP6A 5GM9A 3SUMA 3CZBA 2PICA 4FFTA 3X2HA 2GAEA 3D30A 3SUKA 4JP7A 3X2LA 3X2MA 4JCWA 1N10A 4L48A 4JJOA 2AE0X 2PNWA 4FG2A 2HCZX 4FG4A 3X2PA 2BH0A 3ENGA 4AVRA 4ENGA 2KQAA 4JS7A 1HD5A 1OA9A 2ENGA 5H4UA 5GLXA 3X2OA 3X2IA 1L8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OA7 A;  4FER A;  1BW3 A;  5GLY A;  3X2K A;  4ZM7 A;  3SUL A;  3SUJ A;  3X2N A;  3X2J A;  2G6G A;  2PJJ A;  1BW4 A;  2PI8 A;  3M3G A;  2G5D A;  1WC2 A;  3X2G A;  4JP6 A;  5GM9 A;  3SUM A;  3CZB A;  2PIC A;  4FFT A;  3X2H A;  2GAE A;  3D30 A;  3SUK A;  4JP7 A;  3X2L A;  3X2M A;  4JCW A;  1N10 A;  4L48 A;  4JJO A;  2AE0 X;  2PNW A;  4FG2 A;  2HCZ X;  4FG4 A;  3X2P A;  2BH0 A;  3ENG A;  4AVR A;  4ENG A;  2KQA A;  4JS7 A;  1HD5 A;  1OA9 A;  2ENG A;  5H4U A;  5GLX A;  3X2O A;  3X2I A;  1L8F A; 
#chains in the Genus database with same CATH topology
 1OA7 A;  1BW3 A;  1PYQ A;  3GTL A;  3SUJ A;  1PQF A;  1PT0 A;  1R9T A;  2O5J D;  1Y4Z A;  1R27 A;  1PQH A;  2V45 A;  2A69 D;  1TWH A;  4AZD A;  1BW4 A;  1H0H A;  3H0G A;  1SIW A;  3QQ7 A;  3ML1 A;  3M3G A;  2VPZ A;  2VUM A;  1PPY A;  1H5N A;  1WC2 A;  4JP6 A;  3X2G A;  4DMR A;  1AA6 A;  3GTJ A;  4CRZ A;  3D30 A;  3OUG A;  1G8J A;  1UHD A;  2PMZ A;  1CR5 A;  1YLE A;  4AYB A;  4FG2 A;  1CZ5 A;  4CRY G;  2E2H A;  3X2P A;  3HU2 A;  2VPW A;  5DYG A;  2R92 A;  2KQA A;  1I3Q A;  5C1B A;  2PJH B;  2KI8 A;  1KQG A;  1SFO A;  4QIW A;  1QCS A;  4FER A;  1Y5I A;  4KOD A;  3X2K A;  4AOK B;  1Q16 A;  2G6G A;  2C45 A;  3IR6 A;  1PQE A;  4KDI A;  2EEO B;  1Y1W A;  3HU1 A;  1ZYR D;  1VC3 B;  1FDO A;  1K83 A;  4KDL A;  2G5D A;  5EPP A;  3TM7 B;  5DYI A;  3SUM A;  1DMR A;  1ZC1 A;  2GAE A;  3X2L A;  4AON B;  2DMR A;  2NVX A;  1IW7 D;  1N10 A;  2NVY A;  4L48 A;  1I50 A;  1KQF A;  2PNW A;  5FTJ A;  3GTP A;  4ENG A;  2BH0 A;  3ENG A;  4CS0 A;  2CW0 D;  1QDN A;  4JS7 A;  5FTK A;  5T5M D;  1OA9 A;  2R93 A;  1CZ4 A;  1FDI A;  3X2I A;  4D7Z B;  1YNN D;  2JIO A;  2Y0S A;  1E60 A;  4RV0 A;  5GLY A;  5T5I D;  1PT1 A;  4ZM7 A;  5FTM A;  2NAP A;  2E2I A;  1E61 A;  1S3S A;  1TWC A;  1WLF A;  5C18 A;  2PJJ A;  1TMO A;  3HKZ A;  2NYA A;  1E18 A;  3GTG A;  2VPX A;  3QQ8 A;  5GM9 A;  2JA5 A;  2JA7 A;  3CZB A;  3CF2 A;  1YNJ D;  4FFT A;  4KLN A;  3X2H A;  3FKI A;  3GTO A;  3X2M A;  4JP7 A;  2YU9 A;  3DMR A;  2JIM A;  2BE5 D;  1UHE A;  2VPY A;  4KO8 A;  5GLF A;  4AAY A;  2A6E D;  2E7Z A;  2HCZ X;  4AVR A;  3O5A A;  4C2M A;  2JIR A;  3X2O A;  2ENG A;  3IR5 A;  4NOH A;  5GLX A;  5H4U A;  1TWF A;  1EU1 A;  1L8F A;  1WCM A;  2V3V A;  4JJO A;  1E5V A;  3CQZ A;  2JA6 A;  3SUL A;  3X2N A;  3QC8 A;  1OGY A;  2WAQ A;  3TIW A;  3X2J A;  1G8K A;  2R7Z A;  1AW8 B;  3IR7 A;  2B63 A;  2PI8 A;  2YUJ A;  3QWZ A;  2A68 D;  3GTM A;  1E32 A;  2WB1 A;  5FTL A;  2PIC A;  1PYU B;  1R7R A;  1SMY D;  5B6C A;  3SUK A;  2JIQ A;  1Y1V A;  4JCW A;  1TWG A;  2AE0 X;  4GA6 A;  2JIP A;  5FTN A;  2IV2 X;  4FG4 A;  1TWA A;  3PLX B;  1HD5 A;  1DMS A;  3GTQ A;  3HU3 A;  3GTK A;  4GA5 A;  2A6H D; 
#chains in the Genus database with same CATH homology
 1OA7 A;  4FER A;  1BW3 A;  5GLY A;  3X2K A;  4ZM7 A;  3SUL A;  3SUJ A;  3X2N A;  3X2J A;  2G6G A;  2PJJ A;  1BW4 A;  2PI8 A;  3M3G A;  2G5D A;  1WC2 A;  3X2G A;  4JP6 A;  5GM9 A;  3SUM A;  3CZB A;  2PIC A;  4FFT A;  3X2H A;  2GAE A;  3D30 A;  3SUK A;  4JP7 A;  3X2L A;  3X2M A;  4JCW A;  1N10 A;  4L48 A;  4JJO A;  2AE0 X;  2PNW A;  4FG2 A;  2HCZ X;  4FG4 A;  3X2P A;  2BH0 A;  3ENG A;  4AVR A;  4ENG A;  2KQA A;  4JS7 A;  1HD5 A;  1OA9 A;  2ENG A;  5H4U A;  5GLX A;  3X2O A;  3X2I A;  1L8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...