3SUJA

Crystal structure of cerato-platanin 1 from m. perniciosa (mpcp1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
122
Chain Sequence
AVKLSYDEAYDNPSSSLLSVTCSDGENGLYPKYRTFGDLPGFPIGGSSDIAGYNSPNCGSCYQLTYSSAHTTPKSIYMVAIDRSAEGFTASKQAMDDLTNKRAEELGTVNVDVRKVDFSRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Cerato-platanin 1
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
source organism Moniliophthora perniciosa
total genus 33
structure length 122
sequence length 123
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sujA00
1BW3A 4JCWA 4ZM7A 2GAEA 2PI8A 2G5DA 1OA7A 3SUKA 3SUMA 4FG2A 5GLYA 2PNWA 3X2GA 3M3GA 4ENGA 4JS7A 3SULA 2KQAA 1OA9A 1HD5A 4FG4A 4JP7A 3X2IA 3D30A 3X2KA 3X2LA 2ENGA 5H4UA 4FERA 2PJJA 1WC2A 3SUJA 3X2NA 1BW4A 2G6GA 3CZBA 4AVRA 5GLXA 1N10A 2AE0X 3X2OA 1L8FA 3ENGA 4L48A 5GM9A 4JJOA 3X2PA 4JP6A 3X2MA 3X2JA 2PICA 3X2HA 2HCZX 2BH0A 4FFTA
chains in the Genus database with same CATH superfamily
1BW3A 1PYUB 1PT1A 4JCWA 3OUGA 3QQ8A 4FG2A 2VPWA 5FTMA 3TIWA 1UHDA 1R27A 1TWGA 1DMSA 1Y5IA 1TWHA 3QC8A 5C1BA 4KLNA 3D30A 5H4UA 4AAYA 2JIRA 3IR5A 1WC2A 3X2NA 2WAQA 1BW4A 2JA7A 2G6GA 2A6HD 5FTLA 1DMRA 4AVRA 3TM7B 5DYGA 5GLXA 1N10A 2AE0X 3IR6A 1OGYA 1PT0A 1R7RA 5FTNA 1PPYA 3ENGA 1H5NA 3HU2A 5GM9A 3X2OA 3GTJA 2R92A 2Y0SA 3X2JA 5C18A 2NYAA 2JIPA 2IV2X 1SIWA 2HCZX 4ZM7A 1E18A 3GTOA 2O5JD 1TWCA 5B6CA 1YNJD 2G5DA 2YU9A 1R9TA 3CQZA 4CRYG 4ENGA 4JS7A 2NVXA 1E5VA 2EEOB 4JP7A 1YNND 1Q16A 5DYIA 3O5AA 2E2IA 3GTGA 4GA5A 3CF2A 5FTKA 3X2LA 4KODA 4KO8A 3PLXB 1I50A 5EPPA 1G8KA 4NOHA 4AZDA 4D7ZB 3SUJA 5T5ID 1S3SA 1E32A 3QWZA 1PYQA 1CZ5A 1QDNA 2KI8A 4DMRA 1SFOA 2V45A 4JP6A 3X2MA 2YUJA 1QCSA 1SMYD 3X2HA 4RV0A 1E60A 3GTKA 4KDLA 1WLFA 3GTQA 2VPXA 1PQFA 2PI8A 2V3VA 1ZC1A 1OA7A 4QIWA 3SUKA 3SUMA 2B63A 5GLYA 2PNWA 3HKZA 2VPZA 2VPYA 2BE5D 1IW7D 3SULA 2VUMA 1UHEA 1PQEA 2DMRA 4AONB 1TWFA 3X2IA 3ML1A 3X2KA 4AYBA 1PQHA 1Y1VA 2ENGA 1KQGA 2R93A 2PJJA 1AA6A 2JIMA 1Y4ZA 1YLEA 2R7ZA 1Y1WA 1VC3B 2E2HA 3CZBA 3GTPA 1I3QA 1E61A 1TMOA 2JA6A 5FTJA 3IR7A 4KDIA 2PJHB 1L8FA 2JIQA 1KQFA 2PMZA 3HU1A 2JA5A 2JIOA 3GTMA 2NVYA 3H0GA 2E7ZA 1H0HA 1K83A 4CS0A 2GAEA 3FKIA 2C45A 2A69D 2WB1A 1CZ4A 1TWAA 1ZYRD 3QQ7A 3M3GA 3X2GA 2A6ED 2KQAA 1OA9A 1FDIA 1HD5A 1AW8B 4FG4A 1FDOA 5T5MD 2CW0D 4CRZA 4C2MA 4FERA 4GA6A 3GTLA 5GLFA 2A68D 3HU3A 4L48A 3DMRA 2NAPA 4JJOA 1WCMA 1G8JA 1EU1A 3X2PA 2PICA 4AOKB 2BH0A 1CR5A 4FFTA
chains in the Genus database with same CATH topology
1BW3A 4JCWA 4ZM7A 2GAEA 2PI8A 2G5DA 1OA7A 3SUKA 3SUMA 4FG2A 5GLYA 2PNWA 3X2GA 3M3GA 4ENGA 4JS7A 3SULA 2KQAA 1OA9A 1HD5A 4FG4A 4JP7A 3X2IA 3D30A 3X2KA 3X2LA 2ENGA 5H4UA 4FERA 2PJJA 1WC2A 3SUJA 3X2NA 1BW4A 2G6GA 3CZBA 4AVRA 5GLXA 1N10A 2AE0X 3X2OA 1L8FA 3ENGA 4L48A 5GM9A 4JJOA 3X2PA 4JP6A 3X2MA 3X2JA 2PICA 3X2HA 2HCZX 2BH0A 4FFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BW3 A;  4JCW A;  4ZM7 A;  2GAE A;  2PI8 A;  2G5D A;  1OA7 A;  3SUK A;  3SUM A;  4FG2 A;  5GLY A;  2PNW A;  3X2G A;  3M3G A;  4ENG A;  4JS7 A;  3SUL A;  2KQA A;  1OA9 A;  1HD5 A;  4FG4 A;  4JP7 A;  3X2I A;  3D30 A;  3X2K A;  3X2L A;  2ENG A;  5H4U A;  4FER A;  2PJJ A;  1WC2 A;  3SUJ A;  3X2N A;  1BW4 A;  2G6G A;  3CZB A;  4AVR A;  5GLX A;  1N10 A;  2AE0 X;  3X2O A;  1L8F A;  3ENG A;  4L48 A;  5GM9 A;  4JJO A;  3X2P A;  4JP6 A;  3X2M A;  3X2J A;  2PIC A;  3X2H A;  2HCZ X;  2BH0 A;  4FFT A; 
#chains in the Genus database with same CATH topology
 1BW3 A;  1PYU B;  1PT1 A;  4JCW A;  3OUG A;  3QQ8 A;  4FG2 A;  2VPW A;  5FTM A;  3TIW A;  1UHD A;  1R27 A;  1TWG A;  1DMS A;  1Y5I A;  1TWH A;  3QC8 A;  5C1B A;  4KLN A;  3D30 A;  5H4U A;  4AAY A;  2JIR A;  3IR5 A;  1WC2 A;  3X2N A;  2WAQ A;  1BW4 A;  2JA7 A;  2G6G A;  2A6H D;  5FTL A;  1DMR A;  4AVR A;  3TM7 B;  5DYG A;  5GLX A;  1N10 A;  2AE0 X;  3IR6 A;  1OGY A;  1PT0 A;  1R7R A;  5FTN A;  1PPY A;  3ENG A;  1H5N A;  3HU2 A;  5GM9 A;  3X2O A;  3GTJ A;  2R92 A;  2Y0S A;  3X2J A;  5C18 A;  2NYA A;  2JIP A;  2IV2 X;  1SIW A;  2HCZ X;  4ZM7 A;  1E18 A;  3GTO A;  2O5J D;  1TWC A;  5B6C A;  1YNJ D;  2G5D A;  2YU9 A;  1R9T A;  3CQZ A;  4CRY G;  4ENG A;  4JS7 A;  2NVX A;  1E5V A;  2EEO B;  4JP7 A;  1YNN D;  1Q16 A;  5DYI A;  3O5A A;  2E2I A;  3GTG A;  4GA5 A;  3CF2 A;  5FTK A;  3X2L A;  4KOD A;  4KO8 A;  3PLX B;  1I50 A;  5EPP A;  1G8K A;  4NOH A;  4AZD A;  4D7Z B;  3SUJ A;  5T5I D;  1S3S A;  1E32 A;  3QWZ A;  1PYQ A;  1CZ5 A;  1QDN A;  2KI8 A;  4DMR A;  1SFO A;  2V45 A;  4JP6 A;  3X2M A;  2YUJ A;  1QCS A;  1SMY D;  3X2H A;  4RV0 A;  1E60 A;  3GTK A;  4KDL A;  1WLF A;  3GTQ A;  2VPX A;  1PQF A;  2PI8 A;  2V3V A;  1ZC1 A;  1OA7 A;  4QIW A;  3SUK A;  3SUM A;  2B63 A;  5GLY A;  2PNW A;  3HKZ A;  2VPZ A;  2VPY A;  2BE5 D;  1IW7 D;  3SUL A;  2VUM A;  1UHE A;  1PQE A;  2DMR A;  4AON B;  1TWF A;  3X2I A;  3ML1 A;  3X2K A;  4AYB A;  1PQH A;  1Y1V A;  2ENG A;  1KQG A;  2R93 A;  2PJJ A;  1AA6 A;  2JIM A;  1Y4Z A;  1YLE A;  2R7Z A;  1Y1W A;  1VC3 B;  2E2H A;  3CZB A;  3GTP A;  1I3Q A;  1E61 A;  1TMO A;  2JA6 A;  5FTJ A;  3IR7 A;  4KDI A;  2PJH B;  1L8F A;  2JIQ A;  1KQF A;  2PMZ A;  3HU1 A;  2JA5 A;  2JIO A;  3GTM A;  2NVY A;  3H0G A;  2E7Z A;  1H0H A;  1K83 A;  4CS0 A;  2GAE A;  3FKI A;  2C45 A;  2A69 D;  2WB1 A;  1CZ4 A;  1TWA A;  1ZYR D;  3QQ7 A;  3M3G A;  3X2G A;  2A6E D;  2KQA A;  1OA9 A;  1FDI A;  1HD5 A;  1AW8 B;  4FG4 A;  1FDO A;  5T5M D;  2CW0 D;  4CRZ A;  4C2M A;  4FER A;  4GA6 A;  3GTL A;  5GLF A;  2A68 D;  3HU3 A;  4L48 A;  3DMR A;  2NAP A;  4JJO A;  1WCM A;  1G8J A;  1EU1 A;  3X2P A;  2PIC A;  4AOK B;  2BH0 A;  1CR5 A;  4FFT A; 
#chains in the Genus database with same CATH homology
 1BW3 A;  4JCW A;  4ZM7 A;  2GAE A;  2PI8 A;  2G5D A;  1OA7 A;  3SUK A;  3SUM A;  4FG2 A;  5GLY A;  2PNW A;  3X2G A;  3M3G A;  4ENG A;  4JS7 A;  3SUL A;  2KQA A;  1OA9 A;  1HD5 A;  4FG4 A;  4JP7 A;  3X2I A;  3D30 A;  3X2K A;  3X2L A;  2ENG A;  5H4U A;  4FER A;  2PJJ A;  1WC2 A;  3SUJ A;  3X2N A;  1BW4 A;  2G6G A;  3CZB A;  4AVR A;  5GLX A;  1N10 A;  2AE0 X;  3X2O A;  1L8F A;  3ENG A;  4L48 A;  5GM9 A;  4JJO A;  3X2P A;  4JP6 A;  3X2M A;  3X2J A;  2PIC A;  3X2H A;  2HCZ X;  2BH0 A;  4FFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...