2KQAA

The solution structure of the fungal elicitor cerato-platanin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
b'VSISYDPIYAADLSMGSVACSNGDHGLMAQYPTLGEVPGFPNVGGIPDIAGWDSPSCGTCWKVTIPNGNSIFIRGVDSGRGGFNVNPTAFTKLVGSTEAGRVDNVNYVQVDLSNCINGAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin
publication title The solution structure of the fungal elicitor Cerato-Platanin
rcsb
source organism Ceratocystis platani
molecule tags Toxin
total genus 17
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2kqaA00
2PICA 1L8FA 2PJJA 4ENGA 3X2NA 5GLXA 4JP7A 2HCZX 2KQAA 1BW3A 3D30A 5GM9A 2PNWA 3X2JA 1BW4A 3X2HA 1HD5A 4JP6A 2PI8A 3ENGA 3SULA 3X2KA 4L48A 3M3GA 4JJOA 5GLYA 3X2PA 4FERA 3SUKA 4FG2A 3X2OA 2G6GA 3SUMA 1OA7A 4FFTA 4JCWA 4FG4A 2ENGA 4JS7A 3X2MA 3SUJA 4AVRA 2BH0A 2G5DA 2AE0X 2GAEA 5H4UA 1WC2A 1OA9A 1N10A 3X2IA 3X2LA 4ZM7A 3X2GA 3CZBA
chains in the Genus database with same CATH superfamily
1PYQA 3OUGA 2YUJA 2A69D 1Q16A 5EPPA 5FTKA 4AAYA 3D30A 4D7ZB 3CF2A 2E2IA 1BW3A 5DYIA 1QCSA 5FTMA 1H0HA 2R93A 1WLFA 2A6HD 1Y1VA 4AONB 4KLNA 3ENGA 3SULA 1PYUB 2JA5A 1ZYRD 2EEOB 2V3VA 4RV0A 3X2PA 3GTOA 1OGYA 3SUMA 2NYAA 5FTLA 3FKIA 2ENGA 1PQEA 3SUJA 1AA6A 2G5DA 3HU3A 5T5MD 5H4UA 1N10A 1SMYD 3X2IA 3X2LA 5C1BA 1Y1WA 1YLEA 1L8FA 2PJJA 3GTJA 1G8JA 3GTLA 1TWAA 1UHDA 1QDNA 2KI8A 1E60A 1R27A 2V45A 1E5VA 2PI8A 2JIOA 4L48A 3M3GA 4QIWA 2JIMA 1PQHA 5C18A 2PJHB 1TWHA 5GLYA 1UHEA 2Y0SA 3QC8A 3CQZA 2WB1A 2JIPA 1ZC1A 5FTJA 2B63A 4FG4A 1I3QA 1VC3B 1AW8B 3QQ8A 4KODA 4GA6A 2JA6A 2BH0A 4KDLA 2AE0X 2R92A 2GAEA 1PPYA 1TWFA 1CZ4A 4C2MA 3X2GA 5GM9A 3TIWA 5GLFA 2O5JD 3GTGA 1PT0A 3X2NA 1SFOA 3GTKA 2JA7A 5DYGA 1E18A 4AZDA 2PNWA 4KDIA 1BW4A 3O5AA 1S3SA 2IV2X 3X2HA 1HD5A 4JP6A 5T5ID 1E32A 1Y4ZA 2NVYA 1FDOA 5B6CA 1EU1A 1I50A 1K83A 2VUMA 2R7ZA 4DMRA 2VPYA 3QQ7A 1KQGA 1KQFA 3GTQA 2CW0D 4NOHA 1G8KA 3TM7B 4JJOA 1FDIA 4FERA 3SUKA 1OA7A 2E2HA 4JCWA 2WAQA 2PMZA 1R7RA 2VPZA 2BE5D 3IR7A 4JS7A 4AVRA 3HKZA 2VPXA 3IR5A 3H0GA 1PQFA 1OA9A 1WC2A 3IR6A 5FTNA 1DMSA 4ZM7A 2NVXA 2VPWA 1YNJD 2JIQA 3PLXB 3CZBA 1CR5A 2PICA 1YNND 4AOKB 3DMRA 2C45A 1TWCA 1Y5IA 4CRZA 4ENGA 5GLXA 3ML1A 4JP7A 2HCZX 2KQAA 2YU9A 1CZ5A 1WCMA 4KO8A 3X2JA 1PT1A 1IW7D 1E61A 2NAPA 4CS0A 3X2KA 1TWGA 3HU1A 4AYBA 2A6ED 3GTPA 4GA5A 3QWZA 4CRYG 1R9TA 3GTMA 3X2OA 4FG2A 1DMRA 1TMOA 2G6GA 2JIRA 4FFTA 3HU2A 2DMRA 2E7ZA 3X2MA 1SIWA 2A68D 1H5NA
chains in the Genus database with same CATH topology
2PICA 1L8FA 2PJJA 4ENGA 3X2NA 5GLXA 4JP7A 2HCZX 2KQAA 1BW3A 3D30A 5GM9A 2PNWA 3X2JA 1BW4A 3X2HA 1HD5A 4JP6A 2PI8A 3ENGA 3SULA 3X2KA 4L48A 3M3GA 4JJOA 5GLYA 3X2PA 4FERA 3SUKA 4FG2A 3X2OA 2G6GA 3SUMA 1OA7A 4FFTA 4JCWA 4FG4A 2ENGA 4JS7A 3X2MA 3SUJA 4AVRA 2BH0A 2G5DA 2AE0X 2GAEA 5H4UA 1WC2A 1OA9A 1N10A 3X2IA 3X2LA 4ZM7A 3X2GA 3CZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIC A;  1L8F A;  2PJJ A;  4ENG A;  3X2N A;  5GLX A;  4JP7 A;  2HCZ X;  2KQA A;  1BW3 A;  3D30 A;  5GM9 A;  2PNW A;  3X2J A;  1BW4 A;  3X2H A;  1HD5 A;  4JP6 A;  2PI8 A;  3ENG A;  3SUL A;  3X2K A;  4L48 A;  3M3G A;  4JJO A;  5GLY A;  3X2P A;  4FER A;  3SUK A;  4FG2 A;  3X2O A;  2G6G A;  3SUM A;  1OA7 A;  4FFT A;  4JCW A;  4FG4 A;  2ENG A;  4JS7 A;  3X2M A;  3SUJ A;  4AVR A;  2BH0 A;  2G5D A;  2AE0 X;  2GAE A;  5H4U A;  1WC2 A;  1OA9 A;  1N10 A;  3X2I A;  3X2L A;  4ZM7 A;  3X2G A;  3CZB A; 
#chains in the Genus database with same CATH topology
 1PYQ A;  3OUG A;  2YUJ A;  2A69 D;  1Q16 A;  5EPP A;  5FTK A;  4AAY A;  3D30 A;  4D7Z B;  3CF2 A;  2E2I A;  1BW3 A;  5DYI A;  1QCS A;  5FTM A;  1H0H A;  2R93 A;  1WLF A;  2A6H D;  1Y1V A;  4AON B;  4KLN A;  3ENG A;  3SUL A;  1PYU B;  2JA5 A;  1ZYR D;  2EEO B;  2V3V A;  4RV0 A;  3X2P A;  3GTO A;  1OGY A;  3SUM A;  2NYA A;  5FTL A;  3FKI A;  2ENG A;  1PQE A;  3SUJ A;  1AA6 A;  2G5D A;  3HU3 A;  5T5M D;  5H4U A;  1N10 A;  1SMY D;  3X2I A;  3X2L A;  5C1B A;  1Y1W A;  1YLE A;  1L8F A;  2PJJ A;  3GTJ A;  1G8J A;  3GTL A;  1TWA A;  1UHD A;  1QDN A;  2KI8 A;  1E60 A;  1R27 A;  2V45 A;  1E5V A;  2PI8 A;  2JIO A;  4L48 A;  3M3G A;  4QIW A;  2JIM A;  1PQH A;  5C18 A;  2PJH B;  1TWH A;  5GLY A;  1UHE A;  2Y0S A;  3QC8 A;  3CQZ A;  2WB1 A;  2JIP A;  1ZC1 A;  5FTJ A;  2B63 A;  4FG4 A;  1I3Q A;  1VC3 B;  1AW8 B;  3QQ8 A;  4KOD A;  4GA6 A;  2JA6 A;  2BH0 A;  4KDL A;  2AE0 X;  2R92 A;  2GAE A;  1PPY A;  1TWF A;  1CZ4 A;  4C2M A;  3X2G A;  5GM9 A;  3TIW A;  5GLF A;  2O5J D;  3GTG A;  1PT0 A;  3X2N A;  1SFO A;  3GTK A;  2JA7 A;  5DYG A;  1E18 A;  4AZD A;  2PNW A;  4KDI A;  1BW4 A;  3O5A A;  1S3S A;  2IV2 X;  3X2H A;  1HD5 A;  4JP6 A;  5T5I D;  1E32 A;  1Y4Z A;  2NVY A;  1FDO A;  5B6C A;  1EU1 A;  1I50 A;  1K83 A;  2VUM A;  2R7Z A;  4DMR A;  2VPY A;  3QQ7 A;  1KQG A;  1KQF A;  3GTQ A;  2CW0 D;  4NOH A;  1G8K A;  3TM7 B;  4JJO A;  1FDI A;  4FER A;  3SUK A;  1OA7 A;  2E2H A;  4JCW A;  2WAQ A;  2PMZ A;  1R7R A;  2VPZ A;  2BE5 D;  3IR7 A;  4JS7 A;  4AVR A;  3HKZ A;  2VPX A;  3IR5 A;  3H0G A;  1PQF A;  1OA9 A;  1WC2 A;  3IR6 A;  5FTN A;  1DMS A;  4ZM7 A;  2NVX A;  2VPW A;  1YNJ D;  2JIQ A;  3PLX B;  3CZB A;  1CR5 A;  2PIC A;  1YNN D;  4AOK B;  3DMR A;  2C45 A;  1TWC A;  1Y5I A;  4CRZ A;  4ENG A;  5GLX A;  3ML1 A;  4JP7 A;  2HCZ X;  2KQA A;  2YU9 A;  1CZ5 A;  1WCM A;  4KO8 A;  3X2J A;  1PT1 A;  1IW7 D;  1E61 A;  2NAP A;  4CS0 A;  3X2K A;  1TWG A;  3HU1 A;  4AYB A;  2A6E D;  3GTP A;  4GA5 A;  3QWZ A;  4CRY G;  1R9T A;  3GTM A;  3X2O A;  4FG2 A;  1DMR A;  1TMO A;  2G6G A;  2JIR A;  4FFT A;  3HU2 A;  2DMR A;  2E7Z A;  3X2M A;  1SIW A;  2A68 D;  1H5N A; 
#chains in the Genus database with same CATH homology
 2PIC A;  1L8F A;  2PJJ A;  4ENG A;  3X2N A;  5GLX A;  4JP7 A;  2HCZ X;  2KQA A;  1BW3 A;  3D30 A;  5GM9 A;  2PNW A;  3X2J A;  1BW4 A;  3X2H A;  1HD5 A;  4JP6 A;  2PI8 A;  3ENG A;  3SUL A;  3X2K A;  4L48 A;  3M3G A;  4JJO A;  5GLY A;  3X2P A;  4FER A;  3SUK A;  4FG2 A;  3X2O A;  2G6G A;  3SUM A;  1OA7 A;  4FFT A;  4JCW A;  4FG4 A;  2ENG A;  4JS7 A;  3X2M A;  3SUJ A;  4AVR A;  2BH0 A;  2G5D A;  2AE0 X;  2GAE A;  5H4U A;  1WC2 A;  1OA9 A;  1N10 A;  3X2I A;  3X2L A;  4ZM7 A;  3X2G A;  3CZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...