2KQAA

The solution structure of the fungal elicitor cerato-platanin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
VSISYDPIYAADLSMGSVACSNGDHGLMAQYPTLGEVPGFPNVGGIPDIAGWDSPSCGTCWKVTIPNGNSIFIRGVDSGRGGFNVNPTAFTKLVGSTEAGRVDNVNYVQVDLSNCINGAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin
publication title The solution structure of the fungal elicitor Cerato-Platanin
rcsb
source organism Ceratocystis platani
molecule tags Toxin
total genus 17
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2kqaA00
4JS7A 4FERA 2PNWA 4FG2A 1BW4A 4L48A 1OA9A 1WC2A 4ENGA 2HCZX 1BW3A 1L8FA 3X2NA 2PI8A 3SUMA 2ENGA 3X2GA 4FFTA 2PJJA 3SUJA 3X2OA 3CZBA 2GAEA 2PICA 1OA7A 3X2PA 2G5DA 3X2IA 2BH0A 3SUKA 2KQAA 4FG4A 1HD5A 5GM9A 2G6GA 1N10A 2AE0X 3D30A 3X2JA 3M3GA 4ZM7A 3ENGA 3X2KA 4JP7A 3X2LA 4AVRA 3X2HA 4JJOA 5GLYA 3SULA 5H4UA 4JCWA 5GLXA 3X2MA 4JP6A
chains in the Genus database with same CATH superfamily
1UHDA 1BW4A 4FG2A 1SIWA 4L48A 1OA9A 4RV0A 4ENGA 1G8KA 1TWAA 1E60A 1PPYA 3HU2A 1QDNA 1S3SA 3HKZA 1WLFA 4FFTA 2PJJA 3HU1A 3X2OA 1VC3B 2GAEA 1TMOA 2YUJA 1Y1WA 1E18A 1OA7A 4GA5A 1SMYD 2C45A 4NOHA 4QIWA 4AZDA 5C1BA 1WCMA 2A6HD 2NVXA 3IR5A 1R7RA 3D30A 4ZM7A 4KDIA 4JP7A 2VPXA 3GTGA 1UHEA 3FKIA 3X2HA 4C2MA 5FTKA 5T5MD 3IR7A 2WAQA 1TWCA 1CR5A 4JP6A 4JS7A 2E2HA 1QCSA 1YNND 5FTJA 1WC2A 2R92A 1H5NA 3OUGA 1ZC1A 1PQEA 2VPZA 5B6CA 1CZ4A 1PQHA 5FTLA 2Y0SA 1AW8B 4KODA 5C18A 1DMSA 3SUMA 3X2GA 1DMRA 1PYQA 2A6ED 2PICA 1EU1A 4AOKB 2CW0D 3X2PA 3GTLA 2EEOB 1PT0A 1G8JA 2BH0A 3CQZA 3QQ8A 2KQAA 5FTMA 1PQFA 1TWFA 2G6GA 2V45A 2IV2X 2O5JD 2E2IA 4DMRA 2JA7A 1TWHA 3QWZA 3X2LA 2NVYA 3SULA 5H4UA 4JCWA 1TWGA 2JIPA 2JIQA 2V3VA 5DYGA 3IR6A 5GLFA 5GLXA 2VPWA 3TM7B 4FERA 2PNWA 1E61A 5DYIA 1PT1A 5EPPA 1Q16A 2HCZX 2PMZA 2KI8A 1FDIA 1L8FA 2R7ZA 3X2NA 1ZYRD 3DMRA 2ENGA 4KDLA 2PJHB 1K83A 1KQGA 3CZBA 1SFOA 3GTPA 2NAPA 3HU3A 2NYAA 3X2IA 3QQ7A 3GTMA 1YNJD 5GM9A 5FTNA 2B63A 2AE0X 1YLEA 2DMRA 1KQFA 3ENGA 3X2KA 4AVRA 4JJOA 2E7ZA 1FDOA 2JA6A 2JIRA 2JIOA 4CS0A 4KLNA 1R9TA 4KO8A 5T5ID 1H0HA 4AYBA 3GTKA 2A69D 4CRYG 4D7ZB 1BW3A 3O5AA 1AA6A 2PI8A 1E5VA 2JIMA 3QC8A 2WB1A 2JA5A 3SUJA 1CZ5A 1Y4ZA 1Y1VA 2YU9A 3GTQA 3CF2A 2VUMA 2G5DA 1PYUB 1E32A 2BE5D 2VPYA 3GTJA 3GTOA 2R93A 3SUKA 4FG4A 1HD5A 2A68D 1Y5IA 3H0GA 1N10A 4CRZA 3X2JA 3M3GA 3TIWA 4AAYA 1IW7D 4GA6A 1R27A 3PLXB 3ML1A 5GLYA 1I3QA 4AONB 3X2MA 1OGYA 1I50A
chains in the Genus database with same CATH topology
4JS7A 4FERA 2PNWA 4FG2A 1BW4A 4L48A 1OA9A 1WC2A 4ENGA 2HCZX 1BW3A 1L8FA 3X2NA 2PI8A 3SUMA 2ENGA 3X2GA 4FFTA 2PJJA 3SUJA 3X2OA 3CZBA 2GAEA 2PICA 1OA7A 3X2PA 2G5DA 3X2IA 2BH0A 3SUKA 2KQAA 4FG4A 1HD5A 5GM9A 2G6GA 1N10A 2AE0X 3D30A 3X2JA 3M3GA 4ZM7A 3ENGA 3X2KA 4JP7A 3X2LA 4AVRA 3X2HA 4JJOA 5GLYA 3SULA 5H4UA 4JCWA 5GLXA 3X2MA 4JP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JS7 A;  4FER A;  2PNW A;  4FG2 A;  1BW4 A;  4L48 A;  1OA9 A;  1WC2 A;  4ENG A;  2HCZ X;  1BW3 A;  1L8F A;  3X2N A;  2PI8 A;  3SUM A;  2ENG A;  3X2G A;  4FFT A;  2PJJ A;  3SUJ A;  3X2O A;  3CZB A;  2GAE A;  2PIC A;  1OA7 A;  3X2P A;  2G5D A;  3X2I A;  2BH0 A;  3SUK A;  2KQA A;  4FG4 A;  1HD5 A;  5GM9 A;  2G6G A;  1N10 A;  2AE0 X;  3D30 A;  3X2J A;  3M3G A;  4ZM7 A;  3ENG A;  3X2K A;  4JP7 A;  3X2L A;  4AVR A;  3X2H A;  4JJO A;  5GLY A;  3SUL A;  5H4U A;  4JCW A;  5GLX A;  3X2M A;  4JP6 A; 
#chains in the Genus database with same CATH topology
 1UHD A;  1BW4 A;  4FG2 A;  1SIW A;  4L48 A;  1OA9 A;  4RV0 A;  4ENG A;  1G8K A;  1TWA A;  1E60 A;  1PPY A;  3HU2 A;  1QDN A;  1S3S A;  3HKZ A;  1WLF A;  4FFT A;  2PJJ A;  3HU1 A;  3X2O A;  1VC3 B;  2GAE A;  1TMO A;  2YUJ A;  1Y1W A;  1E18 A;  1OA7 A;  4GA5 A;  1SMY D;  2C45 A;  4NOH A;  4QIW A;  4AZD A;  5C1B A;  1WCM A;  2A6H D;  2NVX A;  3IR5 A;  1R7R A;  3D30 A;  4ZM7 A;  4KDI A;  4JP7 A;  2VPX A;  3GTG A;  1UHE A;  3FKI A;  3X2H A;  4C2M A;  5FTK A;  5T5M D;  3IR7 A;  2WAQ A;  1TWC A;  1CR5 A;  4JP6 A;  4JS7 A;  2E2H A;  1QCS A;  1YNN D;  5FTJ A;  1WC2 A;  2R92 A;  1H5N A;  3OUG A;  1ZC1 A;  1PQE A;  2VPZ A;  5B6C A;  1CZ4 A;  1PQH A;  5FTL A;  2Y0S A;  1AW8 B;  4KOD A;  5C18 A;  1DMS A;  3SUM A;  3X2G A;  1DMR A;  1PYQ A;  2A6E D;  2PIC A;  1EU1 A;  4AOK B;  2CW0 D;  3X2P A;  3GTL A;  2EEO B;  1PT0 A;  1G8J A;  2BH0 A;  3CQZ A;  3QQ8 A;  2KQA A;  5FTM A;  1PQF A;  1TWF A;  2G6G A;  2V45 A;  2IV2 X;  2O5J D;  2E2I A;  4DMR A;  2JA7 A;  1TWH A;  3QWZ A;  3X2L A;  2NVY A;  3SUL A;  5H4U A;  4JCW A;  1TWG A;  2JIP A;  2JIQ A;  2V3V A;  5DYG A;  3IR6 A;  5GLF A;  5GLX A;  2VPW A;  3TM7 B;  4FER A;  2PNW A;  1E61 A;  5DYI A;  1PT1 A;  5EPP A;  1Q16 A;  2HCZ X;  2PMZ A;  2KI8 A;  1FDI A;  1L8F A;  2R7Z A;  3X2N A;  1ZYR D;  3DMR A;  2ENG A;  4KDL A;  2PJH B;  1K83 A;  1KQG A;  3CZB A;  1SFO A;  3GTP A;  2NAP A;  3HU3 A;  2NYA A;  3X2I A;  3QQ7 A;  3GTM A;  1YNJ D;  5GM9 A;  5FTN A;  2B63 A;  2AE0 X;  1YLE A;  2DMR A;  1KQF A;  3ENG A;  3X2K A;  4AVR A;  4JJO A;  2E7Z A;  1FDO A;  2JA6 A;  2JIR A;  2JIO A;  4CS0 A;  4KLN A;  1R9T A;  4KO8 A;  5T5I D;  1H0H A;  4AYB A;  3GTK A;  2A69 D;  4CRY G;  4D7Z B;  1BW3 A;  3O5A A;  1AA6 A;  2PI8 A;  1E5V A;  2JIM A;  3QC8 A;  2WB1 A;  2JA5 A;  3SUJ A;  1CZ5 A;  1Y4Z A;  1Y1V A;  2YU9 A;  3GTQ A;  3CF2 A;  2VUM A;  2G5D A;  1PYU B;  1E32 A;  2BE5 D;  2VPY A;  3GTJ A;  3GTO A;  2R93 A;  3SUK A;  4FG4 A;  1HD5 A;  2A68 D;  1Y5I A;  3H0G A;  1N10 A;  4CRZ A;  3X2J A;  3M3G A;  3TIW A;  4AAY A;  1IW7 D;  4GA6 A;  1R27 A;  3PLX B;  3ML1 A;  5GLY A;  1I3Q A;  4AON B;  3X2M A;  1OGY A;  1I50 A; 
#chains in the Genus database with same CATH homology
 4JS7 A;  4FER A;  2PNW A;  4FG2 A;  1BW4 A;  4L48 A;  1OA9 A;  1WC2 A;  4ENG A;  2HCZ X;  1BW3 A;  1L8F A;  3X2N A;  2PI8 A;  3SUM A;  2ENG A;  3X2G A;  4FFT A;  2PJJ A;  3SUJ A;  3X2O A;  3CZB A;  2GAE A;  2PIC A;  1OA7 A;  3X2P A;  2G5D A;  3X2I A;  2BH0 A;  3SUK A;  2KQA A;  4FG4 A;  1HD5 A;  5GM9 A;  2G6G A;  1N10 A;  2AE0 X;  3D30 A;  3X2J A;  3M3G A;  4ZM7 A;  3ENG A;  3X2K A;  4JP7 A;  3X2L A;  4AVR A;  3X2H A;  4JJO A;  5GLY A;  3SUL A;  5H4U A;  4JCW A;  5GLX A;  3X2M A;  4JP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...