2KQAA

The solution structure of the fungal elicitor cerato-platanin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
b'VSISYDPIYAADLSMGSVACSNGDHGLMAQYPTLGEVPGFPNVGGIPDIAGWDSPSCGTCWKVTIPNGNSIFIRGVDSGRGGFNVNPTAFTKLVGSTEAGRVDNVNYVQVDLSNCINGAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin
molecule tags Toxin
source organism Ceratocystis platani
publication title The solution structure of the fungal elicitor Cerato-Platanin
rcsb
total genus 17
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2kqaA00
2BH0A 3D30A 4FG2A 5H4UA 4JP7A 3SUMA 3SULA 4ENGA 5GLXA 3X2OA 4AVRA 2ENGA 4FFTA 1HD5A 4ZM7A 2AE0X 2PI8A 3X2LA 3X2HA 1BW3A 2G5DA 4JCWA 3X2PA 1OA9A 3X2JA 3SUJA 1WC2A 2PNWA 1BW4A 4JP6A 2HCZX 2GAEA 3SUKA 4FERA 1N10A 2KQAA 3X2GA 4JJOA 4FG4A 3ENGA 2PICA 2G6GA 4L48A 1L8FA 3CZBA 5GM9A 3X2KA 5GLYA 3X2MA 1OA7A 4JS7A 3X2NA 2PJJA 3M3GA 3X2IA
chains in the Genus database with same CATH superfamily
3IR6A 1PQEA 1Y5IA 1YLEA 1TWGA 1KQGA 1PYQA 2JIPA 2R92A 1FDIA 2O5JD 1PT0A 4AZDA 4ZM7A 2AE0X 3HU2A 3X2LA 3QQ7A 2V45A 4RV0A 3ML1A 1E60A 1Y1VA 3SUJA 2VUMA 3GTLA 3GTPA 1R27A 1SIWA 1VC3B 1QCSA 4D7ZB 3X2HA 3HU1A 2GAEA 4C2MA 2VPYA 2KQAA 3DMRA 2WAQA 2JA6A 2PICA 1FDOA 1ZYRD 5GM9A 5B6CA 1OGYA 2A68D 3TIWA 5T5MD 2JIOA 3M3GA 4NOHA 3X2IA 5FTNA 4CRZA 3D30A 1PYUB 5H4UA 4JP7A 3GTOA 3SULA 1Y1WA 4AONB 5FTKA 2DMRA 3X2OA 4AVRA 1DMSA 4KO8A 5DYGA 3TM7B 1KQFA 4FFTA 1DMRA 1UHEA 3PLXB 1TMOA 5GLFA 4CS0A 1OA9A 1IW7D 1WC2A 2PMZA 4GA5A 4JP6A 2YUJA 1AA6A 4JJOA 4FG4A 2A69D 3OUGA 1PT1A 5EPPA 2R93A 2JIQA 4KDLA 5C18A 3X2MA 1SMYD 1E5VA 1E18A 2WB1A 3QWZA 2EEOB 2BH0A 2V3VA 1AW8B 4FG2A 3GTMA 3SUMA 4ENGA 1G8JA 1YNND 4CRYG 1E61A 2ENGA 1HD5A 1R7RA 2B63A 3QQ8A 2VPWA 1YNJD 2PI8A 1E32A 3H0GA 1S3SA 5DYIA 1BW3A 2A6HD 3QC8A 3FKIA 2JA5A 3IR7A 2VPZA 3CQZA 1TWCA 1WLFA 3GTGA 1Y4ZA 2A6ED 3O5AA 4KODA 3SUKA 4FERA 5FTJA 3X2GA 5C1BA 3GTQA 2BE5D 4L48A 1L8FA 2VPXA 3CZBA 3X2KA 2NVYA 5GLYA 2NVXA 1TWFA 4JS7A 3X2JA 1H0HA 1I50A 2PJJA 3HKZA 2Y0SA 1K83A 3GTKA 5FTLA 2CW0D 1WCMA 2JIRA 4DMRA 5GLXA 2E7ZA 4GA6A 1H5NA 1PQHA 1TWAA 1PPYA 1QDNA 3IR5A 3GTJA 1ZC1A 2IV2X 1Q16A 3HU3A 4AOKB 1I3QA 2PJHB 4AAYA 2NAPA 1R9TA 2C45A 2G5DA 2NYAA 4JCWA 3X2PA 1CZ5A 2KI8A 3CF2A 2R7ZA 2E2HA 5FTMA 4KDIA 4QIWA 5T5ID 2PNWA 1SFOA 4AYBA 1EU1A 1BW4A 4KLNA 2E2IA 2HCZX 1TWHA 1N10A 1CZ4A 2JA7A 3ENGA 1UHDA 2G6GA 1G8KA 1CR5A 2YU9A 1OA7A 3X2NA 1PQFA 2JIMA
chains in the Genus database with same CATH topology
2BH0A 3D30A 4FG2A 5H4UA 4JP7A 3SUMA 3SULA 4ENGA 5GLXA 3X2OA 4AVRA 2ENGA 4FFTA 1HD5A 4ZM7A 2AE0X 2PI8A 3X2LA 3X2HA 1BW3A 2G5DA 4JCWA 3X2PA 1OA9A 3X2JA 3SUJA 1WC2A 2PNWA 1BW4A 4JP6A 2HCZX 2GAEA 3SUKA 4FERA 1N10A 2KQAA 3X2GA 4JJOA 4FG4A 3ENGA 2PICA 2G6GA 4L48A 1L8FA 3CZBA 5GM9A 3X2KA 5GLYA 3X2MA 1OA7A 4JS7A 3X2NA 2PJJA 3M3GA 3X2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH0 A;  3D30 A;  4FG2 A;  5H4U A;  4JP7 A;  3SUM A;  3SUL A;  4ENG A;  5GLX A;  3X2O A;  4AVR A;  2ENG A;  4FFT A;  1HD5 A;  4ZM7 A;  2AE0 X;  2PI8 A;  3X2L A;  3X2H A;  1BW3 A;  2G5D A;  4JCW A;  3X2P A;  1OA9 A;  3X2J A;  3SUJ A;  1WC2 A;  2PNW A;  1BW4 A;  4JP6 A;  2HCZ X;  2GAE A;  3SUK A;  4FER A;  1N10 A;  2KQA A;  3X2G A;  4JJO A;  4FG4 A;  3ENG A;  2PIC A;  2G6G A;  4L48 A;  1L8F A;  3CZB A;  5GM9 A;  3X2K A;  5GLY A;  3X2M A;  1OA7 A;  4JS7 A;  3X2N A;  2PJJ A;  3M3G A;  3X2I A; 
#chains in the Genus database with same CATH topology
 3IR6 A;  1PQE A;  1Y5I A;  1YLE A;  1TWG A;  1KQG A;  1PYQ A;  2JIP A;  2R92 A;  1FDI A;  2O5J D;  1PT0 A;  4AZD A;  4ZM7 A;  2AE0 X;  3HU2 A;  3X2L A;  3QQ7 A;  2V45 A;  4RV0 A;  3ML1 A;  1E60 A;  1Y1V A;  3SUJ A;  2VUM A;  3GTL A;  3GTP A;  1R27 A;  1SIW A;  1VC3 B;  1QCS A;  4D7Z B;  3X2H A;  3HU1 A;  2GAE A;  4C2M A;  2VPY A;  2KQA A;  3DMR A;  2WAQ A;  2JA6 A;  2PIC A;  1FDO A;  1ZYR D;  5GM9 A;  5B6C A;  1OGY A;  2A68 D;  3TIW A;  5T5M D;  2JIO A;  3M3G A;  4NOH A;  3X2I A;  5FTN A;  4CRZ A;  3D30 A;  1PYU B;  5H4U A;  4JP7 A;  3GTO A;  3SUL A;  1Y1W A;  4AON B;  5FTK A;  2DMR A;  3X2O A;  4AVR A;  1DMS A;  4KO8 A;  5DYG A;  3TM7 B;  1KQF A;  4FFT A;  1DMR A;  1UHE A;  3PLX B;  1TMO A;  5GLF A;  4CS0 A;  1OA9 A;  1IW7 D;  1WC2 A;  2PMZ A;  4GA5 A;  4JP6 A;  2YUJ A;  1AA6 A;  4JJO A;  4FG4 A;  2A69 D;  3OUG A;  1PT1 A;  5EPP A;  2R93 A;  2JIQ A;  4KDL A;  5C18 A;  3X2M A;  1SMY D;  1E5V A;  1E18 A;  2WB1 A;  3QWZ A;  2EEO B;  2BH0 A;  2V3V A;  1AW8 B;  4FG2 A;  3GTM A;  3SUM A;  4ENG A;  1G8J A;  1YNN D;  4CRY G;  1E61 A;  2ENG A;  1HD5 A;  1R7R A;  2B63 A;  3QQ8 A;  2VPW A;  1YNJ D;  2PI8 A;  1E32 A;  3H0G A;  1S3S A;  5DYI A;  1BW3 A;  2A6H D;  3QC8 A;  3FKI A;  2JA5 A;  3IR7 A;  2VPZ A;  3CQZ A;  1TWC A;  1WLF A;  3GTG A;  1Y4Z A;  2A6E D;  3O5A A;  4KOD A;  3SUK A;  4FER A;  5FTJ A;  3X2G A;  5C1B A;  3GTQ A;  2BE5 D;  4L48 A;  1L8F A;  2VPX A;  3CZB A;  3X2K A;  2NVY A;  5GLY A;  2NVX A;  1TWF A;  4JS7 A;  3X2J A;  1H0H A;  1I50 A;  2PJJ A;  3HKZ A;  2Y0S A;  1K83 A;  3GTK A;  5FTL A;  2CW0 D;  1WCM A;  2JIR A;  4DMR A;  5GLX A;  2E7Z A;  4GA6 A;  1H5N A;  1PQH A;  1TWA A;  1PPY A;  1QDN A;  3IR5 A;  3GTJ A;  1ZC1 A;  2IV2 X;  1Q16 A;  3HU3 A;  4AOK B;  1I3Q A;  2PJH B;  4AAY A;  2NAP A;  1R9T A;  2C45 A;  2G5D A;  2NYA A;  4JCW A;  3X2P A;  1CZ5 A;  2KI8 A;  3CF2 A;  2R7Z A;  2E2H A;  5FTM A;  4KDI A;  4QIW A;  5T5I D;  2PNW A;  1SFO A;  4AYB A;  1EU1 A;  1BW4 A;  4KLN A;  2E2I A;  2HCZ X;  1TWH A;  1N10 A;  1CZ4 A;  2JA7 A;  3ENG A;  1UHD A;  2G6G A;  1G8K A;  1CR5 A;  2YU9 A;  1OA7 A;  3X2N A;  1PQF A;  2JIM A; 
#chains in the Genus database with same CATH homology
 2BH0 A;  3D30 A;  4FG2 A;  5H4U A;  4JP7 A;  3SUM A;  3SUL A;  4ENG A;  5GLX A;  3X2O A;  4AVR A;  2ENG A;  4FFT A;  1HD5 A;  4ZM7 A;  2AE0 X;  2PI8 A;  3X2L A;  3X2H A;  1BW3 A;  2G5D A;  4JCW A;  3X2P A;  1OA9 A;  3X2J A;  3SUJ A;  1WC2 A;  2PNW A;  1BW4 A;  4JP6 A;  2HCZ X;  2GAE A;  3SUK A;  4FER A;  1N10 A;  2KQA A;  3X2G A;  4JJO A;  4FG4 A;  3ENG A;  2PIC A;  2G6G A;  4L48 A;  1L8F A;  3CZB A;  5GM9 A;  3X2K A;  5GLY A;  3X2M A;  1OA7 A;  4JS7 A;  3X2N A;  2PJJ A;  3M3G A;  3X2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...