5T5MD

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, trigonal form at 2.5 a.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
b'MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 31
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5mD00
3PLXB 4QIWA 4AZDA 2E7ZA 1PT1A 1TWHA 1QDNA 3GTGA 2PMZA 4GA5A 3QQ8A 2JIQA 2R92A 1TMOA 2E2IA 3TM7B 4DMRA 5DYGA 4GA6A 1G8JA 1G8KA 2DMRA 4KO8A 1FDIA 4RV0A 1KQFA 1UHEA 3IR7A 1I3QA 4D7ZB 5B6CA 3GTOA 1DMRA 4AOKB 5C1BA 2NVXA 4KLNA 1PPYA 4CRYG 1Y5IA 3GTKA 4AAYA 2E2HA 1E60A 1PQEA 4AONB 3GTQA 2VUMA 1SIWA 1WCMA 1DMSA 4CS0A 5FTLA 3TIWA 1CR5A 3O5AA 2NVYA 3IR6A 2V3VA 2JIMA 1YLEA 1FDOA 1I50A 3CF2A 3H0GA 1PYQA 1AW8B 3QQ7A 1QCSA 1PQHA 4KDIA 3IR5A 1TWGA 5T5MD 1H5NA 4KODA 5FTNA 5GLFA 2PJHB 3HKZA 1CZ5A 2IV2X 1E18A 5FTJA 2JA7A 1E32A 1TWCA 1AA6A 1OGYA 1PT0A 3GTMA 1EU1A 2YU9A 1TWAA 2C45A 1R27A 4AYBA 3HU1A 2VPWA 3QC8A 3ML1A 4KDLA 2WB1A 1K83A 1PYUB 1R7RA 3FKIA 1PQFA 3HU2A 2Y0SA 4CRZA 1H0HA 2VPXA 2JIPA 1VC3B 5FTMA 5DYIA 3CQZA 1IW7D 1Y1WA 1R9TA 2JA5A 2B63A 5FTKA 2JIOA 1CZ4A 2NAPA 3DMRA 3HU3A 5C18A 1WLFA 2WAQA 3QWZA 1KQGA 1SFOA 5T5ID 3GTPA 3OUGA 3GTLA 1E5VA 2R93A 1Y4ZA 2VPZA 1TWFA 2JIRA 2NYAA 1S3SA 2R7ZA 2EEOB 5EPPA 3GTJA 1Y1VA 2KI8A 1Q16A 2V45A 4C2MA 2VPYA 1E61A 1UHDA 2JA6A
chains in the Genus database with same CATH superfamily
3PLXB 4QIWA 4FG2A 2E7ZA 4NOHA 4AZDA 1BW3A 1PT1A 1TWHA 1QDNA 2KQAA 3GTGA 2PMZA 4GA5A 3QQ8A 2JIQA 2R92A 1TMOA 2G5DA 2E2IA 3TM7B 4DMRA 5DYGA 4GA6A 1G8JA 4JJOA 1G8KA 2DMRA 4KO8A 1FDIA 3X2KA 4RV0A 2PI8A 1KQFA 1UHEA 3IR7A 3X2MA 1I3QA 4D7ZB 5B6CA 3GTOA 1DMRA 1L8FA 4AOKB 5C1BA 2NVXA 4KLNA 1PPYA 4CRYG 1Y5IA 3GTKA 3X2OA 2GAEA 4FFTA 2O5JD 4AAYA 2AE0X 2E2HA 1SMYD 1E60A 1PQEA 1N10A 2PNWA 3CZBA 4AONB 3GTQA 4FERA 2VUMA 1SIWA 1WCMA 1DMSA 2PJJA 4CS0A 5FTLA 3TIWA 1CR5A 3O5AA 3ENGA 2NVYA 3X2LA 3IR6A 3SUJA 2G6GA 2V3VA 2JIMA 1YLEA 1FDOA 1I50A 3CF2A 3H0GA 1HD5A 1PYQA 4JS7A 5GM9A 1AW8B 3QQ7A 1QCSA 1PQHA 5H4UA 2A6HD 3X2JA 4KDIA 3IR5A 3X2IA 1TWGA 5T5MD 2BE5D 1H5NA 4L48A 4KODA 5FTNA 5GLFA 4ZM7A 2PJHB 3HKZA 3M3GA 1CZ5A 2IV2X 2PICA 1E18A 5FTJA 2JA7A 1E32A 1TWCA 1YNND 1AA6A 1ZYRD 2CW0D 1OGYA 1PT0A 3GTMA 1EU1A 2YU9A 2A68D 1TWAA 2C45A 1R27A 4AYBA 3HU1A 4AVRA 4FG4A 2VPWA 2ENGA 4JCWA 3QC8A 3ML1A 4KDLA 1OA7A 3X2NA 3X2PA 1YNJD 2WB1A 1K83A 1PYUB 1R7RA 2HCZX 3FKIA 1PQFA 3HU2A 2Y0SA 5GLYA 3X2GA 4CRZA 1H0HA 2VPXA 2JIPA 1VC3B 5FTMA 5DYIA 3CQZA 1ZC1A 1IW7D 2BH0A 1Y1WA 3SUKA 1R9TA 1OA9A 2JA5A 2A69D 2B63A 5FTKA 2JIOA 1CZ4A 2NAPA 3DMRA 1BW4A 3HU3A 5C18A 1WLFA 2WAQA 2YUJA 3QWZA 1KQGA 1SFOA 5T5ID 3GTPA 3OUGA 3GTLA 1E5VA 2R93A 1Y4ZA 2VPZA 1TWFA 2JIRA 3SULA 2NYAA 1S3SA 2R7ZA 3D30A 2EEOB 5EPPA 2A6ED 3GTJA 1Y1VA 2KI8A 1Q16A 2V45A 3SUMA 3X2HA 4JP6A 4C2MA 2VPYA 1E61A 1WC2A 4JP7A 4ENGA 1UHDA 2JA6A 5GLXA
chains in the Genus database with same CATH topology
3PLXB 4QIWA 4NOHA 2E7ZA 4AZDA 1PT1A 1TWHA 1QDNA 3GTGA 2PMZA 4GA5A 3QQ8A 2JIQA 2R92A 1TMOA 2G5DA 2E2IA 3TM7B 4DMRA 5DYGA 4GA6A 1G8JA 1G8KA 2DMRA 4KO8A 1FDIA 4RV0A 2PI8A 1KQFA 1UHEA 3IR7A 1I3QA 4D7ZB 5B6CA 3GTOA 1DMRA 4AOKB 5C1BA 2NVXA 4KLNA 1PPYA 4CRYG 1Y5IA 3GTKA 2GAEA 2O5JD 4AAYA 2AE0X 2E2HA 1SMYD 1E60A 1PQEA 3CZBA 2PNWA 4AONB 3GTQA 2VUMA 1SIWA 1WCMA 1DMSA 2PJJA 4CS0A 5FTLA 3TIWA 1CR5A 3O5AA 2NVYA 3IR6A 2G6GA 2V3VA 2JIMA 1YLEA 1FDOA 1I50A 3CF2A 3H0GA 1PYQA 1AW8B 3QQ7A 1QCSA 1PQHA 2A6HD 4KDIA 3IR5A 1TWGA 5T5MD 2BE5D 1H5NA 4KODA 5FTNA 5GLFA 2PJHB 3HKZA 1CZ5A 2IV2X 2PICA 1E18A 5FTJA 2JA7A 1E32A 1TWCA 1YNND 1AA6A 1ZYRD 2CW0D 1OGYA 1PT0A 3GTMA 1EU1A 2YU9A 2A68D 1TWAA 2C45A 1R27A 4AYBA 3HU1A 2VPWA 3QC8A 3ML1A 4KDLA 1YNJD 2WB1A 1K83A 1PYUB 1R7RA 3FKIA 1PQFA 3HU2A 2Y0SA 4CRZA 1H0HA 2VPXA 2JIPA 1VC3B 5FTMA 5DYIA 3CQZA 1ZC1A 1IW7D 1Y1WA 1R9TA 2JA5A 2A69D 2B63A 5FTKA 2JIOA 1CZ4A 2NAPA 3DMRA 3HU3A 5C18A 1WLFA 2WAQA 2YUJA 3QWZA 1KQGA 1SFOA 5T5ID 3GTPA 3OUGA 3GTLA 1E5VA 2R93A 1Y4ZA 2VPZA 1TWFA 2JIRA 2NYAA 1S3SA 2R7ZA 2EEOB 5EPPA 2A6ED 3GTJA 1Y1VA 2KI8A 1Q16A 2V45A 4C2MA 2VPYA 1E61A 1UHDA 2JA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLX B;  4QIW A;  4AZD A;  2E7Z A;  1PT1 A;  1TWH A;  1QDN A;  3GTG A;  2PMZ A;  4GA5 A;  3QQ8 A;  2JIQ A;  2R92 A;  1TMO A;  2E2I A;  3TM7 B;  4DMR A;  5DYG A;  4GA6 A;  1G8J A;  1G8K A;  2DMR A;  4KO8 A;  1FDI A;  4RV0 A;  1KQF A;  1UHE A;  3IR7 A;  1I3Q A;  4D7Z B;  5B6C A;  3GTO A;  1DMR A;  4AOK B;  5C1B A;  2NVX A;  4KLN A;  1PPY A;  4CRY G;  1Y5I A;  3GTK A;  4AAY A;  2E2H A;  1E60 A;  1PQE A;  4AON B;  3GTQ A;  2VUM A;  1SIW A;  1WCM A;  1DMS A;  4CS0 A;  5FTL A;  3TIW A;  1CR5 A;  3O5A A;  2NVY A;  3IR6 A;  2V3V A;  2JIM A;  1YLE A;  1FDO A;  1I50 A;  3CF2 A;  3H0G A;  1PYQ A;  1AW8 B;  3QQ7 A;  1QCS A;  1PQH A;  4KDI A;  3IR5 A;  1TWG A;  5T5M D;  1H5N A;  4KOD A;  5FTN A;  5GLF A;  2PJH B;  3HKZ A;  1CZ5 A;  2IV2 X;  1E18 A;  5FTJ A;  2JA7 A;  1E32 A;  1TWC A;  1AA6 A;  1OGY A;  1PT0 A;  3GTM A;  1EU1 A;  2YU9 A;  1TWA A;  2C45 A;  1R27 A;  4AYB A;  3HU1 A;  2VPW A;  3QC8 A;  3ML1 A;  4KDL A;  2WB1 A;  1K83 A;  1PYU B;  1R7R A;  3FKI A;  1PQF A;  3HU2 A;  2Y0S A;  4CRZ A;  1H0H A;  2VPX A;  2JIP A;  1VC3 B;  5FTM A;  5DYI A;  3CQZ A;  1IW7 D;  1Y1W A;  1R9T A;  2JA5 A;  2B63 A;  5FTK A;  2JIO A;  1CZ4 A;  2NAP A;  3DMR A;  3HU3 A;  5C18 A;  1WLF A;  2WAQ A;  3QWZ A;  1KQG A;  1SFO A;  5T5I D;  3GTP A;  3OUG A;  3GTL A;  1E5V A;  2R93 A;  1Y4Z A;  2VPZ A;  1TWF A;  2JIR A;  2NYA A;  1S3S A;  2R7Z A;  2EEO B;  5EPP A;  3GTJ A;  1Y1V A;  2KI8 A;  1Q16 A;  2V45 A;  4C2M A;  2VPY A;  1E61 A;  1UHD A;  2JA6 A; 
#chains in the Genus database with same CATH topology
 3PLX B;  4QIW A;  4FG2 A;  2E7Z A;  4NOH A;  4AZD A;  1BW3 A;  1PT1 A;  1TWH A;  1QDN A;  2KQA A;  3GTG A;  2PMZ A;  4GA5 A;  3QQ8 A;  2JIQ A;  2R92 A;  1TMO A;  2G5D A;  2E2I A;  3TM7 B;  4DMR A;  5DYG A;  4GA6 A;  1G8J A;  4JJO A;  1G8K A;  2DMR A;  4KO8 A;  1FDI A;  3X2K A;  4RV0 A;  2PI8 A;  1KQF A;  1UHE A;  3IR7 A;  3X2M A;  1I3Q A;  4D7Z B;  5B6C A;  3GTO A;  1DMR A;  1L8F A;  4AOK B;  5C1B A;  2NVX A;  4KLN A;  1PPY A;  4CRY G;  1Y5I A;  3GTK A;  3X2O A;  2GAE A;  4FFT A;  2O5J D;  4AAY A;  2AE0 X;  2E2H A;  1SMY D;  1E60 A;  1PQE A;  1N10 A;  2PNW A;  3CZB A;  4AON B;  3GTQ A;  4FER A;  2VUM A;  1SIW A;  1WCM A;  1DMS A;  2PJJ A;  4CS0 A;  5FTL A;  3TIW A;  1CR5 A;  3O5A A;  3ENG A;  2NVY A;  3X2L A;  3IR6 A;  3SUJ A;  2G6G A;  2V3V A;  2JIM A;  1YLE A;  1FDO A;  1I50 A;  3CF2 A;  3H0G A;  1HD5 A;  1PYQ A;  4JS7 A;  5GM9 A;  1AW8 B;  3QQ7 A;  1QCS A;  1PQH A;  5H4U A;  2A6H D;  3X2J A;  4KDI A;  3IR5 A;  3X2I A;  1TWG A;  5T5M D;  2BE5 D;  1H5N A;  4L48 A;  4KOD A;  5FTN A;  5GLF A;  4ZM7 A;  2PJH B;  3HKZ A;  3M3G A;  1CZ5 A;  2IV2 X;  2PIC A;  1E18 A;  5FTJ A;  2JA7 A;  1E32 A;  1TWC A;  1YNN D;  1AA6 A;  1ZYR D;  2CW0 D;  1OGY A;  1PT0 A;  3GTM A;  1EU1 A;  2YU9 A;  2A68 D;  1TWA A;  2C45 A;  1R27 A;  4AYB A;  3HU1 A;  4AVR A;  4FG4 A;  2VPW A;  2ENG A;  4JCW A;  3QC8 A;  3ML1 A;  4KDL A;  1OA7 A;  3X2N A;  3X2P A;  1YNJ D;  2WB1 A;  1K83 A;  1PYU B;  1R7R A;  2HCZ X;  3FKI A;  1PQF A;  3HU2 A;  2Y0S A;  5GLY A;  3X2G A;  4CRZ A;  1H0H A;  2VPX A;  2JIP A;  1VC3 B;  5FTM A;  5DYI A;  3CQZ A;  1ZC1 A;  1IW7 D;  2BH0 A;  1Y1W A;  3SUK A;  1R9T A;  1OA9 A;  2JA5 A;  2A69 D;  2B63 A;  5FTK A;  2JIO A;  1CZ4 A;  2NAP A;  3DMR A;  1BW4 A;  3HU3 A;  5C18 A;  1WLF A;  2WAQ A;  2YUJ A;  3QWZ A;  1KQG A;  1SFO A;  5T5I D;  3GTP A;  3OUG A;  3GTL A;  1E5V A;  2R93 A;  1Y4Z A;  2VPZ A;  1TWF A;  2JIR A;  3SUL A;  2NYA A;  1S3S A;  2R7Z A;  3D30 A;  2EEO B;  5EPP A;  2A6E D;  3GTJ A;  1Y1V A;  2KI8 A;  1Q16 A;  2V45 A;  3SUM A;  3X2H A;  4JP6 A;  4C2M A;  2VPY A;  1E61 A;  1WC2 A;  4JP7 A;  4ENG A;  1UHD A;  2JA6 A;  5GLX A; 
#chains in the Genus database with same CATH homology
 3PLX B;  4QIW A;  4NOH A;  2E7Z A;  4AZD A;  1PT1 A;  1TWH A;  1QDN A;  3GTG A;  2PMZ A;  4GA5 A;  3QQ8 A;  2JIQ A;  2R92 A;  1TMO A;  2G5D A;  2E2I A;  3TM7 B;  4DMR A;  5DYG A;  4GA6 A;  1G8J A;  1G8K A;  2DMR A;  4KO8 A;  1FDI A;  4RV0 A;  2PI8 A;  1KQF A;  1UHE A;  3IR7 A;  1I3Q A;  4D7Z B;  5B6C A;  3GTO A;  1DMR A;  4AOK B;  5C1B A;  2NVX A;  4KLN A;  1PPY A;  4CRY G;  1Y5I A;  3GTK A;  2GAE A;  2O5J D;  4AAY A;  2AE0 X;  2E2H A;  1SMY D;  1E60 A;  1PQE A;  3CZB A;  2PNW A;  4AON B;  3GTQ A;  2VUM A;  1SIW A;  1WCM A;  1DMS A;  2PJJ A;  4CS0 A;  5FTL A;  3TIW A;  1CR5 A;  3O5A A;  2NVY A;  3IR6 A;  2G6G A;  2V3V A;  2JIM A;  1YLE A;  1FDO A;  1I50 A;  3CF2 A;  3H0G A;  1PYQ A;  1AW8 B;  3QQ7 A;  1QCS A;  1PQH A;  2A6H D;  4KDI A;  3IR5 A;  1TWG A;  5T5M D;  2BE5 D;  1H5N A;  4KOD A;  5FTN A;  5GLF A;  2PJH B;  3HKZ A;  1CZ5 A;  2IV2 X;  2PIC A;  1E18 A;  5FTJ A;  2JA7 A;  1E32 A;  1TWC A;  1YNN D;  1AA6 A;  1ZYR D;  2CW0 D;  1OGY A;  1PT0 A;  3GTM A;  1EU1 A;  2YU9 A;  2A68 D;  1TWA A;  2C45 A;  1R27 A;  4AYB A;  3HU1 A;  2VPW A;  3QC8 A;  3ML1 A;  4KDL A;  1YNJ D;  2WB1 A;  1K83 A;  1PYU B;  1R7R A;  3FKI A;  1PQF A;  3HU2 A;  2Y0S A;  4CRZ A;  1H0H A;  2VPX A;  2JIP A;  1VC3 B;  5FTM A;  5DYI A;  3CQZ A;  1ZC1 A;  1IW7 D;  1Y1W A;  1R9T A;  2JA5 A;  2A69 D;  2B63 A;  5FTK A;  2JIO A;  1CZ4 A;  2NAP A;  3DMR A;  3HU3 A;  5C18 A;  1WLF A;  2WAQ A;  2YUJ A;  3QWZ A;  1KQG A;  1SFO A;  5T5I D;  3GTP A;  3OUG A;  3GTL A;  1E5V A;  2R93 A;  1Y4Z A;  2VPZ A;  1TWF A;  2JIR A;  2NYA A;  1S3S A;  2R7Z A;  2EEO B;  5EPP A;  2A6E D;  3GTJ A;  1Y1V A;  2KI8 A;  1Q16 A;  2V45 A;  4C2M A;  2VPY A;  1E61 A;  1UHD A;  2JA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...