5T5MD

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, trigonal form at 2.5 a.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
b'MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
molecule tags Oxidoreductase
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
total genus 31
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5mD00
2WB1A 1DMRA 1PYUB 1E61A 2YU9A 2Y0SA 1R27A 1KQFA 2VPZA 3GTLA 2PMZA 1E5VA 5FTJA 5T5ID 1PQEA 1Q16A 1DMSA 2R7ZA 5FTKA 4KO8A 4CRYG 4RV0A 3TM7B 2JIMA 1SIWA 2NVYA 2VUMA 1E32A 1CZ4A 1G8KA 5DYIA 1S3SA 3HKZA 1PT1A 2JA7A 4AOKB 1H0HA 4GA5A 5C18A 3GTMA 1WLFA 1PT0A 1G8JA 4KDIA 4AYBA 1Y4ZA 3IR7A 3QWZA 4CS0A 1I3QA 1PYQA 2E2IA 5EPPA 3GTQA 2E2HA 3GTKA 1R7RA 1H5NA 2IV2X 1FDOA 3QQ7A 1KQGA 1TMOA 5B6CA 2JIQA 1TWHA 3ML1A 4KDLA 4QIWA 1R9TA 5FTLA 3GTOA 4AAYA 2NYAA 2E7ZA 3PLXB 1QDNA 3HU3A 2NAPA 1I50A 3DMRA 1Y5IA 1E60A 4D7ZB 2R92A 3GTJA 2VPYA 3CF2A 5FTNA 1Y1WA 3FKIA 5GLFA 2KI8A 5DYGA 5C1BA 4KODA 2PJHB 2JIRA 1PPYA 2JA5A 1E18A 1TWGA 2EEOB 3HU2A 3H0GA 3HU1A 2JIOA 4C2MA 1QCSA 1AA6A 2DMRA 5FTMA 2B63A 4AONB 1FDIA 1CZ5A 1IW7D 4DMRA 4GA6A 1PQFA 3CQZA 4AZDA 3O5AA 1YLEA 1VC3B 1CR5A 2C45A 3GTGA 1UHDA 1TWCA 2WAQA 1TWFA 2V3VA 1UHEA 2R93A 1EU1A 1TWAA 3OUGA 3QC8A 1K83A 2JIPA 3QQ8A 3IR6A 2NVXA 3TIWA 1SFOA 1OGYA 4KLNA 1WCMA 3GTPA 2JA6A 2VPWA 5T5MD 2V45A 1AW8B 1PQHA 4CRZA 2VPXA 1Y1VA 3IR5A
chains in the Genus database with same CATH superfamily
2WB1A 1DMRA 1SMYD 1PYUB 1E61A 1ZYRD 2PICA 2YU9A 1L8FA 2Y0SA 2ENGA 1R27A 1KQFA 2BE5D 2VPZA 3GTLA 2PMZA 1E5VA 5FTJA 5T5ID 3X2HA 1PQEA 1Q16A 1DMSA 2R7ZA 5FTKA 2BH0A 5GM9A 3X2LA 4KO8A 4CRYG 4RV0A 2GAEA 2JIMA 3TM7B 3CZBA 1SIWA 2NVYA 1OA7A 2VUMA 2PNWA 1E32A 1CZ4A 1G8KA 5DYIA 1S3SA 2KQAA 3HKZA 1PT1A 2JA7A 4AOKB 1H0HA 2A6ED 4GA5A 5C18A 3ENGA 1WC2A 3GTMA 1WLFA 3X2GA 3X2JA 1PT0A 3X2IA 1G8JA 4KDIA 4AYBA 1Y4ZA 3IR7A 3QWZA 4CS0A 1I3QA 4FFTA 1PYQA 2A69D 2E2IA 5EPPA 3GTQA 2E2HA 5H4UA 3GTKA 1R7RA 1H5NA 4FG2A 1ZC1A 1FDOA 3QQ7A 2IV2X 1TMOA 5B6CA 1KQGA 2JIQA 3X2NA 1TWHA 3ML1A 4KDLA 4QIWA 1R9TA 5FTLA 3GTOA 4AAYA 2NYAA 2E7ZA 2A6HD 3PLXB 1QDNA 3HU3A 4L48A 2NAPA 2AE0X 4ENGA 1I50A 3DMRA 1Y5IA 1E60A 4D7ZB 2R92A 3GTJA 2VPYA 3CF2A 5FTNA 1Y1WA 4NOHA 3FKIA 5GLFA 2KI8A 5DYGA 5C1BA 4KODA 2PJHB 2JIRA 1PPYA 2JA5A 1E18A 1TWGA 2G6GA 5GLYA 2EEOB 3HU2A 3H0GA 3HU1A 2JIOA 4C2MA 1QCSA 2YUJA 2PJJA 2DMRA 1AA6A 5FTMA 2B63A 1YNJD 1HD5A 4AONB 1FDIA 3X2KA 1CZ5A 4AVRA 1IW7D 4DMRA 4GA6A 3X2PA 1PQFA 3CQZA 4AZDA 3O5AA 1OA9A 1YLEA 1N10A 1VC3B 1CR5A 2O5JD 2C45A 4JS7A 1BW4A 1YNND 3GTGA 1UHDA 1TWCA 2WAQA 1TWFA 2V3VA 1UHEA 4ZM7A 2R93A 1EU1A 1TWAA 1BW3A 4JJOA 2HCZX 3OUGA 3QC8A 5GLXA 4FERA 3D30A 1K83A 4JP6A 2PI8A 2JIPA 3QQ8A 3SUKA 3IR6A 3IR5A 4JCWA 3SULA 2NVXA 4FG4A 3TIWA 1SFOA 1OGYA 4KLNA 1WCMA 3M3GA 3GTPA 2JA6A 3SUMA 3X2OA 2VPWA 3X2MA 2A68D 2V45A 5T5MD 1AW8B 3SUJA 4JP7A 2CW0D 1PQHA 4CRZA 2VPXA 1Y1VA 2G5DA
chains in the Genus database with same CATH topology
2WB1A 1DMRA 1SMYD 1PYUB 1E61A 1ZYRD 2PICA 2YU9A 2Y0SA 1R27A 1KQFA 2BE5D 2VPZA 3GTLA 2PMZA 1E5VA 5FTJA 5T5ID 1PQEA 1Q16A 1DMSA 2R7ZA 5FTKA 4KO8A 4CRYG 4RV0A 2GAEA 2JIMA 3TM7B 3CZBA 1SIWA 2NVYA 2VUMA 2PNWA 1E32A 1CZ4A 1G8KA 5DYIA 1S3SA 3HKZA 1PT1A 2JA7A 4AOKB 1H0HA 2A6ED 4GA5A 5C18A 3GTMA 1WLFA 1PT0A 1G8JA 4KDIA 4AYBA 1Y4ZA 3IR7A 3QWZA 4CS0A 1I3QA 1PYQA 2A69D 2E2IA 5EPPA 3GTQA 2E2HA 3GTKA 1R7RA 1H5NA 1ZC1A 1FDOA 3QQ7A 2IV2X 1TMOA 5B6CA 1KQGA 2JIQA 1TWHA 3ML1A 4KDLA 4QIWA 1R9TA 5FTLA 3GTOA 4AAYA 2NYAA 2E7ZA 2A6HD 3PLXB 1QDNA 3HU3A 2NAPA 2AE0X 1I50A 3DMRA 1Y5IA 1E60A 4D7ZB 2R92A 3GTJA 2VPYA 3CF2A 5FTNA 1Y1WA 4NOHA 3FKIA 5GLFA 2KI8A 5DYGA 5C1BA 4KODA 2PJHB 2JIRA 1PPYA 2JA5A 1E18A 1TWGA 2G6GA 2EEOB 3HU2A 3H0GA 3HU1A 2JIOA 4C2MA 1QCSA 2YUJA 2PJJA 2DMRA 1AA6A 5FTMA 2B63A 1YNJD 4AONB 1FDIA 1CZ5A 1IW7D 4DMRA 4GA6A 1PQFA 3CQZA 4AZDA 3O5AA 1YLEA 1VC3B 1CR5A 2O5JD 2C45A 1YNND 3GTGA 1UHDA 1TWCA 2WAQA 1TWFA 2V3VA 1UHEA 2R93A 1EU1A 1TWAA 3OUGA 3QC8A 1K83A 2PI8A 2JIPA 3QQ8A 3IR6A 3IR5A 2NVXA 3TIWA 1SFOA 1OGYA 4KLNA 1WCMA 3GTPA 2JA6A 2VPWA 2A68D 2V45A 5T5MD 1AW8B 2CW0D 1PQHA 4CRZA 2VPXA 1Y1VA 2G5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 A;  1DMR A;  1PYU B;  1E61 A;  2YU9 A;  2Y0S A;  1R27 A;  1KQF A;  2VPZ A;  3GTL A;  2PMZ A;  1E5V A;  5FTJ A;  5T5I D;  1PQE A;  1Q16 A;  1DMS A;  2R7Z A;  5FTK A;  4KO8 A;  4CRY G;  4RV0 A;  3TM7 B;  2JIM A;  1SIW A;  2NVY A;  2VUM A;  1E32 A;  1CZ4 A;  1G8K A;  5DYI A;  1S3S A;  3HKZ A;  1PT1 A;  2JA7 A;  4AOK B;  1H0H A;  4GA5 A;  5C18 A;  3GTM A;  1WLF A;  1PT0 A;  1G8J A;  4KDI A;  4AYB A;  1Y4Z A;  3IR7 A;  3QWZ A;  4CS0 A;  1I3Q A;  1PYQ A;  2E2I A;  5EPP A;  3GTQ A;  2E2H A;  3GTK A;  1R7R A;  1H5N A;  2IV2 X;  1FDO A;  3QQ7 A;  1KQG A;  1TMO A;  5B6C A;  2JIQ A;  1TWH A;  3ML1 A;  4KDL A;  4QIW A;  1R9T A;  5FTL A;  3GTO A;  4AAY A;  2NYA A;  2E7Z A;  3PLX B;  1QDN A;  3HU3 A;  2NAP A;  1I50 A;  3DMR A;  1Y5I A;  1E60 A;  4D7Z B;  2R92 A;  3GTJ A;  2VPY A;  3CF2 A;  5FTN A;  1Y1W A;  3FKI A;  5GLF A;  2KI8 A;  5DYG A;  5C1B A;  4KOD A;  2PJH B;  2JIR A;  1PPY A;  2JA5 A;  1E18 A;  1TWG A;  2EEO B;  3HU2 A;  3H0G A;  3HU1 A;  2JIO A;  4C2M A;  1QCS A;  1AA6 A;  2DMR A;  5FTM A;  2B63 A;  4AON B;  1FDI A;  1CZ5 A;  1IW7 D;  4DMR A;  4GA6 A;  1PQF A;  3CQZ A;  4AZD A;  3O5A A;  1YLE A;  1VC3 B;  1CR5 A;  2C45 A;  3GTG A;  1UHD A;  1TWC A;  2WAQ A;  1TWF A;  2V3V A;  1UHE A;  2R93 A;  1EU1 A;  1TWA A;  3OUG A;  3QC8 A;  1K83 A;  2JIP A;  3QQ8 A;  3IR6 A;  2NVX A;  3TIW A;  1SFO A;  1OGY A;  4KLN A;  1WCM A;  3GTP A;  2JA6 A;  2VPW A;  5T5M D;  2V45 A;  1AW8 B;  1PQH A;  4CRZ A;  2VPX A;  1Y1V A;  3IR5 A; 
#chains in the Genus database with same CATH topology
 2WB1 A;  1DMR A;  1SMY D;  1PYU B;  1E61 A;  1ZYR D;  2PIC A;  2YU9 A;  1L8F A;  2Y0S A;  2ENG A;  1R27 A;  1KQF A;  2BE5 D;  2VPZ A;  3GTL A;  2PMZ A;  1E5V A;  5FTJ A;  5T5I D;  3X2H A;  1PQE A;  1Q16 A;  1DMS A;  2R7Z A;  5FTK A;  2BH0 A;  5GM9 A;  3X2L A;  4KO8 A;  4CRY G;  4RV0 A;  2GAE A;  2JIM A;  3TM7 B;  3CZB A;  1SIW A;  2NVY A;  1OA7 A;  2VUM A;  2PNW A;  1E32 A;  1CZ4 A;  1G8K A;  5DYI A;  1S3S A;  2KQA A;  3HKZ A;  1PT1 A;  2JA7 A;  4AOK B;  1H0H A;  2A6E D;  4GA5 A;  5C18 A;  3ENG A;  1WC2 A;  3GTM A;  1WLF A;  3X2G A;  3X2J A;  1PT0 A;  3X2I A;  1G8J A;  4KDI A;  4AYB A;  1Y4Z A;  3IR7 A;  3QWZ A;  4CS0 A;  1I3Q A;  4FFT A;  1PYQ A;  2A69 D;  2E2I A;  5EPP A;  3GTQ A;  2E2H A;  5H4U A;  3GTK A;  1R7R A;  1H5N A;  4FG2 A;  1ZC1 A;  1FDO A;  3QQ7 A;  2IV2 X;  1TMO A;  5B6C A;  1KQG A;  2JIQ A;  3X2N A;  1TWH A;  3ML1 A;  4KDL A;  4QIW A;  1R9T A;  5FTL A;  3GTO A;  4AAY A;  2NYA A;  2E7Z A;  2A6H D;  3PLX B;  1QDN A;  3HU3 A;  4L48 A;  2NAP A;  2AE0 X;  4ENG A;  1I50 A;  3DMR A;  1Y5I A;  1E60 A;  4D7Z B;  2R92 A;  3GTJ A;  2VPY A;  3CF2 A;  5FTN A;  1Y1W A;  4NOH A;  3FKI A;  5GLF A;  2KI8 A;  5DYG A;  5C1B A;  4KOD A;  2PJH B;  2JIR A;  1PPY A;  2JA5 A;  1E18 A;  1TWG A;  2G6G A;  5GLY A;  2EEO B;  3HU2 A;  3H0G A;  3HU1 A;  2JIO A;  4C2M A;  1QCS A;  2YUJ A;  2PJJ A;  2DMR A;  1AA6 A;  5FTM A;  2B63 A;  1YNJ D;  1HD5 A;  4AON B;  1FDI A;  3X2K A;  1CZ5 A;  4AVR A;  1IW7 D;  4DMR A;  4GA6 A;  3X2P A;  1PQF A;  3CQZ A;  4AZD A;  3O5A A;  1OA9 A;  1YLE A;  1N10 A;  1VC3 B;  1CR5 A;  2O5J D;  2C45 A;  4JS7 A;  1BW4 A;  1YNN D;  3GTG A;  1UHD A;  1TWC A;  2WAQ A;  1TWF A;  2V3V A;  1UHE A;  4ZM7 A;  2R93 A;  1EU1 A;  1TWA A;  1BW3 A;  4JJO A;  2HCZ X;  3OUG A;  3QC8 A;  5GLX A;  4FER A;  3D30 A;  1K83 A;  4JP6 A;  2PI8 A;  2JIP A;  3QQ8 A;  3SUK A;  3IR6 A;  3IR5 A;  4JCW A;  3SUL A;  2NVX A;  4FG4 A;  3TIW A;  1SFO A;  1OGY A;  4KLN A;  1WCM A;  3M3G A;  3GTP A;  2JA6 A;  3SUM A;  3X2O A;  2VPW A;  3X2M A;  2A68 D;  2V45 A;  5T5M D;  1AW8 B;  3SUJ A;  4JP7 A;  2CW0 D;  1PQH A;  4CRZ A;  2VPX A;  1Y1V A;  2G5D A; 
#chains in the Genus database with same CATH homology
 2WB1 A;  1DMR A;  1SMY D;  1PYU B;  1E61 A;  1ZYR D;  2PIC A;  2YU9 A;  2Y0S A;  1R27 A;  1KQF A;  2BE5 D;  2VPZ A;  3GTL A;  2PMZ A;  1E5V A;  5FTJ A;  5T5I D;  1PQE A;  1Q16 A;  1DMS A;  2R7Z A;  5FTK A;  4KO8 A;  4CRY G;  4RV0 A;  2GAE A;  2JIM A;  3TM7 B;  3CZB A;  1SIW A;  2NVY A;  2VUM A;  2PNW A;  1E32 A;  1CZ4 A;  1G8K A;  5DYI A;  1S3S A;  3HKZ A;  1PT1 A;  2JA7 A;  4AOK B;  1H0H A;  2A6E D;  4GA5 A;  5C18 A;  3GTM A;  1WLF A;  1PT0 A;  1G8J A;  4KDI A;  4AYB A;  1Y4Z A;  3IR7 A;  3QWZ A;  4CS0 A;  1I3Q A;  1PYQ A;  2A69 D;  2E2I A;  5EPP A;  3GTQ A;  2E2H A;  3GTK A;  1R7R A;  1H5N A;  1ZC1 A;  1FDO A;  3QQ7 A;  2IV2 X;  1TMO A;  5B6C A;  1KQG A;  2JIQ A;  1TWH A;  3ML1 A;  4KDL A;  4QIW A;  1R9T A;  5FTL A;  3GTO A;  4AAY A;  2NYA A;  2E7Z A;  2A6H D;  3PLX B;  1QDN A;  3HU3 A;  2NAP A;  2AE0 X;  1I50 A;  3DMR A;  1Y5I A;  1E60 A;  4D7Z B;  2R92 A;  3GTJ A;  2VPY A;  3CF2 A;  5FTN A;  1Y1W A;  4NOH A;  3FKI A;  5GLF A;  2KI8 A;  5DYG A;  5C1B A;  4KOD A;  2PJH B;  2JIR A;  1PPY A;  2JA5 A;  1E18 A;  1TWG A;  2G6G A;  2EEO B;  3HU2 A;  3H0G A;  3HU1 A;  2JIO A;  4C2M A;  1QCS A;  2YUJ A;  2PJJ A;  2DMR A;  1AA6 A;  5FTM A;  2B63 A;  1YNJ D;  4AON B;  1FDI A;  1CZ5 A;  1IW7 D;  4DMR A;  4GA6 A;  1PQF A;  3CQZ A;  4AZD A;  3O5A A;  1YLE A;  1VC3 B;  1CR5 A;  2O5J D;  2C45 A;  1YNN D;  3GTG A;  1UHD A;  1TWC A;  2WAQ A;  1TWF A;  2V3V A;  1UHE A;  2R93 A;  1EU1 A;  1TWA A;  3OUG A;  3QC8 A;  1K83 A;  2PI8 A;  2JIP A;  3QQ8 A;  3IR6 A;  3IR5 A;  2NVX A;  3TIW A;  1SFO A;  1OGY A;  4KLN A;  1WCM A;  3GTP A;  2JA6 A;  2VPW A;  2A68 D;  2V45 A;  5T5M D;  1AW8 B;  2CW0 D;  1PQH A;  4CRZ A;  2VPX A;  1Y1V A;  2G5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...