5T5MD

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, trigonal form at 2.5 a.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 31
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5mD00
2DMRA 3IR5A 2JA6A 1PQHA 3HU3A 4AZDA 1H0HA 4DMRA 3H0GA 3OUGA 1DMRA 1OGYA 5DYGA 1CZ5A 5FTJA 2R93A 1VC3B 2VPXA 3CQZA 1PT1A 3ML1A 5FTLA 3FKIA 4AOKB 3QWZA 4CS0A 1Y5IA 1G8KA 4KDIA 3TIWA 1E5VA 2JA5A 4D7ZB 1Y4ZA 3HKZA 2JIRA 1SIWA 3GTMA 1YLEA 2VPYA 1E61A 3QQ8A 3IR6A 2EEOB 3HU1A 1S3SA 3HU2A 3GTJA 4QIWA 1SFOA 1TWGA 4AAYA 1QDNA 1G8JA 5C1BA 3IR7A 1KQFA 2IV2X 2VUMA 2B63A 3O5AA 1Y1VA 2JA7A 2V3VA 5B6CA 2E7ZA 2NAPA 1AW8B 3DMRA 1FDOA 3TM7B 4CRYG 1EU1A 2YU9A 1I50A 2NYAA 1AA6A 5C18A 1CZ4A 1TWHA 1KQGA 2E2IA 1TWCA 2V45A 1I3QA 1UHDA 1UHEA 2JIPA 3QC8A 1E60A 1Y1WA 4C2MA 1E18A 4RV0A 1R9TA 1PQFA 1R7RA 5GLFA 4AONB 2JIQA 2C45A 2VPZA 1PQEA 5FTMA 1FDIA 4KODA 3GTKA 2JIMA 4GA6A 3GTOA 1K83A 2VPWA 1TMOA 1IW7D 2NVXA 1PPYA 3GTLA 4KO8A 5T5ID 1PYUB 5DYIA 5EPPA 4KDLA 4KLNA 4CRZA 2Y0SA 3PLXB 2WB1A 1CR5A 2JIOA 1Q16A 2PMZA 3GTQA 4AYBA 3GTGA 1WLFA 2KI8A 2E2HA 1WCMA 4GA5A 1TWAA 1PYQA 1H5NA 2NVYA 2WAQA 2R92A 1E32A 1R27A 3CF2A 1TWFA 5FTNA 5FTKA 2R7ZA 2PJHB 3GTPA 5T5MD 1QCSA 1DMSA 1PT0A 3QQ7A
chains in the Genus database with same CATH superfamily
3X2OA 3X2MA 2DMRA 3IR5A 2JA6A 1PQHA 1YNND 2PICA 3HU3A 4AZDA 1H0HA 2PNWA 4DMRA 3H0GA 3OUGA 3X2HA 1DMRA 1OGYA 5DYGA 1CZ5A 5FTJA 2R93A 1OA7A 1VC3B 2VPXA 3CQZA 3X2PA 1PT1A 2ENGA 3X2JA 1WC2A 3ML1A 5FTLA 3FKIA 4AOKB 3QWZA 3ENGA 4CS0A 1Y5IA 1G8KA 4KDIA 2YUJA 1E5VA 3TIWA 4D7ZB 2JA5A 1Y4ZA 3HKZA 2G6GA 2JIRA 1SIWA 3GTMA 2HCZX 1HD5A 2A69D 1YLEA 2VPYA 1E61A 3M3GA 3QQ8A 3IR6A 2EEOB 3HU1A 1S3SA 3HU2A 3GTJA 4QIWA 1SFOA 1TWGA 4AAYA 1SMYD 1QDNA 1YNJD 2PI8A 1G8JA 5C1BA 3IR7A 1KQFA 4FG2A 2IV2X 3CZBA 2VUMA 2B63A 4JS7A 3O5AA 4JJOA 1Y1VA 2O5JD 4JCWA 2JA7A 1BW4A 2V3VA 5B6CA 2E7ZA 2NAPA 4ZM7A 2KQAA 1AW8B 3DMRA 1FDOA 3TM7B 4CRYG 1EU1A 3D30A 2AE0X 2BE5D 2YU9A 1I50A 3X2IA 2NYAA 1AA6A 5C18A 3X2KA 1CZ4A 1TWHA 1KQGA 2E2IA 1TWCA 2V45A 3X2LA 1I3QA 4AVRA 1UHDA 1UHEA 2JIPA 3QC8A 5H4UA 2G5DA 1E60A 1Y1WA 4FERA 1OA9A 4C2MA 1E18A 4L48A 4JP6A 4NOHA 4RV0A 5GLXA 1R9TA 1PQFA 1R7RA 5GLFA 4AONB 2JIQA 2C45A 2VPZA 1PQEA 5FTMA 1ZYRD 1FDIA 4KODA 3SUJA 3GTKA 3X2NA 4FG4A 2JIMA 4GA6A 3GTOA 1K83A 2VPWA 1TMOA 2PJJA 5GM9A 1IW7D 2NVXA 1PPYA 3GTLA 4KO8A 5T5ID 1PYUB 5DYIA 3X2GA 2A6ED 5EPPA 4KDLA 4KLNA 4CRZA 2Y0SA 3PLXB 2BH0A 2WB1A 1CR5A 2JIOA 1Q16A 2PMZA 3SULA 1ZC1A 3GTQA 1N10A 4AYBA 3GTGA 1WLFA 2KI8A 2E2HA 1WCMA 2A68D 4GA5A 1TWAA 1PYQA 1H5NA 2NVYA 3SUMA 2WAQA 2A6HD 2R92A 1E32A 1R27A 3CF2A 1TWFA 5FTNA 1L8FA 5FTKA 2R7ZA 1BW3A 2PJHB 4ENGA 3GTPA 5GLYA 5T5MD 1QCSA 1DMSA 4JP7A 2GAEA 2CW0D 4FFTA 1PT0A 3SUKA 3QQ7A
chains in the Genus database with same CATH topology
2DMRA 3IR5A 2JA6A 1PQHA 1YNND 2PICA 3HU3A 4AZDA 1H0HA 2PNWA 4DMRA 3H0GA 3OUGA 1DMRA 1OGYA 5DYGA 1CZ5A 5FTJA 2R93A 1VC3B 2VPXA 3CQZA 1PT1A 3ML1A 5FTLA 3FKIA 4AOKB 3QWZA 4CS0A 1Y5IA 1G8KA 4KDIA 2YUJA 1E5VA 3TIWA 4D7ZB 2JA5A 1Y4ZA 3HKZA 2G6GA 2JIRA 1SIWA 3GTMA 2A69D 1YLEA 2VPYA 1E61A 3QQ8A 3IR6A 2EEOB 3HU1A 1S3SA 3HU2A 3GTJA 4QIWA 1SFOA 1TWGA 4AAYA 1SMYD 1QDNA 1YNJD 2PI8A 1G8JA 5C1BA 3IR7A 1KQFA 2IV2X 3CZBA 2VUMA 2B63A 3O5AA 1Y1VA 2O5JD 2JA7A 2V3VA 5B6CA 2E7ZA 2NAPA 1AW8B 3DMRA 1FDOA 3TM7B 4CRYG 1EU1A 2AE0X 2BE5D 2YU9A 1I50A 2NYAA 1AA6A 5C18A 1CZ4A 1TWHA 1KQGA 2E2IA 1TWCA 2V45A 1I3QA 1UHDA 1UHEA 2JIPA 3QC8A 2G5DA 1E60A 1Y1WA 4C2MA 1E18A 4NOHA 4RV0A 1R9TA 1PQFA 1R7RA 5GLFA 4AONB 2JIQA 2C45A 2VPZA 1PQEA 5FTMA 1ZYRD 1FDIA 4KODA 3GTKA 2JIMA 4GA6A 3GTOA 1K83A 2VPWA 1TMOA 2PJJA 1IW7D 2NVXA 1PPYA 3GTLA 4KO8A 5T5ID 1PYUB 5DYIA 2A6ED 5EPPA 4KDLA 4KLNA 4CRZA 2Y0SA 3PLXB 2WB1A 1CR5A 2JIOA 1Q16A 2PMZA 1ZC1A 3GTQA 4AYBA 3GTGA 1WLFA 2KI8A 2E2HA 1WCMA 2A68D 4GA5A 1TWAA 1PYQA 1H5NA 2NVYA 2WAQA 2A6HD 2R92A 1E32A 1R27A 3CF2A 1TWFA 5FTNA 5FTKA 2R7ZA 2PJHB 3GTPA 5T5MD 1QCSA 1DMSA 2GAEA 2CW0D 1PT0A 3QQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMR A;  3IR5 A;  2JA6 A;  1PQH A;  3HU3 A;  4AZD A;  1H0H A;  4DMR A;  3H0G A;  3OUG A;  1DMR A;  1OGY A;  5DYG A;  1CZ5 A;  5FTJ A;  2R93 A;  1VC3 B;  2VPX A;  3CQZ A;  1PT1 A;  3ML1 A;  5FTL A;  3FKI A;  4AOK B;  3QWZ A;  4CS0 A;  1Y5I A;  1G8K A;  4KDI A;  3TIW A;  1E5V A;  2JA5 A;  4D7Z B;  1Y4Z A;  3HKZ A;  2JIR A;  1SIW A;  3GTM A;  1YLE A;  2VPY A;  1E61 A;  3QQ8 A;  3IR6 A;  2EEO B;  3HU1 A;  1S3S A;  3HU2 A;  3GTJ A;  4QIW A;  1SFO A;  1TWG A;  4AAY A;  1QDN A;  1G8J A;  5C1B A;  3IR7 A;  1KQF A;  2IV2 X;  2VUM A;  2B63 A;  3O5A A;  1Y1V A;  2JA7 A;  2V3V A;  5B6C A;  2E7Z A;  2NAP A;  1AW8 B;  3DMR A;  1FDO A;  3TM7 B;  4CRY G;  1EU1 A;  2YU9 A;  1I50 A;  2NYA A;  1AA6 A;  5C18 A;  1CZ4 A;  1TWH A;  1KQG A;  2E2I A;  1TWC A;  2V45 A;  1I3Q A;  1UHD A;  1UHE A;  2JIP A;  3QC8 A;  1E60 A;  1Y1W A;  4C2M A;  1E18 A;  4RV0 A;  1R9T A;  1PQF A;  1R7R A;  5GLF A;  4AON B;  2JIQ A;  2C45 A;  2VPZ A;  1PQE A;  5FTM A;  1FDI A;  4KOD A;  3GTK A;  2JIM A;  4GA6 A;  3GTO A;  1K83 A;  2VPW A;  1TMO A;  1IW7 D;  2NVX A;  1PPY A;  3GTL A;  4KO8 A;  5T5I D;  1PYU B;  5DYI A;  5EPP A;  4KDL A;  4KLN A;  4CRZ A;  2Y0S A;  3PLX B;  2WB1 A;  1CR5 A;  2JIO A;  1Q16 A;  2PMZ A;  3GTQ A;  4AYB A;  3GTG A;  1WLF A;  2KI8 A;  2E2H A;  1WCM A;  4GA5 A;  1TWA A;  1PYQ A;  1H5N A;  2NVY A;  2WAQ A;  2R92 A;  1E32 A;  1R27 A;  3CF2 A;  1TWF A;  5FTN A;  5FTK A;  2R7Z A;  2PJH B;  3GTP A;  5T5M D;  1QCS A;  1DMS A;  1PT0 A;  3QQ7 A; 
#chains in the Genus database with same CATH topology
 3X2O A;  3X2M A;  2DMR A;  3IR5 A;  2JA6 A;  1PQH A;  1YNN D;  2PIC A;  3HU3 A;  4AZD A;  1H0H A;  2PNW A;  4DMR A;  3H0G A;  3OUG A;  3X2H A;  1DMR A;  1OGY A;  5DYG A;  1CZ5 A;  5FTJ A;  2R93 A;  1OA7 A;  1VC3 B;  2VPX A;  3CQZ A;  3X2P A;  1PT1 A;  2ENG A;  3X2J A;  1WC2 A;  3ML1 A;  5FTL A;  3FKI A;  4AOK B;  3QWZ A;  3ENG A;  4CS0 A;  1Y5I A;  1G8K A;  4KDI A;  2YUJ A;  1E5V A;  3TIW A;  4D7Z B;  2JA5 A;  1Y4Z A;  3HKZ A;  2G6G A;  2JIR A;  1SIW A;  3GTM A;  2HCZ X;  1HD5 A;  2A69 D;  1YLE A;  2VPY A;  1E61 A;  3M3G A;  3QQ8 A;  3IR6 A;  2EEO B;  3HU1 A;  1S3S A;  3HU2 A;  3GTJ A;  4QIW A;  1SFO A;  1TWG A;  4AAY A;  1SMY D;  1QDN A;  1YNJ D;  2PI8 A;  1G8J A;  5C1B A;  3IR7 A;  1KQF A;  4FG2 A;  2IV2 X;  3CZB A;  2VUM A;  2B63 A;  4JS7 A;  3O5A A;  4JJO A;  1Y1V A;  2O5J D;  4JCW A;  2JA7 A;  1BW4 A;  2V3V A;  5B6C A;  2E7Z A;  2NAP A;  4ZM7 A;  2KQA A;  1AW8 B;  3DMR A;  1FDO A;  3TM7 B;  4CRY G;  1EU1 A;  3D30 A;  2AE0 X;  2BE5 D;  2YU9 A;  1I50 A;  3X2I A;  2NYA A;  1AA6 A;  5C18 A;  3X2K A;  1CZ4 A;  1TWH A;  1KQG A;  2E2I A;  1TWC A;  2V45 A;  3X2L A;  1I3Q A;  4AVR A;  1UHD A;  1UHE A;  2JIP A;  3QC8 A;  5H4U A;  2G5D A;  1E60 A;  1Y1W A;  4FER A;  1OA9 A;  4C2M A;  1E18 A;  4L48 A;  4JP6 A;  4NOH A;  4RV0 A;  5GLX A;  1R9T A;  1PQF A;  1R7R A;  5GLF A;  4AON B;  2JIQ A;  2C45 A;  2VPZ A;  1PQE A;  5FTM A;  1ZYR D;  1FDI A;  4KOD A;  3SUJ A;  3GTK A;  3X2N A;  4FG4 A;  2JIM A;  4GA6 A;  3GTO A;  1K83 A;  2VPW A;  1TMO A;  2PJJ A;  5GM9 A;  1IW7 D;  2NVX A;  1PPY A;  3GTL A;  4KO8 A;  5T5I D;  1PYU B;  5DYI A;  3X2G A;  2A6E D;  5EPP A;  4KDL A;  4KLN A;  4CRZ A;  2Y0S A;  3PLX B;  2BH0 A;  2WB1 A;  1CR5 A;  2JIO A;  1Q16 A;  2PMZ A;  3SUL A;  1ZC1 A;  3GTQ A;  1N10 A;  4AYB A;  3GTG A;  1WLF A;  2KI8 A;  2E2H A;  1WCM A;  2A68 D;  4GA5 A;  1TWA A;  1PYQ A;  1H5N A;  2NVY A;  3SUM A;  2WAQ A;  2A6H D;  2R92 A;  1E32 A;  1R27 A;  3CF2 A;  1TWF A;  5FTN A;  1L8F A;  5FTK A;  2R7Z A;  1BW3 A;  2PJH B;  4ENG A;  3GTP A;  5GLY A;  5T5M D;  1QCS A;  1DMS A;  4JP7 A;  2GAE A;  2CW0 D;  4FFT A;  1PT0 A;  3SUK A;  3QQ7 A; 
#chains in the Genus database with same CATH homology
 2DMR A;  3IR5 A;  2JA6 A;  1PQH A;  1YNN D;  2PIC A;  3HU3 A;  4AZD A;  1H0H A;  2PNW A;  4DMR A;  3H0G A;  3OUG A;  1DMR A;  1OGY A;  5DYG A;  1CZ5 A;  5FTJ A;  2R93 A;  1VC3 B;  2VPX A;  3CQZ A;  1PT1 A;  3ML1 A;  5FTL A;  3FKI A;  4AOK B;  3QWZ A;  4CS0 A;  1Y5I A;  1G8K A;  4KDI A;  2YUJ A;  1E5V A;  3TIW A;  4D7Z B;  2JA5 A;  1Y4Z A;  3HKZ A;  2G6G A;  2JIR A;  1SIW A;  3GTM A;  2A69 D;  1YLE A;  2VPY A;  1E61 A;  3QQ8 A;  3IR6 A;  2EEO B;  3HU1 A;  1S3S A;  3HU2 A;  3GTJ A;  4QIW A;  1SFO A;  1TWG A;  4AAY A;  1SMY D;  1QDN A;  1YNJ D;  2PI8 A;  1G8J A;  5C1B A;  3IR7 A;  1KQF A;  2IV2 X;  3CZB A;  2VUM A;  2B63 A;  3O5A A;  1Y1V A;  2O5J D;  2JA7 A;  2V3V A;  5B6C A;  2E7Z A;  2NAP A;  1AW8 B;  3DMR A;  1FDO A;  3TM7 B;  4CRY G;  1EU1 A;  2AE0 X;  2BE5 D;  2YU9 A;  1I50 A;  2NYA A;  1AA6 A;  5C18 A;  1CZ4 A;  1TWH A;  1KQG A;  2E2I A;  1TWC A;  2V45 A;  1I3Q A;  1UHD A;  1UHE A;  2JIP A;  3QC8 A;  2G5D A;  1E60 A;  1Y1W A;  4C2M A;  1E18 A;  4NOH A;  4RV0 A;  1R9T A;  1PQF A;  1R7R A;  5GLF A;  4AON B;  2JIQ A;  2C45 A;  2VPZ A;  1PQE A;  5FTM A;  1ZYR D;  1FDI A;  4KOD A;  3GTK A;  2JIM A;  4GA6 A;  3GTO A;  1K83 A;  2VPW A;  1TMO A;  2PJJ A;  1IW7 D;  2NVX A;  1PPY A;  3GTL A;  4KO8 A;  5T5I D;  1PYU B;  5DYI A;  2A6E D;  5EPP A;  4KDL A;  4KLN A;  4CRZ A;  2Y0S A;  3PLX B;  2WB1 A;  1CR5 A;  2JIO A;  1Q16 A;  2PMZ A;  1ZC1 A;  3GTQ A;  4AYB A;  3GTG A;  1WLF A;  2KI8 A;  2E2H A;  1WCM A;  2A68 D;  4GA5 A;  1TWA A;  1PYQ A;  1H5N A;  2NVY A;  2WAQ A;  2A6H D;  2R92 A;  1E32 A;  1R27 A;  3CF2 A;  1TWF A;  5FTN A;  5FTK A;  2R7Z A;  2PJH B;  3GTP A;  5T5M D;  1QCS A;  1DMS A;  2GAE A;  2CW0 D;  1PT0 A;  3QQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...