5T5MD

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, trigonal form at 2.5 a.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
total genus 31
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5mD00
1TWAA 1S3SA 1CR5A 4D7ZB 2R7ZA 1PT1A 2NAPA 4AYBA 1KQFA 1WLFA 1Q16A 3PLXB 1DMRA 1K83A 2YU9A 1TMOA 4KDLA 1AA6A 1PQHA 1R27A 1E18A 1R9TA 4CS0A 2C45A 3DMRA 3GTQA 4GA6A 3GTOA 2JA5A 1PQEA 1TWFA 1E5VA 5T5MD 2DMRA 2PMZA 1VC3B 2Y0SA 2V45A 1E61A 1E32A 1TWGA 2R92A 1UHDA 1Y1VA 5DYIA 2JIMA 1QDNA 4CRYG 3GTKA 5T5ID 2JIQA 1UHEA 4C2MA 3GTPA 3IR5A 2VUMA 1I50A 2VPWA 4AONB 1PT0A 1PQFA 1AW8B 1H5NA 1TWHA 2NVXA 2JIRA 3QWZA 5FTLA 3IR6A 1I3QA 1PYUB 4KO8A 1SIWA 5FTNA 3GTGA 5C1BA 3O5AA 5GLFA 4KLNA 3CF2A 4AOKB 1IW7D 3FKIA 1PYQA 2WAQA 1SFOA 3QQ8A 1E60A 2NYAA 3HU3A 3ML1A 1R7RA 2KI8A 2R93A 5C18A 1OGYA 3GTJA 3CQZA 1FDIA 3TIWA 3HU1A 1QCSA 1Y5IA 1G8KA 4KDIA 1EU1A 1CZ4A 2EEOB 2JA7A 5B6CA 3QQ7A 5FTJA 3HKZA 2E2IA 4GA5A 2NVYA 4KODA 4AZDA 5FTMA 2B63A 4AAYA 2E2HA 4CRZA 4RV0A 4DMRA 1TWCA 2IV2X 3GTLA 1G8JA 1PPYA 2VPYA 1FDOA 1DMSA 1H0HA 2JA6A 3IR7A 5EPPA 3HU2A 1YLEA 3GTMA 1CZ5A 3H0GA 1KQGA 1Y1WA 2VPXA 5DYGA 2PJHB 2WB1A 1Y4ZA 3TM7B 1WCMA 4QIWA 2VPZA 3OUGA 2JIPA 5FTKA 2V3VA 3QC8A 2JIOA 2E7ZA
chains in the Genus database with same CATH superfamily
2ENGA 1TWAA 3X2NA 1S3SA 1CR5A 4D7ZB 2PJJA 2R7ZA 1PT1A 2NAPA 4AYBA 1SMYD 3ENGA 4NOHA 1KQFA 1OA9A 1WLFA 1Q16A 5GLXA 3PLXB 1DMRA 3SUKA 1WC2A 2G5DA 3X2MA 2PI8A 1K83A 4JJOA 3X2HA 2YU9A 1TMOA 4KDLA 2GAEA 1AA6A 1PQHA 1R27A 5GM9A 3X2IA 1E18A 1R9TA 1YNJD 4CS0A 2C45A 3DMRA 3GTQA 4GA6A 2A6ED 3GTOA 1PQEA 1TWFA 1E5VA 5T5MD 2JA5A 4FERA 2DMRA 2BH0A 2CW0D 2PMZA 1VC3B 2PNWA 2Y0SA 1E61A 2V45A 1E32A 1TWGA 2R92A 1UHDA 1Y1VA 5DYIA 2JIMA 1QDNA 3X2JA 4CRYG 3GTKA 4FG4A 5T5ID 2JIQA 1UHEA 4C2MA 4L48A 3GTPA 3IR5A 1YNND 2VUMA 1ZC1A 1I50A 2A68D 2VPWA 3CZBA 4AONB 1PT0A 1PQFA 1AW8B 1H5NA 1TWHA 1BW4A 2NVXA 4FFTA 2JIRA 3QWZA 5FTLA 4JP7A 2KQAA 3IR6A 4JS7A 4JCWA 1I3QA 1PYUB 4KO8A 2A69D 4ENGA 1SIWA 5FTNA 1N10A 3GTGA 2BE5D 5C1BA 1HD5A 3O5AA 5GLFA 4KLNA 3CF2A 3X2KA 4AOKB 1IW7D 2O5JD 1L8FA 1ZYRD 2A6HD 3FKIA 1PYQA 2WAQA 3X2GA 1SFOA 3QQ8A 1E60A 2NYAA 3HU3A 3ML1A 1R7RA 2KI8A 2PICA 2R93A 5C18A 1OGYA 3X2PA 3GTJA 3CQZA 1FDIA 3TIWA 3HU1A 1QCSA 1Y5IA 4JP6A 5H4UA 1G8KA 4KDIA 1EU1A 1CZ4A 2EEOB 2JA7A 4AVRA 3X2OA 3QQ7A 5B6CA 5FTJA 3HKZA 4ZM7A 3D30A 4GA5A 2NVYA 2E2IA 4KODA 4AZDA 5GLYA 4FG2A 5FTMA 2B63A 4AAYA 3SULA 3X2LA 2E2HA 4CRZA 2HCZX 4RV0A 4DMRA 1TWCA 1OA7A 2IV2X 3GTLA 1G8JA 1PPYA 3SUJA 2VPYA 1FDOA 1DMSA 1H0HA 2AE0X 3IR7A 2JA6A 5EPPA 3HU2A 1YLEA 3GTMA 1CZ5A 3H0GA 1KQGA 1Y1WA 2VPXA 5DYGA 2PJHB 2WB1A 3SUMA 1Y4ZA 3TM7B 1WCMA 2YUJA 4QIWA 1BW3A 2VPZA 3OUGA 2G6GA 2JIPA 5FTKA 2V3VA 3QC8A 2JIOA 2E7ZA 3M3GA
chains in the Genus database with same CATH topology
1TWAA 1S3SA 1CR5A 4D7ZB 2PJJA 2R7ZA 1PT1A 2NAPA 4AYBA 1SMYD 4NOHA 1KQFA 1WLFA 1Q16A 3PLXB 1DMRA 2G5DA 1K83A 2PI8A 2YU9A 1TMOA 4KDLA 2GAEA 1AA6A 1PQHA 1R27A 1E18A 1R9TA 1YNJD 4CS0A 2C45A 3DMRA 3GTQA 4GA6A 2A6ED 3GTOA 1PQEA 1TWFA 1E5VA 5T5MD 2JA5A 2DMRA 2CW0D 2PMZA 1VC3B 2PNWA 2Y0SA 2V45A 1E61A 1E32A 1TWGA 2R92A 1UHDA 1Y1VA 5DYIA 2JIMA 1QDNA 4CRYG 3GTKA 5T5ID 2JIQA 1UHEA 4C2MA 3GTPA 3IR5A 1YNND 2VUMA 1ZC1A 1I50A 2A68D 2VPWA 3CZBA 4AONB 1PT0A 1PQFA 1AW8B 1H5NA 1TWHA 2NVXA 2JIRA 3QWZA 5FTLA 3IR6A 1I3QA 1PYUB 4KO8A 2A69D 1SIWA 5FTNA 3GTGA 2BE5D 5C1BA 3O5AA 5GLFA 4KLNA 3CF2A 4AOKB 1IW7D 2O5JD 1ZYRD 2A6HD 3FKIA 1PYQA 2WAQA 1SFOA 3QQ8A 1E60A 2NYAA 3HU3A 3ML1A 1R7RA 2KI8A 2PICA 2R93A 5C18A 1OGYA 3GTJA 3CQZA 1FDIA 3TIWA 3HU1A 1QCSA 1Y5IA 1G8KA 4KDIA 1EU1A 1CZ4A 2EEOB 2JA7A 5B6CA 3QQ7A 5FTJA 3HKZA 2E2IA 4GA5A 2NVYA 4KODA 4AZDA 5FTMA 2B63A 4AAYA 2E2HA 4CRZA 4RV0A 4DMRA 1TWCA 2IV2X 3GTLA 1G8JA 1PPYA 2VPYA 1FDOA 1DMSA 1H0HA 2AE0X 3IR7A 2JA6A 5EPPA 3HU2A 1YLEA 3GTMA 1CZ5A 3H0GA 1KQGA 1Y1WA 2VPXA 5DYGA 2PJHB 2WB1A 1Y4ZA 3TM7B 1WCMA 2YUJA 4QIWA 2VPZA 3OUGA 2G6GA 2JIPA 5FTKA 2V3VA 3QC8A 2JIOA 2E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA A;  1S3S A;  1CR5 A;  4D7Z B;  2R7Z A;  1PT1 A;  2NAP A;  4AYB A;  1KQF A;  1WLF A;  1Q16 A;  3PLX B;  1DMR A;  1K83 A;  2YU9 A;  1TMO A;  4KDL A;  1AA6 A;  1PQH A;  1R27 A;  1E18 A;  1R9T A;  4CS0 A;  2C45 A;  3DMR A;  3GTQ A;  4GA6 A;  3GTO A;  2JA5 A;  1PQE A;  1TWF A;  1E5V A;  5T5M D;  2DMR A;  2PMZ A;  1VC3 B;  2Y0S A;  2V45 A;  1E61 A;  1E32 A;  1TWG A;  2R92 A;  1UHD A;  1Y1V A;  5DYI A;  2JIM A;  1QDN A;  4CRY G;  3GTK A;  5T5I D;  2JIQ A;  1UHE A;  4C2M A;  3GTP A;  3IR5 A;  2VUM A;  1I50 A;  2VPW A;  4AON B;  1PT0 A;  1PQF A;  1AW8 B;  1H5N A;  1TWH A;  2NVX A;  2JIR A;  3QWZ A;  5FTL A;  3IR6 A;  1I3Q A;  1PYU B;  4KO8 A;  1SIW A;  5FTN A;  3GTG A;  5C1B A;  3O5A A;  5GLF A;  4KLN A;  3CF2 A;  4AOK B;  1IW7 D;  3FKI A;  1PYQ A;  2WAQ A;  1SFO A;  3QQ8 A;  1E60 A;  2NYA A;  3HU3 A;  3ML1 A;  1R7R A;  2KI8 A;  2R93 A;  5C18 A;  1OGY A;  3GTJ A;  3CQZ A;  1FDI A;  3TIW A;  3HU1 A;  1QCS A;  1Y5I A;  1G8K A;  4KDI A;  1EU1 A;  1CZ4 A;  2EEO B;  2JA7 A;  5B6C A;  3QQ7 A;  5FTJ A;  3HKZ A;  2E2I A;  4GA5 A;  2NVY A;  4KOD A;  4AZD A;  5FTM A;  2B63 A;  4AAY A;  2E2H A;  4CRZ A;  4RV0 A;  4DMR A;  1TWC A;  2IV2 X;  3GTL A;  1G8J A;  1PPY A;  2VPY A;  1FDO A;  1DMS A;  1H0H A;  2JA6 A;  3IR7 A;  5EPP A;  3HU2 A;  1YLE A;  3GTM A;  1CZ5 A;  3H0G A;  1KQG A;  1Y1W A;  2VPX A;  5DYG A;  2PJH B;  2WB1 A;  1Y4Z A;  3TM7 B;  1WCM A;  4QIW A;  2VPZ A;  3OUG A;  2JIP A;  5FTK A;  2V3V A;  3QC8 A;  2JIO A;  2E7Z A; 
#chains in the Genus database with same CATH topology
 2ENG A;  1TWA A;  3X2N A;  1S3S A;  1CR5 A;  4D7Z B;  2PJJ A;  2R7Z A;  1PT1 A;  2NAP A;  4AYB A;  1SMY D;  3ENG A;  4NOH A;  1KQF A;  1OA9 A;  1WLF A;  1Q16 A;  5GLX A;  3PLX B;  1DMR A;  3SUK A;  1WC2 A;  2G5D A;  3X2M A;  2PI8 A;  1K83 A;  4JJO A;  3X2H A;  2YU9 A;  1TMO A;  4KDL A;  2GAE A;  1AA6 A;  1PQH A;  1R27 A;  5GM9 A;  3X2I A;  1E18 A;  1R9T A;  1YNJ D;  4CS0 A;  2C45 A;  3DMR A;  3GTQ A;  4GA6 A;  2A6E D;  3GTO A;  1PQE A;  1TWF A;  1E5V A;  5T5M D;  2JA5 A;  4FER A;  2DMR A;  2BH0 A;  2CW0 D;  2PMZ A;  1VC3 B;  2PNW A;  2Y0S A;  1E61 A;  2V45 A;  1E32 A;  1TWG A;  2R92 A;  1UHD A;  1Y1V A;  5DYI A;  2JIM A;  1QDN A;  3X2J A;  4CRY G;  3GTK A;  4FG4 A;  5T5I D;  2JIQ A;  1UHE A;  4C2M A;  4L48 A;  3GTP A;  3IR5 A;  1YNN D;  2VUM A;  1ZC1 A;  1I50 A;  2A68 D;  2VPW A;  3CZB A;  4AON B;  1PT0 A;  1PQF A;  1AW8 B;  1H5N A;  1TWH A;  1BW4 A;  2NVX A;  4FFT A;  2JIR A;  3QWZ A;  5FTL A;  4JP7 A;  2KQA A;  3IR6 A;  4JS7 A;  4JCW A;  1I3Q A;  1PYU B;  4KO8 A;  2A69 D;  4ENG A;  1SIW A;  5FTN A;  1N10 A;  3GTG A;  2BE5 D;  5C1B A;  1HD5 A;  3O5A A;  5GLF A;  4KLN A;  3CF2 A;  3X2K A;  4AOK B;  1IW7 D;  2O5J D;  1L8F A;  1ZYR D;  2A6H D;  3FKI A;  1PYQ A;  2WAQ A;  3X2G A;  1SFO A;  3QQ8 A;  1E60 A;  2NYA A;  3HU3 A;  3ML1 A;  1R7R A;  2KI8 A;  2PIC A;  2R93 A;  5C18 A;  1OGY A;  3X2P A;  3GTJ A;  3CQZ A;  1FDI A;  3TIW A;  3HU1 A;  1QCS A;  1Y5I A;  4JP6 A;  5H4U A;  1G8K A;  4KDI A;  1EU1 A;  1CZ4 A;  2EEO B;  2JA7 A;  4AVR A;  3X2O A;  3QQ7 A;  5B6C A;  5FTJ A;  3HKZ A;  4ZM7 A;  3D30 A;  4GA5 A;  2NVY A;  2E2I A;  4KOD A;  4AZD A;  5GLY A;  4FG2 A;  5FTM A;  2B63 A;  4AAY A;  3SUL A;  3X2L A;  2E2H A;  4CRZ A;  2HCZ X;  4RV0 A;  4DMR A;  1TWC A;  1OA7 A;  2IV2 X;  3GTL A;  1G8J A;  1PPY A;  3SUJ A;  2VPY A;  1FDO A;  1DMS A;  1H0H A;  2AE0 X;  3IR7 A;  2JA6 A;  5EPP A;  3HU2 A;  1YLE A;  3GTM A;  1CZ5 A;  3H0G A;  1KQG A;  1Y1W A;  2VPX A;  5DYG A;  2PJH B;  2WB1 A;  3SUM A;  1Y4Z A;  3TM7 B;  1WCM A;  2YUJ A;  4QIW A;  1BW3 A;  2VPZ A;  3OUG A;  2G6G A;  2JIP A;  5FTK A;  2V3V A;  3QC8 A;  2JIO A;  2E7Z A;  3M3G A; 
#chains in the Genus database with same CATH homology
 1TWA A;  1S3S A;  1CR5 A;  4D7Z B;  2PJJ A;  2R7Z A;  1PT1 A;  2NAP A;  4AYB A;  1SMY D;  4NOH A;  1KQF A;  1WLF A;  1Q16 A;  3PLX B;  1DMR A;  2G5D A;  1K83 A;  2PI8 A;  2YU9 A;  1TMO A;  4KDL A;  2GAE A;  1AA6 A;  1PQH A;  1R27 A;  1E18 A;  1R9T A;  1YNJ D;  4CS0 A;  2C45 A;  3DMR A;  3GTQ A;  4GA6 A;  2A6E D;  3GTO A;  1PQE A;  1TWF A;  1E5V A;  5T5M D;  2JA5 A;  2DMR A;  2CW0 D;  2PMZ A;  1VC3 B;  2PNW A;  2Y0S A;  2V45 A;  1E61 A;  1E32 A;  1TWG A;  2R92 A;  1UHD A;  1Y1V A;  5DYI A;  2JIM A;  1QDN A;  4CRY G;  3GTK A;  5T5I D;  2JIQ A;  1UHE A;  4C2M A;  3GTP A;  3IR5 A;  1YNN D;  2VUM A;  1ZC1 A;  1I50 A;  2A68 D;  2VPW A;  3CZB A;  4AON B;  1PT0 A;  1PQF A;  1AW8 B;  1H5N A;  1TWH A;  2NVX A;  2JIR A;  3QWZ A;  5FTL A;  3IR6 A;  1I3Q A;  1PYU B;  4KO8 A;  2A69 D;  1SIW A;  5FTN A;  3GTG A;  2BE5 D;  5C1B A;  3O5A A;  5GLF A;  4KLN A;  3CF2 A;  4AOK B;  1IW7 D;  2O5J D;  1ZYR D;  2A6H D;  3FKI A;  1PYQ A;  2WAQ A;  1SFO A;  3QQ8 A;  1E60 A;  2NYA A;  3HU3 A;  3ML1 A;  1R7R A;  2KI8 A;  2PIC A;  2R93 A;  5C18 A;  1OGY A;  3GTJ A;  3CQZ A;  1FDI A;  3TIW A;  3HU1 A;  1QCS A;  1Y5I A;  1G8K A;  4KDI A;  1EU1 A;  1CZ4 A;  2EEO B;  2JA7 A;  5B6C A;  3QQ7 A;  5FTJ A;  3HKZ A;  2E2I A;  4GA5 A;  2NVY A;  4KOD A;  4AZD A;  5FTM A;  2B63 A;  4AAY A;  2E2H A;  4CRZ A;  4RV0 A;  4DMR A;  1TWC A;  2IV2 X;  3GTL A;  1G8J A;  1PPY A;  2VPY A;  1FDO A;  1DMS A;  1H0H A;  2AE0 X;  3IR7 A;  2JA6 A;  5EPP A;  3HU2 A;  1YLE A;  3GTM A;  1CZ5 A;  3H0G A;  1KQG A;  1Y1W A;  2VPX A;  5DYG A;  2PJH B;  2WB1 A;  1Y4Z A;  3TM7 B;  1WCM A;  2YUJ A;  4QIW A;  2VPZ A;  3OUG A;  2G6G A;  2JIP A;  5FTK A;  2V3V A;  3QC8 A;  2JIO A;  2E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...