3PLXB

The crystal structure of aspartate alpha-decarboxylase from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
ISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of aspartate alpha-decarboxylase from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase
total genus 19
structure length 100
sequence length 100
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3plxB00
1AW8B 1IW7D 2VPZA 3GTOA 1TWFA 5T5MD 3GTKA 3OUGA 3GTJA 3TM7B 2E2IA 2WB1A 1Y5IA 1QDNA 5DYGA 1UHEA 1PQHA 1FDOA 2EEOB 1PT0A 2JIRA 1WCMA 3QQ8A 2NVYA 1CR5A 1DMSA 3DMRA 3PLXB 3H0GA 5FTLA 1H5NA 2NYAA 2KI8A 1E18A 2DMRA 5FTMA 5DYIA 2YU9A 2E2HA 1CZ5A 2V45A 2C45A 2JIQA 1KQGA 4AOKB 1I3QA 1QCSA 2IV2X 1I50A 5GLFA 1R27A 2JA6A 3GTGA 1E5VA 1SFOA 1Q16A 1E32A 2V3VA 1Y1WA 1OGYA 2JIOA 5C18A 4AONB 1K83A 1CZ4A 1TWHA 2VPXA 4KLNA 3GTQA 1TMOA 2VUMA 4GA6A 4QIWA 1EU1A 1G8JA 2PMZA 3IR7A 2VPYA 3IR6A 1WLFA 4AAYA 3QWZA 1PPYA 2NAPA 1DMRA 2PJHB 3IR5A 4KO8A 5T5ID 1AA6A 2R7ZA 3GTMA 4CS0A 1TWGA 3CQZA 1VC3B 4CRZA 2NVXA 3HU1A 3GTPA 2B63A 1UHDA 2JIMA 3ML1A 5FTNA 4RV0A 4CRYG 4GA5A 5FTKA 2Y0SA 4C2MA 5C1BA 4KDLA 1PYQA 1TWAA 1YLEA 2R93A 3TIWA 5B6CA 2E7ZA 4D7ZB 4KDIA 1S3SA 4DMRA 1Y1VA 3HKZA 1FDIA 1TWCA 3FKIA 1PQFA 1H0HA 2VPWA 2R92A 3CF2A 1PYUB 1PQEA 1SIWA 1PT1A 3QC8A 3O5AA 3HU2A 4AZDA 4KODA 1Y4ZA 5EPPA 1KQFA 3HU3A 2JA7A 1R7RA 2WAQA 1E60A 3QQ7A 2JIPA 5FTJA 1E61A 3GTLA 1R9TA 4AYBA 1G8KA 2JA5A
chains in the Genus database with same CATH superfamily
3SUJA 4FG4A 4ZM7A 1AW8B 1IW7D 2PNWA 2VPZA 3GTOA 5GLXA 1TWFA 5T5MD 4L48A 3OUGA 3GTKA 4FFTA 3GTJA 1BW4A 3TM7B 2E2IA 2WB1A 1Y5IA 1QDNA 5DYGA 1UHEA 1PQHA 2YUJA 1FDOA 2EEOB 2G5DA 1PT0A 2GAEA 2JIRA 1WCMA 3QQ8A 2PICA 1ZYRD 2NVYA 1CR5A 3CZBA 1DMSA 3DMRA 3PLXB 1WC2A 2BH0A 1HD5A 3H0GA 5FTLA 1H5NA 2NYAA 2KI8A 3X2KA 1E18A 2DMRA 5FTMA 1SMYD 5DYIA 2YU9A 2E2HA 1CZ5A 1YNND 2C45A 2JIQA 2V45A 1KQGA 4AOKB 3X2NA 1QCSA 1I3QA 2IV2X 1I50A 2O5JD 5GLFA 1R27A 1OA7A 3SUMA 2JA6A 3GTGA 1E5VA 1SFOA 4AVRA 1Q16A 2PJJA 1E32A 3X2MA 1N10A 2A6HD 2V3VA 1Y1WA 3SUKA 1OGYA 2G6GA 2JIOA 5C18A 4AONB 3ENGA 1CZ4A 1TWHA 2VPXA 4KLNA 1K83A 3X2GA 3GTQA 1TMOA 2VUMA 4GA6A 4QIWA 1EU1A 1G8JA 2PMZA 3IR7A 2VPYA 3IR6A 1WLFA 4AAYA 3QWZA 1PPYA 2NAPA 1DMRA 1YNJD 4JP6A 2PJHB 2A69D 2CW0D 3X2LA 3X2HA 3IR5A 4KO8A 4FG2A 5T5ID 1AA6A 2R7ZA 2A6ED 3GTMA 4CS0A 1TWGA 3CQZA 1VC3B 4CRZA 2NVXA 2HCZX 3HU1A 3GTPA 2B63A 1UHDA 4JCWA 2JIMA 3ML1A 5FTNA 1BW3A 4JS7A 4RV0A 3X2IA 4CRYG 5H4UA 4ENGA 4GA5A 4JP7A 2ENGA 5FTKA 2Y0SA 5GLYA 4C2MA 5C1BA 3D30A 1PYQA 4FERA 1TWAA 4KDLA 3SULA 1YLEA 2R93A 3TIWA 5B6CA 2E7ZA 4D7ZB 2KQAA 1L8FA 1S3SA 4KDIA 4DMRA 1Y1VA 3HKZA 3M3GA 5GM9A 2AE0X 4JJOA 1FDIA 1TWCA 3FKIA 1PQFA 1H0HA 2VPWA 4NOHA 2R92A 3CF2A 3X2OA 1PYUB 1PQEA 1SIWA 1ZC1A 3X2JA 1PT1A 2A68D 3QC8A 3O5AA 3HU2A 1OA9A 4AZDA 4KODA 2BE5D 1Y4ZA 5EPPA 2PI8A 3HU3A 1KQFA 2JA7A 3X2PA 1R7RA 2WAQA 1E60A 3QQ7A 2JIPA 5FTJA 1E61A 3GTLA 1R9TA 4AYBA 1G8KA 2JA5A
chains in the Genus database with same CATH topology
1AW8B 1IW7D 2PNWA 2VPZA 3GTOA 1TWFA 5T5MD 3GTKA 3OUGA 3GTJA 3TM7B 2E2IA 2WB1A 1Y5IA 1QDNA 5DYGA 1UHEA 1PQHA 2YUJA 1FDOA 2EEOB 2G5DA 1PT0A 2GAEA 2JIRA 1WCMA 3QQ8A 2PICA 1ZYRD 2NVYA 1CR5A 3CZBA 1DMSA 3DMRA 3PLXB 3H0GA 5FTLA 1H5NA 2NYAA 2KI8A 1E18A 2DMRA 5FTMA 1SMYD 5DYIA 2YU9A 2E2HA 1CZ5A 1YNND 2C45A 2JIQA 2V45A 1KQGA 4AOKB 1I3QA 1QCSA 2IV2X 1I50A 2O5JD 5GLFA 1R27A 2JA6A 3GTGA 1E5VA 1SFOA 1Q16A 2PJJA 1E32A 2A6HD 2V3VA 1Y1WA 1OGYA 2G6GA 2JIOA 5C18A 4AONB 1K83A 1CZ4A 1TWHA 2VPXA 4KLNA 3GTQA 1TMOA 2VUMA 4GA6A 4QIWA 1EU1A 1G8JA 2PMZA 3IR7A 2VPYA 3IR6A 1WLFA 4AAYA 3QWZA 1PPYA 2NAPA 1DMRA 1YNJD 2PJHB 2A69D 2CW0D 3IR5A 4KO8A 5T5ID 1AA6A 2R7ZA 2A6ED 3GTMA 4CS0A 1TWGA 3CQZA 1VC3B 4CRZA 2NVXA 3HU1A 3GTPA 2B63A 1UHDA 2JIMA 3ML1A 5FTNA 4RV0A 4CRYG 4GA5A 5FTKA 2Y0SA 4C2MA 5C1BA 4KDLA 1PYQA 1TWAA 1YLEA 2R93A 3TIWA 5B6CA 2E7ZA 4D7ZB 4KDIA 1S3SA 4DMRA 1Y1VA 3HKZA 2AE0X 1FDIA 1TWCA 3FKIA 1PQFA 1H0HA 2VPWA 4NOHA 2R92A 3CF2A 1PYUB 1PQEA 1SIWA 1ZC1A 1PT1A 2A68D 3QC8A 3O5AA 3HU2A 4AZDA 4KODA 2BE5D 1Y4ZA 5EPPA 2PI8A 3HU3A 1KQFA 2JA7A 1R7RA 2WAQA 1E60A 3QQ7A 2JIPA 5FTJA 1E61A 3GTLA 1R9TA 4AYBA 1G8KA 2JA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AW8 B;  1IW7 D;  2VPZ A;  3GTO A;  1TWF A;  5T5M D;  3GTK A;  3OUG A;  3GTJ A;  3TM7 B;  2E2I A;  2WB1 A;  1Y5I A;  1QDN A;  5DYG A;  1UHE A;  1PQH A;  1FDO A;  2EEO B;  1PT0 A;  2JIR A;  1WCM A;  3QQ8 A;  2NVY A;  1CR5 A;  1DMS A;  3DMR A;  3PLX B;  3H0G A;  5FTL A;  1H5N A;  2NYA A;  2KI8 A;  1E18 A;  2DMR A;  5FTM A;  5DYI A;  2YU9 A;  2E2H A;  1CZ5 A;  2V45 A;  2C45 A;  2JIQ A;  1KQG A;  4AOK B;  1I3Q A;  1QCS A;  2IV2 X;  1I50 A;  5GLF A;  1R27 A;  2JA6 A;  3GTG A;  1E5V A;  1SFO A;  1Q16 A;  1E32 A;  2V3V A;  1Y1W A;  1OGY A;  2JIO A;  5C18 A;  4AON B;  1K83 A;  1CZ4 A;  1TWH A;  2VPX A;  4KLN A;  3GTQ A;  1TMO A;  2VUM A;  4GA6 A;  4QIW A;  1EU1 A;  1G8J A;  2PMZ A;  3IR7 A;  2VPY A;  3IR6 A;  1WLF A;  4AAY A;  3QWZ A;  1PPY A;  2NAP A;  1DMR A;  2PJH B;  3IR5 A;  4KO8 A;  5T5I D;  1AA6 A;  2R7Z A;  3GTM A;  4CS0 A;  1TWG A;  3CQZ A;  1VC3 B;  4CRZ A;  2NVX A;  3HU1 A;  3GTP A;  2B63 A;  1UHD A;  2JIM A;  3ML1 A;  5FTN A;  4RV0 A;  4CRY G;  4GA5 A;  5FTK A;  2Y0S A;  4C2M A;  5C1B A;  4KDL A;  1PYQ A;  1TWA A;  1YLE A;  2R93 A;  3TIW A;  5B6C A;  2E7Z A;  4D7Z B;  4KDI A;  1S3S A;  4DMR A;  1Y1V A;  3HKZ A;  1FDI A;  1TWC A;  3FKI A;  1PQF A;  1H0H A;  2VPW A;  2R92 A;  3CF2 A;  1PYU B;  1PQE A;  1SIW A;  1PT1 A;  3QC8 A;  3O5A A;  3HU2 A;  4AZD A;  4KOD A;  1Y4Z A;  5EPP A;  1KQF A;  3HU3 A;  2JA7 A;  1R7R A;  2WAQ A;  1E60 A;  3QQ7 A;  2JIP A;  5FTJ A;  1E61 A;  3GTL A;  1R9T A;  4AYB A;  1G8K A;  2JA5 A; 
#chains in the Genus database with same CATH topology
 3SUJ A;  4FG4 A;  4ZM7 A;  1AW8 B;  1IW7 D;  2PNW A;  2VPZ A;  3GTO A;  5GLX A;  1TWF A;  5T5M D;  4L48 A;  3OUG A;  3GTK A;  4FFT A;  3GTJ A;  1BW4 A;  3TM7 B;  2E2I A;  2WB1 A;  1Y5I A;  1QDN A;  5DYG A;  1UHE A;  1PQH A;  2YUJ A;  1FDO A;  2EEO B;  2G5D A;  1PT0 A;  2GAE A;  2JIR A;  1WCM A;  3QQ8 A;  2PIC A;  1ZYR D;  2NVY A;  1CR5 A;  3CZB A;  1DMS A;  3DMR A;  3PLX B;  1WC2 A;  2BH0 A;  1HD5 A;  3H0G A;  5FTL A;  1H5N A;  2NYA A;  2KI8 A;  3X2K A;  1E18 A;  2DMR A;  5FTM A;  1SMY D;  5DYI A;  2YU9 A;  2E2H A;  1CZ5 A;  1YNN D;  2C45 A;  2JIQ A;  2V45 A;  1KQG A;  4AOK B;  3X2N A;  1QCS A;  1I3Q A;  2IV2 X;  1I50 A;  2O5J D;  5GLF A;  1R27 A;  1OA7 A;  3SUM A;  2JA6 A;  3GTG A;  1E5V A;  1SFO A;  4AVR A;  1Q16 A;  2PJJ A;  1E32 A;  3X2M A;  1N10 A;  2A6H D;  2V3V A;  1Y1W A;  3SUK A;  1OGY A;  2G6G A;  2JIO A;  5C18 A;  4AON B;  3ENG A;  1CZ4 A;  1TWH A;  2VPX A;  4KLN A;  1K83 A;  3X2G A;  3GTQ A;  1TMO A;  2VUM A;  4GA6 A;  4QIW A;  1EU1 A;  1G8J A;  2PMZ A;  3IR7 A;  2VPY A;  3IR6 A;  1WLF A;  4AAY A;  3QWZ A;  1PPY A;  2NAP A;  1DMR A;  1YNJ D;  4JP6 A;  2PJH B;  2A69 D;  2CW0 D;  3X2L A;  3X2H A;  3IR5 A;  4KO8 A;  4FG2 A;  5T5I D;  1AA6 A;  2R7Z A;  2A6E D;  3GTM A;  4CS0 A;  1TWG A;  3CQZ A;  1VC3 B;  4CRZ A;  2NVX A;  2HCZ X;  3HU1 A;  3GTP A;  2B63 A;  1UHD A;  4JCW A;  2JIM A;  3ML1 A;  5FTN A;  1BW3 A;  4JS7 A;  4RV0 A;  3X2I A;  4CRY G;  5H4U A;  4ENG A;  4GA5 A;  4JP7 A;  2ENG A;  5FTK A;  2Y0S A;  5GLY A;  4C2M A;  5C1B A;  3D30 A;  1PYQ A;  4FER A;  1TWA A;  4KDL A;  3SUL A;  1YLE A;  2R93 A;  3TIW A;  5B6C A;  2E7Z A;  4D7Z B;  2KQA A;  1L8F A;  1S3S A;  4KDI A;  4DMR A;  1Y1V A;  3HKZ A;  3M3G A;  5GM9 A;  2AE0 X;  4JJO A;  1FDI A;  1TWC A;  3FKI A;  1PQF A;  1H0H A;  2VPW A;  4NOH A;  2R92 A;  3CF2 A;  3X2O A;  1PYU B;  1PQE A;  1SIW A;  1ZC1 A;  3X2J A;  1PT1 A;  2A68 D;  3QC8 A;  3O5A A;  3HU2 A;  1OA9 A;  4AZD A;  4KOD A;  2BE5 D;  1Y4Z A;  5EPP A;  2PI8 A;  3HU3 A;  1KQF A;  2JA7 A;  3X2P A;  1R7R A;  2WAQ A;  1E60 A;  3QQ7 A;  2JIP A;  5FTJ A;  1E61 A;  3GTL A;  1R9T A;  4AYB A;  1G8K A;  2JA5 A; 
#chains in the Genus database with same CATH homology
 1AW8 B;  1IW7 D;  2PNW A;  2VPZ A;  3GTO A;  1TWF A;  5T5M D;  3GTK A;  3OUG A;  3GTJ A;  3TM7 B;  2E2I A;  2WB1 A;  1Y5I A;  1QDN A;  5DYG A;  1UHE A;  1PQH A;  2YUJ A;  1FDO A;  2EEO B;  2G5D A;  1PT0 A;  2GAE A;  2JIR A;  1WCM A;  3QQ8 A;  2PIC A;  1ZYR D;  2NVY A;  1CR5 A;  3CZB A;  1DMS A;  3DMR A;  3PLX B;  3H0G A;  5FTL A;  1H5N A;  2NYA A;  2KI8 A;  1E18 A;  2DMR A;  5FTM A;  1SMY D;  5DYI A;  2YU9 A;  2E2H A;  1CZ5 A;  1YNN D;  2C45 A;  2JIQ A;  2V45 A;  1KQG A;  4AOK B;  1I3Q A;  1QCS A;  2IV2 X;  1I50 A;  2O5J D;  5GLF A;  1R27 A;  2JA6 A;  3GTG A;  1E5V A;  1SFO A;  1Q16 A;  2PJJ A;  1E32 A;  2A6H D;  2V3V A;  1Y1W A;  1OGY A;  2G6G A;  2JIO A;  5C18 A;  4AON B;  1K83 A;  1CZ4 A;  1TWH A;  2VPX A;  4KLN A;  3GTQ A;  1TMO A;  2VUM A;  4GA6 A;  4QIW A;  1EU1 A;  1G8J A;  2PMZ A;  3IR7 A;  2VPY A;  3IR6 A;  1WLF A;  4AAY A;  3QWZ A;  1PPY A;  2NAP A;  1DMR A;  1YNJ D;  2PJH B;  2A69 D;  2CW0 D;  3IR5 A;  4KO8 A;  5T5I D;  1AA6 A;  2R7Z A;  2A6E D;  3GTM A;  4CS0 A;  1TWG A;  3CQZ A;  1VC3 B;  4CRZ A;  2NVX A;  3HU1 A;  3GTP A;  2B63 A;  1UHD A;  2JIM A;  3ML1 A;  5FTN A;  4RV0 A;  4CRY G;  4GA5 A;  5FTK A;  2Y0S A;  4C2M A;  5C1B A;  4KDL A;  1PYQ A;  1TWA A;  1YLE A;  2R93 A;  3TIW A;  5B6C A;  2E7Z A;  4D7Z B;  4KDI A;  1S3S A;  4DMR A;  1Y1V A;  3HKZ A;  2AE0 X;  1FDI A;  1TWC A;  3FKI A;  1PQF A;  1H0H A;  2VPW A;  4NOH A;  2R92 A;  3CF2 A;  1PYU B;  1PQE A;  1SIW A;  1ZC1 A;  1PT1 A;  2A68 D;  3QC8 A;  3O5A A;  3HU2 A;  4AZD A;  4KOD A;  2BE5 D;  1Y4Z A;  5EPP A;  2PI8 A;  3HU3 A;  1KQF A;  2JA7 A;  1R7R A;  2WAQ A;  1E60 A;  3QQ7 A;  2JIP A;  5FTJ A;  1E61 A;  3GTL A;  1R9T A;  4AYB A;  1G8K A;  2JA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...