3PLXB

The crystal structure of aspartate alpha-decarboxylase from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
ISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase
publication title The crystal structure of aspartate alpha-decarboxylase from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Lyase
total genus 19
structure length 100
sequence length 100
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3plxB00
1DMSA 2E7ZA 2YU9A 2R93A 5FTNA 3TM7B 1E61A 1E60A 4RV0A 3O5AA 1UHDA 2NYAA 1G8JA 1I50A 2JIPA 4CRYG 2E2HA 4KLNA 4GA5A 5C18A 2E2IA 1TMOA 1Y1VA 4CRZA 5C1BA 4CS0A 3PLXB 3GTGA 1Y4ZA 1PT1A 2VPZA 1R7RA 1WCMA 3GTMA 1H5NA 2WAQA 2NAPA 1PYUB 5FTKA 4C2MA 1R27A 3TIWA 2DMRA 3DMRA 1QDNA 3IR6A 1OGYA 4AOKB 2R7ZA 2B63A 1WLFA 3HU1A 2PMZA 4KDLA 5FTMA 1SFOA 4AZDA 1YLEA 3GTLA 1PQEA 2NVYA 1CZ5A 2R92A 1E5VA 1Q16A 5EPPA 3GTOA 3HU3A 1PPYA 3OUGA 1TWAA 2VUMA 2EEOB 2VPXA 5T5MD 3QQ7A 1AA6A 1H0HA 2IV2X 4AAYA 3HU2A 3HKZA 1UHEA 4GA6A 2KI8A 2JIOA 1R9TA 1TWGA 1SIWA 2Y0SA 2VPYA 1TWCA 1IW7D 4KDIA 1CZ4A 1EU1A 3QWZA 2C45A 4AONB 1AW8B 4KODA 3CF2A 2V3VA 1VC3B 1Y5IA 2VPWA 5T5ID 5FTLA 1E32A 1KQGA 1FDOA 3GTJA 1FDIA 1PT0A 3GTQA 2JA6A 4AYBA 3GTKA 1QCSA 2JIMA 2PJHB 2JIRA 5GLFA 1I3QA 4QIWA 3QC8A 1PYQA 2JA5A 1G8KA 4D7ZB 1Y1WA 2JIQA 1E18A 2V45A 3GTPA 4DMRA 4KO8A 3QQ8A 5B6CA 5DYIA 1PQFA 1TWFA 1PQHA 1K83A 3IR7A 5FTJA 3H0GA 3ML1A 1DMRA 1TWHA 2JA7A 1CR5A 3IR5A 1KQFA 2NVXA 1S3SA 2WB1A 3FKIA 5DYGA 3CQZA
chains in the Genus database with same CATH superfamily
1DMSA 2E7ZA 2YU9A 2R93A 1SMYD 5FTNA 3TM7B 1E61A 2ENGA 1E60A 4RV0A 3O5AA 1UHDA 2NYAA 1G8JA 1I50A 2JIPA 2PICA 2A6ED 3X2NA 1YNND 4CRYG 5GLXA 2E2HA 3CZBA 4KLNA 4GA5A 5C18A 2E2IA 1TMOA 1Y1VA 1YNJD 4CRZA 5C1BA 4CS0A 4L48A 3PLXB 3GTGA 1Y4ZA 2KQAA 1PT1A 2VPZA 3X2PA 1OA7A 1L8FA 3X2HA 1R7RA 1WCMA 3X2OA 3GTMA 1H5NA 2WAQA 2NAPA 1PYUB 2HCZX 5FTKA 3X2IA 4C2MA 1R27A 3TIWA 2DMRA 3DMRA 1QDNA 3IR6A 1OGYA 2BH0A 4AOKB 2R7ZA 2B63A 1WLFA 3D30A 3HU1A 2PMZA 3SUMA 4KDLA 5FTMA 3X2MA 1SFOA 4AZDA 3SUJA 1YLEA 4JJOA 4JS7A 3GTLA 1PQEA 2NVYA 1CZ5A 2R92A 2CW0D 1E5VA 1Q16A 5EPPA 3GTOA 1N10A 3X2JA 4ZM7A 3HU3A 1BW4A 1PPYA 3OUGA 1TWAA 1BW3A 2VUMA 2EEOB 2VPXA 4JP6A 3QQ7A 5T5MD 1H0HA 2PNWA 1AA6A 2IV2X 2A68D 4AAYA 3HU2A 1WC2A 3HKZA 1UHEA 4GA6A 2KI8A 2JIOA 2G6GA 5H4UA 3SUKA 2GAEA 3X2KA 1TWGA 1SIWA 4FG4A 1R9TA 4FFTA 2Y0SA 2VPYA 1TWCA 1IW7D 4KDIA 1CZ4A 1EU1A 4FG2A 3QWZA 2C45A 4AONB 1AW8B 4KODA 3CF2A 2V3VA 1VC3B 1Y5IA 2VPWA 4ENGA 5T5ID 5FTLA 1E32A 1KQGA 1FDOA 2O5JD 2AE0X 2A6HD 1FDIA 3GTJA 3X2LA 1PT0A 3GTQA 2JA6A 2G5DA 4AYBA 4JCWA 3GTKA 1QCSA 2JIMA 2PJHB 2JIRA 5GLFA 1I3QA 3X2GA 4QIWA 3M3GA 3QC8A 1PYQA 1ZYRD 5GLYA 2JA5A 1G8KA 4D7ZB 1Y1WA 2JIQA 1E18A 2V45A 3GTPA 4DMRA 4KO8A 3SULA 3QQ8A 5B6CA 5DYIA 1PQFA 1TWFA 1PQHA 2BE5D 1K83A 3ENGA 4AVRA 1OA9A 2PJJA 3IR7A 2A69D 5FTJA 3H0GA 3ML1A 4FERA 5GM9A 1DMRA 1TWHA 4NOHA 2JA7A 1CR5A 3IR5A 1KQFA 1HD5A 2NVXA 1S3SA 2PI8A 2WB1A 4JP7A 1ZC1A 3FKIA 5DYGA 2YUJA 3CQZA
chains in the Genus database with same CATH topology
1DMSA 2E7ZA 2YU9A 2R93A 1SMYD 5FTNA 3TM7B 1E61A 1E60A 4RV0A 3O5AA 1UHDA 2NYAA 1G8JA 1I50A 2JIPA 2PICA 2A6ED 1YNND 4CRYG 2E2HA 3CZBA 4KLNA 4GA5A 5C18A 2E2IA 1TMOA 1Y1VA 1YNJD 4CRZA 5C1BA 4CS0A 3PLXB 3GTGA 1Y4ZA 1PT1A 2VPZA 1R7RA 1WCMA 3GTMA 1H5NA 2WAQA 2NAPA 1PYUB 5FTKA 4C2MA 1R27A 3TIWA 2DMRA 3DMRA 1QDNA 3IR6A 1OGYA 4AOKB 2R7ZA 2B63A 1WLFA 3HU1A 2PMZA 4KDLA 5FTMA 1SFOA 4AZDA 1YLEA 3GTLA 1PQEA 2NVYA 1CZ5A 2R92A 2CW0D 1E5VA 1Q16A 5EPPA 3GTOA 3HU3A 1PPYA 3OUGA 1TWAA 2VUMA 2EEOB 2VPXA 5T5MD 3QQ7A 1AA6A 1H0HA 2PNWA 2IV2X 2A68D 4AAYA 3HU2A 3HKZA 1UHEA 4GA6A 2KI8A 2JIOA 2G6GA 2GAEA 1R9TA 1TWGA 1SIWA 2Y0SA 2VPYA 1TWCA 1IW7D 4KDIA 1CZ4A 1EU1A 3QWZA 2C45A 4AONB 1AW8B 4KODA 3CF2A 2V3VA 1VC3B 1Y5IA 2VPWA 5T5ID 5FTLA 1E32A 1KQGA 1FDOA 2O5JD 2AE0X 2A6HD 1FDIA 3GTJA 1PT0A 3GTQA 2JA6A 2G5DA 4AYBA 3GTKA 1QCSA 2JIMA 2PJHB 2JIRA 5GLFA 1I3QA 4QIWA 3QC8A 1PYQA 1ZYRD 2JA5A 1G8KA 4D7ZB 1Y1WA 2JIQA 1E18A 2V45A 3GTPA 4DMRA 4KO8A 3QQ8A 5B6CA 5DYIA 1PQFA 1TWFA 1PQHA 2BE5D 1K83A 2PJJA 3IR7A 5FTJA 2A69D 3H0GA 3ML1A 1DMRA 1TWHA 4NOHA 2JA7A 1CR5A 3IR5A 1KQFA 2NVXA 1S3SA 2PI8A 2WB1A 1ZC1A 3FKIA 5DYGA 2YUJA 3CQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMS A;  2E7Z A;  2YU9 A;  2R93 A;  5FTN A;  3TM7 B;  1E61 A;  1E60 A;  4RV0 A;  3O5A A;  1UHD A;  2NYA A;  1G8J A;  1I50 A;  2JIP A;  4CRY G;  2E2H A;  4KLN A;  4GA5 A;  5C18 A;  2E2I A;  1TMO A;  1Y1V A;  4CRZ A;  5C1B A;  4CS0 A;  3PLX B;  3GTG A;  1Y4Z A;  1PT1 A;  2VPZ A;  1R7R A;  1WCM A;  3GTM A;  1H5N A;  2WAQ A;  2NAP A;  1PYU B;  5FTK A;  4C2M A;  1R27 A;  3TIW A;  2DMR A;  3DMR A;  1QDN A;  3IR6 A;  1OGY A;  4AOK B;  2R7Z A;  2B63 A;  1WLF A;  3HU1 A;  2PMZ A;  4KDL A;  5FTM A;  1SFO A;  4AZD A;  1YLE A;  3GTL A;  1PQE A;  2NVY A;  1CZ5 A;  2R92 A;  1E5V A;  1Q16 A;  5EPP A;  3GTO A;  3HU3 A;  1PPY A;  3OUG A;  1TWA A;  2VUM A;  2EEO B;  2VPX A;  5T5M D;  3QQ7 A;  1AA6 A;  1H0H A;  2IV2 X;  4AAY A;  3HU2 A;  3HKZ A;  1UHE A;  4GA6 A;  2KI8 A;  2JIO A;  1R9T A;  1TWG A;  1SIW A;  2Y0S A;  2VPY A;  1TWC A;  1IW7 D;  4KDI A;  1CZ4 A;  1EU1 A;  3QWZ A;  2C45 A;  4AON B;  1AW8 B;  4KOD A;  3CF2 A;  2V3V A;  1VC3 B;  1Y5I A;  2VPW A;  5T5I D;  5FTL A;  1E32 A;  1KQG A;  1FDO A;  3GTJ A;  1FDI A;  1PT0 A;  3GTQ A;  2JA6 A;  4AYB A;  3GTK A;  1QCS A;  2JIM A;  2PJH B;  2JIR A;  5GLF A;  1I3Q A;  4QIW A;  3QC8 A;  1PYQ A;  2JA5 A;  1G8K A;  4D7Z B;  1Y1W A;  2JIQ A;  1E18 A;  2V45 A;  3GTP A;  4DMR A;  4KO8 A;  3QQ8 A;  5B6C A;  5DYI A;  1PQF A;  1TWF A;  1PQH A;  1K83 A;  3IR7 A;  5FTJ A;  3H0G A;  3ML1 A;  1DMR A;  1TWH A;  2JA7 A;  1CR5 A;  3IR5 A;  1KQF A;  2NVX A;  1S3S A;  2WB1 A;  3FKI A;  5DYG A;  3CQZ A; 
#chains in the Genus database with same CATH topology
 1DMS A;  2E7Z A;  2YU9 A;  2R93 A;  1SMY D;  5FTN A;  3TM7 B;  1E61 A;  2ENG A;  1E60 A;  4RV0 A;  3O5A A;  1UHD A;  2NYA A;  1G8J A;  1I50 A;  2JIP A;  2PIC A;  2A6E D;  3X2N A;  1YNN D;  4CRY G;  5GLX A;  2E2H A;  3CZB A;  4KLN A;  4GA5 A;  5C18 A;  2E2I A;  1TMO A;  1Y1V A;  1YNJ D;  4CRZ A;  5C1B A;  4CS0 A;  4L48 A;  3PLX B;  3GTG A;  1Y4Z A;  2KQA A;  1PT1 A;  2VPZ A;  3X2P A;  1OA7 A;  1L8F A;  3X2H A;  1R7R A;  1WCM A;  3X2O A;  3GTM A;  1H5N A;  2WAQ A;  2NAP A;  1PYU B;  2HCZ X;  5FTK A;  3X2I A;  4C2M A;  1R27 A;  3TIW A;  2DMR A;  3DMR A;  1QDN A;  3IR6 A;  1OGY A;  2BH0 A;  4AOK B;  2R7Z A;  2B63 A;  1WLF A;  3D30 A;  3HU1 A;  2PMZ A;  3SUM A;  4KDL A;  5FTM A;  3X2M A;  1SFO A;  4AZD A;  3SUJ A;  1YLE A;  4JJO A;  4JS7 A;  3GTL A;  1PQE A;  2NVY A;  1CZ5 A;  2R92 A;  2CW0 D;  1E5V A;  1Q16 A;  5EPP A;  3GTO A;  1N10 A;  3X2J A;  4ZM7 A;  3HU3 A;  1BW4 A;  1PPY A;  3OUG A;  1TWA A;  1BW3 A;  2VUM A;  2EEO B;  2VPX A;  4JP6 A;  3QQ7 A;  5T5M D;  1H0H A;  2PNW A;  1AA6 A;  2IV2 X;  2A68 D;  4AAY A;  3HU2 A;  1WC2 A;  3HKZ A;  1UHE A;  4GA6 A;  2KI8 A;  2JIO A;  2G6G A;  5H4U A;  3SUK A;  2GAE A;  3X2K A;  1TWG A;  1SIW A;  4FG4 A;  1R9T A;  4FFT A;  2Y0S A;  2VPY A;  1TWC A;  1IW7 D;  4KDI A;  1CZ4 A;  1EU1 A;  4FG2 A;  3QWZ A;  2C45 A;  4AON B;  1AW8 B;  4KOD A;  3CF2 A;  2V3V A;  1VC3 B;  1Y5I A;  2VPW A;  4ENG A;  5T5I D;  5FTL A;  1E32 A;  1KQG A;  1FDO A;  2O5J D;  2AE0 X;  2A6H D;  1FDI A;  3GTJ A;  3X2L A;  1PT0 A;  3GTQ A;  2JA6 A;  2G5D A;  4AYB A;  4JCW A;  3GTK A;  1QCS A;  2JIM A;  2PJH B;  2JIR A;  5GLF A;  1I3Q A;  3X2G A;  4QIW A;  3M3G A;  3QC8 A;  1PYQ A;  1ZYR D;  5GLY A;  2JA5 A;  1G8K A;  4D7Z B;  1Y1W A;  2JIQ A;  1E18 A;  2V45 A;  3GTP A;  4DMR A;  4KO8 A;  3SUL A;  3QQ8 A;  5B6C A;  5DYI A;  1PQF A;  1TWF A;  1PQH A;  2BE5 D;  1K83 A;  3ENG A;  4AVR A;  1OA9 A;  2PJJ A;  3IR7 A;  2A69 D;  5FTJ A;  3H0G A;  3ML1 A;  4FER A;  5GM9 A;  1DMR A;  1TWH A;  4NOH A;  2JA7 A;  1CR5 A;  3IR5 A;  1KQF A;  1HD5 A;  2NVX A;  1S3S A;  2PI8 A;  2WB1 A;  4JP7 A;  1ZC1 A;  3FKI A;  5DYG A;  2YUJ A;  3CQZ A; 
#chains in the Genus database with same CATH homology
 1DMS A;  2E7Z A;  2YU9 A;  2R93 A;  1SMY D;  5FTN A;  3TM7 B;  1E61 A;  1E60 A;  4RV0 A;  3O5A A;  1UHD A;  2NYA A;  1G8J A;  1I50 A;  2JIP A;  2PIC A;  2A6E D;  1YNN D;  4CRY G;  2E2H A;  3CZB A;  4KLN A;  4GA5 A;  5C18 A;  2E2I A;  1TMO A;  1Y1V A;  1YNJ D;  4CRZ A;  5C1B A;  4CS0 A;  3PLX B;  3GTG A;  1Y4Z A;  1PT1 A;  2VPZ A;  1R7R A;  1WCM A;  3GTM A;  1H5N A;  2WAQ A;  2NAP A;  1PYU B;  5FTK A;  4C2M A;  1R27 A;  3TIW A;  2DMR A;  3DMR A;  1QDN A;  3IR6 A;  1OGY A;  4AOK B;  2R7Z A;  2B63 A;  1WLF A;  3HU1 A;  2PMZ A;  4KDL A;  5FTM A;  1SFO A;  4AZD A;  1YLE A;  3GTL A;  1PQE A;  2NVY A;  1CZ5 A;  2R92 A;  2CW0 D;  1E5V A;  1Q16 A;  5EPP A;  3GTO A;  3HU3 A;  1PPY A;  3OUG A;  1TWA A;  2VUM A;  2EEO B;  2VPX A;  5T5M D;  3QQ7 A;  1AA6 A;  1H0H A;  2PNW A;  2IV2 X;  2A68 D;  4AAY A;  3HU2 A;  3HKZ A;  1UHE A;  4GA6 A;  2KI8 A;  2JIO A;  2G6G A;  2GAE A;  1R9T A;  1TWG A;  1SIW A;  2Y0S A;  2VPY A;  1TWC A;  1IW7 D;  4KDI A;  1CZ4 A;  1EU1 A;  3QWZ A;  2C45 A;  4AON B;  1AW8 B;  4KOD A;  3CF2 A;  2V3V A;  1VC3 B;  1Y5I A;  2VPW A;  5T5I D;  5FTL A;  1E32 A;  1KQG A;  1FDO A;  2O5J D;  2AE0 X;  2A6H D;  1FDI A;  3GTJ A;  1PT0 A;  3GTQ A;  2JA6 A;  2G5D A;  4AYB A;  3GTK A;  1QCS A;  2JIM A;  2PJH B;  2JIR A;  5GLF A;  1I3Q A;  4QIW A;  3QC8 A;  1PYQ A;  1ZYR D;  2JA5 A;  1G8K A;  4D7Z B;  1Y1W A;  2JIQ A;  1E18 A;  2V45 A;  3GTP A;  4DMR A;  4KO8 A;  3QQ8 A;  5B6C A;  5DYI A;  1PQF A;  1TWF A;  1PQH A;  2BE5 D;  1K83 A;  2PJJ A;  3IR7 A;  5FTJ A;  2A69 D;  3H0G A;  3ML1 A;  1DMR A;  1TWH A;  4NOH A;  2JA7 A;  1CR5 A;  3IR5 A;  1KQF A;  2NVX A;  1S3S A;  2PI8 A;  2WB1 A;  1ZC1 A;  3FKI A;  5DYG A;  2YUJ A;  3CQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...