3PLXB

The crystal structure of aspartate alpha-decarboxylase from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
b'ISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase
publication title The crystal structure of aspartate alpha-decarboxylase from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Lyase
total genus 19
structure length 100
sequence length 100
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3plxB00
1QCSA 4C2MA 4D7ZB 5DYIA 3HU1A 1FDOA 3HU3A 4RV0A 1SFOA 2JIQA 2R92A 4KO8A 1TWGA 3QC8A 2VUMA 1K83A 1G8KA 3CQZA 3GTPA 2JIOA 4AYBA 4QIWA 4GA6A 1I3QA 1I50A 1Y1WA 1E18A 2E7ZA 2V3VA 1YLEA 2DMRA 2E2HA 1WLFA 4AONB 5GLFA 1R27A 1TWCA 3FKIA 3GTGA 4AZDA 3TIWA 3ML1A 3O5AA 2V45A 1TWHA 1R9TA 2PJHB 3QQ7A 3QWZA 1Y1VA 3TM7B 2PMZA 1H5NA 4KODA 5DYGA 1PYQA 4GA5A 2VPWA 1E60A 1H0HA 4AAYA 5EPPA 3H0GA 1Y4ZA 1PT0A 1TWAA 1S3SA 1KQFA 5FTKA 1CZ5A 2C45A 1QDNA 2NAPA 3GTKA 5FTJA 2JIMA 1PQEA 3DMRA 3OUGA 1PYUB 5FTMA 1AA6A 1DMRA 1FDIA 4KLNA 2JA6A 1CZ4A 4KDIA 4CRYG 3GTLA 3HU2A 3CF2A 1G8JA 3GTQA 2VPZA 1UHDA 1Y5IA 5B6CA 2E2IA 2KI8A 2Y0SA 3HKZA 2YU9A 1AW8B 1WCMA 2VPYA 1R7RA 1SIWA 1CR5A 1IW7D 3PLXB 1UHEA 5T5ID 5C18A 3GTMA 2R93A 2NYAA 1Q16A 1EU1A 2VPXA 3GTJA 2R7ZA 4AOKB 1PPYA 1TMOA 1OGYA 1TWFA 5FTNA 1KQGA 1PT1A 2NVYA 3IR5A 3IR7A 2JA7A 1PQHA 1VC3B 3QQ8A 2JIRA 2JIPA 2WB1A 4DMRA 2IV2X 2WAQA 2B63A 1E5VA 3IR6A 1DMSA 2EEOB 4CRZA 5FTLA 3GTOA 1E32A 5C1BA 1E61A 2NVXA 5T5MD 1PQFA 2JA5A 4CS0A 4KDLA
chains in the Genus database with same CATH superfamily
1QCSA 4C2MA 4D7ZB 2BE5D 5DYIA 3HU1A 1FDOA 3HU3A 4RV0A 1SFOA 2JIQA 3X2KA 2R92A 4KO8A 3ENGA 1TWGA 2A6ED 3QC8A 2VUMA 3SUKA 1OA7A 3SULA 1K83A 1G8KA 1OA9A 3SUJA 4JCWA 2PICA 3CQZA 4JP6A 3GTPA 2JIOA 4AYBA 3X2IA 2A69D 4QIWA 4GA6A 1I3QA 1I50A 3X2LA 1Y1WA 1E18A 2A6HD 2E7ZA 2V3VA 4FG4A 1YLEA 2DMRA 2E2HA 1WLFA 4AONB 1N10A 5GLFA 3CZBA 1R27A 1BW3A 1TWCA 2CW0D 4FG2A 2PJJA 3FKIA 5GM9A 3GTGA 4L48A 4AZDA 1L8FA 3TIWA 3ML1A 3O5AA 2V45A 1TWHA 1R9TA 2PJHB 3QQ7A 3QWZA 4JJOA 1ZC1A 1Y1VA 3TM7B 2PMZA 1H5NA 1HD5A 1SMYD 2A68D 2HCZX 4KODA 5DYGA 1PYQA 4GA5A 3M3GA 2VPWA 2O5JD 1E60A 1H0HA 4AAYA 5EPPA 3H0GA 1Y4ZA 1PT0A 1TWAA 1S3SA 1KQFA 5FTKA 1CZ5A 4ENGA 2C45A 3X2JA 1QDNA 1YNJD 4JP7A 2NAPA 3GTKA 3X2MA 1YNND 2ENGA 5FTJA 2JIMA 1PQEA 1WC2A 3DMRA 3OUGA 4FERA 2YUJA 1PYUB 3X2OA 5FTMA 1AA6A 1DMRA 1FDIA 4KLNA 2JA6A 1CZ4A 4KDIA 4CRYG 2BH0A 3GTLA 2G6GA 3HU2A 3CF2A 1G8JA 4FFTA 3X2PA 3GTQA 2VPZA 1UHDA 1Y5IA 5B6CA 3D30A 2E2IA 2KI8A 2Y0SA 3HKZA 2YU9A 2GAEA 1AW8B 2G5DA 3X2GA 1WCMA 3X2NA 2VPYA 1R7RA 1SIWA 1CR5A 2KQAA 1IW7D 3PLXB 1UHEA 5T5ID 5C18A 1BW4A 3GTMA 5GLXA 2NYAA 3X2HA 2R93A 2PI8A 1Q16A 1EU1A 2VPXA 3GTJA 2R7ZA 1ZYRD 4AOKB 2PNWA 1PPYA 1TMOA 1OGYA 1TWFA 5FTNA 1KQGA 1PT1A 2NVYA 3IR5A 3IR7A 2AE0X 2JA7A 1PQHA 5GLYA 1VC3B 3QQ8A 2JIRA 2JIPA 2WB1A 4AVRA 4DMRA 2IV2X 2WAQA 3SUMA 4ZM7A 2B63A 1E5VA 3IR6A 1DMSA 2EEOB 4NOHA 4CRZA 5FTLA 4JS7A 3GTOA 1E32A 5C1BA 1E61A 2NVXA 5T5MD 1PQFA 2JA5A 5H4UA 4CS0A 4KDLA
chains in the Genus database with same CATH topology
1QCSA 4C2MA 4D7ZB 2BE5D 5DYIA 3HU1A 1FDOA 3HU3A 4RV0A 1SFOA 2JIQA 2R92A 4KO8A 1TWGA 2A6ED 3QC8A 2VUMA 1K83A 1G8KA 2PICA 3CQZA 3GTPA 2JIOA 4AYBA 2A69D 4QIWA 4GA6A 1I3QA 1I50A 1Y1WA 1E18A 2A6HD 2E7ZA 2V3VA 1YLEA 2DMRA 2E2HA 1WLFA 4AONB 5GLFA 3CZBA 1R27A 1TWCA 2CW0D 2PJJA 3FKIA 3GTGA 4AZDA 3TIWA 3ML1A 3O5AA 2V45A 1TWHA 1R9TA 2PJHB 3QQ7A 3QWZA 1ZC1A 1Y1VA 3TM7B 2PMZA 1H5NA 2A68D 1SMYD 4KODA 5DYGA 1PYQA 4GA5A 2VPWA 2O5JD 1E60A 1H0HA 4AAYA 5EPPA 3H0GA 1Y4ZA 1PT0A 1TWAA 1S3SA 1KQFA 5FTKA 1CZ5A 2C45A 1QDNA 1YNJD 2NAPA 3GTKA 1YNND 5FTJA 2JIMA 1PQEA 3DMRA 3OUGA 2YUJA 1PYUB 5FTMA 1AA6A 1DMRA 1FDIA 4KLNA 2JA6A 1CZ4A 4KDIA 4CRYG 3GTLA 2G6GA 3HU2A 3CF2A 1G8JA 3GTQA 2VPZA 1UHDA 1Y5IA 5B6CA 2E2IA 2KI8A 2Y0SA 3HKZA 2YU9A 2GAEA 1AW8B 2G5DA 1WCMA 2VPYA 1R7RA 1SIWA 1CR5A 1IW7D 3PLXB 1UHEA 5T5ID 5C18A 3GTMA 2R93A 2NYAA 2PI8A 1Q16A 1EU1A 2VPXA 3GTJA 2R7ZA 1ZYRD 4AOKB 2PNWA 1PPYA 1TMOA 1OGYA 1TWFA 5FTNA 1KQGA 1PT1A 2NVYA 3IR5A 3IR7A 2AE0X 2JA7A 1PQHA 1VC3B 3QQ8A 2JIRA 2JIPA 2WB1A 4DMRA 2IV2X 2WAQA 2B63A 1E5VA 3IR6A 1DMSA 2EEOB 4NOHA 4CRZA 5FTLA 3GTOA 1E32A 5C1BA 1E61A 2NVXA 5T5MD 1PQFA 2JA5A 4CS0A 4KDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCS A;  4C2M A;  4D7Z B;  5DYI A;  3HU1 A;  1FDO A;  3HU3 A;  4RV0 A;  1SFO A;  2JIQ A;  2R92 A;  4KO8 A;  1TWG A;  3QC8 A;  2VUM A;  1K83 A;  1G8K A;  3CQZ A;  3GTP A;  2JIO A;  4AYB A;  4QIW A;  4GA6 A;  1I3Q A;  1I50 A;  1Y1W A;  1E18 A;  2E7Z A;  2V3V A;  1YLE A;  2DMR A;  2E2H A;  1WLF A;  4AON B;  5GLF A;  1R27 A;  1TWC A;  3FKI A;  3GTG A;  4AZD A;  3TIW A;  3ML1 A;  3O5A A;  2V45 A;  1TWH A;  1R9T A;  2PJH B;  3QQ7 A;  3QWZ A;  1Y1V A;  3TM7 B;  2PMZ A;  1H5N A;  4KOD A;  5DYG A;  1PYQ A;  4GA5 A;  2VPW A;  1E60 A;  1H0H A;  4AAY A;  5EPP A;  3H0G A;  1Y4Z A;  1PT0 A;  1TWA A;  1S3S A;  1KQF A;  5FTK A;  1CZ5 A;  2C45 A;  1QDN A;  2NAP A;  3GTK A;  5FTJ A;  2JIM A;  1PQE A;  3DMR A;  3OUG A;  1PYU B;  5FTM A;  1AA6 A;  1DMR A;  1FDI A;  4KLN A;  2JA6 A;  1CZ4 A;  4KDI A;  4CRY G;  3GTL A;  3HU2 A;  3CF2 A;  1G8J A;  3GTQ A;  2VPZ A;  1UHD A;  1Y5I A;  5B6C A;  2E2I A;  2KI8 A;  2Y0S A;  3HKZ A;  2YU9 A;  1AW8 B;  1WCM A;  2VPY A;  1R7R A;  1SIW A;  1CR5 A;  1IW7 D;  3PLX B;  1UHE A;  5T5I D;  5C18 A;  3GTM A;  2R93 A;  2NYA A;  1Q16 A;  1EU1 A;  2VPX A;  3GTJ A;  2R7Z A;  4AOK B;  1PPY A;  1TMO A;  1OGY A;  1TWF A;  5FTN A;  1KQG A;  1PT1 A;  2NVY A;  3IR5 A;  3IR7 A;  2JA7 A;  1PQH A;  1VC3 B;  3QQ8 A;  2JIR A;  2JIP A;  2WB1 A;  4DMR A;  2IV2 X;  2WAQ A;  2B63 A;  1E5V A;  3IR6 A;  1DMS A;  2EEO B;  4CRZ A;  5FTL A;  3GTO A;  1E32 A;  5C1B A;  1E61 A;  2NVX A;  5T5M D;  1PQF A;  2JA5 A;  4CS0 A;  4KDL A; 
#chains in the Genus database with same CATH topology
 1QCS A;  4C2M A;  4D7Z B;  2BE5 D;  5DYI A;  3HU1 A;  1FDO A;  3HU3 A;  4RV0 A;  1SFO A;  2JIQ A;  3X2K A;  2R92 A;  4KO8 A;  3ENG A;  1TWG A;  2A6E D;  3QC8 A;  2VUM A;  3SUK A;  1OA7 A;  3SUL A;  1K83 A;  1G8K A;  1OA9 A;  3SUJ A;  4JCW A;  2PIC A;  3CQZ A;  4JP6 A;  3GTP A;  2JIO A;  4AYB A;  3X2I A;  2A69 D;  4QIW A;  4GA6 A;  1I3Q A;  1I50 A;  3X2L A;  1Y1W A;  1E18 A;  2A6H D;  2E7Z A;  2V3V A;  4FG4 A;  1YLE A;  2DMR A;  2E2H A;  1WLF A;  4AON B;  1N10 A;  5GLF A;  3CZB A;  1R27 A;  1BW3 A;  1TWC A;  2CW0 D;  4FG2 A;  2PJJ A;  3FKI A;  5GM9 A;  3GTG A;  4L48 A;  4AZD A;  1L8F A;  3TIW A;  3ML1 A;  3O5A A;  2V45 A;  1TWH A;  1R9T A;  2PJH B;  3QQ7 A;  3QWZ A;  4JJO A;  1ZC1 A;  1Y1V A;  3TM7 B;  2PMZ A;  1H5N A;  1HD5 A;  1SMY D;  2A68 D;  2HCZ X;  4KOD A;  5DYG A;  1PYQ A;  4GA5 A;  3M3G A;  2VPW A;  2O5J D;  1E60 A;  1H0H A;  4AAY A;  5EPP A;  3H0G A;  1Y4Z A;  1PT0 A;  1TWA A;  1S3S A;  1KQF A;  5FTK A;  1CZ5 A;  4ENG A;  2C45 A;  3X2J A;  1QDN A;  1YNJ D;  4JP7 A;  2NAP A;  3GTK A;  3X2M A;  1YNN D;  2ENG A;  5FTJ A;  2JIM A;  1PQE A;  1WC2 A;  3DMR A;  3OUG A;  4FER A;  2YUJ A;  1PYU B;  3X2O A;  5FTM A;  1AA6 A;  1DMR A;  1FDI A;  4KLN A;  2JA6 A;  1CZ4 A;  4KDI A;  4CRY G;  2BH0 A;  3GTL A;  2G6G A;  3HU2 A;  3CF2 A;  1G8J A;  4FFT A;  3X2P A;  3GTQ A;  2VPZ A;  1UHD A;  1Y5I A;  5B6C A;  3D30 A;  2E2I A;  2KI8 A;  2Y0S A;  3HKZ A;  2YU9 A;  2GAE A;  1AW8 B;  2G5D A;  3X2G A;  1WCM A;  3X2N A;  2VPY A;  1R7R A;  1SIW A;  1CR5 A;  2KQA A;  1IW7 D;  3PLX B;  1UHE A;  5T5I D;  5C18 A;  1BW4 A;  3GTM A;  5GLX A;  2NYA A;  3X2H A;  2R93 A;  2PI8 A;  1Q16 A;  1EU1 A;  2VPX A;  3GTJ A;  2R7Z A;  1ZYR D;  4AOK B;  2PNW A;  1PPY A;  1TMO A;  1OGY A;  1TWF A;  5FTN A;  1KQG A;  1PT1 A;  2NVY A;  3IR5 A;  3IR7 A;  2AE0 X;  2JA7 A;  1PQH A;  5GLY A;  1VC3 B;  3QQ8 A;  2JIR A;  2JIP A;  2WB1 A;  4AVR A;  4DMR A;  2IV2 X;  2WAQ A;  3SUM A;  4ZM7 A;  2B63 A;  1E5V A;  3IR6 A;  1DMS A;  2EEO B;  4NOH A;  4CRZ A;  5FTL A;  4JS7 A;  3GTO A;  1E32 A;  5C1B A;  1E61 A;  2NVX A;  5T5M D;  1PQF A;  2JA5 A;  5H4U A;  4CS0 A;  4KDL A; 
#chains in the Genus database with same CATH homology
 1QCS A;  4C2M A;  4D7Z B;  2BE5 D;  5DYI A;  3HU1 A;  1FDO A;  3HU3 A;  4RV0 A;  1SFO A;  2JIQ A;  2R92 A;  4KO8 A;  1TWG A;  2A6E D;  3QC8 A;  2VUM A;  1K83 A;  1G8K A;  2PIC A;  3CQZ A;  3GTP A;  2JIO A;  4AYB A;  2A69 D;  4QIW A;  4GA6 A;  1I3Q A;  1I50 A;  1Y1W A;  1E18 A;  2A6H D;  2E7Z A;  2V3V A;  1YLE A;  2DMR A;  2E2H A;  1WLF A;  4AON B;  5GLF A;  3CZB A;  1R27 A;  1TWC A;  2CW0 D;  2PJJ A;  3FKI A;  3GTG A;  4AZD A;  3TIW A;  3ML1 A;  3O5A A;  2V45 A;  1TWH A;  1R9T A;  2PJH B;  3QQ7 A;  3QWZ A;  1ZC1 A;  1Y1V A;  3TM7 B;  2PMZ A;  1H5N A;  2A68 D;  1SMY D;  4KOD A;  5DYG A;  1PYQ A;  4GA5 A;  2VPW A;  2O5J D;  1E60 A;  1H0H A;  4AAY A;  5EPP A;  3H0G A;  1Y4Z A;  1PT0 A;  1TWA A;  1S3S A;  1KQF A;  5FTK A;  1CZ5 A;  2C45 A;  1QDN A;  1YNJ D;  2NAP A;  3GTK A;  1YNN D;  5FTJ A;  2JIM A;  1PQE A;  3DMR A;  3OUG A;  2YUJ A;  1PYU B;  5FTM A;  1AA6 A;  1DMR A;  1FDI A;  4KLN A;  2JA6 A;  1CZ4 A;  4KDI A;  4CRY G;  3GTL A;  2G6G A;  3HU2 A;  3CF2 A;  1G8J A;  3GTQ A;  2VPZ A;  1UHD A;  1Y5I A;  5B6C A;  2E2I A;  2KI8 A;  2Y0S A;  3HKZ A;  2YU9 A;  2GAE A;  1AW8 B;  2G5D A;  1WCM A;  2VPY A;  1R7R A;  1SIW A;  1CR5 A;  1IW7 D;  3PLX B;  1UHE A;  5T5I D;  5C18 A;  3GTM A;  2R93 A;  2NYA A;  2PI8 A;  1Q16 A;  1EU1 A;  2VPX A;  3GTJ A;  2R7Z A;  1ZYR D;  4AOK B;  2PNW A;  1PPY A;  1TMO A;  1OGY A;  1TWF A;  5FTN A;  1KQG A;  1PT1 A;  2NVY A;  3IR5 A;  3IR7 A;  2AE0 X;  2JA7 A;  1PQH A;  1VC3 B;  3QQ8 A;  2JIR A;  2JIP A;  2WB1 A;  4DMR A;  2IV2 X;  2WAQ A;  2B63 A;  1E5V A;  3IR6 A;  1DMS A;  2EEO B;  4NOH A;  4CRZ A;  5FTL A;  3GTO A;  1E32 A;  5C1B A;  1E61 A;  2NVX A;  5T5M D;  1PQF A;  2JA5 A;  4CS0 A;  4KDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...