4CRYG

Direct visualisation of strain-induced protein post-translational modification
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
101
Chain Sequence
b'SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSVYAIAAERGSRIISVNGAAAHASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE
molecule tags Lyase
source organism Escherichia coli k-12
publication title Direct Visualisation of Strain-Induced Protein Post-Translational Modification
rcsb
total genus 23
structure length 101
sequence length 102
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4cryG00
1PQHA 1CZ4A 4CRZA 3HU1A 2PJHB 1TWCA 1Y1WA 1QDNA 3QC8A 5DYIA 2B63A 1TWGA 3IR7A 1PT1A 4AONB 4AZDA 3TIWA 3PLXB 1AA6A 1SFOA 3GTOA 4DMRA 2YU9A 2V3VA 5B6CA 3QWZA 5FTMA 1YLEA 4KLNA 2EEOB 2E2HA 3ML1A 2DMRA 2NVXA 4GA5A 3GTLA 2VPWA 4KO8A 4AOKB 1FDIA 1DMSA 3QQ7A 1KQFA 1G8KA 2VUMA 4KDIA 1G8JA 2C45A 1Y1VA 1CR5A 1UHEA 3IR6A 4GA6A 5T5MD 5T5ID 3O5AA 1PYQA 1PQFA 5GLFA 2IV2X 1EU1A 1S3SA 1R9TA 1OGYA 2JIMA 5C18A 5FTNA 3OUGA 1PYUB 3HU2A 5EPPA 1VC3B 2Y0SA 1AW8B 1DMRA 5FTLA 3H0GA 2V45A 3QQ8A 1SIWA 1I50A 4CS0A 1UHDA 1H0HA 1KQGA 1Q16A 1TMOA 3GTJA 3FKIA 1TWFA 2PMZA 2VPZA 1PT0A 1E32A 2JIQA 3GTKA 2R92A 1Y5IA 4RV0A 2JA7A 5C1BA 2NVYA 4C2MA 1E60A 2JIRA 4KODA 4AAYA 1TWAA 4D7ZB 5FTJA 2VPXA 1TWHA 1IW7D 2JA6A 2VPYA 3GTGA 3HU3A 2WB1A 1K83A 1PQEA 2NAPA 4KDLA 2NYAA 1Y4ZA 5FTKA 1R27A 2R7ZA 4AYBA 1E5VA 4CRYG 2JA5A 3HKZA 1R7RA 2KI8A 3DMRA 1E61A 1WLFA 3GTQA 1E18A 3CF2A 3GTPA 5DYGA 2E2IA 2E7ZA 2JIOA 1QCSA 2WAQA 3CQZA 1WCMA 1I3QA 4QIWA 2JIPA 1H5NA 3TM7B 3GTMA 1CZ5A 1FDOA 2R93A 3IR5A 1PPYA
chains in the Genus database with same CATH superfamily
1PQHA 1CZ4A 2A6ED 1ZYRD 4CRZA 3HU1A 2PJHB 1TWCA 1Y1WA 1QDNA 3QC8A 5DYIA 4JP6A 2B63A 1TWGA 3IR7A 1PT1A 3X2LA 4AONB 3TIWA 3PLXB 4AZDA 1AA6A 3X2IA 1SFOA 3GTOA 4DMRA 2YU9A 2V3VA 5B6CA 2PNWA 3QWZA 5FTMA 1YLEA 4KLNA 2EEOB 2E2HA 5H4UA 4NOHA 5GM9A 3ML1A 1ZC1A 2DMRA 3X2GA 1N10A 4GA5A 2NVXA 3CZBA 3GTLA 2VPWA 4KO8A 4AOKB 1FDIA 2AE0X 3M3GA 1DMSA 3QQ7A 2A6HD 1G8KA 1KQFA 2VUMA 4KDIA 2BH0A 1G8JA 2YUJA 2C45A 1Y1VA 1OA7A 1CR5A 1UHEA 3IR6A 4GA6A 5T5MD 3D30A 5T5ID 4JP7A 2A69D 3O5AA 1PYQA 2A68D 1PQFA 5GLFA 3SUKA 2IV2X 1EU1A 1S3SA 1SMYD 1R9TA 1OGYA 2JIMA 5C18A 5FTNA 3OUGA 2PICA 1PYUB 3HU2A 5EPPA 1BW3A 4JJOA 3X2JA 1VC3B 1AW8B 1DMRA 2Y0SA 5FTLA 3H0GA 2V45A 3QQ8A 1SIWA 1I50A 4JCWA 4CS0A 4FERA 1UHDA 2PJJA 1H0HA 1KQGA 1Q16A 1TMOA 1L8FA 3ENGA 3GTJA 3FKIA 1TWFA 4ENGA 2CW0D 3SULA 2PMZA 2VPZA 4FG2A 1YNND 1PT0A 1E32A 2JIQA 3GTKA 2R92A 4FG4A 1Y5IA 4RV0A 2JA7A 5C1BA 2NVYA 4C2MA 1E60A 3SUMA 4JS7A 2JIRA 5GLXA 2ENGA 4KODA 5GLYA 4AAYA 1TWAA 1BW4A 3X2HA 4D7ZB 1HD5A 2VPXA 5FTJA 1TWHA 1IW7D 3X2KA 2JA6A 2VPYA 3GTGA 2BE5D 3HU3A 2WB1A 3SUJA 1K83A 1PQEA 2NAPA 3X2OA 4ZM7A 4KDLA 2NYAA 1Y4ZA 2KQAA 5FTKA 1R27A 3X2MA 3X2PA 2GAEA 4FFTA 2R7ZA 3X2NA 1E5VA 4AYBA 4CRYG 2JA5A 3HKZA 1R7RA 2KI8A 3DMRA 1E61A 2G6GA 1WLFA 3GTQA 1E18A 2HCZX 3CF2A 3GTPA 1YNJD 5DYGA 4AVRA 2E7ZA 2E2IA 2JIOA 1QCSA 2WAQA 3CQZA 1WCMA 1OA9A 2PI8A 1I3QA 4QIWA 4L48A 2JIPA 1H5NA 3TM7B 3GTMA 1WC2A 2G5DA 1CZ5A 2O5JD 1FDOA 2R93A 3IR5A 1PPYA
chains in the Genus database with same CATH topology
1PQHA 1CZ4A 2A6ED 1ZYRD 4CRZA 3HU1A 2PJHB 1TWCA 1Y1WA 1QDNA 3QC8A 5DYIA 2B63A 1TWGA 3IR7A 1PT1A 4AONB 4AZDA 3TIWA 3PLXB 1AA6A 1SFOA 3GTOA 4DMRA 2YU9A 2V3VA 5B6CA 2PNWA 3QWZA 5FTMA 1YLEA 4KLNA 2EEOB 2E2HA 4NOHA 3ML1A 1ZC1A 2DMRA 2NVXA 4GA5A 3CZBA 3GTLA 2VPWA 4KO8A 4AOKB 1FDIA 2AE0X 1DMSA 3QQ7A 2A6HD 1G8KA 1KQFA 2VUMA 4KDIA 1G8JA 2YUJA 2C45A 1Y1VA 1CR5A 1UHEA 3IR6A 4GA6A 5T5MD 5T5ID 2A69D 3O5AA 1PYQA 2A68D 1PQFA 5GLFA 2IV2X 1EU1A 1S3SA 1SMYD 1R9TA 1OGYA 2JIMA 5C18A 5FTNA 3OUGA 2PICA 1PYUB 3HU2A 5EPPA 1VC3B 1AW8B 1DMRA 2Y0SA 5FTLA 3H0GA 2V45A 3QQ8A 1SIWA 1I50A 4CS0A 1UHDA 2PJJA 1H0HA 1KQGA 1Q16A 1TMOA 3GTJA 3FKIA 1TWFA 2CW0D 2PMZA 2VPZA 1YNND 1PT0A 1E32A 2JIQA 3GTKA 2R92A 1Y5IA 4RV0A 2JA7A 5C1BA 2NVYA 4C2MA 1E60A 2JIRA 4KODA 4AAYA 1TWAA 4D7ZB 5FTJA 2VPXA 1TWHA 1IW7D 2JA6A 2VPYA 3GTGA 2BE5D 3HU3A 2WB1A 1K83A 1PQEA 2NAPA 4KDLA 2NYAA 1Y4ZA 5FTKA 1R27A 2GAEA 2R7ZA 4AYBA 1E5VA 4CRYG 2JA5A 3HKZA 1R7RA 2KI8A 3DMRA 1E61A 2G6GA 1WLFA 3GTQA 1E18A 3CF2A 3GTPA 1YNJD 5DYGA 2E2IA 2E7ZA 2JIOA 1QCSA 2WAQA 3CQZA 1WCMA 2PI8A 1I3QA 4QIWA 2JIPA 1H5NA 3TM7B 3GTMA 2G5DA 1CZ5A 2O5JD 1FDOA 2R93A 3IR5A 1PPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQH A;  1CZ4 A;  4CRZ A;  3HU1 A;  2PJH B;  1TWC A;  1Y1W A;  1QDN A;  3QC8 A;  5DYI A;  2B63 A;  1TWG A;  3IR7 A;  1PT1 A;  4AON B;  4AZD A;  3TIW A;  3PLX B;  1AA6 A;  1SFO A;  3GTO A;  4DMR A;  2YU9 A;  2V3V A;  5B6C A;  3QWZ A;  5FTM A;  1YLE A;  4KLN A;  2EEO B;  2E2H A;  3ML1 A;  2DMR A;  2NVX A;  4GA5 A;  3GTL A;  2VPW A;  4KO8 A;  4AOK B;  1FDI A;  1DMS A;  3QQ7 A;  1KQF A;  1G8K A;  2VUM A;  4KDI A;  1G8J A;  2C45 A;  1Y1V A;  1CR5 A;  1UHE A;  3IR6 A;  4GA6 A;  5T5M D;  5T5I D;  3O5A A;  1PYQ A;  1PQF A;  5GLF A;  2IV2 X;  1EU1 A;  1S3S A;  1R9T A;  1OGY A;  2JIM A;  5C18 A;  5FTN A;  3OUG A;  1PYU B;  3HU2 A;  5EPP A;  1VC3 B;  2Y0S A;  1AW8 B;  1DMR A;  5FTL A;  3H0G A;  2V45 A;  3QQ8 A;  1SIW A;  1I50 A;  4CS0 A;  1UHD A;  1H0H A;  1KQG A;  1Q16 A;  1TMO A;  3GTJ A;  3FKI A;  1TWF A;  2PMZ A;  2VPZ A;  1PT0 A;  1E32 A;  2JIQ A;  3GTK A;  2R92 A;  1Y5I A;  4RV0 A;  2JA7 A;  5C1B A;  2NVY A;  4C2M A;  1E60 A;  2JIR A;  4KOD A;  4AAY A;  1TWA A;  4D7Z B;  5FTJ A;  2VPX A;  1TWH A;  1IW7 D;  2JA6 A;  2VPY A;  3GTG A;  3HU3 A;  2WB1 A;  1K83 A;  1PQE A;  2NAP A;  4KDL A;  2NYA A;  1Y4Z A;  5FTK A;  1R27 A;  2R7Z A;  4AYB A;  1E5V A;  4CRY G;  2JA5 A;  3HKZ A;  1R7R A;  2KI8 A;  3DMR A;  1E61 A;  1WLF A;  3GTQ A;  1E18 A;  3CF2 A;  3GTP A;  5DYG A;  2E2I A;  2E7Z A;  2JIO A;  1QCS A;  2WAQ A;  3CQZ A;  1WCM A;  1I3Q A;  4QIW A;  2JIP A;  1H5N A;  3TM7 B;  3GTM A;  1CZ5 A;  1FDO A;  2R93 A;  3IR5 A;  1PPY A; 
#chains in the Genus database with same CATH topology
 1PQH A;  1CZ4 A;  2A6E D;  1ZYR D;  4CRZ A;  3HU1 A;  2PJH B;  1TWC A;  1Y1W A;  1QDN A;  3QC8 A;  5DYI A;  4JP6 A;  2B63 A;  1TWG A;  3IR7 A;  1PT1 A;  3X2L A;  4AON B;  3TIW A;  3PLX B;  4AZD A;  1AA6 A;  3X2I A;  1SFO A;  3GTO A;  4DMR A;  2YU9 A;  2V3V A;  5B6C A;  2PNW A;  3QWZ A;  5FTM A;  1YLE A;  4KLN A;  2EEO B;  2E2H A;  5H4U A;  4NOH A;  5GM9 A;  3ML1 A;  1ZC1 A;  2DMR A;  3X2G A;  1N10 A;  4GA5 A;  2NVX A;  3CZB A;  3GTL A;  2VPW A;  4KO8 A;  4AOK B;  1FDI A;  2AE0 X;  3M3G A;  1DMS A;  3QQ7 A;  2A6H D;  1G8K A;  1KQF A;  2VUM A;  4KDI A;  2BH0 A;  1G8J A;  2YUJ A;  2C45 A;  1Y1V A;  1OA7 A;  1CR5 A;  1UHE A;  3IR6 A;  4GA6 A;  5T5M D;  3D30 A;  5T5I D;  4JP7 A;  2A69 D;  3O5A A;  1PYQ A;  2A68 D;  1PQF A;  5GLF A;  3SUK A;  2IV2 X;  1EU1 A;  1S3S A;  1SMY D;  1R9T A;  1OGY A;  2JIM A;  5C18 A;  5FTN A;  3OUG A;  2PIC A;  1PYU B;  3HU2 A;  5EPP A;  1BW3 A;  4JJO A;  3X2J A;  1VC3 B;  1AW8 B;  1DMR A;  2Y0S A;  5FTL A;  3H0G A;  2V45 A;  3QQ8 A;  1SIW A;  1I50 A;  4JCW A;  4CS0 A;  4FER A;  1UHD A;  2PJJ A;  1H0H A;  1KQG A;  1Q16 A;  1TMO A;  1L8F A;  3ENG A;  3GTJ A;  3FKI A;  1TWF A;  4ENG A;  2CW0 D;  3SUL A;  2PMZ A;  2VPZ A;  4FG2 A;  1YNN D;  1PT0 A;  1E32 A;  2JIQ A;  3GTK A;  2R92 A;  4FG4 A;  1Y5I A;  4RV0 A;  2JA7 A;  5C1B A;  2NVY A;  4C2M A;  1E60 A;  3SUM A;  4JS7 A;  2JIR A;  5GLX A;  2ENG A;  4KOD A;  5GLY A;  4AAY A;  1TWA A;  1BW4 A;  3X2H A;  4D7Z B;  1HD5 A;  2VPX A;  5FTJ A;  1TWH A;  1IW7 D;  3X2K A;  2JA6 A;  2VPY A;  3GTG A;  2BE5 D;  3HU3 A;  2WB1 A;  3SUJ A;  1K83 A;  1PQE A;  2NAP A;  3X2O A;  4ZM7 A;  4KDL A;  2NYA A;  1Y4Z A;  2KQA A;  5FTK A;  1R27 A;  3X2M A;  3X2P A;  2GAE A;  4FFT A;  2R7Z A;  3X2N A;  1E5V A;  4AYB A;  4CRY G;  2JA5 A;  3HKZ A;  1R7R A;  2KI8 A;  3DMR A;  1E61 A;  2G6G A;  1WLF A;  3GTQ A;  1E18 A;  2HCZ X;  3CF2 A;  3GTP A;  1YNJ D;  5DYG A;  4AVR A;  2E7Z A;  2E2I A;  2JIO A;  1QCS A;  2WAQ A;  3CQZ A;  1WCM A;  1OA9 A;  2PI8 A;  1I3Q A;  4QIW A;  4L48 A;  2JIP A;  1H5N A;  3TM7 B;  3GTM A;  1WC2 A;  2G5D A;  1CZ5 A;  2O5J D;  1FDO A;  2R93 A;  3IR5 A;  1PPY A; 
#chains in the Genus database with same CATH homology
 1PQH A;  1CZ4 A;  2A6E D;  1ZYR D;  4CRZ A;  3HU1 A;  2PJH B;  1TWC A;  1Y1W A;  1QDN A;  3QC8 A;  5DYI A;  2B63 A;  1TWG A;  3IR7 A;  1PT1 A;  4AON B;  4AZD A;  3TIW A;  3PLX B;  1AA6 A;  1SFO A;  3GTO A;  4DMR A;  2YU9 A;  2V3V A;  5B6C A;  2PNW A;  3QWZ A;  5FTM A;  1YLE A;  4KLN A;  2EEO B;  2E2H A;  4NOH A;  3ML1 A;  1ZC1 A;  2DMR A;  2NVX A;  4GA5 A;  3CZB A;  3GTL A;  2VPW A;  4KO8 A;  4AOK B;  1FDI A;  2AE0 X;  1DMS A;  3QQ7 A;  2A6H D;  1G8K A;  1KQF A;  2VUM A;  4KDI A;  1G8J A;  2YUJ A;  2C45 A;  1Y1V A;  1CR5 A;  1UHE A;  3IR6 A;  4GA6 A;  5T5M D;  5T5I D;  2A69 D;  3O5A A;  1PYQ A;  2A68 D;  1PQF A;  5GLF A;  2IV2 X;  1EU1 A;  1S3S A;  1SMY D;  1R9T A;  1OGY A;  2JIM A;  5C18 A;  5FTN A;  3OUG A;  2PIC A;  1PYU B;  3HU2 A;  5EPP A;  1VC3 B;  1AW8 B;  1DMR A;  2Y0S A;  5FTL A;  3H0G A;  2V45 A;  3QQ8 A;  1SIW A;  1I50 A;  4CS0 A;  1UHD A;  2PJJ A;  1H0H A;  1KQG A;  1Q16 A;  1TMO A;  3GTJ A;  3FKI A;  1TWF A;  2CW0 D;  2PMZ A;  2VPZ A;  1YNN D;  1PT0 A;  1E32 A;  2JIQ A;  3GTK A;  2R92 A;  1Y5I A;  4RV0 A;  2JA7 A;  5C1B A;  2NVY A;  4C2M A;  1E60 A;  2JIR A;  4KOD A;  4AAY A;  1TWA A;  4D7Z B;  5FTJ A;  2VPX A;  1TWH A;  1IW7 D;  2JA6 A;  2VPY A;  3GTG A;  2BE5 D;  3HU3 A;  2WB1 A;  1K83 A;  1PQE A;  2NAP A;  4KDL A;  2NYA A;  1Y4Z A;  5FTK A;  1R27 A;  2GAE A;  2R7Z A;  4AYB A;  1E5V A;  4CRY G;  2JA5 A;  3HKZ A;  1R7R A;  2KI8 A;  3DMR A;  1E61 A;  2G6G A;  1WLF A;  3GTQ A;  1E18 A;  3CF2 A;  3GTP A;  1YNJ D;  5DYG A;  2E2I A;  2E7Z A;  2JIO A;  1QCS A;  2WAQ A;  3CQZ A;  1WCM A;  2PI8 A;  1I3Q A;  4QIW A;  2JIP A;  1H5N A;  3TM7 B;  3GTM A;  2G5D A;  1CZ5 A;  2O5J D;  1FDO A;  2R93 A;  3IR5 A;  1PPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...