4CRYG

Direct visualisation of strain-induced protein post-translational modification
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
101
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSVYAIAAERGSRIISVNGAAAHASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title Direct Visualisation of Strain-Induced Protein Post-Translational Modification
rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 23
structure length 101
sequence length 102
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4cryG00
1E18A 1H0HA 1VC3B 2IV2X 4AOKB 1Y1WA 2C45A 5FTMA 4QIWA 1H5NA 1TMOA 3PLXB 1AA6A 4KDLA 2R92A 2WB1A 5FTJA 4RV0A 3FKIA 3O5AA 1FDIA 1K83A 2JIOA 1QDNA 1WLFA 1TWCA 5DYIA 1PPYA 2EEOB 5T5MD 1TWAA 1CR5A 3QQ8A 2WAQA 3QWZA 3H0GA 3HU3A 1PT1A 4AAYA 5EPPA 1DMSA 1UHDA 4AZDA 3GTKA 2JA5A 1R7RA 2NVXA 1OGYA 2VPXA 1R27A 4KODA 1SFOA 3DMRA 4KLNA 1I3QA 2DMRA 3TIWA 5DYGA 3GTLA 3QC8A 1SIWA 4AYBA 1E60A 1AW8B 4GA5A 5FTLA 1G8JA 2JA6A 2JA7A 2E7ZA 2B63A 4DMRA 1CZ5A 3GTMA 3TM7B 1TWFA 1R9TA 2PJHB 3GTGA 2E2IA 5C18A 2NYAA 3HKZA 3IR5A 4CRZA 2PMZA 2JIMA 2JIQA 3GTOA 5T5ID 2V3VA 1YLEA 2Y0SA 2VPWA 1TWHA 2R7ZA 1E61A 1CZ4A 1WCMA 3HU1A 4AONB 4D7ZB 2NAPA 5GLFA 5C1BA 1EU1A 5FTNA 1Y4ZA 5FTKA 1PT0A 2V45A 3GTPA 1Y1VA 1G8KA 1TWGA 1PQEA 1PYUB 3ML1A 1PQFA 1E5VA 2VUMA 4KDIA 4CS0A 1KQFA 1I50A 4CRYG 1DMRA 3CF2A 1UHEA 2VPZA 2JIRA 4C2MA 1PQHA 2YU9A 1E32A 1S3SA 2KI8A 3HU2A 2VPYA 3IR7A 3CQZA 1FDOA 3GTJA 2E2HA 1IW7D 3OUGA 2JIPA 1Y5IA 1QCSA 3IR6A 4GA6A 3QQ7A 3GTQA 5B6CA 4KO8A 1KQGA 2R93A 1PYQA 1Q16A 2NVYA
chains in the Genus database with same CATH superfamily
1E18A 1H0HA 1VC3B 3D30A 2IV2X 4AOKB 2G5DA 3CZBA 3X2IA 3X2MA 4AVRA 1Y1WA 1OA9A 2C45A 5FTMA 4QIWA 1H5NA 3SUMA 3X2JA 1TMOA 2A68D 3X2HA 3PLXB 2A6ED 1AA6A 4KDLA 2R92A 2WB1A 5FTJA 4RV0A 3FKIA 3O5AA 1FDIA 1K83A 2G6GA 2A69D 1QDNA 2KQAA 1WLFA 2JIOA 1TWCA 5DYIA 4ENGA 1PPYA 2EEOB 5T5MD 1TWAA 1CR5A 3QQ8A 2WAQA 3QWZA 1WC2A 3H0GA 3HU3A 1PT1A 5GLYA 4AAYA 5EPPA 1L8FA 1DMSA 1UHDA 4AZDA 3GTKA 2JA5A 3SUKA 1R7RA 2NVXA 1OGYA 3ENGA 2VPXA 1R27A 5GLXA 4KODA 1SFOA 3DMRA 4KLNA 4FG4A 4FG2A 1I3QA 2DMRA 2BH0A 3TIWA 5DYGA 3GTLA 2O5JD 3QC8A 1ZC1A 1SIWA 4AYBA 2CW0D 4JJOA 5GM9A 1E60A 1AW8B 2ENGA 4GA5A 5FTLA 1G8JA 4FFTA 2JA6A 2JA7A 2AE0X 2E7ZA 2B63A 4DMRA 1CZ5A 3X2NA 3GTMA 3TM7B 1TWFA 1R9TA 3X2LA 2PJHB 2PICA 3GTGA 2E2IA 5C18A 2NYAA 3HKZA 3IR5A 4CRZA 2PMZA 4JP6A 2JIMA 2JIQA 3GTOA 5T5ID 2PJJA 2V3VA 4ZM7A 1YLEA 2PNWA 2VPWA 2Y0SA 1TWHA 2R7ZA 4L48A 1BW3A 1E61A 4NOHA 1CZ4A 1WCMA 3HU1A 4AONB 4D7ZB 2NAPA 5GLFA 5C1BA 1EU1A 5FTNA 1Y4ZA 1ZYRD 2A6HD 4JCWA 5FTKA 2YUJA 4JS7A 4JP7A 1HD5A 1PT0A 1OA7A 2V45A 2GAEA 3GTPA 2PI8A 1Y1VA 1G8KA 1YNND 1TWGA 1PQEA 1PYUB 3ML1A 3X2PA 1YNJD 1PQFA 1E5VA 3X2KA 3SULA 3X2GA 2VUMA 4KDIA 4CS0A 1KQFA 4FERA 1I50A 4CRYG 1DMRA 3CF2A 1UHEA 2VPZA 1SMYD 2JIRA 1N10A 2HCZX 4C2MA 1PQHA 2YU9A 1E32A 3X2OA 1S3SA 2KI8A 3HU2A 2VPYA 3IR7A 3CQZA 3SUJA 1FDOA 3GTJA 2E2HA 1IW7D 3OUGA 2JIPA 1Y5IA 1QCSA 3IR6A 4GA6A 3M3GA 3QQ7A 3GTQA 5B6CA 2BE5D 1BW4A 4KO8A 1KQGA 2R93A 5H4UA 1PYQA 1Q16A 2NVYA
chains in the Genus database with same CATH topology
1E18A 1H0HA 1VC3B 2IV2X 4AOKB 2G5DA 3CZBA 1Y1WA 2C45A 5FTMA 4QIWA 1H5NA 1TMOA 2A68D 3PLXB 2A6ED 1AA6A 4KDLA 2R92A 2WB1A 5FTJA 4RV0A 3FKIA 3O5AA 1FDIA 1K83A 2JIOA 2G6GA 1QDNA 2A69D 1WLFA 1TWCA 5DYIA 1PPYA 2EEOB 5T5MD 1TWAA 1CR5A 3QQ8A 2WAQA 3QWZA 3H0GA 3HU3A 1PT1A 4AAYA 5EPPA 1DMSA 1UHDA 4AZDA 3GTKA 2JA5A 1R7RA 2NVXA 1OGYA 2VPXA 1R27A 4KODA 1SFOA 3DMRA 4KLNA 1I3QA 2DMRA 3TIWA 5DYGA 3GTLA 2O5JD 3QC8A 1ZC1A 1SIWA 4AYBA 2CW0D 1E60A 1AW8B 4GA5A 5FTLA 1G8JA 2JA6A 2JA7A 2AE0X 2E7ZA 2B63A 4DMRA 1CZ5A 3GTMA 3TM7B 1TWFA 1R9TA 2PJHB 2PICA 3GTGA 2E2IA 5C18A 2NYAA 3HKZA 3IR5A 4CRZA 2PMZA 2JIMA 2JIQA 3GTOA 5T5ID 2PJJA 2V3VA 1YLEA 2PNWA 2VPWA 2Y0SA 1TWHA 2R7ZA 1E61A 4NOHA 1CZ4A 1WCMA 3HU1A 4AONB 4D7ZB 2NAPA 5GLFA 5C1BA 1EU1A 5FTNA 1Y4ZA 1ZYRD 2A6HD 5FTKA 2YUJA 1PT0A 2V45A 2GAEA 3GTPA 2PI8A 1Y1VA 1G8KA 1YNND 1TWGA 1PQEA 1PYUB 3ML1A 1YNJD 1PQFA 1E5VA 2VUMA 4KDIA 4CS0A 1KQFA 1I50A 4CRYG 1DMRA 3CF2A 1UHEA 2VPZA 1SMYD 2JIRA 4C2MA 1PQHA 2YU9A 1E32A 1S3SA 2KI8A 3HU2A 2VPYA 3IR7A 3CQZA 1FDOA 3GTJA 2E2HA 1IW7D 3OUGA 2JIPA 1Y5IA 1QCSA 3IR6A 4GA6A 3QQ7A 3GTQA 5B6CA 2BE5D 4KO8A 1KQGA 2R93A 1PYQA 1Q16A 2NVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E18 A;  1H0H A;  1VC3 B;  2IV2 X;  4AOK B;  1Y1W A;  2C45 A;  5FTM A;  4QIW A;  1H5N A;  1TMO A;  3PLX B;  1AA6 A;  4KDL A;  2R92 A;  2WB1 A;  5FTJ A;  4RV0 A;  3FKI A;  3O5A A;  1FDI A;  1K83 A;  2JIO A;  1QDN A;  1WLF A;  1TWC A;  5DYI A;  1PPY A;  2EEO B;  5T5M D;  1TWA A;  1CR5 A;  3QQ8 A;  2WAQ A;  3QWZ A;  3H0G A;  3HU3 A;  1PT1 A;  4AAY A;  5EPP A;  1DMS A;  1UHD A;  4AZD A;  3GTK A;  2JA5 A;  1R7R A;  2NVX A;  1OGY A;  2VPX A;  1R27 A;  4KOD A;  1SFO A;  3DMR A;  4KLN A;  1I3Q A;  2DMR A;  3TIW A;  5DYG A;  3GTL A;  3QC8 A;  1SIW A;  4AYB A;  1E60 A;  1AW8 B;  4GA5 A;  5FTL A;  1G8J A;  2JA6 A;  2JA7 A;  2E7Z A;  2B63 A;  4DMR A;  1CZ5 A;  3GTM A;  3TM7 B;  1TWF A;  1R9T A;  2PJH B;  3GTG A;  2E2I A;  5C18 A;  2NYA A;  3HKZ A;  3IR5 A;  4CRZ A;  2PMZ A;  2JIM A;  2JIQ A;  3GTO A;  5T5I D;  2V3V A;  1YLE A;  2Y0S A;  2VPW A;  1TWH A;  2R7Z A;  1E61 A;  1CZ4 A;  1WCM A;  3HU1 A;  4AON B;  4D7Z B;  2NAP A;  5GLF A;  5C1B A;  1EU1 A;  5FTN A;  1Y4Z A;  5FTK A;  1PT0 A;  2V45 A;  3GTP A;  1Y1V A;  1G8K A;  1TWG A;  1PQE A;  1PYU B;  3ML1 A;  1PQF A;  1E5V A;  2VUM A;  4KDI A;  4CS0 A;  1KQF A;  1I50 A;  4CRY G;  1DMR A;  3CF2 A;  1UHE A;  2VPZ A;  2JIR A;  4C2M A;  1PQH A;  2YU9 A;  1E32 A;  1S3S A;  2KI8 A;  3HU2 A;  2VPY A;  3IR7 A;  3CQZ A;  1FDO A;  3GTJ A;  2E2H A;  1IW7 D;  3OUG A;  2JIP A;  1Y5I A;  1QCS A;  3IR6 A;  4GA6 A;  3QQ7 A;  3GTQ A;  5B6C A;  4KO8 A;  1KQG A;  2R93 A;  1PYQ A;  1Q16 A;  2NVY A; 
#chains in the Genus database with same CATH topology
 1E18 A;  1H0H A;  1VC3 B;  3D30 A;  2IV2 X;  4AOK B;  2G5D A;  3CZB A;  3X2I A;  3X2M A;  4AVR A;  1Y1W A;  1OA9 A;  2C45 A;  5FTM A;  4QIW A;  1H5N A;  3SUM A;  3X2J A;  1TMO A;  2A68 D;  3X2H A;  3PLX B;  2A6E D;  1AA6 A;  4KDL A;  2R92 A;  2WB1 A;  5FTJ A;  4RV0 A;  3FKI A;  3O5A A;  1FDI A;  1K83 A;  2G6G A;  2A69 D;  1QDN A;  2KQA A;  1WLF A;  2JIO A;  1TWC A;  5DYI A;  4ENG A;  1PPY A;  2EEO B;  5T5M D;  1TWA A;  1CR5 A;  3QQ8 A;  2WAQ A;  3QWZ A;  1WC2 A;  3H0G A;  3HU3 A;  1PT1 A;  5GLY A;  4AAY A;  5EPP A;  1L8F A;  1DMS A;  1UHD A;  4AZD A;  3GTK A;  2JA5 A;  3SUK A;  1R7R A;  2NVX A;  1OGY A;  3ENG A;  2VPX A;  1R27 A;  5GLX A;  4KOD A;  1SFO A;  3DMR A;  4KLN A;  4FG4 A;  4FG2 A;  1I3Q A;  2DMR A;  2BH0 A;  3TIW A;  5DYG A;  3GTL A;  2O5J D;  3QC8 A;  1ZC1 A;  1SIW A;  4AYB A;  2CW0 D;  4JJO A;  5GM9 A;  1E60 A;  1AW8 B;  2ENG A;  4GA5 A;  5FTL A;  1G8J A;  4FFT A;  2JA6 A;  2JA7 A;  2AE0 X;  2E7Z A;  2B63 A;  4DMR A;  1CZ5 A;  3X2N A;  3GTM A;  3TM7 B;  1TWF A;  1R9T A;  3X2L A;  2PJH B;  2PIC A;  3GTG A;  2E2I A;  5C18 A;  2NYA A;  3HKZ A;  3IR5 A;  4CRZ A;  2PMZ A;  4JP6 A;  2JIM A;  2JIQ A;  3GTO A;  5T5I D;  2PJJ A;  2V3V A;  4ZM7 A;  1YLE A;  2PNW A;  2VPW A;  2Y0S A;  1TWH A;  2R7Z A;  4L48 A;  1BW3 A;  1E61 A;  4NOH A;  1CZ4 A;  1WCM A;  3HU1 A;  4AON B;  4D7Z B;  2NAP A;  5GLF A;  5C1B A;  1EU1 A;  5FTN A;  1Y4Z A;  1ZYR D;  2A6H D;  4JCW A;  5FTK A;  2YUJ A;  4JS7 A;  4JP7 A;  1HD5 A;  1PT0 A;  1OA7 A;  2V45 A;  2GAE A;  3GTP A;  2PI8 A;  1Y1V A;  1G8K A;  1YNN D;  1TWG A;  1PQE A;  1PYU B;  3ML1 A;  3X2P A;  1YNJ D;  1PQF A;  1E5V A;  3X2K A;  3SUL A;  3X2G A;  2VUM A;  4KDI A;  4CS0 A;  1KQF A;  4FER A;  1I50 A;  4CRY G;  1DMR A;  3CF2 A;  1UHE A;  2VPZ A;  1SMY D;  2JIR A;  1N10 A;  2HCZ X;  4C2M A;  1PQH A;  2YU9 A;  1E32 A;  3X2O A;  1S3S A;  2KI8 A;  3HU2 A;  2VPY A;  3IR7 A;  3CQZ A;  3SUJ A;  1FDO A;  3GTJ A;  2E2H A;  1IW7 D;  3OUG A;  2JIP A;  1Y5I A;  1QCS A;  3IR6 A;  4GA6 A;  3M3G A;  3QQ7 A;  3GTQ A;  5B6C A;  2BE5 D;  1BW4 A;  4KO8 A;  1KQG A;  2R93 A;  5H4U A;  1PYQ A;  1Q16 A;  2NVY A; 
#chains in the Genus database with same CATH homology
 1E18 A;  1H0H A;  1VC3 B;  2IV2 X;  4AOK B;  2G5D A;  3CZB A;  1Y1W A;  2C45 A;  5FTM A;  4QIW A;  1H5N A;  1TMO A;  2A68 D;  3PLX B;  2A6E D;  1AA6 A;  4KDL A;  2R92 A;  2WB1 A;  5FTJ A;  4RV0 A;  3FKI A;  3O5A A;  1FDI A;  1K83 A;  2JIO A;  2G6G A;  1QDN A;  2A69 D;  1WLF A;  1TWC A;  5DYI A;  1PPY A;  2EEO B;  5T5M D;  1TWA A;  1CR5 A;  3QQ8 A;  2WAQ A;  3QWZ A;  3H0G A;  3HU3 A;  1PT1 A;  4AAY A;  5EPP A;  1DMS A;  1UHD A;  4AZD A;  3GTK A;  2JA5 A;  1R7R A;  2NVX A;  1OGY A;  2VPX A;  1R27 A;  4KOD A;  1SFO A;  3DMR A;  4KLN A;  1I3Q A;  2DMR A;  3TIW A;  5DYG A;  3GTL A;  2O5J D;  3QC8 A;  1ZC1 A;  1SIW A;  4AYB A;  2CW0 D;  1E60 A;  1AW8 B;  4GA5 A;  5FTL A;  1G8J A;  2JA6 A;  2JA7 A;  2AE0 X;  2E7Z A;  2B63 A;  4DMR A;  1CZ5 A;  3GTM A;  3TM7 B;  1TWF A;  1R9T A;  2PJH B;  2PIC A;  3GTG A;  2E2I A;  5C18 A;  2NYA A;  3HKZ A;  3IR5 A;  4CRZ A;  2PMZ A;  2JIM A;  2JIQ A;  3GTO A;  5T5I D;  2PJJ A;  2V3V A;  1YLE A;  2PNW A;  2VPW A;  2Y0S A;  1TWH A;  2R7Z A;  1E61 A;  4NOH A;  1CZ4 A;  1WCM A;  3HU1 A;  4AON B;  4D7Z B;  2NAP A;  5GLF A;  5C1B A;  1EU1 A;  5FTN A;  1Y4Z A;  1ZYR D;  2A6H D;  5FTK A;  2YUJ A;  1PT0 A;  2V45 A;  2GAE A;  3GTP A;  2PI8 A;  1Y1V A;  1G8K A;  1YNN D;  1TWG A;  1PQE A;  1PYU B;  3ML1 A;  1YNJ D;  1PQF A;  1E5V A;  2VUM A;  4KDI A;  4CS0 A;  1KQF A;  1I50 A;  4CRY G;  1DMR A;  3CF2 A;  1UHE A;  2VPZ A;  1SMY D;  2JIR A;  4C2M A;  1PQH A;  2YU9 A;  1E32 A;  1S3S A;  2KI8 A;  3HU2 A;  2VPY A;  3IR7 A;  3CQZ A;  1FDO A;  3GTJ A;  2E2H A;  1IW7 D;  3OUG A;  2JIP A;  1Y5I A;  1QCS A;  3IR6 A;  4GA6 A;  3QQ7 A;  3GTQ A;  5B6C A;  2BE5 D;  4KO8 A;  1KQG A;  2R93 A;  1PYQ A;  1Q16 A;  2NVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...