4CRYG

Direct visualisation of strain-induced protein post-translational modification
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
101
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSVYAIAAERGSRIISVNGAAAHASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title Direct Visualisation of Strain-Induced Protein Post-Translational Modification
rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 23
structure length 101
sequence length 102
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4cryG00
2WB1A 3HU2A 2E2HA 1PT0A 2R92A 1G8KA 3HU3A 5B6CA 4GA5A 5T5MD 1TMOA 5C1BA 1WLFA 2NYAA 2YU9A 3GTOA 4DMRA 1DMRA 2JIPA 4RV0A 1VC3B 4QIWA 1CR5A 2V3VA 4C2MA 3GTQA 3GTJA 1CZ5A 1Y4ZA 3DMRA 2JIRA 2B63A 1I3QA 1PQEA 3IR6A 2PJHB 3TIWA 3CF2A 2DMRA 2WAQA 4CS0A 3IR7A 2JIOA 5DYIA 2JA7A 2R7ZA 3HU1A 2E2IA 5FTKA 4GA6A 1SFOA 3GTLA 1UHEA 1IW7D 1TWGA 4KDLA 1E5VA 2JA5A 1Y1VA 2NVXA 2EEOB 3QC8A 3TM7B 3GTMA 2JIMA 1TWHA 1PYQA 2IV2X 1H0HA 1OGYA 1Q16A 1AW8B 1KQGA 2VUMA 1SIWA 3OUGA 4KODA 2JIQA 1PQFA 1EU1A 1E18A 2VPYA 1H5NA 3QQ7A 2V45A 3CQZA 1TWAA 2VPWA 2E7ZA 1QDNA 4KDIA 3GTKA 2PMZA 1FDIA 1R27A 1KQFA 5DYGA 2JA6A 3QQ8A 5C18A 1AA6A 1Y5IA 4CRYG 5EPPA 1FDOA 4CRZA 5FTLA 2C45A 4D7ZB 2R93A 4KO8A 5FTMA 1UHDA 1S3SA 2Y0SA 5FTJA 3IR5A 1G8JA 1Y1WA 1I50A 1R7RA 1PT1A 2NAPA 1DMSA 1CZ4A 2KI8A 4AONB 4AAYA 3GTGA 5GLFA 1TWFA 1E32A 1WCMA 1PPYA 2VPZA 3ML1A 4AOKB 4AYBA 3HKZA 1TWCA 1PYUB 3H0GA 5T5ID 4KLNA 1YLEA 3O5AA 5FTNA 1K83A 4AZDA 1E60A 1R9TA 3PLXB 3QWZA 3GTPA 1QCSA 2NVYA 1PQHA 2VPXA 1E61A 3FKIA
chains in the Genus database with same CATH superfamily
2WB1A 2A69D 3HU2A 1SMYD 2E2HA 1PT0A 3SUKA 2R92A 1G8KA 3HU3A 5B6CA 4GA5A 5T5MD 1TMOA 5C1BA 1WLFA 2NYAA 2YU9A 3GTOA 4FG2A 4ZM7A 4DMRA 1DMRA 2G6GA 2PI8A 4JP7A 2A6HD 2JIPA 4RV0A 1VC3B 4QIWA 3X2KA 1CR5A 2V3VA 4C2MA 3GTQA 3GTJA 1CZ5A 1Y4ZA 3DMRA 2JIRA 2B63A 1I3QA 1PQEA 1YNND 3IR6A 4FFTA 2PJHB 3TIWA 1WC2A 2CW0D 2DMRA 3CF2A 1BW3A 2WAQA 4CS0A 5GLYA 3IR7A 2BH0A 2JIOA 5DYIA 4AVRA 5H4UA 2JA7A 3D30A 2R7ZA 3HU1A 2E2IA 5FTKA 4GA6A 1SFOA 3GTLA 1UHEA 1IW7D 1TWGA 2A68D 2ENGA 4KDLA 3X2MA 1E5VA 2JA5A 1Y1VA 2NVXA 2EEOB 2HCZX 3QC8A 3TM7B 1YNJD 3GTMA 2JIMA 1TWHA 5GLXA 1PYQA 2IV2X 1H0HA 1OGYA 1Q16A 1AW8B 1KQGA 2VUMA 1SIWA 3X2JA 3OUGA 4KODA 2O5JD 2JIQA 3X2PA 1PQFA 1EU1A 4L48A 2A6ED 1E18A 2VPYA 2BE5D 1BW4A 1H5NA 3QQ7A 4JP6A 1ZC1A 2V45A 3CQZA 3X2GA 3X2LA 3SUMA 1TWAA 2VPWA 2E7ZA 1QDNA 4KDIA 3GTKA 2PMZA 1FDIA 4JS7A 1R27A 1KQFA 5DYGA 2JA6A 1HD5A 2PNWA 3QQ8A 3SULA 3ENGA 5C18A 1AA6A 1Y5IA 3X2NA 4CRYG 4JCWA 2AE0X 1FDOA 4FERA 4JJOA 5EPPA 1OA7A 2C45A 3X2IA 4CRZA 4D7ZB 5FTLA 2R93A 4KO8A 5FTMA 1UHDA 1S3SA 1OA9A 2Y0SA 5FTJA 3IR5A 1G8JA 1Y1WA 2YUJA 3M3GA 4ENGA 4FG4A 1I50A 2GAEA 1R7RA 1PT1A 3CZBA 2NAPA 1DMSA 1CZ4A 2KI8A 2PJJA 4AONB 4AAYA 3GTGA 5GLFA 2PICA 1TWFA 1E32A 1WCMA 1PPYA 1ZYRD 2VPZA 3ML1A 4AOKB 4AYBA 2G5DA 3HKZA 1TWCA 3X2HA 1PYUB 3H0GA 5T5ID 3SUJA 4KLNA 5GM9A 2KQAA 1N10A 1YLEA 3O5AA 5FTNA 1K83A 4AZDA 3X2OA 1E60A 1R9TA 3PLXB 1L8FA 3QWZA 3GTPA 1QCSA 2NVYA 1PQHA 2VPXA 4NOHA 1E61A 3FKIA
chains in the Genus database with same CATH topology
2WB1A 2A69D 3HU2A 1SMYD 2E2HA 1PT0A 2R92A 1G8KA 3HU3A 5B6CA 4GA5A 5T5MD 1TMOA 5C1BA 1WLFA 2NYAA 2YU9A 3GTOA 4DMRA 1DMRA 2G6GA 2PI8A 2A6HD 2JIPA 4RV0A 1VC3B 4QIWA 1CR5A 2V3VA 4C2MA 3GTQA 3GTJA 1CZ5A 1Y4ZA 3DMRA 2JIRA 2B63A 1I3QA 1PQEA 1YNND 3IR6A 2PJHB 3TIWA 2CW0D 2DMRA 3CF2A 2WAQA 4CS0A 3IR7A 2JIOA 5DYIA 2JA7A 2R7ZA 3HU1A 2E2IA 5FTKA 4GA6A 1SFOA 3GTLA 1UHEA 1IW7D 1TWGA 2A68D 4KDLA 1E5VA 2JA5A 1Y1VA 2NVXA 2EEOB 3QC8A 3TM7B 1YNJD 3GTMA 2JIMA 1TWHA 1PYQA 2IV2X 1H0HA 1OGYA 1Q16A 1AW8B 1KQGA 2VUMA 1SIWA 3OUGA 4KODA 2O5JD 2JIQA 1PQFA 1EU1A 2A6ED 1E18A 2VPYA 2BE5D 1H5NA 3QQ7A 1ZC1A 2V45A 3CQZA 1TWAA 2VPWA 2E7ZA 1QDNA 4KDIA 3GTKA 2PMZA 1FDIA 1R27A 1KQFA 5DYGA 2JA6A 3QQ8A 2PNWA 5C18A 1AA6A 1Y5IA 4CRYG 2AE0X 1FDOA 5EPPA 4CRZA 5FTLA 2C45A 4D7ZB 2R93A 4KO8A 5FTMA 1UHDA 1S3SA 2Y0SA 5FTJA 3IR5A 1G8JA 1Y1WA 2YUJA 1I50A 2GAEA 1R7RA 1PT1A 3CZBA 2NAPA 1DMSA 1CZ4A 2KI8A 2PJJA 4AONB 4AAYA 3GTGA 5GLFA 2PICA 1TWFA 1E32A 1WCMA 1PPYA 1ZYRD 2VPZA 3ML1A 4AOKB 4AYBA 2G5DA 3HKZA 1TWCA 1PYUB 3H0GA 5T5ID 4KLNA 1YLEA 3O5AA 5FTNA 1K83A 4AZDA 1E60A 1R9TA 3PLXB 3QWZA 3GTPA 1QCSA 2NVYA 1PQHA 2VPXA 4NOHA 1E61A 3FKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 A;  3HU2 A;  2E2H A;  1PT0 A;  2R92 A;  1G8K A;  3HU3 A;  5B6C A;  4GA5 A;  5T5M D;  1TMO A;  5C1B A;  1WLF A;  2NYA A;  2YU9 A;  3GTO A;  4DMR A;  1DMR A;  2JIP A;  4RV0 A;  1VC3 B;  4QIW A;  1CR5 A;  2V3V A;  4C2M A;  3GTQ A;  3GTJ A;  1CZ5 A;  1Y4Z A;  3DMR A;  2JIR A;  2B63 A;  1I3Q A;  1PQE A;  3IR6 A;  2PJH B;  3TIW A;  3CF2 A;  2DMR A;  2WAQ A;  4CS0 A;  3IR7 A;  2JIO A;  5DYI A;  2JA7 A;  2R7Z A;  3HU1 A;  2E2I A;  5FTK A;  4GA6 A;  1SFO A;  3GTL A;  1UHE A;  1IW7 D;  1TWG A;  4KDL A;  1E5V A;  2JA5 A;  1Y1V A;  2NVX A;  2EEO B;  3QC8 A;  3TM7 B;  3GTM A;  2JIM A;  1TWH A;  1PYQ A;  2IV2 X;  1H0H A;  1OGY A;  1Q16 A;  1AW8 B;  1KQG A;  2VUM A;  1SIW A;  3OUG A;  4KOD A;  2JIQ A;  1PQF A;  1EU1 A;  1E18 A;  2VPY A;  1H5N A;  3QQ7 A;  2V45 A;  3CQZ A;  1TWA A;  2VPW A;  2E7Z A;  1QDN A;  4KDI A;  3GTK A;  2PMZ A;  1FDI A;  1R27 A;  1KQF A;  5DYG A;  2JA6 A;  3QQ8 A;  5C18 A;  1AA6 A;  1Y5I A;  4CRY G;  5EPP A;  1FDO A;  4CRZ A;  5FTL A;  2C45 A;  4D7Z B;  2R93 A;  4KO8 A;  5FTM A;  1UHD A;  1S3S A;  2Y0S A;  5FTJ A;  3IR5 A;  1G8J A;  1Y1W A;  1I50 A;  1R7R A;  1PT1 A;  2NAP A;  1DMS A;  1CZ4 A;  2KI8 A;  4AON B;  4AAY A;  3GTG A;  5GLF A;  1TWF A;  1E32 A;  1WCM A;  1PPY A;  2VPZ A;  3ML1 A;  4AOK B;  4AYB A;  3HKZ A;  1TWC A;  1PYU B;  3H0G A;  5T5I D;  4KLN A;  1YLE A;  3O5A A;  5FTN A;  1K83 A;  4AZD A;  1E60 A;  1R9T A;  3PLX B;  3QWZ A;  3GTP A;  1QCS A;  2NVY A;  1PQH A;  2VPX A;  1E61 A;  3FKI A; 
#chains in the Genus database with same CATH topology
 2WB1 A;  2A69 D;  3HU2 A;  1SMY D;  2E2H A;  1PT0 A;  3SUK A;  2R92 A;  1G8K A;  3HU3 A;  5B6C A;  4GA5 A;  5T5M D;  1TMO A;  5C1B A;  1WLF A;  2NYA A;  2YU9 A;  3GTO A;  4FG2 A;  4ZM7 A;  4DMR A;  1DMR A;  2G6G A;  2PI8 A;  4JP7 A;  2A6H D;  2JIP A;  4RV0 A;  1VC3 B;  4QIW A;  3X2K A;  1CR5 A;  2V3V A;  4C2M A;  3GTQ A;  3GTJ A;  1CZ5 A;  1Y4Z A;  3DMR A;  2JIR A;  2B63 A;  1I3Q A;  1PQE A;  1YNN D;  3IR6 A;  4FFT A;  2PJH B;  3TIW A;  1WC2 A;  2CW0 D;  2DMR A;  3CF2 A;  1BW3 A;  2WAQ A;  4CS0 A;  5GLY A;  3IR7 A;  2BH0 A;  2JIO A;  5DYI A;  4AVR A;  5H4U A;  2JA7 A;  3D30 A;  2R7Z A;  3HU1 A;  2E2I A;  5FTK A;  4GA6 A;  1SFO A;  3GTL A;  1UHE A;  1IW7 D;  1TWG A;  2A68 D;  2ENG A;  4KDL A;  3X2M A;  1E5V A;  2JA5 A;  1Y1V A;  2NVX A;  2EEO B;  2HCZ X;  3QC8 A;  3TM7 B;  1YNJ D;  3GTM A;  2JIM A;  1TWH A;  5GLX A;  1PYQ A;  2IV2 X;  1H0H A;  1OGY A;  1Q16 A;  1AW8 B;  1KQG A;  2VUM A;  1SIW A;  3X2J A;  3OUG A;  4KOD A;  2O5J D;  2JIQ A;  3X2P A;  1PQF A;  1EU1 A;  4L48 A;  2A6E D;  1E18 A;  2VPY A;  2BE5 D;  1BW4 A;  1H5N A;  3QQ7 A;  4JP6 A;  1ZC1 A;  2V45 A;  3CQZ A;  3X2G A;  3X2L A;  3SUM A;  1TWA A;  2VPW A;  2E7Z A;  1QDN A;  4KDI A;  3GTK A;  2PMZ A;  1FDI A;  4JS7 A;  1R27 A;  1KQF A;  5DYG A;  2JA6 A;  1HD5 A;  2PNW A;  3QQ8 A;  3SUL A;  3ENG A;  5C18 A;  1AA6 A;  1Y5I A;  3X2N A;  4CRY G;  4JCW A;  2AE0 X;  1FDO A;  4FER A;  4JJO A;  5EPP A;  1OA7 A;  2C45 A;  3X2I A;  4CRZ A;  4D7Z B;  5FTL A;  2R93 A;  4KO8 A;  5FTM A;  1UHD A;  1S3S A;  1OA9 A;  2Y0S A;  5FTJ A;  3IR5 A;  1G8J A;  1Y1W A;  2YUJ A;  3M3G A;  4ENG A;  4FG4 A;  1I50 A;  2GAE A;  1R7R A;  1PT1 A;  3CZB A;  2NAP A;  1DMS A;  1CZ4 A;  2KI8 A;  2PJJ A;  4AON B;  4AAY A;  3GTG A;  5GLF A;  2PIC A;  1TWF A;  1E32 A;  1WCM A;  1PPY A;  1ZYR D;  2VPZ A;  3ML1 A;  4AOK B;  4AYB A;  2G5D A;  3HKZ A;  1TWC A;  3X2H A;  1PYU B;  3H0G A;  5T5I D;  3SUJ A;  4KLN A;  5GM9 A;  2KQA A;  1N10 A;  1YLE A;  3O5A A;  5FTN A;  1K83 A;  4AZD A;  3X2O A;  1E60 A;  1R9T A;  3PLX B;  1L8F A;  3QWZ A;  3GTP A;  1QCS A;  2NVY A;  1PQH A;  2VPX A;  4NOH A;  1E61 A;  3FKI A; 
#chains in the Genus database with same CATH homology
 2WB1 A;  2A69 D;  3HU2 A;  1SMY D;  2E2H A;  1PT0 A;  2R92 A;  1G8K A;  3HU3 A;  5B6C A;  4GA5 A;  5T5M D;  1TMO A;  5C1B A;  1WLF A;  2NYA A;  2YU9 A;  3GTO A;  4DMR A;  1DMR A;  2G6G A;  2PI8 A;  2A6H D;  2JIP A;  4RV0 A;  1VC3 B;  4QIW A;  1CR5 A;  2V3V A;  4C2M A;  3GTQ A;  3GTJ A;  1CZ5 A;  1Y4Z A;  3DMR A;  2JIR A;  2B63 A;  1I3Q A;  1PQE A;  1YNN D;  3IR6 A;  2PJH B;  3TIW A;  2CW0 D;  2DMR A;  3CF2 A;  2WAQ A;  4CS0 A;  3IR7 A;  2JIO A;  5DYI A;  2JA7 A;  2R7Z A;  3HU1 A;  2E2I A;  5FTK A;  4GA6 A;  1SFO A;  3GTL A;  1UHE A;  1IW7 D;  1TWG A;  2A68 D;  4KDL A;  1E5V A;  2JA5 A;  1Y1V A;  2NVX A;  2EEO B;  3QC8 A;  3TM7 B;  1YNJ D;  3GTM A;  2JIM A;  1TWH A;  1PYQ A;  2IV2 X;  1H0H A;  1OGY A;  1Q16 A;  1AW8 B;  1KQG A;  2VUM A;  1SIW A;  3OUG A;  4KOD A;  2O5J D;  2JIQ A;  1PQF A;  1EU1 A;  2A6E D;  1E18 A;  2VPY A;  2BE5 D;  1H5N A;  3QQ7 A;  1ZC1 A;  2V45 A;  3CQZ A;  1TWA A;  2VPW A;  2E7Z A;  1QDN A;  4KDI A;  3GTK A;  2PMZ A;  1FDI A;  1R27 A;  1KQF A;  5DYG A;  2JA6 A;  3QQ8 A;  2PNW A;  5C18 A;  1AA6 A;  1Y5I A;  4CRY G;  2AE0 X;  1FDO A;  5EPP A;  4CRZ A;  5FTL A;  2C45 A;  4D7Z B;  2R93 A;  4KO8 A;  5FTM A;  1UHD A;  1S3S A;  2Y0S A;  5FTJ A;  3IR5 A;  1G8J A;  1Y1W A;  2YUJ A;  1I50 A;  2GAE A;  1R7R A;  1PT1 A;  3CZB A;  2NAP A;  1DMS A;  1CZ4 A;  2KI8 A;  2PJJ A;  4AON B;  4AAY A;  3GTG A;  5GLF A;  2PIC A;  1TWF A;  1E32 A;  1WCM A;  1PPY A;  1ZYR D;  2VPZ A;  3ML1 A;  4AOK B;  4AYB A;  2G5D A;  3HKZ A;  1TWC A;  1PYU B;  3H0G A;  5T5I D;  4KLN A;  1YLE A;  3O5A A;  5FTN A;  1K83 A;  4AZD A;  1E60 A;  1R9T A;  3PLX B;  3QWZ A;  3GTP A;  1QCS A;  2NVY A;  1PQH A;  2VPX A;  4NOH A;  1E61 A;  3FKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...