4CRYG

Direct visualisation of strain-induced protein post-translational modification
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
101
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSVYAIAAERGSRIISVNGAAAHASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct Visualisation of Strain-Induced Protein Post-Translational Modification
rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords ASPARTATE 1-DECARBOXYLASE
total genus 23
structure length 101
sequence length 102
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4cryG00
5B6CA 2VPXA 1R7RA 2NVYA 1H5NA 5EPPA 1DMSA 1Y1VA 1R27A 2E2IA 3TM7B 1R9TA 2VPWA 2YU9A 4KDLA 5C18A 1VC3B 1PT0A 1QCSA 1SIWA 1E5VA 4AYBA 1WLFA 1CZ4A 1KQFA 1H0HA 1TWGA 4QIWA 5GLFA 5T5MD 3IR6A 2V3VA 3IR7A 1PQHA 1G8KA 2JIRA 2EEOB 2Y0SA 3HU2A 1AA6A 5DYIA 3QQ8A 2JIMA 5FTLA 1PYUB 5T5ID 2WB1A 1PT1A 4CRYG 2R7ZA 1QDNA 2NVXA 1UHDA 3CQZA 1Y5IA 4GA6A 5FTJA 1TMOA 2JIQA 1AW8B 4C2MA 1I3QA 2NAPA 1IW7D 5FTKA 1DMRA 1TWFA 2JIPA 3GTPA 2VPZA 4CS0A 3GTGA 1OGYA 4AZDA 2JA6A 3O5AA 1PQFA 2B63A 1K83A 3H0GA 2C45A 4KLNA 1TWCA 2JIOA 4DMRA 5FTMA 1E61A 1PQEA 1FDIA 2JA7A 4KODA 1G8JA 3QWZA 1Y1WA 3QC8A 4KO8A 5C1BA 3HU1A 2R92A 2WAQA 4CRZA 4D7ZB 4AAYA 2VUMA 3ML1A 1CZ5A 1KQGA 2KI8A 4KDIA 2PMZA 1PPYA 1PYQA 3HKZA 1E60A 3GTMA 1EU1A 3GTQA 1FDOA 1Q16A 2PJHB 3OUGA 2E2HA 3HU3A 2NYAA 4AOKB 2VPYA 2E7ZA 3FKIA 3TIWA 2DMRA 1TWHA 2R93A 1WCMA 1TWAA 1I50A 1YLEA 1SFOA 3GTKA 1Y4ZA 4GA5A 3DMRA 3CF2A 3QQ7A 3GTLA 1S3SA 4RV0A 3IR5A 5FTNA 1E32A 2IV2X 1UHEA 4AONB 3PLXB 1CR5A 2V45A 3GTJA 5DYGA 1E18A 3GTOA 2JA5A
chains in the Genus database with same CATH superfamily
5B6CA 2VPXA 4JJOA 1R7RA 2NVYA 1H5NA 5EPPA 4L48A 1DMSA 1Y1VA 2PI8A 1R27A 4AVRA 2GAEA 2E2IA 1SMYD 3TM7B 1R9TA 2VPWA 2YU9A 4KDLA 3M3GA 5C18A 1VC3B 1OA7A 1PT0A 1QCSA 1SIWA 1E5VA 4AYBA 1WLFA 4FG4A 1CZ4A 1KQFA 1H0HA 1TWGA 4QIWA 2BE5D 5GLFA 4NOHA 5H4UA 5T5MD 3IR6A 3X2KA 2V3VA 3IR7A 1PQHA 1G8KA 2JIRA 2EEOB 2PNWA 2Y0SA 3ENGA 3HU2A 1AA6A 5DYIA 3QQ8A 2JIMA 5FTLA 1PYUB 5T5ID 2WB1A 1PT1A 2AE0X 3X2IA 3X2HA 4CRYG 2CW0D 2R7ZA 1BW4A 4ZM7A 1YNJD 1QDNA 2NVXA 2A6ED 1UHDA 5GLXA 2PJJA 3CQZA 4ENGA 1Y5IA 4JS7A 4GA6A 5FTJA 1L8FA 3SUJA 2O5JD 1TMOA 3D30A 2YUJA 2JIQA 1AW8B 2A69D 1YNND 1ZYRD 4C2MA 1I3QA 2NAPA 1IW7D 5FTKA 1DMRA 1TWFA 2KQAA 2JIPA 3GTPA 2PICA 3X2MA 2VPZA 3SUKA 1ZC1A 4CS0A 1OGYA 3GTGA 4AZDA 2JA6A 4FERA 3O5AA 2HCZX 1HD5A 1PQFA 4JP6A 2B63A 1N10A 3X2JA 1K83A 3H0GA 2C45A 4KLNA 1TWCA 3X2NA 2JIOA 4DMRA 5FTMA 1E61A 1OA9A 3X2PA 1PQEA 1FDIA 2JA7A 4KODA 1G8JA 3QWZA 1Y1WA 3QC8A 4FG2A 4KO8A 4JP7A 2A68D 5C1BA 3HU1A 2R92A 2WAQA 4CRZA 4D7ZB 5GM9A 4AAYA 2VUMA 3ML1A 3SUMA 1CZ5A 1KQGA 2KI8A 3CZBA 4KDIA 2PMZA 1PPYA 1PYQA 3X2GA 1E60A 3HKZA 3GTMA 3X2LA 1EU1A 3GTQA 1FDOA 2A6HD 1Q16A 2PJHB 3OUGA 4JCWA 2E2HA 3HU3A 2NYAA 4AOKB 2VPYA 5GLYA 2E7ZA 3FKIA 3TIWA 2BH0A 2DMRA 1TWHA 2R93A 1WCMA 1TWAA 1I50A 1YLEA 1SFOA 4FFTA 1Y4ZA 3GTKA 4GA5A 3DMRA 3CF2A 3QQ7A 3GTLA 1S3SA 1WC2A 3IR5A 4RV0A 2G6GA 1E32A 5FTNA 3X2OA 2IV2X 1UHEA 4AONB 3PLXB 1BW3A 2ENGA 3SULA 1CR5A 2V45A 3GTJA 5DYGA 1E18A 3GTOA 2JA5A 2G5DA
chains in the Genus database with same CATH topology
5B6CA 2VPXA 1R7RA 2NVYA 1H5NA 5EPPA 1DMSA 1Y1VA 2PI8A 1R27A 2GAEA 2E2IA 1SMYD 3TM7B 1R9TA 2VPWA 2YU9A 4KDLA 5C18A 1VC3B 1PT0A 1QCSA 1SIWA 1E5VA 4AYBA 1WLFA 1CZ4A 1KQFA 1H0HA 1TWGA 4QIWA 2BE5D 5GLFA 4NOHA 5T5MD 3IR6A 2V3VA 3IR7A 1PQHA 1G8KA 2JIRA 2EEOB 2PNWA 2Y0SA 3HU2A 1AA6A 5DYIA 3QQ8A 2JIMA 5FTLA 1PYUB 5T5ID 2WB1A 1PT1A 2AE0X 4CRYG 2CW0D 2R7ZA 1YNJD 1QDNA 2NVXA 2A6ED 1UHDA 2PJJA 3CQZA 1Y5IA 4GA6A 5FTJA 2O5JD 1TMOA 2YUJA 2JIQA 1AW8B 2A69D 1YNND 1ZYRD 4C2MA 1I3QA 2NAPA 1IW7D 5FTKA 1DMRA 1TWFA 2JIPA 3GTPA 2PICA 2VPZA 1ZC1A 4CS0A 1OGYA 3GTGA 4AZDA 2JA6A 3O5AA 1PQFA 2B63A 1K83A 3H0GA 2C45A 4KLNA 1TWCA 2JIOA 4DMRA 5FTMA 1E61A 1PQEA 1FDIA 2JA7A 4KODA 1G8JA 3QWZA 1Y1WA 3QC8A 4KO8A 2A68D 5C1BA 3HU1A 2R92A 2WAQA 4CRZA 4D7ZB 4AAYA 2VUMA 3ML1A 1CZ5A 1KQGA 2KI8A 3CZBA 4KDIA 2PMZA 1PPYA 1PYQA 1E60A 3HKZA 3GTMA 1EU1A 3GTQA 1FDOA 2A6HD 1Q16A 2PJHB 3OUGA 2E2HA 3HU3A 2NYAA 4AOKB 2VPYA 2E7ZA 3FKIA 3TIWA 2DMRA 1TWHA 2R93A 1WCMA 1TWAA 1I50A 1YLEA 1SFOA 3GTKA 1Y4ZA 4GA5A 3DMRA 3CF2A 3QQ7A 3GTLA 1S3SA 4RV0A 3IR5A 2G6GA 1E32A 5FTNA 2IV2X 1UHEA 4AONB 3PLXB 1CR5A 2V45A 3GTJA 5DYGA 1E18A 3GTOA 2JA5A 2G5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6C A;  2VPX A;  1R7R A;  2NVY A;  1H5N A;  5EPP A;  1DMS A;  1Y1V A;  1R27 A;  2E2I A;  3TM7 B;  1R9T A;  2VPW A;  2YU9 A;  4KDL A;  5C18 A;  1VC3 B;  1PT0 A;  1QCS A;  1SIW A;  1E5V A;  4AYB A;  1WLF A;  1CZ4 A;  1KQF A;  1H0H A;  1TWG A;  4QIW A;  5GLF A;  5T5M D;  3IR6 A;  2V3V A;  3IR7 A;  1PQH A;  1G8K A;  2JIR A;  2EEO B;  2Y0S A;  3HU2 A;  1AA6 A;  5DYI A;  3QQ8 A;  2JIM A;  5FTL A;  1PYU B;  5T5I D;  2WB1 A;  1PT1 A;  4CRY G;  2R7Z A;  1QDN A;  2NVX A;  1UHD A;  3CQZ A;  1Y5I A;  4GA6 A;  5FTJ A;  1TMO A;  2JIQ A;  1AW8 B;  4C2M A;  1I3Q A;  2NAP A;  1IW7 D;  5FTK A;  1DMR A;  1TWF A;  2JIP A;  3GTP A;  2VPZ A;  4CS0 A;  3GTG A;  1OGY A;  4AZD A;  2JA6 A;  3O5A A;  1PQF A;  2B63 A;  1K83 A;  3H0G A;  2C45 A;  4KLN A;  1TWC A;  2JIO A;  4DMR A;  5FTM A;  1E61 A;  1PQE A;  1FDI A;  2JA7 A;  4KOD A;  1G8J A;  3QWZ A;  1Y1W A;  3QC8 A;  4KO8 A;  5C1B A;  3HU1 A;  2R92 A;  2WAQ A;  4CRZ A;  4D7Z B;  4AAY A;  2VUM A;  3ML1 A;  1CZ5 A;  1KQG A;  2KI8 A;  4KDI A;  2PMZ A;  1PPY A;  1PYQ A;  3HKZ A;  1E60 A;  3GTM A;  1EU1 A;  3GTQ A;  1FDO A;  1Q16 A;  2PJH B;  3OUG A;  2E2H A;  3HU3 A;  2NYA A;  4AOK B;  2VPY A;  2E7Z A;  3FKI A;  3TIW A;  2DMR A;  1TWH A;  2R93 A;  1WCM A;  1TWA A;  1I50 A;  1YLE A;  1SFO A;  3GTK A;  1Y4Z A;  4GA5 A;  3DMR A;  3CF2 A;  3QQ7 A;  3GTL A;  1S3S A;  4RV0 A;  3IR5 A;  5FTN A;  1E32 A;  2IV2 X;  1UHE A;  4AON B;  3PLX B;  1CR5 A;  2V45 A;  3GTJ A;  5DYG A;  1E18 A;  3GTO A;  2JA5 A; 
#chains in the Genus database with same CATH topology
 5B6C A;  2VPX A;  4JJO A;  1R7R A;  2NVY A;  1H5N A;  5EPP A;  4L48 A;  1DMS A;  1Y1V A;  2PI8 A;  1R27 A;  4AVR A;  2GAE A;  2E2I A;  1SMY D;  3TM7 B;  1R9T A;  2VPW A;  2YU9 A;  4KDL A;  3M3G A;  5C18 A;  1VC3 B;  1OA7 A;  1PT0 A;  1QCS A;  1SIW A;  1E5V A;  4AYB A;  1WLF A;  4FG4 A;  1CZ4 A;  1KQF A;  1H0H A;  1TWG A;  4QIW A;  2BE5 D;  5GLF A;  4NOH A;  5H4U A;  5T5M D;  3IR6 A;  3X2K A;  2V3V A;  3IR7 A;  1PQH A;  1G8K A;  2JIR A;  2EEO B;  2PNW A;  2Y0S A;  3ENG A;  3HU2 A;  1AA6 A;  5DYI A;  3QQ8 A;  2JIM A;  5FTL A;  1PYU B;  5T5I D;  2WB1 A;  1PT1 A;  2AE0 X;  3X2I A;  3X2H A;  4CRY G;  2CW0 D;  2R7Z A;  1BW4 A;  4ZM7 A;  1YNJ D;  1QDN A;  2NVX A;  2A6E D;  1UHD A;  5GLX A;  2PJJ A;  3CQZ A;  4ENG A;  1Y5I A;  4JS7 A;  4GA6 A;  5FTJ A;  1L8F A;  3SUJ A;  2O5J D;  1TMO A;  3D30 A;  2YUJ A;  2JIQ A;  1AW8 B;  2A69 D;  1YNN D;  1ZYR D;  4C2M A;  1I3Q A;  2NAP A;  1IW7 D;  5FTK A;  1DMR A;  1TWF A;  2KQA A;  2JIP A;  3GTP A;  2PIC A;  3X2M A;  2VPZ A;  3SUK A;  1ZC1 A;  4CS0 A;  1OGY A;  3GTG A;  4AZD A;  2JA6 A;  4FER A;  3O5A A;  2HCZ X;  1HD5 A;  1PQF A;  4JP6 A;  2B63 A;  1N10 A;  3X2J A;  1K83 A;  3H0G A;  2C45 A;  4KLN A;  1TWC A;  3X2N A;  2JIO A;  4DMR A;  5FTM A;  1E61 A;  1OA9 A;  3X2P A;  1PQE A;  1FDI A;  2JA7 A;  4KOD A;  1G8J A;  3QWZ A;  1Y1W A;  3QC8 A;  4FG2 A;  4KO8 A;  4JP7 A;  2A68 D;  5C1B A;  3HU1 A;  2R92 A;  2WAQ A;  4CRZ A;  4D7Z B;  5GM9 A;  4AAY A;  2VUM A;  3ML1 A;  3SUM A;  1CZ5 A;  1KQG A;  2KI8 A;  3CZB A;  4KDI A;  2PMZ A;  1PPY A;  1PYQ A;  3X2G A;  1E60 A;  3HKZ A;  3GTM A;  3X2L A;  1EU1 A;  3GTQ A;  1FDO A;  2A6H D;  1Q16 A;  2PJH B;  3OUG A;  4JCW A;  2E2H A;  3HU3 A;  2NYA A;  4AOK B;  2VPY A;  5GLY A;  2E7Z A;  3FKI A;  3TIW A;  2BH0 A;  2DMR A;  1TWH A;  2R93 A;  1WCM A;  1TWA A;  1I50 A;  1YLE A;  1SFO A;  4FFT A;  1Y4Z A;  3GTK A;  4GA5 A;  3DMR A;  3CF2 A;  3QQ7 A;  3GTL A;  1S3S A;  1WC2 A;  3IR5 A;  4RV0 A;  2G6G A;  1E32 A;  5FTN A;  3X2O A;  2IV2 X;  1UHE A;  4AON B;  3PLX B;  1BW3 A;  2ENG A;  3SUL A;  1CR5 A;  2V45 A;  3GTJ A;  5DYG A;  1E18 A;  3GTO A;  2JA5 A;  2G5D A; 
#chains in the Genus database with same CATH homology
 5B6C A;  2VPX A;  1R7R A;  2NVY A;  1H5N A;  5EPP A;  1DMS A;  1Y1V A;  2PI8 A;  1R27 A;  2GAE A;  2E2I A;  1SMY D;  3TM7 B;  1R9T A;  2VPW A;  2YU9 A;  4KDL A;  5C18 A;  1VC3 B;  1PT0 A;  1QCS A;  1SIW A;  1E5V A;  4AYB A;  1WLF A;  1CZ4 A;  1KQF A;  1H0H A;  1TWG A;  4QIW A;  2BE5 D;  5GLF A;  4NOH A;  5T5M D;  3IR6 A;  2V3V A;  3IR7 A;  1PQH A;  1G8K A;  2JIR A;  2EEO B;  2PNW A;  2Y0S A;  3HU2 A;  1AA6 A;  5DYI A;  3QQ8 A;  2JIM A;  5FTL A;  1PYU B;  5T5I D;  2WB1 A;  1PT1 A;  2AE0 X;  4CRY G;  2CW0 D;  2R7Z A;  1YNJ D;  1QDN A;  2NVX A;  2A6E D;  1UHD A;  2PJJ A;  3CQZ A;  1Y5I A;  4GA6 A;  5FTJ A;  2O5J D;  1TMO A;  2YUJ A;  2JIQ A;  1AW8 B;  2A69 D;  1YNN D;  1ZYR D;  4C2M A;  1I3Q A;  2NAP A;  1IW7 D;  5FTK A;  1DMR A;  1TWF A;  2JIP A;  3GTP A;  2PIC A;  2VPZ A;  1ZC1 A;  4CS0 A;  1OGY A;  3GTG A;  4AZD A;  2JA6 A;  3O5A A;  1PQF A;  2B63 A;  1K83 A;  3H0G A;  2C45 A;  4KLN A;  1TWC A;  2JIO A;  4DMR A;  5FTM A;  1E61 A;  1PQE A;  1FDI A;  2JA7 A;  4KOD A;  1G8J A;  3QWZ A;  1Y1W A;  3QC8 A;  4KO8 A;  2A68 D;  5C1B A;  3HU1 A;  2R92 A;  2WAQ A;  4CRZ A;  4D7Z B;  4AAY A;  2VUM A;  3ML1 A;  1CZ5 A;  1KQG A;  2KI8 A;  3CZB A;  4KDI A;  2PMZ A;  1PPY A;  1PYQ A;  1E60 A;  3HKZ A;  3GTM A;  1EU1 A;  3GTQ A;  1FDO A;  2A6H D;  1Q16 A;  2PJH B;  3OUG A;  2E2H A;  3HU3 A;  2NYA A;  4AOK B;  2VPY A;  2E7Z A;  3FKI A;  3TIW A;  2DMR A;  1TWH A;  2R93 A;  1WCM A;  1TWA A;  1I50 A;  1YLE A;  1SFO A;  3GTK A;  1Y4Z A;  4GA5 A;  3DMR A;  3CF2 A;  3QQ7 A;  3GTL A;  1S3S A;  4RV0 A;  3IR5 A;  2G6G A;  1E32 A;  5FTN A;  2IV2 X;  1UHE A;  4AON B;  3PLX B;  1CR5 A;  2V45 A;  3GTJ A;  5DYG A;  1E18 A;  3GTO A;  2JA5 A;  2G5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...