4CRYG

Direct visualisation of strain-induced protein post-translational modification
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
101
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSVYAIAAERGSRIISVNGAAAHASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title Direct Visualisation of Strain-Induced Protein Post-Translational Modification
rcsb
source organism Escherichia coli k-12
total genus 23
structure length 101
sequence length 102
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4cryG00
2VUMA 1PYUB 3FKIA 3IR7A 1TWGA 5GLFA 1PPYA 2V45A 4AONB 3H0GA 1PT1A 4CRZA 3GTKA 2WB1A 4KLNA 2C45A 4C2MA 1AA6A 3TIWA 4CRYG 2IV2X 1QCSA 3QQ7A 4AAYA 3PLXB 5FTMA 1I50A 1E60A 4AOKB 5DYIA 1CZ4A 5FTKA 1Y5IA 3QQ8A 2DMRA 4AZDA 1Y1VA 4DMRA 5FTLA 4CS0A 1DMRA 1Q16A 2NAPA 2JIMA 1S3SA 2VPWA 1FDOA 2NYAA 3GTLA 1FDIA 4QIWA 3HKZA 3QC8A 2JA6A 3ML1A 1TMOA 2YU9A 1TWFA 5T5MD 2KI8A 3HU2A 1H5NA 5B6CA 5EPPA 1CR5A 4GA5A 2B63A 1PQFA 4AYBA 4D7ZB 1YLEA 5C1BA 1R27A 2JIQA 1QDNA 2R7ZA 2JA5A 2EEOB 4KDIA 1TWAA 1G8JA 2PJHB 1E5VA 1G8KA 2E2HA 2NVXA 1SFOA 3CF2A 1PT0A 5DYGA 3GTPA 1SIWA 2WAQA 1AW8B 1PYQA 2R92A 1E61A 2VPZA 3GTQA 3HU1A 2V3VA 1WLFA 2E7ZA 3HU3A 1OGYA 1R7RA 3IR6A 2R93A 5T5ID 2Y0SA 1R9TA 1EU1A 5FTNA 2JA7A 1TWCA 3QWZA 2VPYA 3DMRA 1WCMA 1VC3B 2JIRA 3IR5A 1DMSA 5C18A 2VPXA 4GA6A 1UHEA 4KDLA 1E18A 1H0HA 1IW7D 1KQGA 1Y1WA 3GTJA 3O5AA 1PQEA 4RV0A 1I3QA 3GTMA 2NVYA 2JIOA 3GTOA 2E2IA 1Y4ZA 3GTGA 3TM7B 4KO8A 1K83A 1TWHA 4KODA 1KQFA 2PMZA 1CZ5A 1PQHA 5FTJA 1UHDA 2JIPA 3OUGA 1E32A 3CQZA
chains in the Genus database with same CATH superfamily
1OA7A 2VUMA 1PYUB 4FG2A 3FKIA 3IR7A 3X2HA 1TWGA 5GLFA 1PPYA 2V45A 2BE5D 5GM9A 2GAEA 2PJJA 4AONB 1N10A 1PT1A 3H0GA 4CRZA 3GTKA 2WB1A 4KLNA 1AA6A 2C45A 2A69D 4C2MA 3TIWA 4JJOA 2IV2X 4CRYG 4ENGA 2BH0A 1QCSA 3QQ7A 4AAYA 4ZM7A 3PLXB 3X2NA 5FTMA 1I50A 4JP7A 1E60A 4AOKB 5DYIA 1CZ4A 1SMYD 5FTKA 1Y5IA 3QQ8A 2DMRA 4AZDA 1Y1VA 4DMRA 2PI8A 5FTLA 4CS0A 1DMRA 1Q16A 2NAPA 2JIMA 2A68D 1S3SA 2VPWA 1FDOA 1L8FA 2NYAA 3GTLA 1FDIA 4JP6A 3X2PA 4QIWA 3HKZA 3QC8A 4L48A 2JA6A 3ML1A 1TMOA 3D30A 2G5DA 2YU9A 1TWFA 5T5MD 2KI8A 2HCZX 3HU2A 1H5NA 5B6CA 5EPPA 5H4UA 1HD5A 4JS7A 1CR5A 4GA5A 2B63A 1OA9A 1PQFA 3X2JA 4AYBA 4D7ZB 3X2IA 1YLEA 1WC2A 5C1BA 3SUJA 1R27A 2JIQA 1QDNA 1YNJD 3ENGA 2EEOB 2R7ZA 2JA5A 4KDIA 1TWAA 1G8JA 2PJHB 1E5VA 1G8KA 2A6ED 3CQZA 2E2HA 4FFTA 2NVXA 4FG4A 1SFOA 2PICA 1PT0A 3CF2A 5DYGA 1SIWA 2WAQA 3GTPA 1AW8B 1PYQA 2KQAA 2R92A 4AVRA 1E61A 2VPZA 3GTQA 3HU1A 2V3VA 5GLXA 1WLFA 2E7ZA 3HU3A 2O5JD 3X2KA 1OGYA 1BW4A 3SUKA 1R7RA 3SULA 3IR6A 2R93A 5T5ID 2Y0SA 1R9TA 1EU1A 2YUJA 5FTNA 2JA7A 1TWCA 3QWZA 2VPYA 3DMRA 1WCMA 1VC3B 2JIRA 3IR5A 2CW0D 1DMSA 1ZYRD 1ZC1A 2PNWA 5C18A 2AE0X 2VPXA 4GA6A 1UHEA 3X2GA 3CZBA 4JCWA 4KDLA 2A6HD 3SUMA 1H0HA 1IW7D 1KQGA 1Y1WA 3GTJA 3O5AA 1PQEA 4RV0A 1I3QA 3GTMA 2NVYA 2JIOA 3GTOA 2E2IA 1Y4ZA 3GTGA 3TM7B 4KO8A 1K83A 1TWHA 2ENGA 4FERA 1YNND 3X2OA 2G6GA 1BW3A 4KODA 3X2LA 1KQFA 2PMZA 5GLYA 1CZ5A 1PQHA 5FTJA 1UHDA 3X2MA 2JIPA 3M3GA 4NOHA 3OUGA 1E32A 1E18A
chains in the Genus database with same CATH topology
2VUMA 1PYUB 3FKIA 3IR7A 1TWGA 5GLFA 1PPYA 2V45A 2BE5D 2GAEA 2PJJA 4AONB 3H0GA 1PT1A 4CRZA 3GTKA 2WB1A 4KLNA 2C45A 2A69D 4C2MA 3TIWA 4CRYG 2IV2X 1AA6A 1QCSA 3QQ7A 4AAYA 3PLXB 5FTMA 1I50A 1E60A 4AOKB 5DYIA 1CZ4A 1SMYD 5FTKA 1Y5IA 3QQ8A 2DMRA 4AZDA 1Y1VA 4DMRA 2PI8A 5FTLA 4CS0A 1DMRA 1Q16A 2NAPA 2JIMA 2A68D 1S3SA 2VPWA 1FDOA 2NYAA 3GTLA 1FDIA 4QIWA 3HKZA 3QC8A 2JA6A 3ML1A 1TMOA 2G5DA 2YU9A 1TWFA 5T5MD 2KI8A 3HU2A 1H5NA 5B6CA 5EPPA 1CR5A 4GA5A 2B63A 1PQFA 4AYBA 4D7ZB 1YLEA 5C1BA 1R27A 2JIQA 1QDNA 1YNJD 2R7ZA 2EEOB 2JA5A 4KDIA 1TWAA 1G8JA 2PJHB 1E5VA 1G8KA 2A6ED 3CQZA 2E2HA 2NVXA 1SFOA 3CF2A 1PT0A 5DYGA 3GTPA 1SIWA 2WAQA 1AW8B 1PYQA 2R92A 1E61A 2VPZA 3GTQA 3HU1A 2V3VA 1WLFA 2E7ZA 3HU3A 2O5JD 1OGYA 1R7RA 3IR6A 2R93A 5T5ID 2Y0SA 1R9TA 1EU1A 2YUJA 5FTNA 2JA7A 1TWCA 3QWZA 2VPYA 3DMRA 1WCMA 1VC3B 2JIRA 3IR5A 2CW0D 1DMSA 1ZYRD 1ZC1A 2PNWA 5C18A 2AE0X 2VPXA 4GA6A 1UHEA 3CZBA 4KDLA 1E18A 2A6HD 1H0HA 1IW7D 1KQGA 1Y1WA 3GTJA 3O5AA 1PQEA 4RV0A 1I3QA 3GTMA 2NVYA 2JIOA 3GTOA 2E2IA 1Y4ZA 3GTGA 3TM7B 4KO8A 1K83A 1TWHA 1YNND 2G6GA 4KODA 1KQFA 2PMZA 1CZ5A 1PQHA 5FTJA 1UHDA 2JIPA 4NOHA 3OUGA 1E32A 2PICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM A;  1PYU B;  3FKI A;  3IR7 A;  1TWG A;  5GLF A;  1PPY A;  2V45 A;  4AON B;  3H0G A;  1PT1 A;  4CRZ A;  3GTK A;  2WB1 A;  4KLN A;  2C45 A;  4C2M A;  1AA6 A;  3TIW A;  4CRY G;  2IV2 X;  1QCS A;  3QQ7 A;  4AAY A;  3PLX B;  5FTM A;  1I50 A;  1E60 A;  4AOK B;  5DYI A;  1CZ4 A;  5FTK A;  1Y5I A;  3QQ8 A;  2DMR A;  4AZD A;  1Y1V A;  4DMR A;  5FTL A;  4CS0 A;  1DMR A;  1Q16 A;  2NAP A;  2JIM A;  1S3S A;  2VPW A;  1FDO A;  2NYA A;  3GTL A;  1FDI A;  4QIW A;  3HKZ A;  3QC8 A;  2JA6 A;  3ML1 A;  1TMO A;  2YU9 A;  1TWF A;  5T5M D;  2KI8 A;  3HU2 A;  1H5N A;  5B6C A;  5EPP A;  1CR5 A;  4GA5 A;  2B63 A;  1PQF A;  4AYB A;  4D7Z B;  1YLE A;  5C1B A;  1R27 A;  2JIQ A;  1QDN A;  2R7Z A;  2JA5 A;  2EEO B;  4KDI A;  1TWA A;  1G8J A;  2PJH B;  1E5V A;  1G8K A;  2E2H A;  2NVX A;  1SFO A;  3CF2 A;  1PT0 A;  5DYG A;  3GTP A;  1SIW A;  2WAQ A;  1AW8 B;  1PYQ A;  2R92 A;  1E61 A;  2VPZ A;  3GTQ A;  3HU1 A;  2V3V A;  1WLF A;  2E7Z A;  3HU3 A;  1OGY A;  1R7R A;  3IR6 A;  2R93 A;  5T5I D;  2Y0S A;  1R9T A;  1EU1 A;  5FTN A;  2JA7 A;  1TWC A;  3QWZ A;  2VPY A;  3DMR A;  1WCM A;  1VC3 B;  2JIR A;  3IR5 A;  1DMS A;  5C18 A;  2VPX A;  4GA6 A;  1UHE A;  4KDL A;  1E18 A;  1H0H A;  1IW7 D;  1KQG A;  1Y1W A;  3GTJ A;  3O5A A;  1PQE A;  4RV0 A;  1I3Q A;  3GTM A;  2NVY A;  2JIO A;  3GTO A;  2E2I A;  1Y4Z A;  3GTG A;  3TM7 B;  4KO8 A;  1K83 A;  1TWH A;  4KOD A;  1KQF A;  2PMZ A;  1CZ5 A;  1PQH A;  5FTJ A;  1UHD A;  2JIP A;  3OUG A;  1E32 A;  3CQZ A; 
#chains in the Genus database with same CATH topology
 1OA7 A;  2VUM A;  1PYU B;  4FG2 A;  3FKI A;  3IR7 A;  3X2H A;  1TWG A;  5GLF A;  1PPY A;  2V45 A;  2BE5 D;  5GM9 A;  2GAE A;  2PJJ A;  4AON B;  1N10 A;  1PT1 A;  3H0G A;  4CRZ A;  3GTK A;  2WB1 A;  4KLN A;  1AA6 A;  2C45 A;  2A69 D;  4C2M A;  3TIW A;  4JJO A;  2IV2 X;  4CRY G;  4ENG A;  2BH0 A;  1QCS A;  3QQ7 A;  4AAY A;  4ZM7 A;  3PLX B;  3X2N A;  5FTM A;  1I50 A;  4JP7 A;  1E60 A;  4AOK B;  5DYI A;  1CZ4 A;  1SMY D;  5FTK A;  1Y5I A;  3QQ8 A;  2DMR A;  4AZD A;  1Y1V A;  4DMR A;  2PI8 A;  5FTL A;  4CS0 A;  1DMR A;  1Q16 A;  2NAP A;  2JIM A;  2A68 D;  1S3S A;  2VPW A;  1FDO A;  1L8F A;  2NYA A;  3GTL A;  1FDI A;  4JP6 A;  3X2P A;  4QIW A;  3HKZ A;  3QC8 A;  4L48 A;  2JA6 A;  3ML1 A;  1TMO A;  3D30 A;  2G5D A;  2YU9 A;  1TWF A;  5T5M D;  2KI8 A;  2HCZ X;  3HU2 A;  1H5N A;  5B6C A;  5EPP A;  5H4U A;  1HD5 A;  4JS7 A;  1CR5 A;  4GA5 A;  2B63 A;  1OA9 A;  1PQF A;  3X2J A;  4AYB A;  4D7Z B;  3X2I A;  1YLE A;  1WC2 A;  5C1B A;  3SUJ A;  1R27 A;  2JIQ A;  1QDN A;  1YNJ D;  3ENG A;  2EEO B;  2R7Z A;  2JA5 A;  4KDI A;  1TWA A;  1G8J A;  2PJH B;  1E5V A;  1G8K A;  2A6E D;  3CQZ A;  2E2H A;  4FFT A;  2NVX A;  4FG4 A;  1SFO A;  2PIC A;  1PT0 A;  3CF2 A;  5DYG A;  1SIW A;  2WAQ A;  3GTP A;  1AW8 B;  1PYQ A;  2KQA A;  2R92 A;  4AVR A;  1E61 A;  2VPZ A;  3GTQ A;  3HU1 A;  2V3V A;  5GLX A;  1WLF A;  2E7Z A;  3HU3 A;  2O5J D;  3X2K A;  1OGY A;  1BW4 A;  3SUK A;  1R7R A;  3SUL A;  3IR6 A;  2R93 A;  5T5I D;  2Y0S A;  1R9T A;  1EU1 A;  2YUJ A;  5FTN A;  2JA7 A;  1TWC A;  3QWZ A;  2VPY A;  3DMR A;  1WCM A;  1VC3 B;  2JIR A;  3IR5 A;  2CW0 D;  1DMS A;  1ZYR D;  1ZC1 A;  2PNW A;  5C18 A;  2AE0 X;  2VPX A;  4GA6 A;  1UHE A;  3X2G A;  3CZB A;  4JCW A;  4KDL A;  2A6H D;  3SUM A;  1H0H A;  1IW7 D;  1KQG A;  1Y1W A;  3GTJ A;  3O5A A;  1PQE A;  4RV0 A;  1I3Q A;  3GTM A;  2NVY A;  2JIO A;  3GTO A;  2E2I A;  1Y4Z A;  3GTG A;  3TM7 B;  4KO8 A;  1K83 A;  1TWH A;  2ENG A;  4FER A;  1YNN D;  3X2O A;  2G6G A;  1BW3 A;  4KOD A;  3X2L A;  1KQF A;  2PMZ A;  5GLY A;  1CZ5 A;  1PQH A;  5FTJ A;  1UHD A;  3X2M A;  2JIP A;  3M3G A;  4NOH A;  3OUG A;  1E32 A;  1E18 A; 
#chains in the Genus database with same CATH homology
 2VUM A;  1PYU B;  3FKI A;  3IR7 A;  1TWG A;  5GLF A;  1PPY A;  2V45 A;  2BE5 D;  2GAE A;  2PJJ A;  4AON B;  3H0G A;  1PT1 A;  4CRZ A;  3GTK A;  2WB1 A;  4KLN A;  2C45 A;  2A69 D;  4C2M A;  3TIW A;  4CRY G;  2IV2 X;  1AA6 A;  1QCS A;  3QQ7 A;  4AAY A;  3PLX B;  5FTM A;  1I50 A;  1E60 A;  4AOK B;  5DYI A;  1CZ4 A;  1SMY D;  5FTK A;  1Y5I A;  3QQ8 A;  2DMR A;  4AZD A;  1Y1V A;  4DMR A;  2PI8 A;  5FTL A;  4CS0 A;  1DMR A;  1Q16 A;  2NAP A;  2JIM A;  2A68 D;  1S3S A;  2VPW A;  1FDO A;  2NYA A;  3GTL A;  1FDI A;  4QIW A;  3HKZ A;  3QC8 A;  2JA6 A;  3ML1 A;  1TMO A;  2G5D A;  2YU9 A;  1TWF A;  5T5M D;  2KI8 A;  3HU2 A;  1H5N A;  5B6C A;  5EPP A;  1CR5 A;  4GA5 A;  2B63 A;  1PQF A;  4AYB A;  4D7Z B;  1YLE A;  5C1B A;  1R27 A;  2JIQ A;  1QDN A;  1YNJ D;  2R7Z A;  2EEO B;  2JA5 A;  4KDI A;  1TWA A;  1G8J A;  2PJH B;  1E5V A;  1G8K A;  2A6E D;  3CQZ A;  2E2H A;  2NVX A;  1SFO A;  3CF2 A;  1PT0 A;  5DYG A;  3GTP A;  1SIW A;  2WAQ A;  1AW8 B;  1PYQ A;  2R92 A;  1E61 A;  2VPZ A;  3GTQ A;  3HU1 A;  2V3V A;  1WLF A;  2E7Z A;  3HU3 A;  2O5J D;  1OGY A;  1R7R A;  3IR6 A;  2R93 A;  5T5I D;  2Y0S A;  1R9T A;  1EU1 A;  2YUJ A;  5FTN A;  2JA7 A;  1TWC A;  3QWZ A;  2VPY A;  3DMR A;  1WCM A;  1VC3 B;  2JIR A;  3IR5 A;  2CW0 D;  1DMS A;  1ZYR D;  1ZC1 A;  2PNW A;  5C18 A;  2AE0 X;  2VPX A;  4GA6 A;  1UHE A;  3CZB A;  4KDL A;  1E18 A;  2A6H D;  1H0H A;  1IW7 D;  1KQG A;  1Y1W A;  3GTJ A;  3O5A A;  1PQE A;  4RV0 A;  1I3Q A;  3GTM A;  2NVY A;  2JIO A;  3GTO A;  2E2I A;  1Y4Z A;  3GTG A;  3TM7 B;  4KO8 A;  1K83 A;  1TWH A;  1YNN D;  2G6G A;  4KOD A;  1KQF A;  2PMZ A;  1CZ5 A;  1PQH A;  5FTJ A;  1UHD A;  2JIP A;  4NOH A;  3OUG A;  1E32 A;  2PIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...