4CRYG

Direct visualisation of strain-induced protein post-translational modification
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
101
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSVYAIAAERGSRIISVNGAAAHASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct Visualisation of Strain-Induced Protein Post-Translational Modification
rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords ASPARTATE 1-DECARBOXYLASE
total genus 23
structure length 101
sequence length 102
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2014-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4cryG00
2DMRA 1PYQA 2JIPA 4AONB 5FTLA 1PPYA 1UHEA 4KODA 1SFOA 2NAPA 2R92A 4KO8A 1Y4ZA 1TWAA 5B6CA 2PMZA 1FDIA 5DYIA 2JIMA 1AA6A 3HKZA 3GTPA 1KQGA 2KI8A 3FKIA 3HU2A 1I3QA 5FTMA 3GTOA 4KLNA 4AYBA 1TMOA 2C45A 1Q16A 2NYAA 3GTQA 1WCMA 1UHDA 2Y0SA 5T5MD 5EPPA 1Y1WA 1AW8B 3HU1A 3ML1A 4AAYA 1SIWA 1FDOA 2EEOB 3QC8A 1CZ4A 2VUMA 4KDLA 1QCSA 3CQZA 3O5AA 5FTKA 5FTJA 1E5VA 1H0HA 3IR5A 3QQ8A 1TWGA 1VC3B 2E7ZA 3GTGA 5FTNA 1E60A 2VPYA 5C1BA 1E18A 1PQHA 2V45A 3GTJA 3CF2A 4GA5A 1R27A 3DMRA 1TWCA 4KDIA 1CZ5A 4GA6A 2NVXA 1PT1A 1WLFA 2B63A 3IR7A 1PT0A 1E32A 4CS0A 2NVYA 1H5NA 4QIWA 1R7RA 2IV2X 1K83A 1Y1VA 4AZDA 1Y5IA 2JIOA 3H0GA 4CRZA 2E2HA 1CR5A 3TM7B 2E2IA 3IR6A 2JA7A 2JIRA 4DMRA 2R7ZA 3PLXB 1E61A 1DMRA 5DYGA 3QQ7A 5GLFA 1S3SA 1R9TA 3GTLA 5T5ID 1EU1A 1OGYA 3GTMA 1PQEA 1IW7D 1G8JA 1G8KA 3GTKA 1PYUB 1KQFA 1TWHA 4AOKB 2WAQA 1I50A 3OUGA 2V3VA 2JA5A 5C18A 2VPXA 1QDNA 2VPWA 3QWZA 1YLEA 3HU3A 4C2MA 4CRYG 2WB1A 2R93A 2YU9A 2JIQA 2JA6A 2PJHB 2VPZA 1TWFA 4D7ZB 4RV0A 3TIWA 1PQFA 1DMSA
chains in the Genus database with same CATH superfamily
2DMRA 1HD5A 1PYQA 2JIPA 2YUJA 4AONB 1PPYA 5FTLA 3X2GA 1UHEA 3X2LA 4KODA 1SFOA 2NAPA 3CZBA 3D30A 2PJJA 2R92A 4KO8A 4FG4A 1Y4ZA 5GLXA 1TWAA 3X2OA 5B6CA 2PMZA 1FDIA 5DYIA 2JIMA 1AA6A 3HKZA 2ENGA 3GTPA 1KQGA 2KI8A 3FKIA 3HU2A 4FERA 1OA9A 1I3QA 2PI8A 5FTMA 3X2NA 3GTOA 1BW4A 4KLNA 4AYBA 4NOHA 1TMOA 2C45A 1Q16A 2NYAA 3GTQA 1WCMA 1UHDA 2AE0X 2Y0SA 1OA7A 5T5MD 5EPPA 1Y1WA 1AW8B 3HU1A 3ML1A 4AAYA 1SIWA 1FDOA 3X2HA 2EEOB 3QC8A 4JP6A 1CZ4A 2VUMA 4FG2A 4KDLA 4ZM7A 1QCSA 3CQZA 2G6GA 3O5AA 5FTKA 1YNND 3X2KA 5FTJA 1E5VA 3SUKA 1H0HA 3IR5A 3QQ8A 4JCWA 1TWGA 1VC3B 2E7ZA 3GTGA 1BW3A 1YNJD 5FTNA 1E60A 2VPYA 5C1BA 1E18A 1PQHA 2V45A 3GTJA 3CF2A 3SUJA 4GA5A 2HCZX 1TWCA 1R27A 3DMRA 4KDIA 3X2MA 1CZ5A 4GA6A 1WC2A 2NVXA 1PT1A 1WLFA 2B63A 2A69D 1PT0A 2A6HD 1E32A 3IR7A 4CS0A 2GAEA 2NVYA 1H5NA 4QIWA 2O5JD 3M3GA 1R7RA 2KQAA 2IV2X 1K83A 1Y1VA 4AZDA 1Y5IA 2JIOA 3H0GA 2BH0A 4CRZA 2E2HA 2PICA 1CR5A 5GLYA 3TM7B 3X2IA 2E2IA 3IR6A 3X2PA 2JA7A 2BE5D 2JIRA 4DMRA 4FFTA 2A6ED 2R7ZA 3PLXB 1E61A 1DMRA 3SULA 1N10A 5DYGA 4JS7A 2G5DA 3QQ7A 1L8FA 5GLFA 1SMYD 1S3SA 1R9TA 3GTLA 5T5ID 1EU1A 4L48A 1OGYA 3ENGA 2CW0D 3GTMA 1PQEA 1IW7D 1G8JA 1ZYRD 1G8KA 3GTKA 1PYUB 3SUMA 5H4UA 4AVRA 1KQFA 1TWHA 4AOKB 2WAQA 4JJOA 1I50A 2A68D 3OUGA 2V3VA 2JA5A 5C18A 2VPXA 4JP7A 1QDNA 1ZC1A 2VPWA 3X2JA 3QWZA 1YLEA 3HU3A 4C2MA 4CRYG 2WB1A 5GM9A 2R93A 2YU9A 2JIQA 2JA6A 2PJHB 2VPZA 1TWFA 4D7ZB 2PNWA 4RV0A 3TIWA 4ENGA 1PQFA 1DMSA
chains in the Genus database with same CATH topology
2DMRA 1PYQA 2JIPA 2YUJA 4AONB 1PPYA 5FTLA 1UHEA 4KODA 1SFOA 2NAPA 3CZBA 2PJJA 2R92A 4KO8A 1Y4ZA 1TWAA 5B6CA 2PMZA 1FDIA 5DYIA 2JIMA 1AA6A 3HKZA 3GTPA 1KQGA 2KI8A 3FKIA 3HU2A 1I3QA 2PI8A 5FTMA 3GTOA 4KLNA 4AYBA 4NOHA 1TMOA 2C45A 1Q16A 2NYAA 3GTQA 1WCMA 1UHDA 2AE0X 2Y0SA 5T5MD 5EPPA 1Y1WA 1AW8B 3HU1A 3ML1A 4AAYA 1SIWA 1FDOA 2EEOB 3QC8A 1CZ4A 2VUMA 4KDLA 1QCSA 3CQZA 2G6GA 3O5AA 5FTKA 1YNND 5FTJA 1E5VA 1H0HA 3IR5A 3QQ8A 1TWGA 1VC3B 2E7ZA 3GTGA 1YNJD 5FTNA 1E60A 2VPYA 5C1BA 1E18A 1PQHA 2V45A 3GTJA 3CF2A 4GA5A 1R27A 1TWCA 3DMRA 4KDIA 1CZ5A 4GA6A 2NVXA 1PT1A 1WLFA 2B63A 2A69D 1PT0A 2A6HD 1E32A 3IR7A 4CS0A 2GAEA 2NVYA 1H5NA 4QIWA 2O5JD 1R7RA 2IV2X 1K83A 1Y1VA 4AZDA 1Y5IA 2JIOA 3H0GA 4CRZA 2E2HA 2PICA 1CR5A 3TM7B 2E2IA 3IR6A 2JA7A 2BE5D 2JIRA 4DMRA 2R7ZA 2A6ED 3PLXB 1E61A 1DMRA 5DYGA 2G5DA 3QQ7A 5GLFA 1SMYD 1S3SA 1R9TA 3GTLA 5T5ID 1EU1A 1OGYA 2CW0D 3GTMA 1PQEA 1IW7D 1G8JA 1ZYRD 1G8KA 3GTKA 1PYUB 1KQFA 1TWHA 4AOKB 2WAQA 1I50A 2A68D 3OUGA 2V3VA 2JA5A 5C18A 2VPXA 1QDNA 1ZC1A 2VPWA 3QWZA 1YLEA 3HU3A 4C2MA 4CRYG 2WB1A 2R93A 2YU9A 2JIQA 2JA6A 2PJHB 2VPZA 1TWFA 4D7ZB 2PNWA 4RV0A 3TIWA 1PQFA 1DMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMR A;  1PYQ A;  2JIP A;  4AON B;  5FTL A;  1PPY A;  1UHE A;  4KOD A;  1SFO A;  2NAP A;  2R92 A;  4KO8 A;  1Y4Z A;  1TWA A;  5B6C A;  2PMZ A;  1FDI A;  5DYI A;  2JIM A;  1AA6 A;  3HKZ A;  3GTP A;  1KQG A;  2KI8 A;  3FKI A;  3HU2 A;  1I3Q A;  5FTM A;  3GTO A;  4KLN A;  4AYB A;  1TMO A;  2C45 A;  1Q16 A;  2NYA A;  3GTQ A;  1WCM A;  1UHD A;  2Y0S A;  5T5M D;  5EPP A;  1Y1W A;  1AW8 B;  3HU1 A;  3ML1 A;  4AAY A;  1SIW A;  1FDO A;  2EEO B;  3QC8 A;  1CZ4 A;  2VUM A;  4KDL A;  1QCS A;  3CQZ A;  3O5A A;  5FTK A;  5FTJ A;  1E5V A;  1H0H A;  3IR5 A;  3QQ8 A;  1TWG A;  1VC3 B;  2E7Z A;  3GTG A;  5FTN A;  1E60 A;  2VPY A;  5C1B A;  1E18 A;  1PQH A;  2V45 A;  3GTJ A;  3CF2 A;  4GA5 A;  1R27 A;  3DMR A;  1TWC A;  4KDI A;  1CZ5 A;  4GA6 A;  2NVX A;  1PT1 A;  1WLF A;  2B63 A;  3IR7 A;  1PT0 A;  1E32 A;  4CS0 A;  2NVY A;  1H5N A;  4QIW A;  1R7R A;  2IV2 X;  1K83 A;  1Y1V A;  4AZD A;  1Y5I A;  2JIO A;  3H0G A;  4CRZ A;  2E2H A;  1CR5 A;  3TM7 B;  2E2I A;  3IR6 A;  2JA7 A;  2JIR A;  4DMR A;  2R7Z A;  3PLX B;  1E61 A;  1DMR A;  5DYG A;  3QQ7 A;  5GLF A;  1S3S A;  1R9T A;  3GTL A;  5T5I D;  1EU1 A;  1OGY A;  3GTM A;  1PQE A;  1IW7 D;  1G8J A;  1G8K A;  3GTK A;  1PYU B;  1KQF A;  1TWH A;  4AOK B;  2WAQ A;  1I50 A;  3OUG A;  2V3V A;  2JA5 A;  5C18 A;  2VPX A;  1QDN A;  2VPW A;  3QWZ A;  1YLE A;  3HU3 A;  4C2M A;  4CRY G;  2WB1 A;  2R93 A;  2YU9 A;  2JIQ A;  2JA6 A;  2PJH B;  2VPZ A;  1TWF A;  4D7Z B;  4RV0 A;  3TIW A;  1PQF A;  1DMS A; 
#chains in the Genus database with same CATH topology
 2DMR A;  1HD5 A;  1PYQ A;  2JIP A;  2YUJ A;  4AON B;  1PPY A;  5FTL A;  3X2G A;  1UHE A;  3X2L A;  4KOD A;  1SFO A;  2NAP A;  3CZB A;  3D30 A;  2PJJ A;  2R92 A;  4KO8 A;  4FG4 A;  1Y4Z A;  5GLX A;  1TWA A;  3X2O A;  5B6C A;  2PMZ A;  1FDI A;  5DYI A;  2JIM A;  1AA6 A;  3HKZ A;  2ENG A;  3GTP A;  1KQG A;  2KI8 A;  3FKI A;  3HU2 A;  4FER A;  1OA9 A;  1I3Q A;  2PI8 A;  5FTM A;  3X2N A;  3GTO A;  1BW4 A;  4KLN A;  4AYB A;  4NOH A;  1TMO A;  2C45 A;  1Q16 A;  2NYA A;  3GTQ A;  1WCM A;  1UHD A;  2AE0 X;  2Y0S A;  1OA7 A;  5T5M D;  5EPP A;  1Y1W A;  1AW8 B;  3HU1 A;  3ML1 A;  4AAY A;  1SIW A;  1FDO A;  3X2H A;  2EEO B;  3QC8 A;  4JP6 A;  1CZ4 A;  2VUM A;  4FG2 A;  4KDL A;  4ZM7 A;  1QCS A;  3CQZ A;  2G6G A;  3O5A A;  5FTK A;  1YNN D;  3X2K A;  5FTJ A;  1E5V A;  3SUK A;  1H0H A;  3IR5 A;  3QQ8 A;  4JCW A;  1TWG A;  1VC3 B;  2E7Z A;  3GTG A;  1BW3 A;  1YNJ D;  5FTN A;  1E60 A;  2VPY A;  5C1B A;  1E18 A;  1PQH A;  2V45 A;  3GTJ A;  3CF2 A;  3SUJ A;  4GA5 A;  2HCZ X;  1TWC A;  1R27 A;  3DMR A;  4KDI A;  3X2M A;  1CZ5 A;  4GA6 A;  1WC2 A;  2NVX A;  1PT1 A;  1WLF A;  2B63 A;  2A69 D;  1PT0 A;  2A6H D;  1E32 A;  3IR7 A;  4CS0 A;  2GAE A;  2NVY A;  1H5N A;  4QIW A;  2O5J D;  3M3G A;  1R7R A;  2KQA A;  2IV2 X;  1K83 A;  1Y1V A;  4AZD A;  1Y5I A;  2JIO A;  3H0G A;  2BH0 A;  4CRZ A;  2E2H A;  2PIC A;  1CR5 A;  5GLY A;  3TM7 B;  3X2I A;  2E2I A;  3IR6 A;  3X2P A;  2JA7 A;  2BE5 D;  2JIR A;  4DMR A;  4FFT A;  2A6E D;  2R7Z A;  3PLX B;  1E61 A;  1DMR A;  3SUL A;  1N10 A;  5DYG A;  4JS7 A;  2G5D A;  3QQ7 A;  1L8F A;  5GLF A;  1SMY D;  1S3S A;  1R9T A;  3GTL A;  5T5I D;  1EU1 A;  4L48 A;  1OGY A;  3ENG A;  2CW0 D;  3GTM A;  1PQE A;  1IW7 D;  1G8J A;  1ZYR D;  1G8K A;  3GTK A;  1PYU B;  3SUM A;  5H4U A;  4AVR A;  1KQF A;  1TWH A;  4AOK B;  2WAQ A;  4JJO A;  1I50 A;  2A68 D;  3OUG A;  2V3V A;  2JA5 A;  5C18 A;  2VPX A;  4JP7 A;  1QDN A;  1ZC1 A;  2VPW A;  3X2J A;  3QWZ A;  1YLE A;  3HU3 A;  4C2M A;  4CRY G;  2WB1 A;  5GM9 A;  2R93 A;  2YU9 A;  2JIQ A;  2JA6 A;  2PJH B;  2VPZ A;  1TWF A;  4D7Z B;  2PNW A;  4RV0 A;  3TIW A;  4ENG A;  1PQF A;  1DMS A; 
#chains in the Genus database with same CATH homology
 2DMR A;  1PYQ A;  2JIP A;  2YUJ A;  4AON B;  1PPY A;  5FTL A;  1UHE A;  4KOD A;  1SFO A;  2NAP A;  3CZB A;  2PJJ A;  2R92 A;  4KO8 A;  1Y4Z A;  1TWA A;  5B6C A;  2PMZ A;  1FDI A;  5DYI A;  2JIM A;  1AA6 A;  3HKZ A;  3GTP A;  1KQG A;  2KI8 A;  3FKI A;  3HU2 A;  1I3Q A;  2PI8 A;  5FTM A;  3GTO A;  4KLN A;  4AYB A;  4NOH A;  1TMO A;  2C45 A;  1Q16 A;  2NYA A;  3GTQ A;  1WCM A;  1UHD A;  2AE0 X;  2Y0S A;  5T5M D;  5EPP A;  1Y1W A;  1AW8 B;  3HU1 A;  3ML1 A;  4AAY A;  1SIW A;  1FDO A;  2EEO B;  3QC8 A;  1CZ4 A;  2VUM A;  4KDL A;  1QCS A;  3CQZ A;  2G6G A;  3O5A A;  5FTK A;  1YNN D;  5FTJ A;  1E5V A;  1H0H A;  3IR5 A;  3QQ8 A;  1TWG A;  1VC3 B;  2E7Z A;  3GTG A;  1YNJ D;  5FTN A;  1E60 A;  2VPY A;  5C1B A;  1E18 A;  1PQH A;  2V45 A;  3GTJ A;  3CF2 A;  4GA5 A;  1R27 A;  1TWC A;  3DMR A;  4KDI A;  1CZ5 A;  4GA6 A;  2NVX A;  1PT1 A;  1WLF A;  2B63 A;  2A69 D;  1PT0 A;  2A6H D;  1E32 A;  3IR7 A;  4CS0 A;  2GAE A;  2NVY A;  1H5N A;  4QIW A;  2O5J D;  1R7R A;  2IV2 X;  1K83 A;  1Y1V A;  4AZD A;  1Y5I A;  2JIO A;  3H0G A;  4CRZ A;  2E2H A;  2PIC A;  1CR5 A;  3TM7 B;  2E2I A;  3IR6 A;  2JA7 A;  2BE5 D;  2JIR A;  4DMR A;  2R7Z A;  2A6E D;  3PLX B;  1E61 A;  1DMR A;  5DYG A;  2G5D A;  3QQ7 A;  5GLF A;  1SMY D;  1S3S A;  1R9T A;  3GTL A;  5T5I D;  1EU1 A;  1OGY A;  2CW0 D;  3GTM A;  1PQE A;  1IW7 D;  1G8J A;  1ZYR D;  1G8K A;  3GTK A;  1PYU B;  1KQF A;  1TWH A;  4AOK B;  2WAQ A;  1I50 A;  2A68 D;  3OUG A;  2V3V A;  2JA5 A;  5C18 A;  2VPX A;  1QDN A;  1ZC1 A;  2VPW A;  3QWZ A;  1YLE A;  3HU3 A;  4C2M A;  4CRY G;  2WB1 A;  2R93 A;  2YU9 A;  2JIQ A;  2JA6 A;  2PJH B;  2VPZ A;  1TWF A;  4D7Z B;  2PNW A;  4RV0 A;  3TIW A;  1PQF A;  1DMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...