4FG2A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellotetraose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg2A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg2A02
1OA7A 4JCWA 4FERA 2KQAA 2PI8A 3X2LA 1HD5A 1WC2A 2PNWA 5GLYA 3X2GA 3CZBA 4JP7A 3SUJA 5GLXA 2BH0A 4FG2A 2G5DA 3FT9A 1BW3A 2VXQA 3X2HA 1L8FA 1N10A 3M3GA 3X2NA 3X2OA 2JNZA 2PJJA 3X2KA 2G6GA 3ENGA 4FG4A 5GM9A 1WHPA 2GAEA 2ENGA 3FT1A 4JS7A 3X2IA 2AE0X 4AVRA 2PICA 4ENGA 1WHOA 4JP6A 3SULA 3D30A 1BMWA 3SUMA 1OA9A 3SUKA 4JJOA 3X2PA 2HCZX 4FFTA 3X2MA 5H4UA 4L48A 3X2JA 1BW4A 4ZM7A
chains in the Genus database with same CATH superfamily
1BAFL 3AMLA 1PZCA 4O00A 5CGTA 5HYSG 1RU9L 1TJGH 3QO0B 4WKZA 3CUPA 3V4PH 4XBGA 4NKOB 1B0GB 4B3EA 3X3FL 2EDJA 4ZSOE 4HCIA 5DEFB 2F7RA 2XG4A 5FFOA 3X11A 1I9IH 3BUYA 4I3SL 3UX9B 4NQXA 3B5GA 4FF9A 3RVXD 4N90D 4G9FE 5ACZA 2V3FA 4FFYL 3T0EA 2IG2L 3OAYH 3F5WB 3OSVA 2XWJB 3CN1A 3DMRA 1MFEH 3GIVB 1KFGA 4J3OG 1ZIBA 2J4WH 3S3BB 4NQVB 4TQEH 3DV6A 3WO4B 3NEXA 5EUOA 5SWZB 3R19A 3B5TA 4JZJB 3ZT7A 2JCCF 4XNDA 3RTQD 2B5IC 3MRJB 1U2CA 2XKNB 5EG6C 3AU0A 3DX9A 2DDQH 3FU9A 1LO3H 3SDCD 4L18A 1MRCL 4JPIB 4P5TC 3JWDH 4L4JA 4PRHA 4R4BB 1K5NB 1FFQA 4A2EA 1UADC 5MEPB 1OP5H 3ARDD 3I84A 2X2UA 3MREA 4OUUA 4HISA 2ATAA 3FU8A 5F7EH 2AE0X 2HG5A 4Q9BA 4XXWA 3P9LB 3BXNA 4FL4C 4KK8D 2VDQB 3HB3B 1EFXA 1MEXH 1HYRC 2QQKL 3AUWB 2FWSA 1F97A 4OV6F 3BUQA 1EUUA 3Q2NA 2DZEA 4J1UB 3MJGX 3QG7L 4RMUA 1EA9C 5JQ6H 3PQYD 4JO2L 2AQ1A 4JPVL 3V95A 3RWFA 4H8WH 4KXDA 4PJCB 1Z1WA 5FUOL 1VGKB 4R7DA 3QJVB 4A7QA 1T80A 1TO4A 4BK4A 4GMTL 3EO9H 2GJRA 3DX0A 3KJ6H 2YEVB 1GTFA 3RPIA 3L45A 1I3UA 3LHAA 4AIEA 5HBBA 5AOIA 4E36A 4ZX3A 1JAEA 3TFKC 4KK5D 2R8SH 2CGRL 1BQSA 1IM9B 4LEOA 4ZMPA 1LVEA 3R8BB 5CM1A 1QG3A 4NQDA 2X28A 4UT9A 1IEHA 2H26A 3A23A 3JWOH 3LZRA 4X7TB 4XVJL 5E00B 1FL3B 5EBWB 3D52A 1X6LA 4JHWL 1R33A 4PWFA 3VXMA 1F5WA 2CNYA 3BAYA 2EZ0D 3FTUA 3T8VA 2K9UA 4KJQD 3QORD 4NKMB 4P2QE 1TTFA 4YE0A 4DGWC 4JPSA 1ADQH 4CSZA 2LOEA 1YYLH 1JV2B 3S9DB 1A7PH 1BFSA 1YMMA 2AEOA 5LJYH 4XVSL 2WINA 4NUGH 4PJIE 2YFNA 5FM8A 2Z9TA 3ASOB 3U1QA 4I0KA 5DFWH 3T09A 4HIJB 4J39A 3KPSB 5FDWB 3V4PA 3WTYA 1OTSD 3SOTA 1OD7A 1B2YA 3UG5A 4JCLA 3QZMA 5T8IA 3FHQA 1U0QA 3ETSA 5CSGA 4W68A 3SGKC 4U6TA 3S7GA 1F00I 5I6KA 5A16B 2QGCA 3SPGA 2DQEL 3FQUA 3QE5A 5D1QB 5F21B 4M43L 5CFHA 2IEPA 2WYIA 2XY2A 1QFWM 4ADJA 3LRMA 5FCUL 3VGEA 2CJ3A 5TK2A 5JIIA 1S7TB 4MB1A 1KTCA 4YSUA 5GLYA 2K45A 5AKVA 5FYKL 1MWAB 3QI9B 3MV9B 4CMMB 5FEBA 2W0LA 2XN0A 4U6HB 5DLML 4K5NA 3BAWA 3E2HC 2IGFH 3M7OA 1MHCA 4J3OD 4ZW8A 4OLYL 1OAQH 4DFHA 1EMTL 2N0KA 1X5IA 2I69A 3C5SA 3L5JA 2ED9A 1FN4B 3C5JA 3FFDB 1JSYA 4HFUH 4WNQA 3BQUB 5DZOA 3ZL4H 2OMZA 1NICA 3NZUA 2LHAA 4JN1H 3P73B 3SJVA 2JKLA 1WTGT 3A21A 1Y5IA 5HD8D 1ZKAA 4PP1C 5MENA 3NEOA 3GBMH 4EZLA 3VFTB 4JVPA 4N0FB 5EBLA 1KB5L 4FQXB 1OCRB 5IFAL 2AJSL 3QRLA 2X0VA 4H13C 3T0ED 4NM4L 1MJ7L 2IH1B 3V52L 3LSOB 1XCTB 3VFGH 4Z3FA 1I53A 3QO0A 4KITB 3VW3H 2OR9L 4NKOA 1JZJA 1B0GA 2WCSA 3X2QB 4OGYL 5DEFA 4IK6A 1K3IA 4WK4B 1PKQB 5KZCB 3HG1D 2GBUA 2CRIA 5GXBB 2QLVB 1XF4B 4AMXA 1FWXA 3FHAA 3F5WA 3LQAH 2H8PB 2XWJA 3T6ZA 3GIVA 3TU6A 4F15B 5ALBL 4PRHD 1QLRB 1A2YB 2IWEA 4NQVA 5ITBH 4MDJB 4BA0A 5SWZA 1TWCA 1S5IH 2VUMA 2MNUA 3BI9X 4JZJA 5EDXA 1Q0EA 3RNKB 1UC6A 5DK2B 4UTAH 1MWAH 3BAJA 1KBGH 3MRJA 1TSHA 1X6NA 2XKNA 2BE5D 3WFBL 4OFDA 2IOIA 1HINH 2CUMA 1MOEA 5H94B 1E7UA 4JPIA 2GVYA 1AOHA 1BG9A 1GCYA 1K5NA 2K3HA 4R4BA 4XNYL 1JPSH 2XTLA 3V2AR 5MEPA 1MFCL 5CN1A 3U7YH 3VG9B 5HHOE 1YEFH 3EJQA 4ES9A 1U36A 2VZ1A 4BK5C 1NAMB 2D3VA 4L4TB 5JIDA 2WKGA 5C0IB 1Y07A 3NSCA 2WXHA 3P9LA 3WNOA 3GMMB 2DLFL 3IRZA 4X7DC 1NCTA 2R1YB 2O5JD 3NSDA 1JZ7A 3ZGIA 1UJTA 4N25A 4ZODA 2E27H 3E9UA 4J1UA 2RQEA 2VR8A 4BQCA 2BP8B 4YPJA 4Y5VC 1I3VA 1IAOB 4PJCA 4Q14A 1YECL 1GR7A 1IJ9A 4RCAA 1VGKA 4JPQA 5B8CB 2YMTA 4UILH 4XC1H 4F8PA 1R9TA 3UG4A 3TEZA 1QEWB 2R0WH 4PJXE 5B1JC 4G7YH 3P0GB 2PJHB 1O7DE 2WSPA 3E8VA 5DVPA 3WTVA 1KV3A 1XSKA 5IHUH 4TQPA 1S7WB 3LPWA 4MRBA 4P59L 4AH2B 1IM9A 1L7IH 3SEPA 3FB6B 2FO1A 1MXGA 4CC4C 1GS7A 1IFHH 4PV8B 5E00A 3FN0L 4HUCA 4X7TA 1FL3A 5EBWA 4LVOC 5MEQB 1D6VL 2ZXEB 3CC1A 4I85A 2C5DC 5T1MB 2HJFB 4EO5A 4Z7WF 2GBTA 1DHKA 1M71B 3IF1B 4NKMA 4GXVH 1MFAL 5E1HB 5I26A 4HBCH 1OQOA 2DMBA 4AMWA 2HLAB 1MREL 1JV2A 2VR5A 2WLHA 3H0GA 3TCLB 4KWUA 3EDJA 1RK7A 1UHDA 2ZCLH 4WGVB 1SRDA 4ONOA 4HUMB 5DYGA 1YEIL 4P2QB 5SV4A 1MSPA 4HIJA 3KPSA 3WIAA 5FDWA 1JZFA 1AS7A 1DFBH 3UIZA 3RVXC 2R51A 4K3DH 4XPBL 3VVVA 2D2OA 4HUWB 2HG0A 3LRSB 5DZAA 1ZLVH 1D7CA 4AEFA 4PJIB 2QMKA 2WZ0A 1KOAA 3RAJL 5A16A 2OK0H 4E0RB 1AR1B 1BQRA 4ODTL 3ZMNA 1T6WA 2E86A 4C4BA 5MERB 2EDHA 2X9XA 4P5SA 5D1QA 4UB0H 3C2AL 3GTVA 5FDYA 3VJ6B 1QX1A 5D70L 2QQQA 3RTQC 4GEJA 4J28A 5ADOL 5T5FA 1FVDB 2G4GA 2X4UB 4ATWA 1S7TA 3GLZA 3GPSA 3AS0A 5FF6B 3UBXI 3UTOA 3RFZB 1MWAA 1KC5L 1WIPA 3MV9A 3QI9A 3CQQA 5D6DA 3UZEA 1KELH 4U6HA 4CMMA 5MEND 5IFJB 3D8MA 1H15B 2ICEC 4NI6A 3AC0A 4WFEE 1FIGH 2X40A 5D1XE 2W59A 3LS4L 1RZFH 2CBPA 4PJ8B 3TESA 1FN4A 2P5WA 3FFDA 4GQ9L 4BIKA 3BQUA 2E4FA 3DYPA 5JUEH 1CU4L 3CQZA 3S35L 3P73A 4Q9RH 4Z7VB 1YDPB 4OUOA 2VXTL 3IAPA 4UT6L 3VFTA 5AZUA 4N0FA 1G9ML 1XL6A 4FQXA 4GBXB 1T2QL 4LQFH 1F4WH 3APFA 5AZEL 1OPGH 2IH1A 5AVRB 3LSOA 1XCTA 2TAAA 5FK9B 5LQBL 4KK9D 3V6OA 3OR7B 3SO3C 3VB8A 2XXMB 1PKQA 4PJHE 4KK5C 5GJTL 1F0LA 1XF4A 3IAGC 5J57B 5CMAB 2HN7B 4K7PY 2H8PA 3BYYA 4NKQB 1QLRA 3OF6A 1A2YA 3UIYA 1J7VR 3ILEA 1RPQA 3OHXC 4ZFGL 5HGGS 4MDJA 3U30B 3O81A 4IKNA 2FUTA 3RNKA 3DX1A 1DYZA 5DK2A 5C0DB 2EZ0C 2G5DA 1A1NB 3MV11 4KJQC 3QORC 3TTSA 4RESB 1M9SA 1H8OA 2P48B 3FAWA 1N5YH 1BFTA 4YDVB 5H94A 1SY6L 4K8RH 1CN4A 4FNRA 3QZWG 4LCWE 1BREA 2E9IA 4U4IA 1G9MC 2H7WA 2FLMA 2ZCZA 1RP8A 1GGIL 4M61B 4PJDF 1NAMA 3F8UB 4L4TA 1EJ8A 5C0IA 4ZO6A 1OK0A 3KPOB 1OTSC 3NMEA 5EZLB 5FYLE 3VD3A 1JFQH 5I1LB 3GMMA 2IGLA 5ICZB 1AG0A 2R1YA 1SN0A 1AZNA 4QTIH 3NIFF 1ZLSH 3DX7B 4JL2A 1TZGL 1N2RB 2LFGA 4OFKA 3GSXB 4MMZB 3LVTA 1MJUL 3OKKB 2BP8A 3LOWA 3IS1X 5C1BA 1XCQB 2C9VA 4AJ0A 3ARFC 1IAOA 3GMOB 3CBRA 2ZCKL 1RURL 5B8CA 4LIQH 1CDJA 5DA4A 2I24N 2ZJSL 3LHPL 4GKZB 1QEWA 2G3XA 4KZDH 4RMWA 3CQPA 5T1DL 3HUJF 4JDTH 2GIXA 2V2WB 4BJLA 1WWWX 2YD1A 3NCJH 3CQFA 1L9QA 3VD9A 1S7WA 1QFOA 3KLHD 5EH1A 4AH2A 4J3OC 1MUJB 1XH1A 2Q0ZX 1QFHA 3V4LA 5ICYB 4ELDA 4MNGE 3FB6A 2EUVA 4LPYA 3SBWC 2QKSA 4LPXA 1QLEL 5IP4A 4PV8A 1S9KC 5I15H 3W0WD 5I75B 4L3EB 3SKJL 1IBZA 4G59C 5SV3A 5MEQA 2XKUA 4K71C 4DQAA 1DLHB 2K4WA 2HJFA 2Z34A 4XMXA 5T1MA 1M71A 2HX7A 3IF1A 5HD8C 2J88H 3FDWA 1T2XA 2V3DA 1HS6A 4GY4A 2WYZA 3MV7D 2CHWA 4OFQA 1KIQB 3GXIA 1X5KA 2HLAA 3T0EC 5HHPB 1EAJA 1TO5A 4HDIB 4DF9A 3TCLA 1SHWA 1OHZA 2BVOB 2WSKA 4LRNL 1OL0A 4OJCA 4QI3A 4Y2DB 1JPEA 2KMWA 4P2QA 4XPHL 4FNTA 1AGFB 1Y1WA 5D1QD 1RJLB 3RIAK 2WXRA 1Q9OB 3TM7B 4TTDD 4HUWA 1PLCA 3LRSA 5J1SC 2X2JA 4KOCA 1A6UH 3FW6A 3JYCA 5DDHB 4PJIA 2KPNA 3BAIA 3QI9D 5TQ2L 4N2LA 3SZ6A 1KPVB 4UT9L 3ZR6A 1MW2A 5EU6E 4E0RA 4AL8H 5MERA 3G9AB 3VJ6A 4ZTOH 3TJHD 4DPRA 1A6PA 4XXWC 4AJVA 2P5WD 1FVDA 5FOBB 3HNTH 3L2LA 2X4UA 2UUDH 1WQVT 1NUNB 1A3LH 1IGML 3OWRA 1Q9KB 4RWYH 5FF6A 2X4PB 5IHLB 3RFZA 5DR5H 1A0QL 1UA3A 9PCYA 4CL7A 1AQHA 3FH8A 5IFJA 2ATKB 1H15A 1IC5L 1I9EA 1QTPA 4FQXD 4PJ8A 4MKMA 1QQDB 4PTUB 3LIZH 3ZDXB 1THAA 3WE6B 3CG8A 1VFUA 3QWRA 2YEQA 4ODSH 4Z7VA 2VPXA 1JHLH 1YDPA 2A4EA 2R0KH 3GMQB 3ZJAA 5J7CC 5HHXH 2IO5A 2LVCA 5KZCD 4UQ9A 2P5PA 4ZT1A 5D1ZI 2CBMA 4GBXA 4ODBD 2PWFA 1IGIH 4FG2A 1RLBA 3G6DH 4PRPB 1QABA 5DJCB 2WWMC 5DRXB 4K15A 4OTXL 3MLXH 4Y4FD 4G2AA 5FK9A 5EEVA 1KIRB 1P1ZB 3IDJB 2O4EA 3QIWB 3OR7A 1NCCL 1D7FA 4JO8A 3T4AC 3CSTA 3JWNE 4O02H 2IANB 1J8RA 1V7ML 4R7XA 4YSOA 5KN5B 1W16A 4H0GA 1QR1B 4JB9L 2F9BT 4G9FD 3IJHB 3BPNC 1UWEH 2HN7A 5CMAA 5ITFB 2Q10A 4TN9A 3SZKC 5I1JH 4WI7A 1EZVX 2EIBA 3B2PA 3GSQB 2X6VA 2YIHA 1JK8B 4BYHA 2XKSA 3DJRA 1PQZB 2VDPB 3BFWA 3WI9A 1DBML 1X4ZA 4AMKH 3ZHLA 4PJHB 5C0DA 3CF2A 4GH7B 5DCCA 5IMLB 1A1NA 1XF5B 1AVAA 2IDTA 2AGJH 2B3RA 4R84A 3D7PA 3QS2A 4JFDB 5I18H 4YDVA 3KL0A 4OCRL 3HC0B 2G5UA 4NP9A 4XP1L 4F91B 2HVJB 5DD3L 5E6SB 2AQQA 3P2TA 3MFGB 2WOYA 3IGFA 4M61A 2JQZA 2GG1A 3MO1B 2FEDD 1BOGB 3JTTB 5DD0H 5FGSA 3KPOA 5EZLA 2BP5M 2F5AH 5I1LA 4JFXB 5ICZA 5EHFA 3QQ7A 5AW5B 1EQWA 2GHWB 3DX7A 3QPKA 5IUSA 3T6VA 1JNJA 4FQJL 1N2RA 3H3BC 4LCWB 4X8JB 3OAUL 3GSXA 2KPWA 1NZRA 1OM9A 3HNSH 3QIBD 3OKKA 4IIQB 4GMSL 1SLVA 2NYAA 1DQJB 1XCQA 5CUSH 5C07B 2YO3A 3GS4A 3GMOA 5C9KA 1CTNA 4RAVB 2HVBA 1PGRB 2AXGB 2JIXB 4U1JB 3G04B 4GKZA 2FX9L 5HXMA 4FCAA 1IM3B 4MAYD 3HG3A 4KXBA 2XPZA 2H9GB 2V2WA 4OH2A 3M88A 1A7BA 4QXTB 4M3KB 5LAPA 1R17A 4PRNB 3NH7H 3T3PF 4HK0B 3WXWH 3VQ1C 3IDYB 1Q1JH 3B1TA 4HT1L 2VDPH 1MUJA 5ICYA 2VWEE 4NCC2 1XMEB 4YEEA 1AHWB 4Q2ZB 3CFCH 3EYSH 3ZDZE 5E5RB 4L3EA 1SJHB 2VDQL 1DLHA 1SYVB 3DSFH 3L6FB 1L5GB 3VNZA 2NY3B 3TV8A 1M9WA 3WNMA 3T6QC 4P2QD 4G7VH 2B15A 4ZAKB 4Z7QE 5CEXB 1QKZH 1KIQA 3AJ7A 4G9DB 1KGUA 3CXFA 3PWPE 2V0AA 4HAGA 2Q8AL 5HHPA 4QEGA 1KGIA 4HDIA 2CE6A 3LYRA 3OKLB 4S0TD 3SOBH 1D7DA 5TE6L 3D4ZA 2YPLB 3NAAL 4KK9C 2XETA 2R0ZL 2BVOA 3QH3B 4ELMF 1DQKA 3O2VL 4L9LB 4Y2DA 3WO4C 5F7BA 1AR1D 4OCNC 1AGFA 5E6ID 4KTEL 4JZJC 5HHMB 1RJLA 4B96A 4U1GB 4DK5A 1Q9OA 5LG1A 1WA0X 5BZXA 4U7SA 1SXNA 4PCSA 3G9VA 5DDHA 5B38B 15C8H 4K3JH 2V2TB 5AW4B 1IGFL 1KPVA 2I9LB 4QNPE 1MCFA 4CBPA 5EOQH 4HCRA 1TIUA 3FSVA 3HNVL 3HIZA 1BZ7B 4PJ8D 3S2CA 3L9EA 1EAPB 5JHAA 1PLGH 5FOBA 4KAQL 4KV5F 5B7EA 4L2LA 3HB3C 4Z0BL 1TU2B 3CPLB 5J12B 1Q9KA 2X4PA 2X7LB 5DQJB 4BFJA 3KS0H 2BLFA 4UQDA 3W5NA 1DTUA 3W2DH 4KQ4H 1OO2A 2Z1PA 3H54A 2ATKA 2NYYC 2A4CA 4OLXH 4DGIL 2KI6A 4MDRA 3O45B 4EZKA 3P4OB 1QQDA 4PTUA 5KJRH 2B1AH 3WE6A 3FFCB 3VXNB 4LO9A 3PPSA 4NJ9H 3NACH 3DARA 3OPUA 3NCYP 3ZQ9A 3GMQA 2CIIB 3GWJA 2BRRL 4RDQF 3FN9A 3K6NA 4F2FA 3FT9A 3CZEA 2XJKA 3UXFA 4PRPA 2GHZA 5DJCA 3L1GA 5DRXA 2ATPB 1YQVH 4MQTB 2MTAA 2ROYA 4H0LC 2BJML 1KIRA 4PIBA 5B1AB 1P1ZA 4F20A 4X6DE 2R2HB 3IDJA 4G6ML 3QIWA 4PS4H 4MKTA 3B9AA 5A2AA 4ABQA 3SYOA 3F7RA 5T5FL 3DC0A 1AQKH 1WYJA 2JJVA 1N7MH 2IANA 4DCQB 5KN5A 1BXVA 1QR1A 5HPOA 3KLHC 3ESUF 2QSTA 3IJHA 3SY6A 4AUYA 1SJXA 4M1GL 5KBMA 5ITFA 3D12B 4LZKA 3GSQA 1JK8A 3OQ3B 3TYGL 1PQZA 3FTSA 3FB7B 4NWTH 3BWUC 3MOAL 1T7VA 3IR6A 4PJHA 5KYNA 1R3HB 1GGBH 3WN5B 1AC0A 1HKLL 1L8FA 3P2DA 1DQML 4KZCA 3RY4A 5IMLA 1XF5A 4A68A 5KEZA 1EIBA 5FM4A 3PFQA 4JFDA 4F9PA 4YBLB 5KS9F 3HC0A 2Y69B 2D4FA 2FO8A 4I2XB 2HVJA 3L3HB 4GG6F 2HCZX 5HHOD 3UPAA 4K9EL 3LEYL 3ZZQA 2NCMA 2O30A 1CGSL 2ADIB 4LSSH 3MO1A 1RMFL 4GRWB 3T71A 1BOGA 4LMQI 3JTTA 1G7PB 4LSUL 5FFGA 1LILA 1UFUA 5D1QC 4JFXA 1ZPLA 4OQTA 1VB9A 4OQ1A 1JDCA 4K7PH 4KPHL 2Y0SA 4TTDC 4F27A 4D9QE 4WVRA 4X8JA 4LCWA 2D7TH 4IIQA 1KYOJ 1DQJA 3O8XB 4TSCH 3SPJA 3QI9C 3E1F1 3UZEC 4ETYA 1KFAL 3FHEA 5I8OL 3Q9QA 1BXAA 4RAVA 2YR3A 3ISRA 2AXGA 3TJHC 2JIXA 3CDZB 4U1JA 2CPCA 1N4XH 1V3LA 3G04A 2QKIB 3CBJB 2NY2B 3GXTA 1IM3A 4NGHL 3BQUC 2H9GA 3NRPA 1M56B 2WW8A 4JM2B 3X2GA 4QXTA 2ZKHL 4LF3B 1Q16A 4PRNA 4PJEF 5DJDB 3FUHA 3A67H 4HK0A 4P46D 4PPTA 5J3HC 3THML 3IU4H 3Q5YA 2FT6A 3CV5A 4FQXC 1AHWA 3OAWA 4Q2ZA 3NZ8B 1ITCA 1DVYA 2YLKA 1HNYA 1NAML 4KKBD 4CC1A 4K9EC 1M4KA 1MAMH 2ALAA 4PU2A 1BF5A 1SJHA 1T0OA 2DL9A 1L5GA 1SYVA 3L6FA 3LMJL 4WAFA 1H3XA 1ZEAL 4ZAKA 1KJVB 1X5MA 3S34L 1FGNH 5CEXA 4O58L 3CFDB 4G9DA 3IFPB 3BN9C 3UROR 4FG6D 3AAZB 2W92A 3OKLA 1NGXB 2YPLA 4F15C 3QH3A 2VXUL 4OBSA 3GB7B 4FYTA 3RIFF 4BKLB 4L9LA 4Z7QB 2R1WB 2AERT 5KVEH 4GP5B 3QYCA 1K6QH 5DUBB 2GI0A 2YEZB 3PWPB 4AVIA 4GAGL 2Z91B 1W6LA 3OD3A 1LE5B 2QDVA 5B38A 4R2GB 5HDBF 2V2TA 2WJ7A 3MRBB 2I9LA 3FTVA 5DVMA 3VG9C 4OF8A 1CZ4A 3NJKA 4UM9B 3G6AB 2M8XA 4K5LA 1BZ7A 5HI5D 5A3ID 1EAPA 1R5VB 5BZWB 2MCPL 1OP9A 2FWUA 3IPBA 4NZFA 3OKOB 3PUCA 1TU2A 1Z9LA 3CPLA 5ALCH 2DLGA 2DD8H 2P8MB 2X7LA 1XCWA 5DQJA 3G6JE 4IDJL 3NFNB 1WZ1L 3D0LB 4D0DB 3S35X 1KCRL 2PLTA 1AQMA 4WHCA 5D1XD 5C2BH 2FEDC 3O45A 5I73B 4JJOA 3P4OA 4X5QA 2WKOF 5B8CC 1R3LB 4N2EA 4D7PA 3L5IA 2MNJB 3FONB 4F8QA 3FFCA 3L4TA 3VXNA 2ZOTA 2HRPH 2Y06L 4H2AA 2XQYA 1KZYA 2CIIA 3QGVA 2B39A 3IFNL 1OSPL 1OSYA 3KLSA 4B27A 5D7KE 3V8CA 4YHOH 3SY0B 1T1WB 1VPOH 2AV1B 4L5FL 1CJYA 2ATPA 3H9SE 2Y36H 4TYUA 1G1YA 1XEUA 2O5XL 3MVSA 5FW8A 3ZTEA 4BZ1A 2R2HA 2RHEA 3GINA 4U0QB 3W1ZA 3MRQB 1WICA 4DCQA 2NY5L 3C6LB 3BDXA 2AQSA 5IEKB 3KGTA 2Y3AA 5D7IF 1MRDL 2RCSL 1YJDH 1KJ2B 4BKSC 1A5FL 3F83A 4OD3L 4MA3B 5DC2A 5D7SH 2D9CA 3V9FA 4MZRA 4FEIA 2WO2B 4X6DB 3V0FA 2F61A 3QXUA 4Z7NE 3CZLA 3DMMD 3FB7A 1P7BA 2MQCA 3D2UB 4O9HH 4PRIE 2EE6A 1R3HA 3WN5A 4ODUB 3V5KB 1T4WA 4L0ZA 3RVUC 1IMHC 1M1SA 2VM4A 4AQ8A 4CADB 3G5XB 5K69A 1UQSB 4I2XA 4LCWD 1XSIA 2VDOL 1RJZB 1TG8A 2QFPA 3IDNB 3L3HA 4NO0B 4ZXBB 2BDNH 4RA3A 4LLMB 4XT1C 4YS4A 5A40E 2QPDB 2ADIA 5IBUB 1ICTA 3NBNA 2YHGA 2C7UB 1AR1C 4YR6B 5CKAA 1G7PA 1F3RB 4Y8DC 5FYLD 4CSTA 4M5YL 4HF5L 4DJMA 2JIXD 3ML8A 3EYFB 3JWNG 3WCYA 2TRHA 1IM3D 5L2JB 4ZMYA 2HTLD 1U2YA 2NY5C 3RFZC 1XL4A 2Z6FA 3O8XA 5JORB 3QEQE 4FX5A 5DK0B 1SXZA 4X8CA 1II4E 3TIWA 1RPKA 2DIBA 2IV9A 5F89B 4F8TA 2HVKB 3EJYC 3LNFA 4HLZH 4PJ8C 3CDZA 4WFHE 2QKIA 3V5HB 5FB8B 1NM4A 3MZTA 1YYML 2H2PC 3ESOA 4LNRB 4JM2A 4RFOL 5I1CL 5J9PB 2HFEB 4N0RA 4LF3A 3VSUA 3TWCL 5D2LF 5DJDA 5KG9B 5C71A 4HJTA 1PZBA 3EGDB 1H8NA 5IUCA 1D5RA 4GBXC 3DO3A 3NJIA 3NZ8A 5L88L 4OT1H 5B22A 1QSEB 3N1MC 4HJGB 4KNUA 3BPLB 3EG9B 3W5MA 5D71H 5F9DC 1XBDA 5FTJA 5ACLA 4JY4B 1BBDL 1KJVA 5TDOB 1JL8A 1ZAGA 4J6RH 4N4YB 5HHMD 4FRWA 3ULAB 3CFDA 2J5WA 3IFPA 3QDGE 2V9UA 1NGWB 4MFHA 3AAZA 4UT7L 1IVLA 3RRQA 1NGXA 1X9RA 3GGWB 3D50A 2ICWJ 1HH9B 5E24E 3B7TA 3GB7A 1BG1A 4BKLA 2XG5B 1OOWA 1R7RA 5C8JB 3VFOB 2R1WA 4BHUI 1NCJA 5L6YH 2FX7L 5DO2C 4DKDC 4D7BA 1OXYA 4ORGB 4WTWA 5DUBA 2YEZA 3PWPA 3DIFB 4NFBA 4Y2NA 5C70A 2VUYA 2BHFA 5JPMB 2Z91A 5C6TH 5AUMB 1IAKB 4JO1L 1WBZB 4XVOA 1YUKB 3SKOB 5CP3A 2R4SL 1LE5A 4P4RB 2DQCL 5K9QG 5I19H 3POCA 4GA6A 5AB0A 3E9TA 2ZICA 4YE4H 3MRBA 3ESMA 5EU6D 4HK3J 2L8AA 2ZXBA 4UM9A 3G6AA 1J5HA 1X5JA 4L8CB 3GJEB 2JI3A 1LO2H 1R5VA 5BZWA 3ECWA 3OKOA 2BOCB 4J2XA 1CXHA 2VPZA 2P8MA 3HFML 4OAWB 5DYIA 3NFNA 5EN3A 3D0LA 4D0DA 2DB8A 4W9GC 4MMZC 2FWLB 3U7WL 3UFIA 1SXBA 4TRPL 2WQSA 4QOKB 2WXIA 2YPKB 4NO5B 1LEIB 4QPEA 1CL7L 4JPWL 5KJ4A 4Y19B 4XP4H 3QR0A 1AFVL 1R3LA 3MJ9H 3AXIA 3FONA 1DEDA 2A9BA 1SJEB 2J1WA 1NIAA 2XZCL 3G6JB 5H4ZA 3NJJA 4M8QB 3P2BA 4X6BB 2VDRH 2PCFB 3VH8B 2E7MA 4IKIA 2F1AA 3SY0A 3EOYG 4HZ1A 1P9MA 1T1WA 2AV1A 2J8UB 3EYOB 3DHMA 3QDAA 4HCRL 4XVUC 1TEGA 4ZW5A 2LAAA 1BJMA 3Q6FB 3SYAA 3LKNB 3RI5K 1F3DH 4ZMOA 1O7DC 3MRQA 4OB5H 4OBRA 1VAHA 3C6LA 4Y9GA 2UWEE 5IEKA 2WVTA 5GGQH 5M95B 1OARH 1KJ2A 4XCFL 2DW5A 4LP5A 2YSTA 2OKMA 4MA3A 3SUJA 5I9QB 1YC7A 4X6DA 4OGQC 5C08E 2I5YH 2R56L 4KKBC 4C56B 4FLQA 3MLSH 3D2UA 3TH3T 1DBJL 3X3GH 1DLFL 2VZOA 1F4YH 2FR4B 2IGTA 1YEJL 4ODUA 3V5KA 4K7PX 4Y2DC 5F7FA 4OJEH 1X4YA 3TZVB 4CADA 4FG6C 3G5XA 2VITB 1UQSA 4Z7NB 3VD0A 4PJFF 1QA9B 1RJZA 4NO0A 3IDNA 4ZXBA 4YSCA 4HUVB 1BQUA 4LLMA 5F9OL 3VD5A 1KTKE 1MHHB 3O8XD 1NDMB 3GI8L 4AWJC 1TYJA 2C7UA 4YR6A 1KLGB 2ENQA 4NPKA 4BA8A 2Y1ZA 3F3HA 3DTDA 5LLIC 1QI3A 3D85D 3S96B 3D06A 4XE0A 1JPTL 2J5LB 3EYFA 4WSJA 4UI2A 5L2JA 2WJ5A 3DPDA 4B9IA 4ZTPL 2WTOA 5JORA 1IRAY 5DK0A 5DMJB 3G5ZB 1MDTA 3APNA 4NJAL 5F89A 1A4AA 2HVKA 4MXWL 4BFIB 4NQUA 4A7VA 3T3MB 4Y9BA 5A3IC 3V5HA 5FB8A 4X9GA 1BQKA 5H37H 1P2CB 5IBUG 5LGJB 5D6CB 1OGSA 1LO0L 4LNRA 4YVUA 5EU7C 5J9PA 2HFEA 3QFGA 3P3TA 3SPIA 3QEQB 4JR9L 3SD2A 5KG9A 4GJTB 2W94A 1OTUC 4R5TA 3EGDA 3WAKA 4K94L 3EDFA 5AVXB 2B77A 5E03A 2EVIA 1U33A 5FUCE 4F7KA 1QSEA 4IJTA 4BQBA 4HJGA 4XOAA 2E4TA 2HSIA 3LDBB 1RHHB 3EG9A 5LHDA 4OQTL 4HKXB 4DTGH 3QIWC 4ZMNA 2K7PA 2A9NL 2DWEB 2BY0A 1YSOA 3P4NB 4JY4A 1FH2A 2FO4B 5EA0H 4QXWA 2R29A 2LVEA 5TDOA 2JELL 2R69A 1NCWH 2B16A 4BEIA 1XF3B 3L48A 3QUZB 3KL3A 2E7HA 4HK3N 3PWPD 4RAUB 1UFGA 3BKMH 1EEYB 1NGWA 1OB1B 1E6OH 3CHPA 4YHKH 1NIEA 4AJWA 3GGWA 1HH9A 4R2GD 5IB5B 1FPTL 2HWZL 2XG5A 4CKVX 5C8JA 3VFOA 4AM0B 1QFUL 4OD2B 1XB8A 2PICA 4ORGA 3VFPB 1NMAH 3DIFA 2YQ3A 2WN3A 5JPMA 3LZOA 5AUMA 1IAKA 4OZHE 1WBZA 3SKOA 3SD5A 3QHZH 1H3WM 1F6LL 4P4RA 1DJGA 4XO5A 5G2NA 4GT0A 4F9LA 4F9PC 4DUVA 5BW7A 1L9NA 1AJ7H 1CDUA 4QRRB 4PJGF 2VYRE 1XH2A 2FYVA 4FXKB 5I8KL 4AYGA 3BZFB 4K94C 3GLEA 1U8CB 2EACA 4ZOBA 4X7CC 1WSST 1ND0B 2HJLB 4NS0A 1Y1VA 3VSTA 4L8CA 1A8JH 3GJEA 4E41E 5KSAB 3MRKB 4Y5XB 1SPDA 2BXZA 2ZG3A 2A73B 4LSPL 2BOCA 4N0YL 5GPRA 3SGDI 3N42B 3SE9L 1LO4L 5BQ7B 4OAWA 4AAYA 1FLRH 3BP5B 4IIQC 2G2NA 2O5ZL 2P42B 4I9WE 2PPAA 4LSVL 3UL4A 2VN5A 1OLZA 4QOKA 1BFVL 1FDLL 3ZOAA 2YPKA 4NO5A 5SWSE 1LEIA 1BEXA 2I7OA 4Y19A 2ITEA 3LNIA 1SJEA 4KTYA 5FECB 1VESA 2VPWA 1OIOA 2ADFL 3G6JA 3QARA 1NLDH 2B20A 4M8QA 4QKXB 5KTEL 2HTLC 1E4WH 2CDEB 4X6BA 4L05A 1B6UA 4OGXH 2PCFA 3C6LD 3VH8A 3WE1A 4TULL 3WSQL 1QBLH 3IDYC 1EU1A 5DUML 4HC1H 2J8UA 1IQDB 3EYOA 4G5ZL 4JHVA 3MLZL 1CZ5A 3S5YA 1TFPA 4JG0H 3IB4A 1AHWC 1SVBA 1XQ4A 1AI1H 1QHQA 5K9JL 5LNEA 1PZ2A 2CU9A 5IESH 4FGMA 3V0IA 3Q6FA 1WUZA 3LKNA 2Z64C 1HL4A 4MJ2A 4JO5A 2ZZUT 4EE2A 1EVTC 2NY3C 2F7PA 4AENB 4ZAKC 2VABB 1JZ4A 4IRZA 1BW3A 4U3CA 1WRFA 1HIMH 1UT2A 1EEUA 4C56A 4XNZB 2B2XL 4NO0D 2EXWD 3EDKA 4KHTH 12E8H 4MA7L 2J21A 4U7MA 2HX8A 1HZHL 2DTSA 5IREA 2R39A 2FR4A 3QFJE 2UWEB 4FZ8H 4L9LC 3D4GA 1XGQB 4HEPG 3QZPA 1F6AB 2DTML 3RBGA 4U1GC 2DBLL 2KHAA 3TZVA 4KX9A 3QIUB 4M6OL 3ZMEA 5KUKA 2QSQA 2VITA 1DFXA 3OSKA 1QA9A 1UOWA 4HAKA 2EJ1A 2UY6B 4HUVA 3PP3H 1OPOA 2EO1A 1MHHA 5CCKL 3ZTCC 5GRXG 2NX5E 1NDMA 5DU7A 4BZ1L 5GGTA 3FH7A 1FE8H 5FC9A 1KLGA 2EP6A 2VN7A 3L4VA 1DJXA 3L2NA 3S96A 2NXYB 2YKLH 3PJNA 2XWTB 4FNQA 5KJ7E 1FBIH 4POUB 4D9QD 3ZT5A 1EAQA 5J12C 4CN4A 4ONFH 4DP8X 3WKYA 2JJUA 3ULVH 4P3CL 1VA9A 3G5ZA 3EJUA 6FABL 3BPOB 3QBTB 1NBVH 1ZJBA 3GK8H 2ZUWA 2EXYD 3C08H 1A6VH 5IHWA 1R34A 4BFIA 3SDYL 4X4YB 2JKJA 4P9ML 1P2CA 3K80A 5LGJA 4R26L 5D6CA 4UNTA 3TC9A 3QEQA 2YAPA 1W72B 3R0NA 1UGNA 1AA6A 1EO8H 1T7XA 3VQLA 4V1DB 4YHLH 4TVPE 2FLBT 3S98A 1NBZB 2PTTB 4WJG3 4FMFA 3RIAF 3MKKA 5BV7B 5DHVB 4JFUA 4OF6A 4F57H 4NIKB 1RHHA 3GJFH 1HSBB 5SWQB 4HKXA 5C0RH 1P69B 2DWEA 5EB9A 3P4NA 3SSGA 3WELA 2FO4A 1D3CA 4WQOA 1KXVA 2J8OA 1XF3A 3QUZA 4RAUA 3WMQA 1HCFX 1KCUL 2CDFB 3PE9A 4O2FB 1MI5E 1EEYA 1OB1A 5GISH 5E0QA 2OL3B 4TNFA 3TJPA 4I77H 4Z7OF 1J9TA 2QGEA 4R83A 1ZT4B 4Z3IA 4FQLL 4HWNA 4WY7H 3CVHB 2HFGH 4LOEA 1B4JH 5IB5A 3WTSA 4PREB 4HC1A 2OZ4H 2DJ4A 4S1SH 4AM0A 1YAIA 4OD2A 1IAIH 1RZIB 1T66D 4UOW0 2H6PB 5IW3A 1Y1DA 3VFPA 3WN5C 3KVQA 2X87A 3ZO0A 2E7LA 4U3SB 4AQ1B 5IBLD 1I7TB 3CFUA 3ESNA 4WHDA 5A2JH 1JZ6A 4YBLC 1HVXA 1J1PL 1I8AA 1RIUL 3RWGB 5M94B 1ZTXH 4K7FB 1ZOXA 3RGVB 1TYRA 4QRRA 4FXKA 1E9PB 5CBAB 3BZFA 1OAZH 1U8CA 3MAWA 2HJLA 1ND0A 2BSDA 3PV6B 3ATFA 3NCMA 1GXEA 4XMVA 3MRKA 4Y5XA 5KSAA 3DI3B 2P45B 3CHXA 3VI4F 2A73A 2P5EE 4YX2L 4JANB 3FJTA 4JQVC 3AREB 2JE8A 3QAQA 5BQ7A 3RUGB 4N0CC 3BP5A 3BZ5A 4P07A 5BV7H 3TEUA 3O8XC 2QVTA 5I1GH 1B2WH 4RRPM 5AEAA 3S3SA 4JM4H 2XOTA 3BH8B 1E4XL 4WWOA 3EBAA 2I60H 4FNPA 1MLBB 4GFTB 1WWCA 1CTOA 3NCXA 4BXSV 4LAJH 1XGRB 2J1YA 5FECA 2QKIC 2WB1A 1T20B 2NY2C 3HRZB 4KXCA 4OZFH 5D4HA 3VXRD 4ETQB 5I16B 5KYYB 2R2EB 4JM2C 2CDEA 4YAQB 1F8TL 3NRQA 3FQTB 5D7KD 1SOKA 3MA9L 1WAAE 1N8ZB 3VTMA 3VD7A 3WUZA 3FO0H 3DTUB 1IQDA 4OD1L 3H9SD 4OCMC 2Q7AA 1X5LA 1JNHB 1K4DB 3IMUA 1GMEA 1JGLH 3N9GH 5E6UB 1EX0A 3Q43A 1UM5L 3T1FB 3TGXA 5AVUB 1JHTB 5EC1B 1UJ3B 1HZLA 3FQ1A 3ZTJH 4AENA 2VABA 3JV6B 2VWEC 4KY1L 3H7BB 5HDQL 3OLEA 4HJIA 3Q8BA 2LE9A 4XX1E 3HC4H 1FF5A 1MFVA 3WNLA 2VJ8A 2E7CA 1L6XA 3BVNB 3SE3A 4PRID 2HLFD 4PWKA 4G6FD 1A7RL 2UWEA 3P11L 4LSTH 4MTMA 4I1RA 4QT5B 4R97B 5B3NA 1WEJL 1XGQA 1F6AA 1F58H 1FGVH 2XACC 1NSNH 2VAAB 3QIUA 4LL9A 2C45A 2AJ3B 2CLRB 2OQJB 3HMXL 3M8OH 2K8QA 4J3OF 2UY6A 1XEDA 3I9GH 2OJ1A 2B63A 1XAUA 1FHGA 2DM4A 4R2GC 2WXQA 3QFJB 3HR6A 3ATEA 2NNCA 1N10A 3CDYA 5KUMA 5JW3H 5BQDA 4WO4B 4PSRA 1WWAX 3UYRH 1R75A 3WEAA 2XWTA 2WANA 3U1SL 1KJ2L 3NZSA 4FQCL 2Y07H 3VO0A 1SF3A 4HJSA 2WNKA 3QEQD 1UKQA 2NNXA 4KNSA 1KQFA 4J3TA 4U4BA 5GJSH 4OM1L 2DMKA 3UZVB 4WFHD 3ARWA 4H88L 4X4YA 5I73C 4NCDA 1NCHA 5EUOF 2CMRL 1Z0MA 3KJ4B 1PMYA 2X38A 3UABA 1NANH 2D4DA 5E8DL 1W72A 4Y4HD 1VJSA 5AVYB 1UOLA 3B2UD 3T6WA 4V1DA 3QPQD 1BVNT 1NBZA 2PTTA 1P9MC 1HL5A 2OYMA 1DMRA 5DRNB 2XA3A 1R4XA 5DHVA 1JTOA 3N44F 1HSBA 5SWQA 2YJQA 4R4FH 4OF0A 5I6MA 2Z1KA 3HJEA 4HX1B 3CH1B 2WM0A 2I9TB 3C6LC 3PHAA 5JXEA 3QDGD 2XIIA 2ZX6A 2CDFA 4B6ZA 4O2FA 4DT2A 5CNHA 5IMOB 2OL3A 1JNNH 3ZE2F 3ABZA 2Q8BL 1MIMH 1ZT4A 4DUXA 1C8QA 1H9VA 3PAYA 3CVHA 3L54A 1DQVA 1RUPH 4PREA 4QHKI 1WFOA 3LZQA 3WGUB 2ZPKL 2DN7A 1RZIA 2H6PA 1CVSC 2MOQA 2RMNA 4S10A 1UD2A 1HI6B 4U3SA 5KSAD 4AQ1A 1MI5B 1I7TA 4BZ2H 5JHLH 2MJWA 1PNDA 1WS8A 3MLVL 4R90L 3RWGA 4A2LA 1I8LA 4U6VL 1F1AA 4K7FA 5L7XL 1C8PA 1EJ6A 2DIAA 3RGVA 3AXLB 3FF7A 4ZXBC 1E9PA 3RJQB 1ZIAA 2EXWC 5CBAA 2ITFA 5BVPH 3PV6A 4MXQD 3ZXAC 2YGVA 2BCKB 3ENGA 1OT2A 2PCPB 2AJVH 4OCSH 3UJTH 5JLZB 2ZOLB 1FAIL 2VMFA 5DURD 3G08B 3RG1C 4JANA 1GJWA 2R69L 3AREA 3TIDB 3FTWA 2NUTB 3RUGA 4ONGH 5T5NG 4AUUA 5A2FA 1QYGL 3BH8A 3LTVA 5J4MA 1MLBA 4WHYH 2P5EB 3ARGB 2F8OA 3RU8H 2VPYA 2QQNH 3FUIA 4WEBL 3O2DL 1XGRA 3LKPB 2VC2B 4OCWL 1J5OH 3HRZA 1CE6B 1T20A 4ETQA 5I16A 1C1EL 5KYYA 1J1OL 4Z8FH 1O7SA 2R2EA 4OZGF 4YAQA 3TEXA 3OZ9L 1WK0A 1UASA 3FQTA 1BA9A 2YUVA 1FC2D 1N8ZA 2DEWX 4XXDB 4LXFA 3QJSB 5AENA 3IFOB 4HWEH 1JNHA 1K4DA 2CK0H 1QBML 1S7RB 1W2KT 4IGBD 3JVGA 3BPLC 5E99L 3T1FA 2C9QA 1JHTA 5EC1A 5F96L 1FZMB 1UJ3A 3L5XH 2ZAGA 2Y6SC 2LV4A 1GHFL 3JV6A 3BN3B 1V3KA 4I9XA 1C7SA 3H7BA 4WUKH 3B8SA 4I5BB 4KX8A 4P5MB 3TH4T 1T21B 2Y9RT 5C08D 5FA4B 5AAPA 5CCJA 2VDNB 1CLYL 1FNAA 1YNLL 3BVNA 1EHLL 2X4NB 4HMCA 3NZHL 3P9WB 3UACA 2DI7A 2X3AA 5C07E 3AS2A 5BMFL 4QT5A 1KCVH 1FZOB 1ZHNB 2DQGH 1A3RL 3LIUA 3L4WA 2VAAA 1XZ0B 5AW8B 5JPMC 2AJ3A 2CLRA 2OQJA 3MRLB 1J05B 4H8QA 3X14B 4F9LC 5BW7C 4J27A 4P49A 4ABVA 3MJ6A 3QFJA 3WBDA 3LXAA 3NQIA 1R24B 3KBEA 1VC3B 1PL3A 4UTBH 2WZPD 3VGAB 4LLDB 4WO4A 1IAIM 1T66C 4YBQD 4QF1B 3D9AL 4R0LB 5IBLC 5DJ8B 4OZIE 3GF8A 5IVNA 4IRZL 5DHEA 4D7ZB 4JQIA 1P5VB 1WFMA 2XBDA 1EJOL 3Q1SH 4LEXH 1ZGLB 3N0AA 1DSFH 1RUMH 3ARBD 3UZVA 4V1DD 1G7LB 5HP5A 4M5ZH 1GJUA 3HHMA 3TYFB 3AXHA 4LP8A 1U8HB 5FS5A 2A9AA 3X2OA 3PL6B 2X6BA 3RVWC 4NRYB 4B9KC 3WJLA 5A7BA 5DC9B 4GI6A 3AW5A 3E8UL 4X5WB 1CCZA 1LP9E 4S0HA 3TFBA 1UACH 4B0MM 4V2CB 4GINA 4NWUH 4XMZA 2A2QT 2Q9OA 4FD0A 5GGTL 3ZRSA 5DRNA 3IR5A 3STLB 5CD5C 3OWEA 4FADA 4PVBA 4JJ5B 5ABAA 3FN3A 1AHKA 4HX1A 4RBPH 1DN2A 2DQJL 3CH1A 3LRLA 2I9TA 1UG9A 2H41A 4KXZH 5SX4H 3ALPA 5IMOA 1KDJA 3I2CL 5I9QC 3LEVH 1UEYA 4NZUL 2Y1VA 2QQLL 4U6YB 1R3IL 4ANWA 2W65B 4PBXA 2OMYB 3ETBJ 2AEQL 4NNYB 5B21A 1IQWL 4UU9B 4E9WA 4QRPE 5KAQG 1UHEA 1HI6A 2C3HA 1MI5A 2P9RA 3S2AA 3MODL 1SM3L 5DHXB 4ZD3L 4G6JL 3TZVC 2C3XA 4JO3H 1RH8A 3L3JB 2E5EA 3AXLA 2HLFC 3HC3L 2X2YA 4QYOB 4KO7A 4IBWA 2BCKA 4XP9L 2CUIA 4E41D 5JLZA 2PCPA 3QJHB 1JYVA 2HFFB 2ZOLA 4GRLB 5I6XB 3KNBB 4D0BB 3G08A 3O6FB 2F0CA 2J5LC 5CO1A 5M7QA 5EUKB 3TIDA 2NUTA 4Z7WB 4FOMA 1E18A 4IS6B 4I9WD 5L8JB 4XMKH 3UCRA 2Y72A 4AY0A 1RY7B 5SWSD 2VSCA 4MNQE 1HEJC 4L1BA 1K2DB 2P5EA 3ARGA 3BWUF 1HJBC 4URTB 3HAEB 5GRJL 3LKPA 2DWSA 2ZNWA 4AV5A 1E43A 1CE6A 5DRWB 5EF3A 2PUQT 3I75B 5DMIL 1JVLA 1XB6A 5ISZE 2NNFA 4TQEL 4XO8A 5AVZB 3MRRB 3F7VB 2F19H 1T6BX 4XXDA 1QBBA 1RUKH 3AZUA 3CTTA 3IFOA 4TXVB 1F2XK 2E7BA 3L08A 2IOMA 4HSQA 5AW6B 3DJ9A 3HG4A 1YEGH 4D2NA 1S7RA 1M2OA 1KGXA 4NCC1 3LDBC 4YDJB 2R4RH 1CGTA 1FZMA 1TWHA 1YC8A 1OW0A 3E1ZA 4OGAC 4HU8A 4AK2A 3HE6B 4W1TA 3B2UC 5JHDE 3QUZC 3QPQC 1HFUA 4I5BA 5IQOA 4P5MA 1T21A 3NPSB 4H1LH 4N2MA 5FA4A 3W39B 1YEEH 2IPTH 5DK3A 3GKWL 5AG8A 2X4NA 1JS4A 2IIJA 2K78A 4YNYB 2DYRB 2AVFA 3QFJD 3EF7A 2AI0H 1K3ZA 3QPXH 1FZOA 3P3UA 4WO4D 1ZHNA 5EFIB 5LKNA 1YEKH 4LQ1A 3CN3A 2E7LC 2A68D 1XZ0A 3VD4A 3GS0A 4NQTA 5IB2B 3MRLA 1J05A 3BDBA 2GJ6B 4HEME 4TVUA 5TE4H 3X14A 5I1KL 2BVPB 3MV8B 2X1OA 5CIPH 1PCSA 1CK0H 2A38A 3IFLH 1NEUA 2AJZB 2NYKA 1R24A 4FXKC 4XO3A 4IBUA 3DBSA 4LLDA 5FO9B 3FUFA 2R8SL 4TNVF 2V5TA 5TE7L 4PGEB 1PZDA 5EO9B 4QF1A 2C7FA 4R0LA 4Y5XC 5DJ8A 5F44A 5HYJE 5KSAC 2H6UA 2WD0A 3EBIA 1KBWA 3JWOL 4TS6A 5BNXD 1P5VA 5IGXH 1YA5A 5IZ7A 1PT1A 2O26U 3ARQA 3VRLE 1ZGLA 4XX1G 1M3IA 3KPMB 2NUPB 2AZUA 4BFRA 4MXQC 4NM8L 2UZIH 2A69D 1G7LA 3TYFA 4JKPH 1U8HA 3OAZH 3H3PH 3PL6A 5DEGB 2HFTA 1RV6X 4NRYA 1U2HA 4TNWF 4KKAD 5ANHA 2PP7A 1MQKL 3GS7A 4X5WA 3KLAB 4RIRB 5DZVA 2ESVB 4TVPD 2MQGA 3DROB 1J5IA 2DWDB 3C6SB 4XCCH 4TTGA 3TT1L 4KUZL 2Y2WA 3STLA 3ES6B 3RPBA 4JJ5A 4LDCA 3K71B 4PJDB 2X5PA 4BWTA 4N3UA 3GZKA 4M02A 4YVNA 1E3FA 2BSRB 3ZHNA 1L0YA 3TJEL 3FKIA 4DZ8B 3OV6A 1MI5D 2AK1H 5CJQL 3SGEH 2NY1D 2PR4H 3JWOC 3DDGA 2VERN 3PAVA 4UAHA 4U6YA 3MLPA 2W65A 1PSKH 2X0WA 3D07A 1WTLA 1J5CA 3NJNA 2OMYA 4XNZC 1DSYA 7PAZA 3SE3C 3T2LA 4X83A 1UZ6E 2R59A 4GYBA 4IK7A 4NNYA 4UU9A 1Z6JT 1CFMA 2FEJA 2NNAB 4CMHB 5C3TA 1CICD 1E90A 2WCPA 2P7TB 1W72L 2VB5A 1HOCB 1H3UA 1ML0A 3L3JA 3GDCA 4XNQB 3ARRA 2HKHH 2KI8A 3HI6H 4QYOA 3MUY1 4M5SA 2JH2A 3AT8A 3L9RB 3MC0A 3QJHA 2AEPH 4WK0B 2HFFA 4GRLA 4QXGL 4B41A 3KNBA 4D0BA 2P5ED 2KERA 3O6FA 4H40A 4UANA 5C6WH 1JF5A 2AITA 5EUKA 4Z7WA 1UD6A 3K1DA 4PI2A 4IS6A 3GHEL 1EXUB 4KROB 1Z9OA 4L0YA 2A3TA 2OL3L 2A0LD 4OKDA 3BPOC 3EFDL 3EXJA 4M56A 4XXCA 1J1XL 3STBA 1K2DA 3I6GB 5A6IA 4J3WA 5IK3B 3HAEA 5DRWA 3U0TB 1NBYB 5LBGA 1QR4A 3I75A 2B9AA 3JTBA 2QVMA 3IN0A 1MCSA 1ZT1B 3MRRA 3F7VA 5F0JB 4ZOAA 3MRDB 3DOIA 2FATH 1D5MB 2VDMH 2PO6D 1OCOB 1KBGL 1P6FA 5C3LD 1CS6A 4PJIF 5GGSY 3NA9L 5HI3D 2HH0L 5ISZB 4JPKH 3N40F 4WCYL 1N6QH 4YDJA 1DBAH 5K9QI 3U7YL 2B0SL 3HE6A 1CGYA 4PWHA 1A66A 3FKUS 4A2HA 4TUJB 5JXEC 4LP4A 3MLTB 1PIFA 2CM6A 3QCTH 4L4VE 3W39A 3CLEL 4OVVA 3OAYK 3MPCA 1H19A 3NN8B 3TO4B 2IAMD 5EEWA 3O2WL 5D7LB 3SDXB 2E27L 4YNYA 4F58H 2RBLA 1GGTA 4FNSA 2PNWA 1R3JB 5ID0B 3LN9A 3O0LA 5EFIA 5JHDB 2B4CL 5KSBE 2QV2A 3PHQB 2RTTA 3QJQB 2Y5QA 5AAWC 3RY5A 4AQ1C 3TBCA 5IB2A 5CJXA 1XGPB 3IPFA 2GJ6A 2EDEA 2BVPA 3MV8A 2CUHA 2VW4A 2WP3O 4MCZB 1EO7A 4G7YL 1COBA 5F8QC 3RGVC 3ZRCC 2MPVA 2AABH 2AJZA 4Z7UE 1OP5K 3X2IA 3GEWB 4HG4K 5FO9A 4N9OB 3U25A 5KBKA 4O5LH 1CB4A 4PGEA 2NR6D 3ZBMA 5EO9A 3QWOB 5E9NA 1QZ1A 1CLZH 1ETJA 3FO9B 1QSFB 3K4ZA 3F64A 1JFHA 1KN2H 1RK1B 4ZX4A 2D3JA 3K5RA 4QGYA 5J1AB 3WEOA 3KPMA 3QFDB 2NUPA 2ZIDA 3GHBH 2K6YA 3KGRA 2BPBA 4PYGA 3TBSB 3E0GA 4L3AA 4N2DA 5DEGA 1UA6L 1S8DB 5DGRA 3HRZC 1A6ZB 1C5DB 3K8KA 2YAFA 4ZMWA 3X2PA 4WGWB 2B4CC 2KQMA 4X80H 3KLAA 3VMPA 4RIRA 4MQXD 1TSRA 2VL5B 4KVCL 4ZUTB 1NCBH 1XFPA 2ESVA 1QUPA 5CJOL 4EBQL 3U0WL 4LCIH 3DROA 5KOMC 2DWDA 3C6SA 5KW9L 1AE6H 3ES6A 1W15A 5E9AA 2G9HB 3K71A 2YAEA 4PJDA 3HBGA 2VDKB 4OV5B 1BVLB 2BSRA 3JVGC 5JTWA 4AC2A 5E2TH 3HS0B 3WTTA 3MXVL 3WKQA 4JQIL 1EBAA 2X6AA 4L1HA 2ENGA 3IM1A 4DZ8A 2OTPA 1ZPUA 1UYWL 1JGVL 1NLBL 2CLVB 3J7HA 3LH8A 3BFOA 4X7FC 3S5ZA 5EO1B 4ZO7A 3HA0A 4TSBH 2DJMA 3FU7B 4JFFB 3U6XA 5AG9A 4R97C 2CJUH 4YHYB 3N85H 4GRLD 5DGQA 2IPUG 2NNAA 2P52A 2P7TA 4AC4A 5IJDC 1HOCA 3V5DA 3MQIA 5AFAA 2NXZD 3F7PC 3COOA 1SVZA 4P2OB 4ZUVB 4CU8A 3C5XA 4XNQA 3T3PB 5J13B 3CBKB 4XMLH 1UB5B 2C9AA 1B3IA 2C26A 3L9RA 4X5LA 1QVOB 2DWTA 3QUYD 1QLFB 4WO4C 1MFBL 1UD3A 3I50H 3DETC 3GIZL 4P4KB 5KANG 3H42L 4BK8A 3HVDA 3BKCH 4TVPL 2ZP8A 1EXUA 3OXSB 3FSZA 3CFIC 3ERXA 3N04A 5GHWL 3S48A 4XNXH 1WDAA 1FO0B 1SVCP 2Y24A 3FRUB 5MP6H 3QUXB 2VDKH 4AGMA 2TSBA 1D5ZB 4IQHA 4X7SL 1I8KB 3I6GA 4GO6B 4EDWL 5KBDA 2WXOA 5IK3A 1CD1B 5HPMB 1BYOA 4GP4B 2G4EA 4MZ3A 4YQXH 2XZQH 4GIPD 4ZS7H 3U0TA 1NBYA 4ZMZA 1E65A 1HN1A 2AQRA 3MLYL 3O4LE 2JB5H 3KJ4C 2WKLA 3WEBA 3EJZD 1B9ZA 1GYWA 3ZIYA 1ZT1A 4JHBA 1TWAA 3MMEB 3MRDA 1J0ZA 1D5MA 1DBKL 3HE6D 1A3ZA 3BD3A 2WUBH 5DQDL 2FNWA 1SEQH 1CGXA 2J12B 1HK6A 3CLFH 4N2NA 5ISZA 2F5BL 2DY2A 4KKAC 2APBA 4IBYA 5F9AC 3NA4A 4HA1A 1M6OB 1T03H 3JYBA 2OMUB 1PCXA 1SXCA 4IBTA 4CJ0A 4TUJA 2M83A 4DGVH 2YGPA 2Y1AA 3B9EA 4C8XA 1CXFA 1C08B 2YWYA 3NN8A 3TO4A 1IGYB 5IB4B 5D7LA 3MI6A 3SDXA 1H3GA 2VC2L 3L1OH 1MIEL 1PU0A 1ZSDB 4HCFA 1R3JA 4ZZKA 1DQDL 1BGXH 5ID0A 5JHDA 4UDUB 6TAAA 4YHML 3PHQA 5CLTA 2NY1C 1XGPA 3WY4A 4XP5L 4MCZA 5I1IH 3R4RA 1QFWI 3AT9A 4HH9B 1UM6H 4KDLA 1AZBA 4LAQL 1CGUA 2CGZA 1FFOB 3UJJH 5DTFB 2CRYA 4R7LA 2EH8L 5K39B 4JHAL 5KSBB 1IC7L 3GTNA 4ISVB 3QWOA 2LT9A 3S97C 1F13A 1G5AA 3O3BB 1CICC 2V2XB 3FO9A 3JV4B 4HEMA 2MMXA 1FJ1B 5GSRB 1QSFA 5IBTL 1RK1A 3PF2A 3WV0A 1KCSH 1T6VN 5J1AA 3SCMB 4KO5A 2AJXL 2VDNL 1IGCH 3QFDA 1UWGH 2CQVA 4MHHI 3NK3A 2ESVD 1CDGA 1H6UA 3OL2A 3PJLA 1HNGA 3TBSA 3V6FB 3ARGC 1ORQB 3PFUA 1AY1L 2CALA 1RIHH 4PJHF 3CU1A 1S8DA 3NIDB 1HHHB 4MJHA 1NOAA 1A6ZA 1C5DA 3WFDH 4DESA 5EZJB 4DP6X 4QDGA 4Z95L 4PHZA 2EXTA 4RGOH 2UVFA 4ALAH 1RZQA 2VL5A 3GUFA 3CXDH 2A0LC 4IKJA 4ZUTA 1MNUH 1DL7H 5E1GA 3HE7B 4MQ7B 5GZOA 1RZKL 1FCGA 1GYVA 3HZYB 2FH6A 2CKNA 5T3XE 2G9HA 4TLSA 1EZLA 1A6UL 1XMWA 4Y5YB 4OV5A 1GTNA 1BVLA 3HS0A 4G8GE 3KPNB 1OW0C 5E2VL 3VGHA 2AQ2A 1UCBH 4ZTOL 2PO6C 4K23H 4NNPL 3LPFA 4PJAE 2CLVA 1PX8A 5TH2B 4HHAB 1A3LL 5HI3C 1ETA1 5EO1A 5FM5O 3TCTA 2DICA 2MPAL 4RGMB 1AGEB 2Y5EA 2DKUA 4JFFA 3FU7A 4QRPD 1LDPL 4JKLA 2Q6WB 1RFDL 3S8GB 2OW7A 3MOBH 1W80A 3KBPA 5I82A 4HMEA 4NN6B 4FNLL 3QQ9D 1RZJH 4ZUVA 4P2OA 4X4ZA 1F90L 3SODB 4KROD 2IAMC 3B3IB 1ZLVK 3ZSSA 1C7TA 4LARL 7TAAA 1UB5A 5HHXL 3Q8CA 3WIIL 2E9WA 2IC2A 2QHLA 4NQSB 5FHAH 1RZKC 4WWKB 3RVTD 3V9EA 4ACPA 2PP8A 1QVOA 2NY6D 1QLFA 3WNJA 4P4KA 1ULVA 1SHMA 1UENA 1HQRB 5I0WA 1VIWA 4ENEC 2PF6A 3K5SA 4JFWA 4KZEH 2ZOWA 1N0XH 1HEHC 3OXSA 5B4MD 4P5KB 4J4PD 2JIQA 1AQ8A 1NBQA 1FO0A 2XQ0A 3FRUA 1IEAB 2A74B 3ZKND 1G6RB 4JRFA 3QUXA 1D5ZA 3UBXB 1I8KA 3BE1L 3CGTA 3FT0A 1CD1A 1BQHB 1R1CA 2KZWA 4KJWD 4HOWA 4KRPD 5HPMA 2ZSWB 1I85A 2CUAA 4F1SA 1ZGLP 1SF5A 5ISZD 3PL6C 4C2MA 4TUKL 1I1FB 1WFNA 3TTYA 3A4DA 2VQTA 3X2LA 1BX2B 1BZQK 2FECI 4FHBD 5FUZH 2LABA 3MMEA 1WZLA 2E9BA 5IQ7L 4EEEA 3HR5B 1GL4B 2X6MA 1X5HA 4TUUA 2WYTA 4IRSB 2PPFA 3M07A 4C58B 2OFQA 2EDBA 3TO4D 3KGUA 4WFFE 1QSZA 4HQQH 2M26A 4XZ4A 4ZQKB 3GSNH 4KTDH 5CN3A 1M6OA 3Q0HA 1PD1A 2OMUA 4XWGH 4MQXC 5JHDD 4NAJA 4HWBA 2FNBA 4PJBE 3HG0A 2VISB 3AU1B 4P06A 1RZ7H 1YLBB 4A6YH 1C08A 5F1NB 3VG0L 4HLZG 2YUWA 3C8DA 1RAMA 1IGYA 4YFLF 5IB4A 3PP4L 1I1AB 4DW2H 4K0OA 4KDWA 3HNSL 5ERWB 1PZUB 1ZSDA 4KU1A 2IDCA 5ILTH 1CDIA 1RUAL 4XPGL 4UDUA 4PSPA 1P4BL 1U8MB 1G6RH 3OR6B 1HHJB 5JR1H 1Q90A 2YN5A 1I50A 5KVFH 2CBOA 4HH9A 4GAJL 1LD9B 1TVDA 4B9YA 1FFOA 4L48A 1CE1H 5DTFA 4CKQA 1YPZE 5KSBA 5K39A 2XUWA 1V7NH 4NZDA 5LXVA 3DUSB 4ISVA 4Y16B 5HYJD 3DIVA 1R5IB 4GRLC 1BM3L 3O3BA 1IC4L 3CFCL 2CR0A 4PLOB 2V2XA 3JV4A 5GSRA 1FJ1A 3O6FC 3LV3B 2ORBL 5AVSB 4A1RA 5EU3B 2YD3A 3EOAB 3SCMA 4UBDC 1XGYL 3CFNA 2XLLA 4G7VL 5KOVC 1JVKA 5CSZB 4R5VA 1HOEA 3FT1A 3K2IA 4D8PB 5GZOD 4XXCC 3V6FA 3LH2L 1T2JA 1ORQA 3KPLB 4KOBA 1WD8A 1HHHA 3EHBB 5I23A 1JPST 5EZJA 3EOBB 5J1TC 4HETA 4LU5H 4M3JA 1JF1B 1TTUA 2O93L 2DQFB 2PR9A 5EZOH 4YL9A 3HE7A 1DMSA 4MQ7A 3W82A 1M57B 1UZ8B 3HZYA 3MCYA 4GI8A 1X5GA 2GI7A 3F7YB 2X89A 4Y5YA 4LT7A 3T04D 1BAWA 4F5CA 3E3QE 3EJZC 4K55A 3RKPA 4CBZA 1KLFB 2XZAL 1D5IH 3KPNA 2BNRE 3K2UH 4A39A 4Z3GA 3IYLW 2XNAB 3HE6C 1SMAA 5FKAB 1WAPA 2JKSA 1RPUA 5TH2A 1I31A 3NPSC 5E4IA 4HHAA 5JHMA 2VH5L 4P2OD 4EQ3A 3VU1A 3DECA 3WAJA 4RGNE 2J1KA 3AFLA 1AGEA 3WFZA 4N8VG 2EDOA 2Q6WA 1GC1H 4LEEA 1MCPH 1G7MB 1YN7B 4AKOA 1TQWA 3PABB 1IFGA 4YDMA 4JM2F 4PJAB 5EOTB 4P4KD 4BFKA 2G60H 2VQ1B 2CLZB 4EUPB 5CJXC 4WRLA 5CINH 1RCYA 1WWBX 3B3IA 1WZMA 1Y4ZA 2O5YL 2HKFH 4N8CH 4YZFE 1M7UA 3H9YA 1B4LA 5LCVH 4NQSA 1U9KA 4WWKA 3IBOA 2FJFB 4GSXA 4OF5A 4KMLB 1MCRA 1K9TA 4FABH 2XPYA 1GKOA 1HQRA 2E76C 3DGDA 1WA2X 1OAKL 2RFXB 4J7RA 4TSAL 5B7FA 5E6RB 5F7HA 1L6PA 2UUDK 4P5KA 4FJZA 1BEYH 3L8QA 3FC8A 1IEAA 2A74A 2YZ1A 3ZDZF 1G6RA 1CFNB 1HWGB 4G6KH 1LK3L 1QHPA 1JHKL 1H3VA 1NGPL 3UBXA 3VA6A 1BQHA 1BLNB 2ZSWA 4Z7QF 1U3NA 1I1FA 2NVYA 2YA2A 2YPVA 1AP2B 4FFZH 4JUSA 3AQYA 1IKNA 4MJ4A 4N20A 1BX2A 3SGJA 5DD5L 4YXHH 4CDHA 1GGBL 2JK5B 1HAWA 4RRPG 1AZZC 4NO2B 3HR5A 3HCVB 4HXAL 2XQBH 4IRSA 2FLRT 2GB2A 3P40A 2VKWA 4PVMA 3QWQB 2YOAA 5D1ZB 4AYID 4ZQKA 4PVNA 3F58H 3QXWA 2F1EA 3CDGB 5C0CE 4AG4H 3BOVA 3I74A 4NP4H 4UQEA 3B7YA 3UCQA 4D9LH 3M1CA 2VISA 3MLWH 4L4VD 5EOCL 3ZU8A 2FD6H 1TQTA 3AU1A 1M6UA 5F1NA 5J6GB 1Y6NR 3F00A 4QNPF 3G3LA 1I1AA 1PJ9A 4Y1AB 2B3IA 5FLVA 2Y7SA 5ERWA 4BFGA 3N3EA 2WKOA 4XI5D 5DYOB 4TLKA 1A7OH 4PJBB 1MFDH 2IJ0C 1YN6B 1DE4B 2MRYA 3KDPB 4U6XB 1U8MA 2K7QA 4KJPC 3OR6A 4CMHC 1HHJA 4X5RA 1OP3H 1J10A 4DPAX 1LD9A 3SCMD 2FGWL 2JCCE 3T77B 3B7RL 2ZKWA 3DUSA 1Z5LB 3IU4L 1ZE3H 3MV01 4PB9L 2HTKD 1R5IA 1QAWA 2PTUA 4Y16A 2IWFA 4ODWB 2MTPA 4EDXB 1DVFB 3LV3A 2LU4A 4HS8L 5E2WL 3QVAA 5EU3A 2NRDA 3EOAA 5EEYA 2DM2A 5AYUL 4KROC 3EYUL 4XBEH 3H2PA 2JQAA 2DKMA 3P4MB 3RVTC 5CSZA 4YDZA 2V17L 4X6DF 4Y9FA 2GFBB 2V7NB 2DQMA 4D8PA 1F42A 3DGCR 1AGBB 4K5PA 3KPLA 4L1SA 5C0AB 1CZ8H 3OUGA 2EDFA 3EOBA 4NPJA 4AEIL 3GLDA 3QC5X 4UMGA 1GGCH 1AOZA 4PMEA 4AZ8B 1I9JL 1JF1A 1NFKA 2DQFA 3W11D 3D09A 5IG7B 4HSAC 5IJKA 3S6CA 1DEEB 1MHEB 2GTWB 1EGJH 1UZ8A 2FEEI 4WW2F 1CD8A 2OM5A 1U8JB 4KJWC 1A1OB 1P84K 1EXHA 3F7YA 5E7FA 2RQ8A 3BAEH 3ZVVA 3T8XB 4KKZA 1KLFA 4A04A 4X8GA 2PXYB 1K85A 5I76B 2XNAA 3CVIH 2HLEB 4XVTH 3INOA 2NW3B 4NXSA 5FKAA 3APCA 3ECQA 2H1XA 4OI7A 3ME0B 1BAFH 1G7QB 3B2VL 3KVDD 2VKXA 3LNHA 1Z5YD 3TO4C 5L2KE 1PZ3A 3D6GA 2FJSA 4NQEE 2BNRB 3WFCH 3I9PA 3X3FH 3WS3B 3L5WB 4WWKD 1G7MA 1YN7A 2HX9A 1J0JA 2WQRA 4ERSL 3OMAB 3MUJA 3PABA 5EOTA 3NTCL 4PJAA 1EANA 1VADB 1S78D 2VQ1A 2CLZA 3EGSB 4EUPA 4RMBA 4FFYH 3WFEL 4MMXB 2CJTA 2IG2H 3SE8H 1PIGA 4RGNB 4UINH 3VFSB 3FZUD 5KYUB 2YQBA 4KJYB 2C3WA 3FQ4A 4P3WA 3V0GA 2VLKE 2A1WL 2YGNA 1YMHB 4PD4J 2FJFA 1VPOL 1FH5L 1U8NB 1VEOA 4ZPVB 3QULB 2RFXA 3IMSA 3CFKB 4QJ4B 1G7IB 1WBYB 3Q44A 2NY0B 5FTNA 3O41B 1MRCH 3DA0A 4NKDB 5B1BB 2F53E 1CFNA 4H25B 4HAFA 2ICCA 4XN8A 1QWUA 4X2UA 1GS6X 1FHNA 2AKRB 2QEJA 4RLDA 1BLNA 1ESOA 4EVNB 3O4LD 5GGVL 4QGTA 1I82A 4E9RA 1AP2A 7FABL 2UY7B 3ZL2A 2QQKH 2XRAL 1JZ5A 4B9GA 2K0RA 1UKTA 2X12A 2JK5A 3QG7H 4KKNA 5LG6A 4NO2A 2EICA 3HCVA 4JPVH 2Z7YA 3VGFA 5GZOC 4PJGB 3FULA 5JW4R 5FUOH 3DPBB 1I1AD 5D1ZA 3WYRA 2DV6A 1INQB 2WQ8A 1B6DA 4GMTH 1Z32X 1UGKA 3CDGA 1FFRA 1SQ2N 3HS0C 3MDJA 3MACL 2XX1A 5CHNB 5GGUB 1DVUA 2JSFA 4WTQA 3PRZA 5B3JE 2VZUA 6PCYA 5J6GA 2CGRH 5L8KB 3KPTA 4S1DD 1CLOL 2LLGA 4Y1AA 1MZYA 2FJHB 2VM9A 4QRBA 1N6UA 3WNPA 5C0CB 4XVJH 3AROA 4FLOA 5DYOA 4OCYL 4LLAA 3BX7C 5D8JL 4NXKA 4JHWH 4CSSA 4PJBA 2DYSB 1ROCA 1YN6A 1DE4A 4YHYC 4U6XA 4Y16D 4EOWH 1WE5A 3G6JF 1KGCE 3H2WA 1G7HB 3RBSA 3O3EB 3CAFA 4P2OC 1NJ9B 3NFSL 4XNUH 5J13C 1CR9L 3T77A 4JO4L 4ZMQA 2BSSB 3CPUA 2OSLB 3P02A 4X98B 4XVSH 2A99A 4LHUB 1Z5LA 5E8OB 2VMEA 2CO7B 5DJYB 2WBJB 2XQYK 4ODWA 4OT1L 5FR3A 4LGRB 2V45A 1DVFA 3OVUB 4P4KC 4EDXA 1GH7A 2UXGA 4JUTA 4K3HA 2X1PA 4P2RE 1FG2B 4DP7X 1P4IL 3N5AA 3P4MA 4OU3A 3BEWB 2CCWA 1FSKB 1M7XA 3QUXC 2GFBA 2V7NA 3A6CL 4FFYA 4J6RL 4CSPA 4DP9X 5AW2B 1AGBA 3QCUL 2WY3B 4G7SB 1MCOL 5C0AA 2BOBB 1KXQE 4M43H 4W4OC 1I85C 1G4RA 1QFPA 4PW4A 5FCUH 4LPCA 2O6CA 4AGLA 4N0UB 4G80B 5E23A 4AZ8A 2EAEA 3HTLX 5IG7A 4Z7NF 4NQCE 2C4FU 3MCKB 3N41B 3BIAX 1DEEA 1MHEA 2JLLA 2GTWA 3HLKA 4UOJA 4OLYH 1U8JA 1A1OA 5T3XD 1EMTH 1CLVA 2JKWA 3P30L 4B9FA 2XA8H 3MRMB 4QIWA 3SUMA 1RL1A 4YE4L 4LVOB 4G8GD 3T8XA 3TP4A 1A3QA 1KYOK 1JTTA 2HP4A 2PXYA 5BZDB 4WF7A 5I76A 1DCLA 3MBED 1JV5B 4ZNCD 2XXFA 4LCVA 4M7LL 2NW3A 2CK2A 1KB5H 3ME0A 5IFAH 1KF9B 2AJSH 1FL6B 1G7QA 2VO5A 4P57B 3CN4A 2EVFA 1QATA 1MJ7H 4NM4H 3ULUE 2OR9H 2TSAA 5JIMA 2BNRA 1LGVA 4RFNB 3WS3A 3L5WA 2WIMA 5F6IB 5J0BA 4OGYH 4OLUH 5JIHA 1N67A 2D03L 2XTJE 1VADA 2R2CA 1F1DA 1Q9LB 2OTWB 3EGSA 4JRWA 3GSOB 3ZK0A 2EDKA 3QDME 4HUNB 4MMXA 3RZWA 2ZXQA 1A21A 3BW9B 4GQPH 4U05A 1MAJA 3VFSA 4JM0A 5KYUA 1YG9A 1TQSA 2OW6A 4KJYA 4E9YA 1KTJA 5CR1A 5ALBH 3QJRB 5C0FB 5AYQA 1YMHA 2F8VA 3BAKA 3ZTJG 1TLMA 2EE2A 2R9HC 4JY5H 4NPYB 4IRJB 1U8NA 2L7EA 4ZPVA 3QULA 4N5ED 3CFKA 1G7IA 1WBYA 3QXVA 3KD4A 4LNVA 1Q1PA 1J87A 4U3XA 3BSZA 3O41A 3SDCB 4NKDA 1DBBH 2FQFA 2G3ZA 4J8RB 3SCMC 4AOFA 4H25A 4F7MB 4M3HA 4XNYH 1DP0A 5C0EB 1G84A 1MFCH 4C47A 1JJUA 3D39B 1NCUA 3ARDB 1MJ8L 2AKRA 3BD5A 3NT0A 1V5JA 4JN2B 5TD4A 3BGAA 4EVNA 1ETZB 1IZJA 3ALXA 4AV4A 5D1ZD 1FAKT 2UY7A 2DLFH 5LGKA 3BVTA 3X3GL 2OAAA 2F53B 1F4YL 2NMSA 4Q52A 3SYPA 2G30A 3TBTB 2BVTA 5IHHA 3U46B 3PQYB 3KEHA 3F85A 4HUUB 5DC4B 3HE7C 4PJGA 1YECH 4C57C 3DPBA 4WFFD 1EZUA 4XR8C 5TJWK 1U3HD 1INQA 3O6ML 1AS8A 2WXLA 4URKA 3JZ7A 3N42F 5CHNA 5GGUA 2HKAA 1CF8L 3K46A 4P59H 2DWXA 4U2ZA 1I1CA 4I13B 1CBVL 2X41A 1HSAB 3RNQB 2Z8WC 2FJHA 3FUJA 1BZOA 4N2OA 4ZG1A 5C0CA 3ZL1A 3FN0H 4HSCX 3OHXB 4PBDA 1D6VH 2X09A 4BSJA 4GFXA 1GOGA 1BV8A 1MG3C 2RD0A 2ZYRA 3HJ0A 3RA7L 1G7HA 3QORB 1MFAH 3KYMB 1DVFD 1CYXA 1QW9A 5H35B 3W37A 3O3EA 2QPUA 1U3YA 3RKDD 1NJ9A 3ZE1E 2QHRL 4EI5B 2IFFL 1A6WL 1DDTA 1A65A 2BSSA 1S7UB 2OSLA 2EC9U 2V8LA 4KHXL 4X98A 5CU5A 4AQOA 4LHUA 5E8OA 5BJTB 1AXTL 4WWKC 3S8FB 2CO7A 2JWYA 5DJYA 2WBJA 4FQ1L 1YEIH 5GS0L 2N4IA 4BK5A 4CN1A 1K5WA 1B0IA 3FOMB 4H26B 3OPZL 1A6AB 1D7BA 1TFHA 1JNLL 4XPBH 2CAKA 4DTGL 1FG2A 1F4XL 3BDYL 2Z93B 3FZUC 4DWHA 5KVMC 5FWQA 1MH5B 2DQHL 3ECBB 2A74C 3BEWA 3AQDA 1WS7A 1NFIB 2DLIA 2GBAA 1BQLL 3UMNA 5T33L 3RAJH 3PXJA 4NBZB 3DXAE 4ODTH 5L4IA 3OJMB 2BOBA 3C2AH 4J3XA 2UWEF 5D70H 2BHYA 4JRXE 2H32B 5ADOH 1GZPB 4LLWB 4N0UA 5CILL 3SGJC 4G80A 3LVEA 1Q8MA 3IJ7A 1KC5H 2PXYD 4EXPX 4BQ9A 4PUBL 2F08A 3MCKA 4AITA 1D9KB 4Q8BA 4JG5A 1RK0B 3LS4H 3QHZL 4JZOB 3UAEA 4YSEA 1V54B 3MRMA 4PS7A 4Q89A 4CC4A 2RIKA 4X50A 1AJ7L 3A22A 4GQ9H 1Y1UA 2BWDA 2P4AB 1CU4H 4MA8L 3S35H 2BNRD 3GTQA 5GS0C 2Z31D 5CS7A 5BZDA 2L7JA 1BAGA 2VXTH 1EZVY 2ZCHL 1JV5A 4UT6H 3NABL 1EERB 3KM1A 3ZQWA 4P8QA 1WIUA 5G4NA 4BFNA 1G9MH 1NL0L 5AZ2L 5GZNA 1T2QH 3R7RA 4P57A 1FL6A 3TA3D 3U9PL 1LLAA 5AZEH 1UUSA 1NFAA 3FMGL 1I1AC 4RGND 4HD9A 4QCIB 5T1LD 1G6VK 5LQBH 3UGEA 1OSEA 4M1DL 4RZKA 1M1XB 4XB8A 2HRLA 4CRZA 3V0WL 5FWRA 4NNXB 2GT9B 3HG1B 5E1IA 1Q9LA 3S0PA 1KG0B 2OTWA 5GJTH 1NKGA 3GSOA 1T4KB 3FT2B 3V8OA 3BW9A 2NY0D 3CIAA 1CFSB 3F65A 1W0YT 2XN9E 4N2CA 4ZFGH 2V9TA 5DVNA 3FFOA 3VXSE 5C0FA 1ILUA 3FU6A 4HHWA 4HIHB 1Q38A 1W6WA 3N44B 4NPYA 2KH2B 3QCVH 2OA9A 4IRJA 4Y16C 5KVDE 2BSED 3BAXA 4DFIA 4J3OH 4DP1X 3SDCA 1SY6H 5T3XL 3QYMA 3NJVA 4J8RA 5CZXD 2YD8A 4F7MA 3LB6C 5C0EA 1TZHB 3VX0A 3D39A 1XWVA 4MS8D 3ARDA 3E6FB 1JP5A 1ZS8B 4G8AC 1GGIH 1ONQB 1Y6MR 4JN2A 3BP4B 4X6CE 1ETZA 1DQQB 2VSMB 5DMYA 4ZFOB 1XTLA 2VN6A 4NUQA 4WV1B 4D9RE 4F8LA 1ZANL 4KKQA 4HIIB 3OKDB 3EHBC 1R47A 4S1QL 1J18A 2VLME 4G1MB 2F53A 5T5NF 4E9SA 4ECNA 1TZGH 5DVLA 3BEVB 3TBTA 2XVBA 1MJUH 5K93A 2Y25A 3PQYA 2VMCA 4QHLB 3U46A 3WFHB 2FWOB 4HUUA 4E9QA 5IJKC 5DZPA 2H2SC 1T7WA 2ZCKH 1RURH 4WUUE 5HDOA 1DUZB 2ZJSH 3LHPH 1SBSL 5C0CD 4XODA 5T1DH 2XYBA 1NMBL 4OZHF 2RR3A 4U1IB 3R1GH 3T4AB 2O1AA 4KGJA 2ISDA 2AJYL 1J9SA 4U1MB 4NZTL 1A02N 1BMZA 4M7KL 1FBIL 1JRHH 4DOHE 1HSAA 2ZWYA 3RNQA 2A6KB 3CZGA 3H53A 1TJIL 2OXHB 3JXAA 5ANMB 4XNMB 1QLEH 3TEYA 4XN4A 3OHXA 3SKJH 3FYIB 2V3VA 2AMUA 5FGCE 1JVOA 4FXLA 3US1A 3WLWD 4IHOB 3NJHA 1MW0A 3GBLA 1Z9PA 3QORA 4HWZB 4OZGB 3LKSB 3KYMA 4ODVL 4YLBA 4HGKC 5I6LA 5H35A 4MA1C 4HOZA 4CU6A 5CLYA 1LJMA 3X13B 3D08A 3H85A 2YGQA 1IBGH 4JVWA 4EI5A 3IDMB 1S7UA 1LHZA 3OG4B 2R1XB 3EGXB 1ZK9A 5BJTA 4LRNH 1ZRUA 4XPHH 4HV8B 2WAQA 3FOMA 4H26A 1A6AA 4E2OA 4DKEL 1UATA 5AOKA 3U2SB 1VZHA 2Z93A 1GKEA 1MH5A 3ECBA 1NQBA 4PW9A 1I9RL 5AL8A 4HJEA 1ZVNA 1NFIA 5TQ2H 3A4EA 1BCIA 4UT9H 3GBDA 5I17B 4A7UA 1ZCRA 5LAXB 3V7AE 3UTSE 5E5LA 1NFDE 5EWIL 2GAZB 4N5EC 2VXQA 2H32A 2YOCA 4UQ3B 1PAMA 1GZPA 4MSWB 1JGUL 3S3JA 4LLWA 1RVFH 2PPEA 2XVKA 1A0QH 1ACCA 1MCEA 3ATDA 3LCYA 2HMID 4TL5A 3UO1L 2C4FT 3IGAB 4ADGA 3PYCA 1D9KA 1XGUB 3PDOB 1IC5H 5E95B 1RK0A 5GZND 4JZOA 3SIKA 1IFRA 4JRXB 3SBWA 4BGLA 4NKIL 5EMYA 5D1ZC 4I7ZC 4ZYKB 1XF2B 3QDJE 4NOBA 3BT2L 4HG4J 3N43B 4Z5RB 2G5BB 4Q9CA 4MMYB 5AOLA 1BD2E 5L2KD 4BM7A 1J48A 4RH4A 4IBSA 4QCIA 1U3HC 3RYMA 4NQED 3MLRL 4OF3A 3W3BA 4KUCD 1GGYA 1M1XA 5F97E 2VXVL 1NCCH 1YEHH 3T2QA 1BXXA 2YN3A 4QLWA 4LDEB 1V7MH 2GT9A 4IRJD 3HG1A 4NNXA 2APXA 1KG0A 4JB9H 1T4KA 4BHUA 3FT2A 4ELME 2XIBA 5ABDE 5IROD 1CFSA 4GUPB 1E30A 1TTAA 2IDQA 2NCEA 3VXTB 1UH2A 4AEHL 2VLKD 3AWFA 2CJSA 3D1MC 3D39D 3T5WA 3MNWB 2FTAA 5KAQF 4HIHA 4MVBD 2K70A 4OJDH 4LVHC 1DVFC 3LH9A 2OMVB 2ZQKA 2E3VA 1ZVHA 2APWA 1XH0A 4OCRH 3RKDC 1I1YB 2F53D 2AC0A 1QWHA 4ZX6A 4WEEA 4XP1H 1YEDB 1FFPB 4JGUA 5DD3H 3VXSB 4UNVA 1TZHA 3UEZA 1JWSB 2WLYA 3E6FA 2P24B 4JFPB 5E2UL 1ZS8A 4JFYB 4WTZG 43C9B 4KV5E 1ONQA 3BP4A 4DO4A 4ZNEE 1DQQA 1QRNB 4OJAA 4ZFOA 4WV1A 3ASNB 3HW7A 4HIIA 3OKDA 1CIUA 1E5YA 2O6PA 4JJHA 4G1MA 4LVNB 4FHKA 5TDPB 3LN4B 4FQJH 5DWUL 3BEVA 3OAUH 2J6WA 4JG1H 2CHXA 4QHLA 3WFHA 2FWOA 3D0VB 4E5XG 1XD0A 1UTDA 4X6CB 3M7FB 1AMXA 4ENZA 3VXUE 3SPVB 1DUZA 1IZKA 2FX9H 3Q3GB 4KH2A 4U1IA 1RQ5A 2YQGA 1XXDC 2DLTA 3T4AA 2GJZB 2GEQA 3DYOA 2OX5B 5FTMA 1TMOA 1SN2A 1X3DA 2PXYC 1UVQB 2ENYA 2WAHA 2ZF9A 3BSZL 3EJPA 3NEEA 4U1MA 4APQD 4HT1H 5F1OB 4EMZA 4WUUB 1I7RB 1E60A 5IVZB 3G5YB 2A6KA 1CR5A