4FG2A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellotetraose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
b'AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
molecule tags Cellulose-binding protein
source organism Bacillus subtilis subsp. subtilis
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg2A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg2A02
1N10A 2G6GA 1BW3A 2VXQA 3X2IA 3FT9A 5GLXA 5H4UA 3X2MA 4ZM7A 1BMWA 1WHOA 3D30A 3SULA 3X2OA 3ENGA 2AE0X 2G5DA 3X2LA 3SUKA 1HD5A 4JP6A 5GLYA 4JJOA 5GM9A 3X2NA 3SUMA 4ENGA 3X2PA 1OA9A 2PJJA 2PNWA 4JCWA 1L8FA 1WHPA 2JNZA 4L48A 2ENGA 4JS7A 3X2JA 4JP7A 4AVRA 3X2KA 4FG4A 4FG2A 3SUJA 3FT1A 2BH0A 2KQAA 4FFTA 1WC2A 3M3GA 2HCZX 2PICA 3CZBA 1OA7A 2GAEA 2PI8A 4FERA 3X2GA 3X2HA 1BW4A
chains in the Genus database with same CATH superfamily
5KG9A 1WBXA 3P0YH 2G6GA 1NBVH 1NM9A 3AGWA 3BH8A 3L45A 4GINA 3QW9A 1AE6L 2X4NB 3LZFH 5MERA 1RSFA 1VSCA 2BHFA 3P69A 4HIJA 4B9YA 5I1KH 4NCC2 5HXMA 2ED6A 5BQ7A 1BW8A 1JZ7A 1IZJA 5MI0B 4P49A 2IH3A 5KSAD 4BUHA 3CFJB 3OZLA 1OO2A 4DN3L 1JCKA 5BW7A 1DQMH 2VL5A 1KGIA 3VRLF 4PMFA 1S5IH 5C0JB 5IMLA 4AK1A 1VZGA 3V6OA 1MFEL 2FJUB 1INEL 3RVVC 2UY7B 1JV5A 1R3LA 3BO8A 4V2BA 1SXSA 1DBAH 1G1CA 4R5XA 1HCZA 3ZT7A 3OXRA 4X4YA 1H6TA 4NBZB 4J6RL 5DLML 1CD1B 3D25A 3LEXB 1ZE3C 3EGXA 5HGBA 1O6VA 5C0AB 1E4XI 1HL9A 5FA4B 4UQBA 3KD4A 1WK0A 3C60A 4PJBF 4F7CB 4HS3B 3VFTA 4LNVA 5DEGA 3WFDL 4QTIH 1EGJA 3IBOA 1WZLA 2IXQB 3QNXA 4KUZL 1MCOL 1OF2B 3V0VB 2NY3B 1VERA 1HCVA 2V17H 4OIIL 1T2QL 3ATFA 4ALAH 5JOFB 3I50L 3H9SE 5FUOH 3NG5A 4LLDB 1ZLUK 5D4QA 1MLBB 4N0YH 5EC1A 3WO4B 5J8OA 2X4TA 3EKCA 3O11A 3PJSB 5DJXA 3IMRA 1AR1D 1QWNA 2APSA 2FO4B 2CNYA 2NX5B 3QJVB 4G6AD 4AUUA 3PF2A 4F9LA 5DMIH 1M7IB 3ULVH 3X17A 1NH6A 3O81A 3D4GA 2AHIA 5JW4N 1DDHB 3GTOA 2DQFA 4QOKE 3FB8B 4JDVA 5KSVB 1T6WA 2R23B 4LPWA 1I3QA 1ED3B 5CP3A 1AMYA 2O30A 3QIUA 4X6DB 2NT0A 4BZ2L 3RWHB 2QPUA 1HHGA 1J0YA 4XPAL 5ESVB 2IFFL 4P3DB 5D7EA 3CLFL 2VR6A 3UAEA 4Z7IA 1I3GH 4RZKA 3TYFA 3MYJB 5K9KA 2MCG1 2VZVA 2NNAB 3G04A 1V7ML 5ITBH 2DN7A 4WI0B 5J9PA 5DRWB 4Y5XA 4NDMB 3ZOAA 1MI5B 5C86A 4BH7B 5I1GH 3H9YA 2X3BA 2DB8A 2AXJA 2VN4A 3C8DA 3TWCL 1HL4A 5BUAA 4JY6B 4OT1H 1YECL 3AACA 4JG1L 5J3HC 1QZ1A 1X5HA 3TPUA 1CLZL 1MHEA 1ZHLA 3F8UB 5CCKL 3RVUC 5BOZG 1BREA 2BOBB 1XCWA 4HP5A 4K9EL 4QR7A 1E8ZA 4XN5A 5AWNH 2X70A 3AITA 4LCWB 1Q16A 1R5IB 3A6BH 3DI2B 3FYIB 1L9NA 4Z7UE 4MJ5A 1IBHA 4FQLL 5CGYC 1TTAA 1NL0L 2QZ5A 3SGJC 3GUFA 1DJSA 2X4QB 5GS0D 1YNLL 3OWEA 1X5XA 1KPUA 3MRBA 3MJ9A 3T4YB 1TQSA 4M5ZH 4MCZA 4P0DA 4FYRA 1HN1A 1WC2A 1YEKH 3BGMA 3RWDB 5BVJB 5ES4B 4HFWB 2DV6A 4QXTA 3X1NA 1BVLB 3WNIA 3P3UA 5DWUH 3DGGB 1T7WA 1JD9A 5DD6A 3IMVA 4IMKC 2KZKA 1LXMA 2AS5M 3FO9B 2Y7QB 3W11C 5HYQA 4KTEL 3BVNA 2RQEA 1TQCC 2AQPA 4NQDB 4PRDA 2X1PA 3L9RA 3NJNA 4ENGA 5K1NA 4H8UA 5I0XA 4YHNB 3LPWA 5DZJA 2N4IA 3OX8B 3QWQB 4JO4L 4I5BA 4S1DC 2UYLB 5B8CA 4HEPA 1P6AB 5CZKA 5D72L 3V4VH 3B9AA 3N0AA 3CHSA 5IW1A 5J6GA 2EABA 3EBGA 3QS3A 2X89D 1T1WB 3S8FB 3M8OH 4MCYA 2ZSWA 4ZFQA 4G8GB 2R1YA 3U4AA 8CGTA 3GTJA 2LE9A 3KVQA 4LP8A 3FHEA 4NRXA 4JO3L 1DCLA 4NCC1 4AT6B 4WTQA 2Y6SC 4GXFA 2NMSA 4HKXB 3ETTA 5LN8A 1P7HL 4P46B 5EEVA 1HDMA 4XMWA 4JUTA 3BAIA 1NJ9B 3K6SB 1TTCA 4JRLA 4GS7C 3KPQA 4GRLA 4FD0A 1XGTA 4LHUG 3WKMH 3DDGA 1P2CA 3ZZLA 1C5CL 4GBXC 4KGLA 3HC3H 4FXKC 2G5RA 2YUWA 5DDHB 2ADIA 1FF5A 3NCCB 1EK3A 1U2HA 4HJ0C 1U3HB 4GRWB 4L4TE 3MMEB 1SEQH 2HT4D 4JBSA 2ZSWB 1HWGB 1T4KB 3TPKA 2BSCA 3K7UA 2J6EL 2D8KA 4BDVA 3PYCA 5ANME 1SMDA 5J6GB 2F18A 4LARH 5HPOA 1BXVA 1DBAL 1NBZB 1M3JA 4NKOA 4PJDB 1AGCA 1CYXA 2ZWYA 3V6BR 1K8DB 4U1LB 4PY8J 5HHNA 5FS5A 2VDKB 4LOUC 5JDSA 3DPBB 1BA9A 1WA0X 2YD3A 2XXGA 1EGJH 1A3RH 3WTWA 5I1HH 2XXFA 4JY5H 2AJXH 5F96H 2NVYA 1UA6L 2JJVA 3SGDI 1NUGA 1U92A 2ADGA 5I0WA 1RPKA 2AK4B 3HE7C 3GTGA 4NUQA 5T3XE 3EO9H 1MNUH 2EADA 3MRMA 2L3BA 4MXVE 1A5FH 5KSBA 4CADA 3A4DA 1J18A 4XPGL 1DFBL 3R0NA 1F4YL 4WENB 2VXTH 2IWGA 3MRCA 5IEHA 1ET5A 2SEBB 3HS0A 4F1SA 1DEEA 3I02B 2LLLA 1P6WA 3F84A 2PW1A 3APDA 4XPFL 5IVNA 2G3NA 3KLHD 1H3PL 4N2EA 5AVTB 3BN3B 1RZPA 3BGFC 5E7FA 1J1XL 2QZQA 1JIBA 4Y4HB 1ASOA 3EOBA 4KRPD 1E27B 2EDNA 2P45B 3CX2A 4P23C 5FM5M 2MCPH 4ODWA 1X9UA 4LCCB 5KYNA 1DMRA 3LSOA 3TU6A 3OKYA 1OTTC 5BJTA 5CD5C 2W92A 1RUKH 2W9DL 2B3IA 5LG1A 1GAFL 4KKBD 2XQYA 3MV8E 1NLBH 2NUPA 1EDQA 1SYVB 3MGTA 3D3VB 5EN2A 3HLAA 3MUZ1 4POZD 4FERA 3D05A 4R0LB 3HC0B 2ZCKH 1E2WA 4HOWA 4G72B 4XP5H 5ESVA 3HE7B 1C5DA 5E23A 3GSQB 3GRGA 2WGNB 4RAVB 5FTLA 3NSDA 5A16A 3TBVB 5TDPA 4CSPA 2PWGA 3I3EA 2JE8A 4CILA 2X4OB 1I8AA 2GBVA 1FO0B 4NZJA 2VGLM 1M7IA 1S7WB 3NJLA 2FTAA 3QWRA 4U1SB 1BX2A 1S78C 4KO8A 2C3GA 1M3IA 1VEPA 5GQBA 4M3JA 1KZQA 2A4EA 5ACZA 1WE5A 2NZIA 3R4DA 1XR8A 1JZDC 5D5MF 5CCHE 3IFPA 2E9BA 1ZVYA 3US9A 4B50A 4F7MB 2AKRA 2WZ0A 4FNSA 3QDGB 4PD4J 2FX8H 3QFGA 5JIPA 3FB5B 2V17L 3W56A 1MJUH 4HLEA 4YXKH 4IJTA 5I8EA 2IANB 1ZA3B 1DQQA 4D9RD 3L5WB 3M7OA 2FIRT 4EEEA 2WB1A 5KSAA 1P5UA 4HISA 1P4BL 5IJKA 4UQ2B 4YDKH 3S0PA 3WY3A 4QRAA 3ET9F 2YGNA 5CD3A 5IQMA 1J5HA 3UTPD 2VXQA 4YIQB 4HHGA 3CFKA 4CBZA 1SLWA 5I19L 2A4ZA 3NJFA 1H8NA 1KC5L 1T3FA 1N26A 4Y9FA 3NH7H 3HNVH 1LO3L 4QHUB 1DQKA 5DD0L 2YARA 2MOQA 3DX6A 4YLQT 3SIKA 3D0LB 5HHOD 3NFPA 5CBAA 1L7TH 1P4LA 4M6NH 5I6KA 3DHMA 1YC8A 3C60D 3ILQC 3J8F7 5HHQB 4GG6B 2X41A 5JOPE 4W9ZA 2AQ3A 1C5BL 1X7QB 3A6OA 3KXFD 2WQUA 3AU0A 3Q5YA 2FL5A 4N2GA 1JI1A 4DPAX 3FT0A 2DH3A 1D7BA 32C2A 2BFGA 5DK0B 4O2CB 3SO3C 1OD9A 4M61A 1OAUH 5B1BB 2W0PA 4Z7OE 1FI8C 5CGMA 2YA2A 5ADPH 5IUSA 2OL3A 1UZ8A 3TWCH 5TQ2L 4JHWH 5HYEA 4B41A 3WTYA 4ZD3L 2JIMA 4ODVH 2BS8A 1WIOA 3DO7B 5CJ5A 2ATKA 4BKSC 3D33A 4S2SA 4NQEA 1CDGA 3SQOL 2Z64C 3BQVA 2VUYA 2DEWX 2IFFH 5EBWA 4H8WC 5J57B 3GKZA 2IQAA 3L3IB 2R0ZL 3CSBA 3GXMA 2HH0L 4LCUB 4IKKA 5AZEH 1CFNA 3ARYA 2Y22A 4XMPH 3G6JB 4L1TA 3T3PF 3RUGE 4Y5XC 1OZUA 3VFUA 2K4AA 1JTOA 4JFDD 4LDOB 1UJ3C 3OJMB 1WAAA 3II2A 4G6JL 4ZSOE 4LIQL 3FCTB 1JZHA 3EO9L 3S98A 1CF8L 3CX5J 5A3ID 4QRUA 4XMPL 1Y1WA 1TLKA 3NDZE 5KVFH 1J05B 4IRZL 4PY7A 1RIVL 2HFFA 3CNKA 3HMXA 3OZ9H 1ZK9A 3OZKA 2R4RH 1FNFA 4KQ4L 1UHDA 4QTHB 1LO5A 3FQWA 4M7KH 2OBGA 4IOSD 2G3ZA 2LW3A 4GKSB 2NY5H 5GSRB 5I8KL 3KJ6H 1C1EH 1BWWA 2YGPA 1QSFE 3BPLB 1HYRC 1NKGA 5EWIL 1XB8A 1IM3B 1MFDH 1ZLVK 5L9DL 2EO7A 3DSFL 4NOBA 1ZKAA 1VDGA 4HUUA 1XIWA 4PJHE 1DANU 1AGBB 4ONFH 3NIGB 3VNYA 2ARJQ 3QWNA 1EEYB 5T3ZE 2A4CA 4XMKH 1GY1A 3RPKA 3ZGHA 3O2WL 3QE5A 4C8XA 3GS0A 5AKVA 12E8L 5C0AE 1RK1B 3ZXAC 2A68D 5JIHA 1JZFA 5JPNC 1V3LA 3KPTA 2FT6A 5I6XC 3FH7A 4GAYA 3LRSB 1JWUB 4L8SA 1G4MA 3CVHB 3QZWB 1U8HA 4PYHA 5DD3H 1A22B 5MEPA 5EU6E 4CKQA 2UY6B 2YFNA 2GBAA 1K8IB 3KEDA 3BPNC 3O3AB 1LO0H 2W07A 4N0FA 4HETA 4P57A 2KT6A 5DZOA 4ZMOA 3P4NB 2JFCA 7PAZA 35C8L 2WY3B 3KMDA 1CB4A 5E4EC 3CCHA 2B7DT 4R2GD 4H88H 4PG2A 3MPCA 3UZQB 1E61A 3P3RA 1ILSA 3OHXB 5E5UB 4QXGL 1HHKA 2XV0A 5T1LA 3ZMNA 5DF0A 2C34A 2CR6A 1UKQA 4KY1L 1AXIB 1JGLH 5F70A 5AENA 1UXLA 4J3OD 3ZLQC 2XRAL 4NC2B 3RJOA 1NLDH 2XN9E 4BZYA 3PWLB 3O5AA 5K9OB 4TNEA 1T83A 1OTSC 4P46A 4LU5H 4HKXA 3NQIA 4JO8A 5D2NB 4GKLA 4KC3B 4XO3A 4IS6B 3N1MC 2UVEA 2R29H 2VXQH 1LILA 1Q9OA 1MCWM 5D6CA 5DO2C 1G9ML 3ILDA 5E9DE 2VDQH 4NKIH 4EZKA 2MHAB 2Q76B 2CCVA 4I48B 2BRRH 4JZOB 3QQ3B 5EOTA 3FN0L 1I8IA 3W5NA 2DM2A 4C58B 4W9CC 1CBVH 1AZZC 4H1LB 2C1PA 2XWTA 3BAWA 2HFEB 5CEZE 2FECL 4Y8AA 2J1WA 5LHDA 2Q3AA 1U93B 3CUPB 4PJHA 4OJFL 2GUOB 3LKNB 3ILPB 3SB3A 2A9BA 3CN2A 5EF0A 2DQUL 3IDGB 2QFRA 3F6LA 3NJJA 3FO0H 3HB3C 4NYLB 5BZXA 3RNKB 4PRIA 4EI6B 1MWAL 4F27A 4M6NL 4ZFZA 1JHLL 2F5AL 3MO1B 3EJYD 2F1AA 3IRCA 5FW7A 5SX4I 5A40E 5BVJA 3O8XB 3GMQA 4QRRD 5LCVA 4D9QD 3ULUL 2KL6A 5DZPA 1QEWB 2Y3AA 4OCXL 5CM1A 4PS4L 4D3CH 5A6IA 5I8CB 2P28B 3WTTA 1GAFH 4PJAB 5E2VL 5H37A 2E9JA 4Z95H 5HGAB 4ZUUA 3AFLA 1AS6A 2JKSA 3GF8A 1NANI 1N4XH 5DMGC 3T4AC 1PF3A 3QFJE 5D7SL 3VFMB 3E7JA 3K3QA 1EO7A 1I85A 4G5ZH 4PJEA 1GXEA 5BUPA 1JPGA 5HYJA 3SDDC 5EEZA 2VT0A 4MYPA 4UOW0 2YGOA 4P99A 3IJHB 3VXSD 4M7LT 2VERA 2B77A 1B9ZA 2Z7UA 3BIBX 4YGVA 3SE9H 1KCWA 2CRMA 3PP4H 5IROD 3CD4A 4JM2C 2YA1A 3L3OA 2IADB 1NFDF 3CVHA 4W6XB 3FQNA 4JRXD 3HZKA 3KM2A 5FCUL 4NP4L 3L81A 3DBSA 3ZO9A 2R0KH 3GO1L 4IKNA 2ZCHH 4ZNEE 1JZ6A 2W80C 1E65A 3J07A 4MVBD 4UOJA 1PQZA 1FNEB 3EYSL 4NDMA 4BINA 3ARBC 4L1SA 4FABL 2ALAA 3MNWA 3RFZA 3IGKA 2G2RA 5F96L 3D0VA 1EZLA 3SZKC 3QO1B 4EN3C 4TNWK 4NRZA 1XIWB 3NACH 5LNDA 2KLTA 3U9PL 1NCGA 3BPNB 5DQJB 3LKSA 4Z7VA 1N6QL 1KUMA 4Y5YC 3V4PB 5EU3B 2B15A 5IHWA 3W38A 2W9LA 5I5MA 4ZMZA 1HH6B 5I18L 4JJ5B 2BRQA 3B9KD 1I7RB 2CKBA 2XICA 2NR6D 5I6XB 5AAMC 3WN5C 5HHXH 1DVFC 2EAEA 4LEBA 3HU2A 5FWQA 1A7BA 3FB8A 2IPKB 2QHLA 3NPSC 5FW6A 4QTFA 4JFYA 4PJAE 3LYRA 3U36A 3WD5L 2IWKA 5T3XL 3KW8A 4PH8A 4AJWA 2XVGA 2N7AA 1KLFB 3K2UH 2X3CA 3Q1SH 4KV5E 3VSTA 2VDMH 3Q2CA 2OSXA 3QISA 1CK0H 3TCXA 4MHHG 2KZ1B 4L8BB 4XE5B 3EH1A 2BZ7A 2G3XA 3FUDA 2DQ6A 5IIEB 2YXVA 4YPGB 3QQ7A 2G5UA 3P73A 2J4WH 4K3DL 4LVNC 1S9XA 2F8VA 5I6PA 2AERT 3M17A 3MLZL 1E4KA 1E42A 1PT0A 1PCSA 3G6JA 3OKDA 3CVBA 4PJGE 1XD0A 5CILL 1A14L 4PJCF 4UI2A 5BMFL 1EXHA 1U3NA 3N2JA 2BS71 1S7VB 2YFOA 3FHQA 4KK6C 3RWCB 5D55A 2V7HB 4MZ3A 4MDRA 3ES6A 1XX9C 3D5OF 4J8RB 5E9DB 1W2KT 3KYAA 4IIZA 3VVVA 2MRYA 4JZJC 5F9JA 5KOMC 5I71B 4PB0L 1SOQA 3TONA 1RV6X 3D39D 3WY1A 4TYUA 3POHA 3THMH 5AOMA 2CA4A 1QW9A 5CUSH 4EDXA 4JNXA 2FR4B 3EYUL 3SQOH 3L5XH 1TEGA 3S5ZA 1D5RA 4PR5A 1F86A 1NA8A 4TRPH 3RAJH 1JZ4A 3FQRA 2EEFA 4M00A 2WLZA 4KJYB 2CDFA 2H6OA 2IV9A 5D8JL 5IKCB 5AYUL 4AIXA 4D9LL 2CPUA 4N28A 5C7ZA 5JHAA 1IGFH 4KU1A 1IGCH 4HIQA 2Y5TB 3PL6D 5TE4H 3VE0A 1A21A 2I9TA 4PGCB 3A22A 4YJZL 1RULH 1MIML 4FL4B 3TNNA 2J6EH 2IMNA 4IGBA 4PJGF 4EUPA 5D1XC 4FFTA 1CFVH 5EU4B 1A7PL 4GG6E 4BFGA 4H0GA 1F13A 3RP1A 5AD0B 4YHPA 2BY1A 1ERNA 3G5XA 2X6BA 1QSZA 5FX3A 4DCQA 4MNQB 2J8UE 4P04A 3FQXA 3O6KL 2UZXA 4NNXA 1EPFA 2IF7A 4NT6B 2BJMH 3O4OC 3GZQA 3MCKB 2VH5H 3U6RB 4ZMXA 5TH2B 4Z7AA 4WDIA 3RHWK 1OGAE 5DJDA 5ILTH 5D1ZC 4M93C 4B0MM 5FO8B 3QHTC 1GW6A 1UATA 4JLRA 5DZNA 4WWPA 2DMGA 1JMZA 2EC9T 3PWJA 3DTUB 4ZTOL 1IV8A 1FORH 4BFJA 3VG9C 4BZ1H 3LKOA 4L37B 5DS8A 2FWLB 4U6VH 5CSZA 3TT3L 5C0BD 4F7TA 4XCYA 2PWEA 4P2OA 4OKDA 3EJQA 3ECWA 4D0CA 4DEPC 5HYJE 3X13B 4H8HA 1YPZA 3MRLB 3DBXA 4QXVA 4AONB 3ZE2B 4CBPA 4L3CA 4DGUA 4QAMB 2QKIC 5EPMA 5TK2A 1CG9A 1AZRA 2VSDA 4P2QB 3WY2A 3VNZA 4PJBA 1A6UH 1NOAA 3QJXA 4HAFA 1ZLUH 4EN2A 4FDWA 3BAEL 3D7PA 3QC8A 3TBWB 4TUJB 5B1AB 3PDDA 5DMIL 2ZKYA 5C0EB 4BM7A 1OCWH 4QRQA 4UILH 4A38A 1U8MB 4B96A 3DWTA 3EGDA 2CIIB 2X10A 1MQ8A 2N7SA 4NKDA 4AIEA 2P3YA 3B2VL 3EJZC 3V5HB 5C7XH 1G8KA 1BBDL 4GY4A 4NWUH 2PNDA 1E9QA 3CLWA 3DO4A 3JWDL 3BIAX 5F1KC 4N1HB 3ZTEA 2H2PC 2WSKA 3M1BA 2NNXA 3NCYP 5FV2A 1Q72L 3TO4C 4PJAF 3ZUNC 4KTGA 1ONQB 2VZTA 4ZUSB 2A6HD 5IFJA 4G6FD 3S3PA 3GDCA 1A6ZA 4MQXC 4RWHA 4UT7H 3SODB 2PXYB 4WEUD 4YSAA 4P5TD 1IGJA 2WINB 4BSVB 3I02A 1X7TA 2NYYD 3HR5A 1ES0B 3EJPA 4HK0B 1E5VA 3PQYE 1BIIA 4B5ZA 4ZUUB 4N0CD 3BGAA 1K83A 4UNTA 4E5XA 3O3BB 3NA9L 1E8XA 3TP4A 2DLFH 2J1YA 4TSCL 5FOJA 3UERA 3QXAA 3ZDYE 1OP5K 4CMMA 4O2FA 4WJ5A 1BZQK 2OR8A 4EIUA 3LHPL 3P0VL 1JPST 4XNMB 1KJ3L 4Y4HC 1ZS2A 3GRBA 3QS2A 5CLXA 2QVKA 1C08B 2OJEB 3L1EA 4LCVA 3N40F 3MRHB 3U0TB 1QCSA 4A6YB 3MRJB 1E90A 1Y07A 2ZXEB 5KW9L 2ICWA 3MCKA 4GA5A 2ZOWA 2W95A 5E1AA 3QUKA 4GOSA 1ZGLB 2WYHA 2EVJA 5HHNB 5FKPA 3CK0L 5EBMA 1TVBB 3CSTA 3EGSA 1CXKA 4LCYA 1CIDA 1YNTF 2FBRA 3WXWL 3L9EA 1XSJA 4AQ1C 1FQ9C 2RFXA 3U6XS 3T0AA 3MRKB 5LJYH 4HQQL 2X28A 2NYAA 3ARVA 1AGFA 2HRLA 2X40A 3GBNH 4HBQA 1AACA 2DYRB 2OMTA 3WEBA 2E7ZA 2MHAA 4XI5C 1VAHA 3OLGA 2ZCZA 4JANB 4RNRB 2EEDA 2DQCL 3BH9A 5DHVA 4JHZA 4L4JA 4C4KO 1JYNA 4YK4C 3QCTH 5I0VA 3TEWA 1VCBC 2VXSH 3AQXA 3LS5L 2I9LB 3HMWH 4QYAA 5E4EB 3GBNL 1URIA 4K3EL 5IV2A 5C0DB 5KBPA 2GHWB 1E0OB 3ESVF 4AZDA 4NN7C 5AOKA 5K9OA 4OIBA 4WTZA 5F7AA 4ZD3H 5K59F 4GRLB 4CUCA 5CNHA 1FIGH 4G9DB 4XVTH 5AEAA 3RTQA 2MPVA 3MBXL 4UTBA 1S7UB 4FP8H 4D3CL 1B2WH 1BAFH 2UXFA 4M1GH 4K8RC 3GMLB 5D9SA 3VSUA 1I1AA 3K74B 5DFVD 1SMAA 3JTTA 1ZT7A 4ZX3A 4H8WL 3CSYB 4PWIA 1S5IL 4GP4B 3QIBD 2YGQA 4HXBH 4KHTH 1ZK5A 3KPSB 4MZIA 4FEMA 4CJ1A 3GSRB 4G7SB 4IGBC 3V7AG 5DRZA 5C08A 2X42A 1MAJA 1NSNL 3X1BA 2V3VA 4QHPA 5B38A 4G1MB 4AXWB 5I5JA 4QO1A 4X6CB 4KDTC 3IPBA 4GMTH 4LCYB 1IB5A 1MIMH 1TVBA 3WUZA 4Z8FL 4FULA 1G4RA 2FEEL 2ZYRA 4F58L 3AT0A 2XG5A 3T2OA 5JXAL 3HHRB 5FB8A 4KMQA 1DBMH 5ACLA 2DKSA 2CIKA 4HZ1A 3AG2B 2NUTA 5G4OA 3QZMA 1OM9A 4WRLA 3FH5A 2KMWA 1I7ZA 4OKVA 2ZSVB 4GAFB 4WNQA 2B3RA 1SRDA 4NQDE 4R90L 4D0DB 2VB5A 3QUML 5HDQH 5J11B 3EYOA 1RKRA 3MBEA 4NQVB 2EXWD 2MPAL 3NJVA 4NQCD 4OR1A 4LPTA 4U1HB 5MP6L 4BK8A 5KZCB 4L1BA 1OAZH 3ELAT 2ENQA 2I32A 4IHBA 2X4QA 4HH9B 3OXSA 5T33L 2QQNH 1NKOA 3GSUA 4HFUL 2C9QA 3DJZA 4G7QB 1XSIA 4FJZA 1WT5A 3MN8A 4RRPM 2QELA 5CHNA 4GRMB 5JNYB 1YUHA 3CE1A 5BXFA 3X2GA 2A9MH 5ITFA 4RFOH 3CV5A 2XZQH 3L6FA 3VXRD 1BQ5A 3IF1A 3CZKA 2BSTB 1T6VN 1A6ZB 2OULB 1MHEB 1DJXA 1SLUA 3EYVB 3AG1B 3GSNA 4U4IA 3RFZC 4ABQA 2E5EA 4XC3L 1KJ2B 1ANUA 4M6MH 3LCYA 4QOKB 4IOFD 2KHAA 3FTSA 1MI5D 3BXNB 3TFBA 3RFZB 2WO2B 4F9LC 4GAGH 1J5CA 4FI6A 3BP6B 3GBLA 1I31A 1TF4A 1CD0A 3T9WA 12E8H 2EDMA 3QT2A 1EEYA 4OM1L 4TULL 4WV1C 1UB6B 1FL5A 1I9JH 4AUYA 2E6JA 1NTDA 4HBCH 3GTMA 5CEZD 4QHLA 4GYBA 5I0ZA 2EDQA 2W81C 4QRQB 4IOFC 2Y36H 2GCYA 4MJ6B 1IC5L 3CH8A 1XCQB 1B0WA 2CHDA 2RQ8A 1UCBL 5I1GL 2CK0H 1ZGLM 3L4VA 5DJ2A 2NX5D 3ZKND 4JG0H 1DQIA 4ZQTA 1OTUC 1LO2H 2DQHH 5DFAA 5D7JC 4Y5VA 2ORBH 2NDGA 4N8CL 1QI5A 2P8MA 4Y19E 4B6ZA 1GGBL 2Z8VC 1OE1A 2OMWA 3HZMA 3BLPX 4WGKA 4UM9A 2PR4H 4AV0A 3X3FL 3PPSA 5I1AA 1WWCA 4XNUH 3O9WA 2B59B 2B4CC 4RZCA 5L8JB 1QEWA 1A6WH 2VC2H 4WHYH 2EUWA 3VD4A 1JF1B 4PJXF 3K6NA 3TGXA 1SXNA 1TDQA 3QPQC 4YDIL 3BPCA 1E8YA 1M42A 4XX1E 2OMZA 3R7RA 4XR8C 1T5KA 4M8QB 4MA7L 3UYRL 1IGYB 3I75B 4S1RL 2EIEA 3ILPA 5TJWK 3TO2A 3HRPA 2JELH 2DLEA 1S7RA 4GI8A 2RJMA 1FGVH 4GEJA 4JRXE 4W9GC 2ITFA 2VQ1B 1MJ8L 4YHPB 1W6WA 4S2SB 3RPIB 3IJ8A 4ZFFA 3U2SB 1I8IB 5TDOA 4HWZB 3FFCA 2ALWA 4PGEA 3QVAA 4UDTA 4PJDF 2N1KA 2Z31A 4JG9A 2IDCA 5EF1A 2G60H 1WC7A 1WHPA 1EV2E 3D0AA 1YC7A 4GRLC 1CICD 3V5DB 1PPIA 1QD0A 4FQHA 4PJFB 4X80L 1EQWA 4M61B 2GB2A 1NPNA 3MODL 4ENZA 1WTLA 3VXOB 1XL4A 5ADPL 2VDNB 1FN4A 3IJSB 3GMMA 1AZVA 3S36H 1NGQL 1J8HA 4XX5A 4HCIA 2HJLB 4KDVA 5IREA 1IAKB 3NZ8A 3B34A 4D7ZB 2DLTA 3FN9A 5ICZA 4H20L 3WTUA 5DHYA 5E2UH 3ZE2F 2YXFA 2B5IB 2FYYB 1P4IL 3LB6C 1OIOA 2WBXA 1CDUA 2C4FU 3KNBA 1P4LB 1S7WA 1ZOXA 4OZIE 4NN6B 4NZDA 1IC4L 1T22A 2NY7L 4R96B 3S5LB 5F6HI 1KJVA 3CQFA 3MZTA 2XACC 1OWWA 3V4VA 4OQTL 3U4BH 4PGEB 3HW7A 4UMSA 1RZ8A 2IPTL 4K8RH 2OTWB 2WNGA 2ENSA 5L0QC 1MDAA 4D8PA 4LO9A 1EFQA 1FYTA 1R1CA 2APXA 1I8UA 3EG9A 3ASOB 3ETBF 3PWNA 2OXHB 3UZVB 3TO2B 4AC4A 5AALA 5LG6A 2Z91B 4JDZB 2IC2A 4WSGA 5I1IH 4GW4A 2MEJB 2VE6A 1IGTB 1ZA3A 3IGFA 5IBLC 2FCBA 6CGTA 5ANMB 2CQVA 3DVGA 1ML0A 2VLLB 2XYCA 1ZV9A 3M17B 4YDVA 5C2BL 4UBDD 4WWOA 2F7RA 4PS8A 2JKXA 1MNNA 1VPOH 3N04A 4NNPH 1FFTB 2XQBL 3RQ3A 4AZUA 3QFJA 3SBWA 4F15B 5IIEA 5JQIB 5C0CD 3VSQA 5ENWA 5IQNA 5CEZH 1A6TB 1A9EA 5B1JC 4IDJL 5BVPL 4L5FE 3C5JA 2XKNA 3IU4L 1I9EA 1DSFL 2EYTB 3O2DA 2QGCA 1QACA 1KTCA 5HI4C 1ACCA 1CD8A 3CIAA 4UV4H 2J73A 5CP7A 3VQ2C 3A6CL 1YPZF 2WLHA 3F7KA 4JFYB 1ETZB 2D0HA 5DJCB 5HVGB 5F7DB 4YFEA 1I8KA 2IOOA 3VI4F 3MRCB 1VF5C 2AEPL 2L7EA 1GZQA 1KY6A 5DJ2B 1Z0NA 1UHVA 4Y1AA 4IBLT 5T33H 1MVYA 2GCYB 3VXTB 2CHWA 2R2CA 4IHOB 3C5JB 4X7SH 1DVQA 3P0VH 4HWNA 2IAMC 1F6LL 2OCFD 4RMQA 2CBQA 4PD4K 1YNTA 4Q6IB 2ZCKL 4HEPG 1T20B 5D2LB 1HQ4A 5F97E 4X50A 1KT2B 25C8H 3WNPA 1U3JA 5E2VH 5CINH 1PY9A 3FT3B 3MJ6A 4N2HA 1SUJA 3PAVA 1BQHB 3D18B 2B63A 3GT6A 4LCCA 3HE7D 3U48A 1EZUA 2H26A 1JZ5A 5M95B 4LEOB 5AL8A 2ZP8A 4EZLA 1L9RA 4P05A 3HG0A 2G30A 2HAZA 3CN0A 4JN2A 3APNA 1NCWL 4ZS7L 4TULH 4TKWA 2UV3A 3ALWA 3QDJD 1P1ZB 3WHXA 3WAKA 2GBUA 1OGAD 4C4BA 1G6VK 1GC1H 4ZO7A 1BJ8A 4NGHH 2DQTL 4HJJL 5F7HA 2ZWZA 4XCFH 5D1ZB 3MKGA 1ORSB 3CFMA 4UTAA 2YZ1A 1MJJB 4YXLH 3SPCA 4OU3A 3QQ8A 1MEXH 3H0TA 4P48A 3IB4A 5IMMB 2GABA 4WVRA 4LRNH 2WBJB 3W57A 4UOQA 3CFDB 4LESA 1KV3A 5LBGA 4XOEA 5AW6B 5T1DL 3V6ZA 2EH7L 1I9IH 2IO5A 3MFGB 2R1YB 4PRPE 1UA6H 5IB4A 2MCAA 3D0LA 4F3FB 3BJ91 4IRJA 1T80A 4UT6L 3NIGE 2MPAH 4AQ8C 3K1DA 4E5XG 3RVWC 1H0HA 3VW3H 2WSPA 4AG4H 4R5VA 2Z92B 3GMPA 4RAHA 4NPYA 3VYOA 2D9CA 4RAUA 1TT6A 1JHKH 3LVEA 5A1AA 4WV1B 1AQDB 1IAIL 2Z8WC 4F9PA 4YHKL 5C09D 2CRYA 3LB6D 4GQQA 4L05A 1JVKA 1CDIA 4YHNA 4B9GA 4I0CC 3Q1SL 1J11A 1Y18B 3FSVA 4TV3A 5E95B 3GSRA 5KS9B 1KQGA 2HRGA 5JXAH 4AH2B 3B2DC 2YPKA 1LL1A 1R9FA 4WJG3 4PREA 2CK2A 5DLLA 1CQYA 4PLJD 5FR3A 2W0FA 4UQDA 4BE6A 3QEUA 4J3OC 3SY6A 4Z76B 2IBBA 1AKPA 5B38G 4ODBD 4MDJB 3GBMH 4C59B 4Q56A 4DO5A 1X6LA 1CLCA 2BHZA 2B2XH 2VZUA 3FNKA 4NQCA 3WNKA 4HJEA 1KPUB 1XMWA 4XCNB 5DT1L 2PXYD 1DR9A 3SDXE 5F9DC 3IS1X 1G7IA 3O2DH 3Q6GH 4FZ8H 3I3DA 2F54D 4U1SA 5GS0H 5MEND 3RTQC 2IFGA 4FMKA 5LBSH 2X4PA 3FTWA 1S7QA 4ZT1A 2KH2B 4X0NA 4OBRA 5HD8D 3M8OL 4XWOD 2ITCB 4QF1A 2OMTB 2DPKA 3O6LH 1F1AA 2LHAA 2FT7A 4Z3FA 2YRPA 1XXFC 4XP4H 4YL4A 3CHXA 2H26B 3UTSA 2AANA 2Z92A 1R75A 4N68A 4FQ2H 4DVRL 3CPLA 4ANWA 5LXGL 1IT9L 3EHBD 3MA9L 5FHBH 2YKKA 1RIVH 4NNPL 1DQLH 1K6QL 1GYWA 3BSGA 3L3DA 2ZWSA 4WKZB 1JZEA 2NT1A 4AYFA 1ZCRA 4DZBB 4OCSL 3KEHA 3L54A 4YEFA 3MV7E 4I4WA 1JP5A 4J12A 3ZHLA 3F58H 2OCJA 4NO2A 3U25A 5J4MA 1ECYA 3QFDB 2XZAH 2JCCA 1SBSH 2QV4A 4HIPA 4YSOA 4UV4L 3U1SL 5DUBA 4JDVB 4EI0A 4NOFA 1AGDA 1A9BA 2EE6A 3HR5B 1KJ3H 3RURA 3GTTA 2EIMB 5BVPH 3CFCH 1QBAA 3PL6A 1EGJL 5AVWB 2CDEB 5CP3H 5DRXA 1JTPA 2D3JA 3DECA 3T0EE 3U7AA 1G6RH 4QTIL 3KVDD 1R3IH 4HUMB 2A6DA 2XKNB 4H8PA 5AYTA 1FFOB 4HGKC 1S2EA 4LB8A 4DP9X 1TJHL 2XOTA 4RETB 2WAHA 5IFJB 3QCUH 3IMSA 4AQOA 4AYFB 1T66C 3I6GB 4X6CF 3E6HB 5E6ZA 1OOAA 1KJ2L 2NQDA 2ZOUA 2JNZA 3W82A 1V3KA 1G5GA 4KLNA 3NCWA 4OKVB 5HI4D 5AG8A 1GGIL 3V4PL 1J9RA 4YFLI 1TQUA 3RWEA 4JCMA 4WI0A 2DKMA 3RG1C 1WZKA 2PW2B 3IDMB 5ANMA 2GTZB 1VGEL 1F00I 4AQ1B 5KJRH 3QRFM 1MLCB 2VQUA 1I9JL 1J1OH 1L6XA 4JRYB 4PJIE 5IG7B 3Q8EA 4AL8C 4L1LA 4AQAB 1NCIA 1QEXA 1BW3A 1JGUL 3SDCA 4G1MA 4AXWA 3ARRA 2VR4A 2GSGB 1FRGH 1URZA 1JV5B 1PVHA 5C07D 3S35X 4HG4J 3V0WH 1MUJB 2YD7A 3P0YL 1I8KB 2LU3A 3RZCC 4APQC 1F90L 3HFFA 4CMHB 4R7NB 3U7YL 4LT7A 5KJ4A 1KULA 4HDIA 3V7AE 3H7BA 1XH2A 1I1AB 1WQVT 3E1ZA 4G6MH 1K4CB 1HOCB 2DI8A 3WEAA 2BWQA 1DSYA 1QI4A 2MCMA 4FNUA 1OHQA 2KUTA 3IXTA 3LZOA 4XZ4A 3VD5A 2X09A 1HDMB 1I8LC 1BFTA 2BO0A 1OF2A 5IVZA 4AIZB 1CURA 1I1YA 3SPHA 1LM8V 5IVXA 3EZJB 3O0RL 3H53A 2EYRA 4QHMB 2YOAA 5KS9E 4UM8B 4OZHF 2F68X 1AD0A 2WXLA 4PJ8C 3AADB 3QDMB 3TBSB 2DJSA 1FG2A 1D5BA 1E40A 1MWOA 1QLEL 2ZX8A 3DJ9A 4OZFA 3G5XB 2HN7A 3LIUA 4GJTB 4E36A 2V5SA 2VERN 4YWGH 1R3KA 4TOYL 5EEYA 4ZZKA 1HNYA 2XN2A 5T1KA 2OTWA 1B0GB 2WUBL 3D9AL 5B7EA 3VFGL 1GYVA 5KSAB 3AU1A 5I0YA 2XWBA 4XNZB 1Q0EA 3TNNB 2NY5L 3CDGB 3P3SA 3RVXD 1SEBB 1UEMA 1TETH 4TLKA 4UQAA 3NDYE 3DX3A 5D1QC 1HC1A 3U0TA 1WFIA 3BPCB 3D06A 3GMOB 4PCSA 1KACB 2YPVH 4YXHL 3CMOL 1BVLA 1SFHA 4QPEA 1QUPA 2X4NA 1VFUA 1BZ7B 3DI3B 4O02H 5FWRA 5MERB 4ETQA 3H0TB 1WH0A 4A7TA 1BM7A 3SGJA 6PCYA 3NOIA 2DICA 3TJHC 2R1XA 3TBYA 2R0WL 4GB9A 3GLZA 4XMKL 3UJTL 4Z7WF 1BP3B 2D7TL 1BX2B 1F4YH 3NJHA 2BHUA 4HF5H 4Y4FD 5SWZE 2V2WB 5I1EH 4APXB 4IKJA 4UILL 2ZOLA 4OI9A 4Y5VB 1I3UA 4MJ5B 1SVCP 4A2GA 2WUCH 1YEWA 1BG1A 2EVHA 1SOKA 4RFOL 3QAQA 2AV7A 5A16B 1ZC1A 2VKXA 3DYPA 1M57B 3EOTL 4FEIA 5D4IA 2PF6A 2F15A 3OBAA 3V5KA 1T0NB 2ZPKL 3F01A 1MCSA 3C5ZC 1J1XH 4JM2F 3P0GB 1VIWA 4X7SL 4EJ1C 2VDRH 4DN4L 4AQAA 3N42F 4I1NB 5C3IA 5H35B 3KXFA 2HT3C 3HHMA 3HNSL 4OF0A 4WU7A 3T1FA 3EFOA 2IQ9H 5I2IB 3BP6A 4XB8A 2ZOTA 3BVDB 5AVRB 3FUNA 5HVFB 2BP0A 4I9XA 4Z7NF 3G6AA 1FFQA 2H41A 4MQSB 3D52A 3QYMA 4S1QL 2OSWA 3IFOA 5D5ME 3N40P 1IJNA 3Q2VA 2E74C 1NUDA 3B7SA 4RGMB 3TNMB 1XEUA 3GLAA 1YY8A 3V0IA 4P4KA 3IU4H 4TUJA 3IF1B 3FMGH 4XC1L 2G4EA 1K72A 1UFUA 1LWJA 4XNUL 1QG3A 3KDMB 3TLRA 2PW1B 2G9HA 3VFNA 3MJ8B 2R0ZH 5PCYA 3QB7C 1GZHA 2EDBA 1VRSA 4JPVL 1B2YA 1A6AA 3KYKL 5E94A 4F2MA 5E8EB 1MF2L 4NENB 3NK3A 1BFVH 2IOIA 2EKSB 1ULVA 1WD8A 1TTGA 4LPUA 3L1FA 4N2BA 3MRDA 5TE7H 2Y4SA 2QVTA 3MBEB 2OI9C 3NJIA 2V3FA 5DRNA 4AQZA 3NCJH 2E7HA 3ZKQD 4PJFE 1PU0A 3SKMB 4K94L 5HJBA 5MEQB 2EE3A 3VYNA 2ZSVA 4K94C 5IQ7H 2WBKA 3ESMA 2A9DA 5GZOA 3QUXB 2YMTA 1MJUL 2FH8A 4F33B 4H26A 3ARGB 4XPAH 2R4SH 2EO1A 1IGIL 2BNQD 4M7KL 1QKZH 3VW3L 3OWRA 2OYMA 5I1JH 1FFPA 5IHLB 1OP5H 3HZKB 4CKVX 1OGTA 3QCTL 4XPFH 4Z7UA 3VD3A 1P84J 1CGSL 4G8EB 1AGCB 1CDJA 2V8LA 1FYTB 1PZ2A 4PBVC 2XIDA 3ZZQA 1MW3A 1T0OA 4NQED 1R3LB 3BO8B 3WXVL 3S36L 2ITCA 3CIQA 5EA0H 2Y7MA 3MLSL 3FKUS 1OSPH 1HJBC 4N0UB 1N5AA 4LNRA 2VAAB 2CKBL 4M7LH 5B39G 1B2WL 4BQBA 3FYEB 4ZMNA 2XWCA 2QVMA 5C0CE 4BHUI 4XNQA 2Z7WA 2GTWA 2VDLB 2AJSL 3DKHA 1CYWA 4KI1A 1S7UA 4FOMA 3GZOA 4Q0XL 3NZ8B 4Q6YA 2OZNA 2IANE 1NWPA 5H4ZA 1GPOH 4U1GB 1FNAA 4XP1L 5KYYB 2A5UA 1A7NH 1UXMA 3FQRB 1A0QH 4QHKJ 4FRWA 3WTSA 2R1WA 2WP3T 4NPKA 1EAPA 3FRPG 4HDIB 5J6HB 3DVNB 2XETA 4PRIB 4EI6A 2J57A 2N0KA 1YEFL 1EX0A 5DHVB 1NCOA 1NGZB 5H37G 3WGVB 5C6PB 4L0ZA 5FPIA 4NI3A 5INCB 3HAEB 3SD5A 1WS7A 1QR1B 5B8CB 5SWZB 1FDLL 3Q5TA 2HJFA 5CIPA 1EFXD 2KYIA 3VD7A 3KPPB 3AT8A 4M9OA 5JHDD 3S2AA 2O61B 1SEQL 1P53A 1CL7I 1OLLA 2H45A 1WBYB 4DN3H 3N55A 3IR5A 3IPFA 2A77L 4IBWA 3BYYA 2YD0A 1XO8A 4ZOEA 4BKLA 1LP9F 3FO0L 3CZBA 1MHHA 4KXAA 4F8LA 1ZT7B 3MRHA 3ZE0F 5L8KB 3LKRB 3CZEA 4YDNA 7PCYA 1NAMA 2YAOA 3E6HA 5DJ8B 1KLGB 2IDFA 1RL1A 3GJFH 3D9AH 4UUJA 2A9AA 5F7YC 2AV1B 5IR1B 4CMMB 1JRHL 4ODSH 4OF5A 1WISA 1B3IA 3HKFA 2QEJA 2VO8A 4FXGA 1R5WB 5I6NA 4U2ZA 3QDJE 3O3BA 1HZLA 3OHXA 3FDWA 5LO7A 2XU9A 2WXKA 3AREB 5BRZD 1A1NA 1S7SA 3MZGB 3PP3K 4CGTA 2WK2A 1F5WA 4L1DA 1GOGA 2OR9L 3BH9B 1EVUA 4HLZG 4PV1C 3QH3A 4U3HA 3FUHA 1I3GL 4KO6A 4H1LH 4ADJA 5DQ9A 2W07B 2FSEB 2AMGA 3OL2A 5HHOE 4K07A 4L4VD 3LS4L 4M03A 1KCBA 5MEPB 2X0UA 4OVUA 3BUYA 4WJKB 1G84A 3K6DA 4Z7UB 2WVVA 1QSEB 1JSYA 4ZUSA 4PJBE 1ID2A 2PKDA 4K71B 3OV6A 4DAGH 3B2VH 1JYWA 5ISZE 1G7JB 4X9YA 4TUKH 4CW1B 4ZMQA 3RDTD 2ADJB 2ARWA 2VZ3A 4OD3L 2ODHA 3B37A 4P9MH 2GC4C 4OGXL 4CC4A 4JN1H 4IK6A 3DUUB 4ILDA 3UBXA 1ETJA 1QRNB 1Z6JT 4J5VA 3EGDB 2ICEC 2WVVB 4JFED 1TO4A 5IOPA 1JXDA 5A2IH 1GGBH 5JHDB 5CGTA 5I9QC 5L0QB 1H5BB 4FQIL 1USQA 3EHBC 3Q7JA 4Q14A 1ED3A 3HU1A 2PCYA 5KSVA 4OD2B 1MFVA 3R19A 4H40A 4ESKA 4UZGA 2GEEA 4DFIA 4A55A 1YECH 2ZTBA 1IGJB 1NZRA 1BFOA 3SN6N 4XPBL 4YEEA 1UHEA 2VLME 3WYRA 5HPMA 1CFBA 3H7LA 4J6RH 1UCBH 4PJAA 4YWGL 1IIIA 1U8JB 1E60A 5GS1C 1HL8A 2EVGA 2LLNA 2VDNL 5ENWB 3AXLB 1PDKB 3QZOA 3NIFE 2NY6C 4X98B 3ATAA 4WGWB 5KVDL 1DVUA 2W0FB 3S3CB 1SDAB 2XTJC 5J5EA 1ZD6A 1YYCA 4N9OB 4BKLB 1AD9A 4PCYA 2HZHA 1KN4H 5FYKE 5H2BA 2XG5B 5L2KD 2CIIA 1V3JA 3EGXB 5JQHC 3D25B 1A1OB 3D6GA 3LEXA 7FABH 3O9WC 3NFSH 1A7OH 4BHUA 2P24B 1F6AA 5INCA 2E6QA 4WCYL 5F7FA 2MOGA 1P4BH 3V4UL 1TNNA 3E2HC 3VRLE 4L3CB 2O5ZH 3CSYA 5GS2H 3K81A 2BNRB 2WWMC 3QQ4B 5K33A 5DJ0A 5JZ7C 3N85H 1UKTA 1IQWH 2LV4A 3V6ZB 2FYYA 4D2NA 4Y1AE 4OV5A 4ZMLA 4TSAH 3HKZA 4ERSH 3V6OC 4UQEA 5BS0E 5K9QI 4TLTA 5ADOL 4H2CA 3RTLA 1MCJA 1OW0C 3DDFA 3FN3A 1P1VA 1D6EB 2VUKA 4EI5C 4LEXL 4ZPTB 3EJSA 4TLUA 5D7JB 4NAJA 1KB3A 4BBWA 5C0FA 3GNMH 4DGVL 3SJVB 2WLIA 2C45A 2B08A 2HKHL 3INUH 4NP9A 4R7LA 1HK6A 2R2HA 2YAMA 2GY5A 2A74A 4PJ7F 2YPLB 4JN2B 2JWYA 3RU8H 5IMKA 1XF2B 2R51A 4P2RE 3OGCB 1E2VA 3AXIA 1KYOJ 4LXFA 4AEEA 2YLKA 3BEVA 2CBMA 3MBED 2DY2A 3CFTA 5EU4A 3WKQA 4DTGH 5GGSA 2F6AA 2BY3A 2ZX5A 3J27A 3TEXA 3A47A 1NGXB 3D18A 2VSKB 2WKLA 4YS4A 4MJ4A 4BCYA 2DYPB 3G5YA 4F93B 4TVPD 5JR1H 1CQKA 1W80A 2VITA 2BP8B 3P73B 5DWPA 4JPKH 5FTMA 5EDSA 2AK1H 4HUUB 2NYZA 4ODHH 1KSRA 2JJSC 4UV7L 1BD2D 4OZFG 4RZCB 1J8SA 1HOCA 4O2FB 3QJQB 2VC2B 1U8JA 4WI2A 4DOHB 4D94A 5TPWH 2HVJA 2J55A 1JHKL 1HHHB 3PQYB 4JFPA 2QQNL 4TSBL 5EF2A 3HE6A 1RZIA 4EN3D 3G5ZA 4IU2A 3FU0A 2W0LA 2EUVA 1SLVA 3N1GC 1DQJB 2IAMD 1RIHL 4OCYH 1H0DB 4JK0D 2BFVL 2BNRE 4ZRGA 1DJHA 5KN5B 3PWPE 1E4WL 1BOGB 4LQFL 3QUZA 5KBMA 1LE9A 5TPWL 3NP4A 4KROB 4GIOA 1AZBA 3D3VE 1QBMH 3S96A 1GOFA 2PYEE 2WQ8A 5EU3A 1NAML 1X5FA 4KJWD 1LHZA 3FTGA 3MACL 2A6ED 4NKMB 1OSPL 3FCTA 1ZAGA 2CJTA 2AEIT 4P59L 3ZT5A 5E70A 4F24A 2G2RB 4RMUA 5K1JA 1XDTT 1JZ3A 1Q38A 2Y69B 1FNEA 1S9XB 4UYQA 3I2CH 3FSZA 3N44B 1IEBB 1JAEA 3MX0A 4KKPA 1U0QA 4HPYL 1BZEA 2Q86B 4L8BA 2AEWA 4K8RD 1YEJH 4NEHB 3FOLA 3FTGB 1E4XL 1NCTA 2IG2L 1QQDA 4PJGA 5E1GA 3WO3B 1DQVA 1NLBL 1NCAH 3IJHA 5DC4B 1I4FA 2WTRB 5LDSA 1MFUA 2AJ3B 4G82A 4FCHA 1FNSH 3BVVA 2WV3A 3NIFF 1SHWA 3T2QA 1SN2A 4DZ8B 2F53B 1XV8A 2NY4B 2XIIA 4TQIA 3S5LA 1NMAL 5D7JA 3MCLL 4ZPTA 5GJTH 4MS6A 3EJCA 1DO5A 3C5XA 1JGEB 4UOW1 3P4LA 4D0CB 2E86A 32C2B 4PTUA 5EIVA 5T3ZL 1SY6A 1TVDA 4DESA 1U21A 5IBUB 4L0PB 4MAUH 1AE6H 3LZFL 1A64A 2BLFA 5FO8A 1PG7X 2DM7A 4OV5B 2D7MA 1Y4ZA 3LKRA 3QORD 1EO8H 3H6AA 3IDNA 1PX3A 1JWMB 2XZAL 2BNRA 3QQ4A 2VAJA 3ORJA 2GVYA 1ZE3H 1H3UA 4K73A 5B39A 4NQDD 3QR0A 3NPZB 1UKSA 1E43A 4N2NA 4ODSL 3HI5L 1K8DA 3N5AA 4KNTA 4PUBL 5GGTA 5GGUB 2B9BA 2Y23A 4Z7OB 1R3KB 1G0XA 2VSMB 3WNJA 4YDJA 4JO4H 2GJ6B 2Q1EA 3KYOA 3V6FA 4N5ED 1I7UA 4FADA 3WIFB 2VLJE 4XAWH 3FXIC 2YN5A 3SE3A 4WFFE 2PICA 4J7RA 3SJVA 1N0XL 4GP5B 1TWCA 2JQAA 3MMEA 1BQHG 1CTNA 2CBTA 4KPHH 4KUZH 3J7HA 1GHFH 1WT5C 3DVIA 4MNGE 1W8OA 4EIBA 2VR3A 4JQVA 4E9WA 4F7MA 1UYWH 3PV6A 2D2OA 5CKAA 1X44A 4LPCA 1R6VA 3SZ6A 2P5WA 2JXMB 3HBQA 4KJYA 1RUKL 4I3RH 2SODB 3FQYA 5ECGA 5DZLA 4HWBL 2AQQA 5F1NB 4GBXA 3HZMB 5L7XL 3MRNA 3BP7B 4Z7WE 1A4CA 4AQEA 4UQ9A 2NSMA 1AQKH 1D9KD 1JJUA 4MCYB 4PN6A 4ERSL 3SE6A 1CFSB 2B1OA 2NY2D 3WFHA 5JZ7D 3FQ2A 4YDZA 4Z5RA 2JIQA 1P4IH 2DL9A 4AENA 4AK2A 3FF8A 3VI4B 1EJOL 3V7MA 3KYNA 1C12A 1L0YA 3L9RB 1QLEB 3SGKA 2XBTA 4P3CL 1ZGLA 1BAFL 1LEKB 3NAAL 3BT0A 2AGJL 5KVEL 5F7LB 5EUOF 3GXDA 3SHSA 3QDJA 4P2OC 4ZMTA 3HI6L 4LZKA 2OLDA 4XMTA 4CVUA 2YMOA 2BX5A 2D7QA 1IRAY 3QP3A 3EOBB 4U6TA 4ES8A 2FHBA 2VLJA 3CDZB 3LIZL 5D1ZA 3SCMC 3ARFB 1YEEL 4RMTA 5IQLA 4QI3A 3H2WA 1WUZA 3GSWA 1WFUA 5GRJH 5EPPA 4EZMA 1R4XA 4XPTL 3HS9A 3RNQB 4WWID 2BSSA 1J48A 1NCDH 4R90H 4K9JA 4Z7QB 4NAQA 1DBML 3QIBB 4P57B 4LVHB 2FLMA 1ZEAL 4OD2A 3PUCA 5JQ6H 2XT1B 4HH9A 4HUXB 4JVUA 2MOVA 3GQFA 4LEOA 5C1MB 3MRMB 4QRUB 2X2YA 4L8SB 5KYWA 3WIAA 3UAAA 5CAYB 2WKOA 5FUOL 3ULUC 5GGVL 2AK4D 5C9JB 1AR2A 2PPCA 3SGKC 1QZNA 3D0VB 4BXSV 4E41E 3OLDA 4RFEB 5EOQL 4I9WD 1XAUA 1F8TH 2CIKB 5E0QA 3PNRB 4WU5B 1LEKA 3RZCA 1AXTL 4JN1L 2QSVA 5GGTL 3SD2A 4LSTH 5K9KB 3TYFB 1I3VA 4NSKA 3HU3A 1OD7A 1QPXA 4KO7A 3U0WL 2DQJL 1ZV5A 1GGIH 3GI9H 4N2LA 5T3XD 1T0NA 5IB3B 1T89C 1Q9WB 2DTSA 4PJBB 4RV0A 5C0RL 1A66A 1QHPA 1MW0A 5DJAB 5DQ9B 4PJ5E 3I9IA 1DDHA 2DQFB 3B6SB 3MC0A 2JJTC 3QUYC 4J3VA 4X4MA 2EIKB 5D8JH 3UBXI 1YNKL 3QIUC 3HNSH 3T3ME 4AQEB 4IU2B 3BP7A 3QR2A 1YLEA 2CU9A 1UZ6F 1UWXK 3LS5H 4GAGL 3GKWL 4MXWH 4PRAB 4GAAA 1MCWW 5I18H 2YMXH 1CFMA 4OQ1A 2FEDD 1EHLH 2DWTA 3KPLB 5EG6C 1A6TA 1A9EB 1REIA 3RWJB 4A63A 2RTTA 3FN0H 3OKLB 2WXGA 3KLHC 5EB9A 4YSPA 1X5GA 4WDIB 3PL6C 4WI4A 4OLVH 3U0PA 2NLJB 2VLLA 4HX1A 5KANI 1RI8A 3DX6B 1Z9LA 2GKIA 5IFHL 4NHCH 1IGTA 3WI9A 3IMWA 1FO0H 2ZUSA 1B0GA 4QDGA 6FABH 4DCQB 1DSFH 2FATH 4JQIL 3OGCA 3C60C 3ILQD 2F5BL 4F2EA 4HUCA 5HHVH 2PR4L 1BQRA 1XF2A 1KDJA 2WXQA 4R7XA 4NPYB 3LKPB 3L08A 4ELMF 3CFBA 3QWOB 1TZGH 2WLYA 4PRDB 4PWKA 1KJVB 3TC9A 1MFAL 1GKEA 3BQUD 1ZHKA 5F88B 2H1PH 3QZWG 4E2OA 1IJ9A 5KVEE 5FYLH 3FUFA 3KNBB 2BIQA 4Y2OA 4PJ6A 4XN2A 3RA7L 2VZ1A 1JVOA 2EIJB 3LDBB 4J3BA 5GGSY 3SKMA 2R69A 5ALCL 5T5NF 5MEQA 4LCWD 5I26A 3VWKD 1UD6A 5LBSL 2J5LC 1HSAA 3BEWB 1WWAX 1CVSC 3GMMB 5J6SA 2ZXDA 1N10A 4OLWL 1WA1X 5DUMH 4AYDC 4E9RA 2AI0L 3VCLB 3VD9A 4NENA 3ALXA 1LO4H 3VRIA 3HUJE 4R7NA 3SOBL 1W9XA 2E9GA 3ZKNC 5IGXL 1INDL 1GJIA 2H8PB 4MS8D 4O5LL 4M6ML 3BD3A 4N0UA 1YN6B 2WINA 1IO4C 4KKQA 3N43F 1I4FB 1PZ5B 2WTRA 4OLWH 2P24A 4XP9H 1BXUA 2Z4QB 3WIHL 4AEHH 1R33A 2H7WA 2EH8L 4H0LC 4KZCA 3MODH 2YD5A 3MACH 4HCGA 2NY3C 4WI6A 4DKEH 2VN7A 3UTPE 4OFKA 2ZF8A 2ZYSA 3SBRA 2D3VA 4JAMA 5G5DB 2Z0UA 3FQTA 4EZJA 3G6AB 2AC0A 2G5DA 3F64A 4F80A 2FO8A 4MQXD 2K78A 1MXDA 3SDXB 4TTGA 3C6LD 2V37A 1DQLL 1K6QH 4M6OL 2GIMA 1DUYA 4OGAD 4RA0C 1QTSA 2XG4B 2WANA 3E9UA 4JS7A 4PJ7E 4HT1L 1F41A 2XI9A 1P7QD 4JHUA 4LMQE 3VUAA 3ZMEA 2MNWA 4YZWA 3FFCE 4Y1AB 3TBWA 2AVFA 3IMUA 3JUZA 2YPLD 2Z1PA 3QZBA 2H32B 2DWSA 3N0PB 1M1XA 4R3SA 1KFAL 4QXWA 5E94B 5J06A 4F8PA 4AMKH 3LQAH 3ECBA 2TAAA 4KZDL 4PG9B 1JDAA 5AG9A 1G87A 5D1XE 4WZ9A 4X0KA 1WD9A 2EE2A 4AGNA 1Q0XH 1P7BA 2E46A 2C9SA 3ASNB 1IARB 1C5DB 1X4ZA 4OVVA 3CFUA 4R97B 1HE7A 4LSPL 1JZ2A 5FYJE 4NRZB 3Q1EA 4P9HH 5TF1H 3HB3B 3V0VA 3E8UH 1LEGB 3FTVA 4U1JA 1AO7B 5KBNC 5ESQB 3O45A 4CVXA 1A4KB 2ITDA 2YBRB 4Y8DC 1HEJC 5HGGS 1N67A 1Y1DA 1ZYRD 1AY1L 2QMKA 5G4NA 1NC4D 2FE0A 1NC2A 2KPWA 2JB5L 2IBZY 2XTJB 3MVSA 3OPZH 4HKZA 4KKNA 4L3AA 5AB2A 4YFDB 2MFNA 3LQMA 2BVEA 1MRCL 1BMZA 4OZHB 5BUGA 1Q9LA 1CGVA 4K3EH 2FJFA 3MLWH 4O9HL 4TSAL 4XNXH 3HG1B 5JOPD 5DMGD 1OWRM 3KXFE 1AANA 1BPVA 4IW4C 1HTYA 4X6FA 5GS1B 1CGUA 1C5CH 2EYRB 4HK3J 1OSYA 2F54A 3OAUH 4PGDA 4QHMA 5MENA 1MI5E 2I9TB 5KUMA 1FLRL 2C9RA 2F08A 1IQWL 3SE8H 5FYLD 3CZJA 1C7SA 4L4VB 4OGYH 5KJ7E 1RHFA 3DMMD 1KYAA 5I5RA 4LRNL 1WP6A 2YEZA 2ZCHL 1FN4B 1SPDA 2O6FA 3HZ3A 4O4YH 5FXCH 3TIEA 2WPGA 3FHAA 3V5DA 1M7UA 1RURH 3KR3L 3MR9A 4CNIB 3BDYH 1FPTH 4LLWB 3Q2LA 1K85A 1PKQA 4HG4K 3D3VD 4TTDD 3AU1B 2N59A 2EDLA 3IN2A 3CBJB 1GC1L 3LZRA 4TQHA 1QFPA 4AYBA 2CALA 2BDNL 2WZ5A 5C2BH 2O61A 1XZWA 1CLYH 5EHFA 3HEIB 5TFSH 3APFA 1NBZA 3NGBB 3GMPB 5C08B 1D5BB 2WXPA 1MZYA 5E8OA 2MMXA 2QSCL 1MLCA 1U2YA 3APMA 2OAAA 2XV2A 3B5HA 4BIKA 4G8FA 1FYTE 5JUEL 4TQ8A 3MR9B 1BYNA 4PBWD 3GJEA 4FFWD 3JTTB 4H13C 5AYQA 1YVLA 5AVYB 3ZTJH 1AOZA 2D7TH 4HF5L 5AQ0A 4LK4A 1OKEA 2HTKC 3O2VL 3Q13A 4IM8A 1W0VA 1DEDA 1IBYA 1KBBA 2GFBA 4E9TA 1RZKL 1XD1A 4G9DA 4MNQE 3PWUB 3ARZA 3K6SA 4PJEE 5CGYD 5K9JL 3QPXL 4JQIA 1RLBA 2WZAA 3RB5A 2AI0H 2VQ4A 4KODA 3OZ9L 2QSQA 2Z9TA 3DV6A 2GJZB 5JTWA 1CI5A 3H42L 1AQKL 5DSCB 3VH8G 1N5AB 1DZ0A 2YWYA 4XBGA 3LMJL 1L0PA 2GC7C 3KJ4B 3NH7L 1AJ7H 3STZB 4UOZA 3GJFK 2I5YH 2VRQA 3BDXA 3AJ7A 4ZUVB 4BFOA 5B1JA 4MA3B 2OMUB 1Y6KR 1HH6A 1IEAA 4OAWB 3SBWC 4K23H 4NO2B 3W5MA 2X6AA 2J71A 3SDCB 2CMRH 3V0WL 5J13B 4Z7OF 3LKSB 4LP5A 2GITA 2OP4L 2JKJA 1YN7A 4Y4HD 3RL1A 1G5AA 1ZXKA 4GO9A 1G1OA 4W70A 1A4KA 2ITDB 2YBRA 5ITBL 4WFEE 3AS2A 1UD8A 2ICWB 1EZVY 4LP4A 3EO1A 4TUOA 5D7LB 4G43B 5LXGH 1E28B 1ETB1 1L7IH 4Y5XB 3TYGL 4JFOB 3DGGA 4F37K 3NCMA 1F0LA 3B2PA 5C9JA 4OZFH 4BD4A 2YAQA 5D7SH 4XH2B 3LSOB 1DANT 3DIVA 1UT1A 1QASA 1WCMA 3BKJH 2H1LM 4GEIA 3WAJA 1GZPB 4TXVB 1IM9D 2WAQA 1Z1WA 1NANH 1U8IA 4JR9L 4HUWA 3L6FB 4HZAA 4FA7B 2MNUA 4UQ3B 1A6WL 2VC2L 1RJZB 3SKJL 1DQML 2ZG3A 4RWYH 2X70B 1IILE 1S3RA 1U3YA 2QQKH 5EUOE 3VB8A 4GSUA 1WWWX 2BOBA 1J9TA 3OAZH 2ICWI 2Z34A 4HS6A 2M26A 2DH2A 1SDDB 1FHGA 3BP4B 1YEHL 2WZ6A 4U1HA 4X7TA 3RX7A 3H9HA 1LO2L 2AV1A 3IKCB 1E4HA 4FS0A 4OGZA 1O7DE 2AK4A 4XH2A 1EHKB 4CN6A 1VFAB 4GIAA 3US1A 1NGYB 3FTXA 3QDJB 1RJLB 2VLKE 2E7LA 3VFUB 5DRWA 3DVGB 2VXQL 1YQ2A 1OM3H 3FQTB 2GPZA 4G8FB 2VQTA 3GXNA 3ARGC 4ONGH 4KK5C 3M6DA 2YSSA 3NSJA 5H35A 2BFVH 5E6YA 2G60L 1ZA6A 3I74A 4YLBA 4HKJB 4X6CA 4ELMB 2F5BH 4Y4FC 2KBGA 2YD4A 2BVPB 4QRRA 4YZFE 2VABB 3W1ZA 4MXVF 1JFQH 2V0AA 1M4KA 3RGVD 3UTQB 4PJ9D 1J10A 3WSQH 1VCAA 1NKRA 1B4JL 2H3XC 4IRZA 1HXKA 4JHAL 2XQYK 4BDVB 2V4LA 2YJLA 3OAWA 2X4PB 2ZOLB 2DS4A 5D6CB 3WXWH 4JQVC 3OC8A 3VH8B 3DVNA 5IWLA 3SPGA 3INOA 2NX5A 4HIJB 5ICZB 4OGYL 4ZW8A 1FE8L 3MLSH 2H0PA 4K9EC 1MAKA 3E3QE 5EEUA 3NABH 1H15A 5BRPA 1KFGA 2H2SC 1L9SA 2CD0A 3QEUB 4P06A 3PABB 5T1LB 4GG6A 1AI1H 1JZGA 3C6SB 4RX4D 4JM4L 1FRGL 1UGNA 3ZE1E 4PREB 3SOBH 4PGDB 1MJ7L 1UD2A 3T6VA 4N2OA 3D85A 4EO5A 3AABA 2XWBB 3KGUA 1PBYA 2Q3ZA 4R9HA 2VKWA 5TDOB 5AVVB 1NCNA 1CGXA 4B5EA 1UUNA 4S0HA 4HXAH 5LDUA 3QIWC 5CO1A 1HXMB 2VQ1A 5CD3B 4WV1A 3CVIL 4KRPC 3CFEA 2P5PA 1FG2B 4PS3A 3WDIA 1QUNB 1LQSR 1NFDA 3SGEI 1X4XA 2PPEA 5IHZB 3DMMC 1XGQA 4IGBB 2P5WE 4I9WE 2UWEF 1XF1A 1JI2A 3BISA 1MFAH 3HS0C 4CNIA 4I7ZC 15C8H 2Y7QA 3ABKB 4PGCA 1U6AH 2HG0A 1BJMA 2C9UA 3IDNB 2FUQA 4H0HB 4MAYD 5HTSA 1T20A 4PRPD 5D2LA 3D07A 4J2XA 3DX7B 3ZDZF 4FHJA 1XR8B 2BVUA 3Q01A 4X6CE 2F7PA 4XBPA 4WSJA 4HPHA 1KCSL 1MJJA 6FABL 1GZHC 4L4VA 4M1CC 1XGPB 4PR5B 3MLTB 2VIRA 1IAOB 4LPVA 5H37H 5ETUB 2P8MB 1MY5A 3ECQA 3IEAA 2P46B 4DIXA 3JWNH 1HIMH 4AM0B 2ZKHH 1MNUL 4NBYB 4YHLH 4DZ8A 2WNKA 1GIGL 1AG0A 1IAII 1SFDA 1W16A 1V05A 5CP7B 3L95B 3F00A 4KK8C 2PR9A 3S3JA 5IB3A 4RAVA 4FG6C 3FQ1A 2HVBA 3BD4A 4URTB 1QDNA 4P4KB 1MCBA 1R24B 2HLAA 3HCVB 3CF2A 4LSVH 3UH8A 4LASH 3QQNA 3HLAB 4PB9L 2FJGB 3SCMA 3TT3H 1XEDA 3QI9D 3D4CA 3RY4A 1MI5A 3TEUA 4XVOA 3H85A 1NQBA 2HT4C 1D5XB 3CH1A 3TVMC 3IK2A 2NY3D 2JVUA 3IAPA 4JAMB 3VFVA 1DJZA 1CFNB 1C7TA 1VADB 1M9SA 2JB5H 1NCJA 2DQDL 4P3DA 4PP1C 4F7KA 3EG9B 3DO3A 4HUXA 4P8QA 1EA9C 1MFCL 2UZYA 4N20A 3RWHA 2Z4QA 5KS9F 2L0DA 4AOKB 3EH5B 1OA7A 3KL3A 5DVLA 1GZQB 3X3FH 3QEQA 2JA6A 1YN6A 4JFZL 2I25N 4PG9A 4HXBL 1Q90A 3IDIA 1OE2A 5KYXA 2SEBA 3HS0B 1AGDB 1I1AC 3EBAA 3FSWA 1PTZA 4H5SB 3ROOB 2LQRA 4UTBL 1FDOA 1CLZH 2BERA 2H32A 3VI3F 2EXYD 1PYWA 1JV2A 1UG9A 3T3MF 5GJSL 4F20A 1XGPA 1JZIA 3S8GB 4LGPB 5I8OL 3NRPA 5JIMA 4JO1H 3QIWB 1W6LA 1HSAB 2FL5B 4RFNB 3T65B 2J44A 2IALA 2BM3A 4WQOA 5JHLA 3BQUC 3RVWD 2HMIC 4XPBH 4NM4L 5IESH 4X5LA 4Q9QL 3QNYB 1LDSA 4A7UA 3G5YB 1G1KA 1QSED 5DEGB 1TZGL 2Z31B 2CGYA 3CZFA 3L4YA 4NT6A 4M48H 1Z9SA 3CZUB 3QWOA 1NFDB 2R0LL 3MGAA 4MNQA 2OXHA 3U2SA 4ZFFB 3U1QA 3PWNB 3GM0A 4G11A 4YIQA 4A2LA 1YEGH 3B2UD 2E7DA 4TQEL 3QEGL 5DWUL 5I74C 4M62L 4JMXA 5C97A 2VLKB 2COVD 4L9LA 3NRQA 5JIQA 4EUPB 5AVSB 3SBQA 2Q7AA 1PS3A 3VFMA 4XVJH 2YK1L 2XZQL 2VZOA 3HI5H 1AA6A 4AE0A 3M46A 4JPQA 5HGAA 3JVGC 4KXDA 3GB7A 2VDLL 5F1NA 4KROD 5BQ7B 5KW9H 3WSQL 2FGWH 3WEMA 1L9PA 2P5WB 3IXTB 4NFCA 3RTQD 3BWUF 3KPQB 4ZMVA 1U95B 5C3TA 2WQSA 5K9JH 3ZPDA 1BF8A 4Z76A 1FNGA 5HSFA 5HJGA 3SE9L 4LKCB 5K69A 3RGVC 3MO1A 4HC1L 4E41A 3EO0B 1OP9A 4CSTA 3EZ8A 4N9GB 2H3NA 3GRWA 4XO8A 2K1MA 1FO0A 4E9SA 4LHQB 4NO0D 1EU1A 4AH2A 2WQRA 1T04B 2G5BB 3BAKA 3NSCA 2VDOH 3FFCB 2C7UB 1Y18A 1Y6MR 4FP8L 4JFEE 2G0KA 4LARL 4WW2C 2X6UA 2CAKA 1UASA 1EXGA 3L13A 3UTQA 2WWNA 2KI8A 2BSBA 3KVPA 4H1LA 3TO4A 3LDBC 4RLDA 2QPEB 2NY7H 5EBMB 3WS6C 4C56E 4G6KL 3L5JA 3RIFF 3AM8A 1M05A 4M4RB 4OQTH 2D3NA 5B39B 2FGZA 3QXWA 4P2RA 3OKOA 3C08L 3HN8A 3PY9A 4KQ3H 4Q6KA 3UO1H 5I17A 5C0GB 5EC2B 2PP8A 3S3DB 4XAKE 5DJZA 1FL3B 5EZJA 3U1SH 4LOVA 3E38A 4YHZL 2O5JD 2YOCA 4X5XB 4LVOC 3FSAA 3PWLA 1KTRL 3AWEA 3MV8D 5F3HA 5KZCD 5JXED 3V0DA 1UWEH 2H47C 3IU3A 4YDIH 4I77H 1ZEAH 2BSTA 5HJ3A 5JQ6L 3RDJA 1R34A 1JGEA 1TIUA 2PNWA 1XVSA 2YQGA 1NBQA 2V8MA 2QADC 3QI9C 3ZDYB 5L2JA 4L48A 4WEEA 2BIMA 2ITEA 3PL6B 3TF7C 3X2QB 3UG5A 4LAQL 2QGEA 1RIHH 2AQNA 5FYLE 2IPKA 5CEZL 2OJZH 5CCJA 3HAEG 2X9YA 1RQ5A 1Y5IA 4MMXA 3U9UA 3W9DA 1G43A 2A9NL 5CIPH 5L2KA 4HUWB 1I7RA 2CKBB 2JELL 2H32H 2YWZA 4JJ5A 5I66A 2PCXA 3VM5A 2UWEB 2W0KA 4OB5L 5DJ6B 4A2FA 1ZTXE 1H5BA 4XTRC 1JUFA 4KITB 4CADB 4AYEC 2R4SL 1V7NL 4ORGA 1J8RA 4RQQA 4TS6A 4D7PA 1IFHL 1A4AA 4JFEB 4AYID 1A3QA 4I4WB 4OF7A 2ZKHL 3FT3A 1MVUA 1FORL 1XL6A 3CVCA 2V33A 4PRHB 3ZDZB 1MQKH 4YNYB 3O6LL 1FSKB 4MLSA 2VM4A 1AHKA 1R3HB 1NFKA 4CW1A 1NCAL 3H1ZA 5FB8B 2KS0A 3HTLX 1UACL 4JZJA 4RQQB 4MQ7A 1Z32X 5C0EA 1CGSH 1IBFA 3LH2H 4D9RE 5FECB 5T8IA 2K9FB 5CN1A 4YSEA 1FWXA 4MA3A 4YGVB 1H8SA 3C9NB 1TR7A 2H0EA 1T1ZA 3I2CL 2CJSA 4JFZH 2CG9X 1AOHA 1RZJH 3QSKB 4IRSA 5D7KD 4PJEB 5EPMB 5LN4A 4QKXB 4WEBL 1FP5A 5DHEA 3NPSB 1AS8A 4XMXA 4UBDC 5TE4L 4B3EA 2IVFC 2VZSA 1IL1B 2HVJB 2FO4A 4LRIC 3PG2A 3KG5A 4DUWA 1T03L 3HE6C 3NZSA 1G7PB 1MSPA 3RDTA 4Y5YB 1NFDE 4RRPG 4IRJC 2V2XB 3STLA 1S9WA 4KUCD 5I75B 1NAMB 3V0GA 2OA9A 5DMKA 5IROC 3GXUB 4FQXB 2FX8L 1Z2KA 4P4RA 1ZWIA 1KCVL 4Q4IA 1UWXH 1RURL 3ARFC 1Z9OA 2K7QA 4HS3A 3MOAH 5CJXC 3VGEA 3OKOB 2YPKB 4P2RB 3P4OA 2ENYA 4JGNA 1OB0A 2H5UA 1RLWA 5IW1B 1EERB 2IQAB 2F19L 5C6WH 1J9CT 4ZYKB 3UZVA 3S7GA 4OI7A 1X7SA 4PUBH 5IBLD 2TRYA 3BZ4A 2VISB 4X6BA 4Q9RL 5F7NC 5AUMA 3QBTB 4Q6IC 2A1WH 2HJFB 5CIPB 1YNLH 3JVFC 1DQDL 1SY6L 4Z8FH 3ARFD 4JZOA 3RZCD 1QFOA 4G6FB 4PTTA 5CILH 3V4VB 1CTMA 1T7VA 3TV8A 1NGZA 5JHLL 4OF3A 1ETA1 5F0JB 1Q94A 2YD1A 3TWYA 3O2DL 4X4KA 1RUML 1C9SA 2NTFA 3GBDA 4JUSA 4WK2B 4QNPE 4Z0XB 3VFOA 5CSGA 3VXPA 5EO1A 2OR9H 1PD0A 1EJ8A 2WYZA 3GBML 3V52H 1RERA 2XSKA 5ABZA 1VZHA 1GOHA 2NY0B 4HUVB 2ISDA 4PJFA 2RHEA 4YAQA 2YA0A 3JV4B 1YCSA 5LGKA 1JS4A 1WC7B 4PS7A 4KK9C 4TM9A 4UU9A 3VWJC 3WFZA 4F15C 3FTUA 1KXQA 4X6FB 5GS1A 2XY2A 1H3WM 1N6VA 1TNMA 4U1KA 4ZI8A 4ODXB 4NLHA 1LVEA 4FQXC 1OEZW 4HIEA 3O3AA 1ND0A 1KXHA 3D12B 2ATAA 1ZIBA 5EO0B 1HKLH 1XGYH 5AVZB 2E2IA 2WCPA 5MHSD 4Y19B 3BW9B 3GIZL 3UPRB 4IEFB 4N4YB 4LFHD 4KTDH 1IKNC 2K0RA 3ARWA 1PLCA 5TE6H 5HBBA 1L6PA 1TSRA 5ESQA 3BDBA 1HNGA 2WBWB 4DUXA 4O4YL 4DK3A 4JR9H 4BZ1A 2IEPA 3STBA 4CS0A 1RZFL 1YMME 2CO6B 3CDFA 2CLVA 4J6IA 1JF6A 4RMRA 4NKDB 3P11H 3K80A 3Q5OA 3T65A 4QT5A 4NKMA 1E6JH 3DHUA 3QUMB 2ZG1A 4Y19D 4JREC 4GMSL 5I1AB 4WAFA 1J0IA 1BQKA 1YEEH 1EDHA 3G9VA 4XMLH 1XQ4A 5SWSB 3LNIA 3EW3B 3CC1A 4QIWA 2BW4A 3K0WA 4XPHH 3EFFA 5AVXB 4F2MB 1N8ZB 1PSKH 4HWBA 4OH2A 1QO3A 3ECBB 2QMJA 3I50H 3QWZA 3KLDA 3QHZL 4DMRA 1G9NC 1I53A 4L3ED 4AVIA 1DQJA 1N0LA 4BSVA 1ACYL 2AEQL 4Q52A 4YSDA 3IFNL 4AIOA 5JW4R 4FXTA 3AQZA 3X13A 2PXYA 1HHHA 4JFPB 3FAWA 4OY9A 4NQXB 4EDWL 3ENEA 3WTXA 1QQDB 1SXAA 4RIRA 2CJ3A 1E32A 3QUMA 4N86A 2AK1L 2H9GB 4Z3HA 4XHJC 5D96B 4BUGA 1M2OA 4AKOA 3H2QA 2NY4C 3FUMA 4LGSB 4KMTL 4AEFA 2YD9A 5FO9B 2NQCA 4PEEA 1FZOB 1D5XA 1DUZA 1WZ1L 3CH1B 3W9EA 1N9PA 5K93A 1MWAH 2XN9D 3HG3A 3MOQA 5IFAH 5K9QG 1R3IL 2ADJA 4FNLL 1WEJL 5L88H 4E0RB 1XBRA 2DYPA 1BGXL 5BZWA 3VFTB 2PPAA 3RY5A 4F7CA 5I6LA 2VE6B 3F7YB 4WTXA 4Y19A 5C0AA 4G9FD 3KBPA 5GGVH 2IADA 1FFRA 1WFTA 2FK9A 3D4ZA 5E9DD 4ZXBA 2X0VA 5L7XH 4FNLH 2V6HA 3ABMB 1HINH 5L88L 1OXYA 2YPLA 3C6LA 2CK0L 1WUNT 2AV7B 4GSQA 5EULV 3N1FC 2NZ9D 1F56A 4OT1L 1PG7H 2RCSL 2WLIB 1TSHA 3II1A 3MBXH 4P4KD 4RSYA 1NMBL 4YC2C 2OL3B 3JV4A 2QLVB 2QQLL 3QDGD 1L6ZA 2VXVH 5FYJL 3PQYA 3A23A 2P8PB 2R1XB 5EZLB 2JCCF 3SKNA 3EJTA 1PMYA 3WNLA 4DNLA 4R4BB 3PWJB 2CDFB 3G6DH 3SYAA 1OK0A 1GGCL 3Q2WA 4PG2C 5DJ8A 1BZ7A 4J39A 2XC8A 1ZT4B 2FZ3B 1A02N 4FQ2L 4DVRH 4JRFA 4D9QE 4JQIH 2LOEA 2VR8A 1I9IL 2GAEA 2DBLH 4KY1H 2XCMC 2WKGA 2DRUA 1SF5A 5D71L 2NY1C 3ZE1F 1ZJAA 2IH9A 3KCWA 1T3FB 1BECA 2GUOA 3LKNA 4RGND 4UDUA 5C0NC 3ZUCA 1TCMA 3T0BA 4MSWB 3RGVB 3S97C 2HFEA 5FM8A 2AJXL 2F8XC 1QR1A 3EFDH 4M62H 4DTGL 2HH0H 4HZLB 4MASA 3MCG1 5E5MB 1DQQB 1N70A 2IANA 2VLRD 4ZMAT 2XA3A 5JPMC 1A7PH 4ABUA 1A8JH 3DJRA 3QZNA 1ECZA 5CN2A 1OCCB 3PDOB 4W81A 2NXYD 1RZ7H 5AL0A 1VESA 1KF9B 4X5WB 3UAJC 1CGWA 3VFGH 2CRZA 5TF0A 3T04D 3VX0A 3TZVD 1F6FB 4OCXH 1GS7A 2AK4E 5T1LD 4L2LA 3IT8D 4KDWA 4E41D 4MB4A 3AS3A 3U4EB 1NPUA 3BRDA 1HEHC 2EEXA 3D2UA 1XGRA 2IMMA 2M8XA 4A2EA 1AZNA 5DD1H 4JFFE 2VDMB 2EVIA 4EOWL 3NCEB 3KPRD 4XP1H 4J8RA 3QJUB 1AGFB 3B2MA 4WY7H 1XCQA 3RWIB 3GTKA 3NTCH 2EXTA 3HE7A 1KYUA 3LH8A 4KVCL 4RFNC 4A6YA 4OZIF 4NSKB 2HX8A 3FUKA 2CPCA 1F58L 2XHNA 2Y2TA 3AMKA 2CUHA 4WFHE 3IDMA 4N8UA 3FQUB 3N06B 3VGAB 3ASWA 4ZK8A 4X98A 1MVUB 3QDMD 3NIDF 5LCVH 4QOKA 2GBTA 1HWHB 2JJTA 3BGMB 3GEWB 3RWDA 4JFVA 3HC2A 4LBEA 4KTDL 2QT6A 3CC5B 1B0RB 5HI3D 1E27A 4OIAA 4R4FH 5EZOL 4QCIA 4BK5A 3OTTA 4MA8L 2K45A 2IBZX 2RALA 4ELKB 1PJWA 4OJEH 1FLTX 3TJPA 4M43H 5E8EA 1I1RA 1FIEA 4MMYA 3Q9QA 4NC1E 3QUMH 1U41A 4LL9A 4YBLB 3SYQA 3WDJA 4JKWA 4KRNA 4NJAH 3UCRA 2J72A 2WTOA 4F91B 1K2DB 2WXFA 4Y16A 3IDUA 4HJ0D 3GSUB 3JWOL 3D39E 5L4MA 4MJJA 4CA4A 4KXZI 1GZPA 3E8UL 1IBDA 1ZHLB 3TASA 4ZW3A 1L4IA 3TNMA 3EYFA 3KL0A 5HHXL 4UT9L 2ZXBA 3BN9D 3VXSA 4OFQA 3O8XA 1ONQA 4NC0B 4P4KC 5FGBA 3DUUA 4HAGA 3UBXB 5DJZB 1I7ZB 3TBBA 5C70A 1WFJA 1E9QB 2QKSA 2YC1B 2JA5A 2YPVL 4BFIA 4YXHH 5LLIC 5KJRL 4ANVA 5IB5B 1GVIA 1E7UA 1KEML 2YIHA 3D2TA 5F8RC 1CZ8H 1GJWA 4MLIA 1CBVL 2OCCB 2PTTA 2AP2A 3OSKA 4P23B 4OAWA 1KQFA 5B1CA 1TWGA 3MAWA 2BPBA 4OD3H 5SWZA 3Q6FB 2Q6WB 3LVTA 4LCIH 3S3SA 4JM0A 1G7HB 5DHXB 2F58L 3VXRA 3KPSA 3MUJA 4HIIA 5JIKA 2ZNWA 4FAAB 1CFSA 1R0AH 1NFAA 5DSCA 1N3NB 1W0WB 2VCOA 4JCLA 3T2NH 1OQOA 3ULAB 3RX8A 3PWPB 3IR7A 1GHFL 3OMAB 5D2NA 4LSQH 2EZ0C 4JVPA 1ODUA 4POUB 4WSKA 4BZ2H 4HSCX 2Y2YA 3TBYB 3GMLA 2YUZA 4P23D 4PJ8A 5KYYA 3DMMB 3T0ED 1MLBA 5AZ2L 2ENPA 5IF0A 3GUTB 3ARQA 2PXYC 5CBEA 4DGYL 1IQDA 1ROWA 2XYBA 3DPDA 3ZZ1A 3MLYL 3PDOA 4B9FA 4NO5B 3F62A 3I9PA 2ZOOA 3I6KB 1LDPL 1E18A 3GYRA 5KBKA 1WFNA 2O26U 5C0BE 1QSFD 4P2AA 5E1QA 3VXUB 2A6JB 2WMPA 2UZIH 1M2VA 3VQMA 1JCVA 3FU3A 5HI5C 2BY0A 3T0EB 4NWTL 3TZVC 1NAKH 1R9TA 1I7UB 2VDKL 4Y7MA 4AGMA 2HCZX 5AD0A 4XHQA 4DVBA 4QJ4B 3MRKA 3QJFB 3GKWH 2HT2D 3QIWD 4MXWL 4N2DA 1CXIA 3ZKXB 2B4CL 4GQZA 4UANA 4ZOAA 2GI0A 3X2IA 1JWUA 1MG2C 3QQ3A 1NC4B 5EOTB 1AD0B 2QPSA 3L5WA 2ZUVA 4ZAKA 1PKQB 1THCA 2DQIH 3S48A 5IVXB 1HQRA 4F3FA 1A3ZA 1HL5A 3JYCA 5HDBE 1UUSA 3CVHH 3UG4A 1YRKA 1C08A 2OJEA 3P40A 1E50A 2HLFD 5ILTL 4ZDHB 2DZEA 1JYXA 2KDYA 3QCVH 1AGBA 5ALCH 1TEFA 4OD1H 3UADA 4PTUB 4KKZA 5HVHB 3MRBB 3KJ6L 2Z35B 3T5WA 2BCKA 3U7WL 2GTWB 1JV2B 1UT2A 2EACA 5IK3A 3UZQA