4FG2A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellotetraose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg2A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg2A02
3M3GA 1WHPA 3SUMA 1L8FA 1OA9A 3X2KA 3FT9A 5GM9A 1WC2A 2HCZX 3X2HA 2GAEA 3X2LA 2PI8A 2AE0X 4ENGA 2KQAA 3X2MA 4ZM7A 3CZBA 3X2NA 2PNWA 5GLXA 1BW4A 2ENGA 2VXQA 1OA7A 4JS7A 2G5DA 3D30A 1BW3A 4AVRA 2PICA 3SUJA 4L48A 4FERA 4JP6A 3X2OA 3X2GA 2JNZA 3X2IA 1HD5A 3X2PA 1WHOA 3SULA 2BH0A 3SUKA 2PJJA 4FFTA 3FT1A 5GLYA 5H4UA 1N10A 3ENGA 3X2JA 4JJOA 1BMWA 4JCWA 4JP7A 4FG4A 2G6GA 4FG2A
chains in the Genus database with same CATH superfamily
4ODTH 3V5KB 1C16B 1FL3A 5A16A 5C3TA 2HB0A 2NXYD 4H1LA 3DVNA 4Q9RH 4OTXL 5E4IA 2XA8H 3ZQXA 1E8WA 2GK0A 3MR9A 2Y7OA 2QSCL 1PCXA 3G04B 4X7DC 5JUEL 4KO7A 3A5VA 4B9KC 1FAIH 2PCFB 5I0XA 1OCWH 4JZJB 3LPOA 1SDDA 1JYXA 1R19A 4C57C 1WA2X 3ARRA 2AQTA 3TPUB 1KEML 4CS0A 2IH3A 2XX1A 2NQDA 4MJHA 2EDJA 1S5IH 5TFSH 4EBQL 4HGWB 4JKLA 4HHAB 4DEWA 5KSVA 3KBHE 3J8F7 1NCCL 1PKQB 1U30A 4CNIB 3E80A 5HYSA 1ZPLA 3CN2A 2WB1A 2NY4D 5EOTB 1OSEA 4K7FA 3G9AB 4JPSA 3QIWD 2L3BA 4R4FL 2XXFA 5JORB 3S35L 2ADIB 4JKKA 4MDJB 3MACH 3PL6A 4F7CA 3OJ2C 4IRSD 4NYLA 5LCVA 2Z6FA 4RGND 5H35A 2O6DA 1MFDL 3FO2A 1FPTH 1I3VA 2NQ3A 4UNUA 3BXNB 1D2OA 3VFGL 4MDIA 4UINL 1R3IL 1XIWD 1VRSA 1UHDA 1WHPA 4GUQA 1D6EA 4I8DA 1D9KC 2XIIA 3BZ4B 2HT3C 3CTTA 4PJXB 5T5FL 4U1NB 5CSZA 1BGXH 3C6LB 1DHKA 5CHNB 3RTQD 1PGRB 4JO4L 1P5VB 3KBEA 3CVDA 3QQ3A 4ZFGL 1BLNB 1S7UA 5EORH 3GIVB 4B5ZA 3LKSA 3VFTB 3SE9H 1RK1A 2BVQA 1JPTH 1PAMA 1VAHA 2YKLH 5IQOA 3TA3C 1SGKA 5HVGB 5CJQH 4UM9A 3UTQB 3LIZA 1CFNB 4RSYA 3JWOL 4EIBA 4YDIH 2P24B 3V4VA 1S6NA 4J23A 5F0MB 1PSKL 1YNTA 1H0DA 4TNFA 4F8PA 4RWYL 3IGKA 1A5FH 1DJIA 2D7NA 4X5WA 1BZEA 4HEMA 3OJMB 3GDCA 5TDOA 1ZCRA 2Z35A 3F7VA 1ZLSH 5EU5B 2ZX7A 3EGXB 2CCWA 2FJSA 5IBUB 3EF7A 3CXFA 2QHRH 3L7FB 3KPMA 3UO8B 4F58L 5BS0E 3H56A 4MGXA 5E5MB 3T0EC 4XPAL 1KJ2B 3CSYA 3I9GL 4S0TD 1JRHI 1OD9A 4Q74A 1KQGA 4NQDD 1LTXA 4MWFA 4NX0A 4HU2A 1HXMA 3RA7L 4WHDA 3G5XA 5CKGA 4FYSA 4L3EE 4H4NA 1K3IA 2Y07H 4FG2A 3DX3A 1S7RB 3O9WC 3FOMA 4ZUTA 3D39E 3Q6GL 3GMRB 5DA4A 3OHXC 3UACA 4W9DC 4AIZB 3STLA 2GT9B 1UGKA 3TA3B 3TBVA 3KPRA 2X4OA 4AIOA 5AW7B 3MJ7B 2B14A 4UQ9A 1MCQA 2I5YL 5JXEA 3QUZA 5TDPB 4QHUB 5ESVA 1QNZH 1RUML 4M7LH 3MUY1 4OZHB 2OW6A 1IT9H 3QNZA 4PR5B 1Q9KA 2X1OA 3MA9H 1BEYL 1SEQH 4YL4A 3V0VA 1O75A 2EEDA 2GQHA 4MA8L 5FYJE 3GC3A 5DA0B 5I15H 2I9TA 1A7PH 3MRDB 3WJLA 1R7RA 2VDKB 4IHOA 4GSRA 4X4YA 3V5DB 1YA5A 4PIBA 2J12B 3X2LA 3TH3T 2LLLA 1XGRB 1LEIA 1JP5A 3QEGL 2PUQT 3PQYB 2F1AA 3II1A 3HZ3A 5E9DB 4O4YL 4Y19A 3FQRB 3TVMD 3VDBA 1S9VA 4R4ND 3VGDA 2XZZA 4XCEB 3V2AR 1AY1H 1Z6JT 3OJDB 1UATA 3FB5B 4RSVA 4Y88A 5EF0A 3LRSB 4PGEA 2UX6A 1P4BL 4LLAA 2A5UA 2NCEA 3ASNB 7PAZA 4GAAA 1B6UA 3BAKA 1SYSA 1JGVL 2P5EB 1YN7A 2R83A 2QT6A 3Q8AA 5JOFB 3M17B 4N2MA 1QVOA 1TTFA 4OV5B 4IDJH 2B9BA 3L9RB 4WI4A 3CDZA 3BWAB 3JWNG 3QWZA 4R7VA 2XIBA 1ZXQA 4K94H 2R4RL 3EJQA 2CDFB 4OU3A 4Z3TA 4TVPH 1Z3GH 2JELL 4RZCA 1A65A 1KCUL 2P8MA 4H1LH 5DC0A 4HP5A 3C2SA 3KH3A 3MXVH 5IVXE 4JN2A 4JZOB 5F9OL 5KJRL 2GSMB 5MENA 3VD0A 4XBGA 1QBLH 2PYEA 1KTLA 4QYOA 1CG9B 3GM8A 4PRIA 5LBGA 2EC8A 3IJYA 4KK5C 2CBOA 3AT0A 1LDPL 4N2LA 5HSFA 4D9RE 3NT0A 4IMKC 1D7CA 3LEYL 1NCGA 2OSXA 1ZT1B 2DL9A 3HPJA 3KPLB 1KB5B 4X6DB 1SM3L 4F2EA 2ODIA 1KLGB 4QWWD 2FSDA 4AW4A 3ESMA 1G9MC 3QORB 5D4QA 1F00I 4JRYE 4DQOH 2JLPA 2VDLL 4LVNC 5I76B 5IT2L 1A7OL 1G84A 2BERA 3FFDA 4G7SB 2DQCL 3EOTH 3T8XB 5TE7H 1LXMA 4HEPG 3WOVA 1EAPB 3IDXL 3G6DH 2EDYA 3MLYL 5HGBA 1Q1JL 3U48A 3QDHA 3K5RA 4M1GL 1QSEE 2A73A 4LRIC 2BSTA 5D2LA 5K1JA 5IVXF 4PTTB 2H2SD 2FD6L 3DUSA 1G0DA 4JFUA 5C0JB 4WV1A 4YPGA 5AKSA 5LCVH 2P8LB 4FQHA 3U0PB 3DMRA 4M6NH 3ZY7A 3BZ5A 1IZKA 1FO0B 1J1PL 1G7QA 1UD5A 3W1ZA 2ZXCA 3ZUNC 1F4HA 4QGTA 5E24E 3JV6A 2WQVA 2YQBA 1FBIL 5CSBA 5IBUG 1QMUA 1IM9A 2IGFL 5F1OB 5IJCC 1DQTA 5DYOB 2J8HA 1H6TA 2PO6A 1X4XA 3B3IB 3GMNA 3FO9A 3KCWA 2D4FA 3GIZH 5CD3B 1UXLA 4TSAH 1UTDA 5BRZA 3KBPA 1IKOP 1EK3A 3BKCL 3PHAA 5AW0B 4WEBL 4HJ0D 3UJTL 3MRBA 4ZO8A 1W16A 2ZX8A 2WKOA 4XVJL 4XAWH 1I7UA 1HESA 2VO5A 4H20H 1KIRB 2YXVA 5HJBA 5EU6A 3MRFA 2ZKYA 3LIZH 1DYZA 3QR2A 3SE4A 3P40A 1FCGA 4MAYB 4O9HL 4ODXB 1QD0A 3V4VH 1INQB 5DMGC 1RLWA 2QQLL 5CEXB 4NKDB 2VSMB 3QXTA 2AK4E 3ATDA 4NO2A 1CZ5A 1U21A 4XNDA 1L9RA 3FQYA 3P1VA 1VACA 3GZQA 3IWUA 2AEPL 4L5FE 4GQ9L 2HVJA 1EEYA 5FA3A 4ZUWA 3L6FB 4PVLA 3UIZA 5BS0D 1M4KA 3SDXE 4KOBA 5AZEL 3HRPA 5I24A 2D0FA 2EDQA 1BIIB 3DURA 3OXSA 4KU1A 1JHTA 3C2AH 3GSOB 3RNKA 2VR4A 4PW3A 2OTWA 3DMMD 3QFJE 2VXSH 3AM8C 3OQ3B 4DGVL 5KVMC 1PT1A 1XL6A 2DBJA 5DYIA 4LEXH 1UJ3A 4NKMA 4GAJL 4L3ED 1RP8A 4OCXL 3NIDE 4Q0XH 5IG7B 1J0KA 3OF6D 1S8DA 5E00A 5GISL 4HUVB 2WQXA 3OZLA 4I0PD 3ECVA 3D39D 5FECB 4WTWA 4ZMWA 3TS8A 3U79A 3RX7A 4IRSA 1U8JA 2H41A 2CGRH 3O11A 3U9PH 4AGPA 4LLWB 5AOLA 2AJUH 5HYQA 4LSTL 4E0RA 4O2CB 3SDXF 3GLZA 2ZX5A 3MLRH 4BCZA 2V2WA 1XIWA 2JIMA 4JGJA 4Q2ZB 1OQOA 5DJYA 3OLEA 3RIAK 1DUZB 5FYJD 3IXTA 4UAHA 5J57B 3CFCH 3TV3L 2EEOB 4Y2NA 4G9DA 1OANA 3ROOA 3RTQA 3NIDF 4CILA 1O7DE 4KKBC 4ZX3A 3AU1B 2Z8WC 3X14A 1TQSA 3QCUL 2HMIC 1VADA 3UTTB 1KT2A 3BN3B 4JRFA 2EVGA 5FGBA 3FQUA 5BO1H 1WS8A 5C2UB 4K73A 4G8EB 4JPVL 2HRGA 3STZB 1CD1B 2H8PB 2MWCA 1P5UB 2QGDA 4LCVA 5HBBA 4XVSL 5I16A 2F54B 3VFMB 3OX8A 2J4WL 2V6HA 3JBG7 3WXVH 3JZYA 3D0AA 3KWTA 3CVHA 4OIBA 3RY5A 1J9RA 1GS7A 4RAVB 3VI3B 1EU1A 2H1PH 3TT3L 3ZRCC 4Z7VB 1CB4A 4JREB 4K3EL 3TBWA 5E9AA 2VC2H 3FFOA 4LU5L 3CHSA 1OO2A 1TG8A 4NQDA 1ZGLP 3SYPA 2OR9L 4P57B 1KPRB 2X7LB 1JPST 3QPQD 3KJ4C 4GAGL 2B59A 4FYTA 4YO0A 5FC9A 5K33A 1GCFA 5T3XL 1TLKA 3N2JA 2AZAA 3NG5A 3QH3B 3M3GA 1VENA 5I28A 3NZ8B 4YEFA 2P5WE 3Q3GB 1FNFA 4FULA 4JY4B 4Z7UB 4HIHB 3UP6A 2I32A 4OLYL 2WZAA 1U8PB 4P07A 2V45A 3BDBA 4NRYA 2KERA 4PBXA 3TYGH 3VXSE 2LU5A 2VXVL 4N0UE 1E2WA 3L4UA 3TJEL 2VWEC 4PP2A 4X6EA 1EXUB 5LGJB 4IGBD 4D9RD 5KYXA 5FK9B 3IJ9A 3NJLA 4IOIA 5AVTB 3QNXA 1Q0YL 5KOMC 3UROR 4PRBB 3U82B 4LLUB 2C4FT 3EJRA 3KPOA 3FYEB 1TCRB 2Q86A 4JRYD 3KWVA 4N6QA 1I3GH 3FT2B 4O02L 3BRFA 1FG9C 4CADA 2EZ0D 3AXLB 1SLUA 1U8LA 3BMVA 4PWKA 4XP6L 1U0QA 4YQXH 1HIMH 5H94A 3L3GA 4PJFE 5JXAL 1QSED 4FXKA 3KJ4B 1JZEA 3L3OA 4JCMA 2EDBA 3TVMA 2O6EA 5F44A 1KLFB 4XGZB 1OE1A 2XY1A 5CIPB 2O1AA 2VM4A 4LCWD 4A63A 1V3KA 1MEXL 1TWAA 4XP9L 5BZDA 2WWMC 1B2WL 1RMFL 4PLJC 1ZE3C 3VB9A 2R27A 5GJTH 3GXNA 3V6OE 3ZZLA 3DBXB 4ZMPA 1XCQB 2GCYB 4WU7B 5K5YA 1RZKC 2JWYA 5CWSA 3BPCB 3VXRE 4H88H 4B3EA 1HHKB 3EYQC 3ZQWA 4FQLL 2Y1ZA 4JFYA 1UFUA 3L9BA 4ADJA 5GGSB 5EF3A 5FW7A 5D6DC 2BIMA 3JZ7A 2XWBB 1U2CA 2CZNA 4N0CD 3O0LA 4QRRE 1JPSL 5FDWA 5J5EA 4RGOH 2VDMH 1PQFA 3DYPA 4JE0A 3LRKA 1BAFH 3WHE0 3WFDH 1BSIA 2NW3B 1HI6B 3HC4L 1N8ZB 4YXHL 4J4PD 1TVBB 1GOGA 1ZA3B 4ZUSB 3TJPA 4XVTH 4IMLA 4GBXC 3V9EA 1AGBB 1QEXA 2G3XA 1AE6L 5T1MA 5HD8C 4DP4X 3ECWA 4L8CB 4DUXA 2QMKA 2WC7A 1UT1A 3T77A 5F9AC 1Q72H 2AK4D 1QQDA 1J0ZA 2WSDA 2Y72A 3BP5A 5HYEA 5EF2A 1IV8A 3VW3L 4X9IA 2AQ1A 1O6TA 1D7DA 4S0SD 3GMLB 4JFTA 4PGZA 2JQMA 2BP8B 2CRIA 4LQFH 1G7LA 4OIIL 4F8TA 4Y1AE 5I1DA 1ONQB 3KXFE 3WSQL 4BWTA 4N20A 5EC1B 3B9KB 3QJTB 1C08A 3DHPA 4MXQC 3QFJD 2R56H 4B97A 4OAWB 4X6FB 1SY6L 5GGQH 4RQQB 4U7SA 4CA4A 1DL7H 5E4EC 5ITBL 2OJZH 4WQOA 4GXVL 2EE6A 1LDSA 1I3RA 2Q76A 5IGXL 4ZFOB 4JUSA 2WBJD 4PJ5E 1SXCA 1P1ZA 5DJ8B 2L04A 4YBQD 3RQ3A 1DVFB 3TJHD 4GBXB 2JXMA 3WFEH 4G1EA 2VUKA 1S7SB 1G5GA 1EXHA 2DJSA 4PUBL 4JFQA 3L4TA 3RPKA 1A9EA 2DQMA 5AD0A 5IKCA 3R06B 3KLDA 1GOFA 1EZUA 2CIIA 1HE8A 1I3QA 3WMQA 4MS8D 2C9UA 4UV4H 5I1EH 5GHWH 3FTXA 5F3FA 1EO7A 4Y0GA 3QPXH 1GZQB 1Q9WA 4EN2A 5ALCL 1Y6MR 4AGMA 4M56A 3FQWB 1VKXA 4Z7OB 4I3RH 1IB5A 2O93L 1KDIA 2Q7AA 3D4CA 4P5SA 5E4EB 4NUMA 4P2OB 2GY5A 4OD1L 5GRWA 2YPVL 3SY0A 2ZPKH 3U7AA 1GYUA 4KTYA 3LMJH 5F8RC 4JFDB 5DU7A 4OVUA 3PY9A 3CVHH 2WXFA 1KGXA 2QVFB 1N68A 2H47C 4HSCX 2OAAA 2CXGA 3IDIB 3A6BL 3BAEH 4I13B 5EA0L 1FJ1A 4OGXH 4JY6B 3DX2A 1BW8A 5BS0A 1E4XL 2WLLA 4OZGB 3VXME 2OR8A 3MRPA 2IDUA 3K8KA 3S96A 4A55A 5CSGA 1Y07A 2OQJB 3DMMA 3GSRB 1T1YA 1WO2A 4X0NA 4ICXA 1PJ9A 3JWOC 4U2YA 3HI1B 3DX8B 2DWXA 3K4AA 3LV3B 2ID5A 2VQTA 3LB6C 4L3EA 4J3XA 3SPGA 3OF6A 5CEZE 4Y9EA 4ZODA 2P5WD 2KS0A 3SZ6A 4I0PA 4AOFA 1THAA 5DHEA 4WU5A 2YARA 1CZ4A 4JO2H 5E8EA 2FYYB 1HOEA 3B7RL 1G6RA 3SKOA 4Y9GA 3VXSD 4TYUA 2OMNA 2W9EL 3W0WE 2V5RA 2Q0ZX 2YZ8A 2X4RB 3D05A 1G9HA 3KR3L 3QG7H 5AALA 3QJFA 1ZEAL 1UCTA 5I1LA 3HG5A 5A1AA 1WLHA 1EJFA 1J18A 3LDBC 3AW5A 2OA9A 1SBSL 3PABB 4AEIH 1F4XL 2AKRA 3V95A 3B5GA 4PIRF 3GI9L 1N0LB 1CLVA 1GKEA 4XXCA 1QSFB 4QXUH 5DMKB 5ESQB 3NPSC 5TQ0L 1GRWA 1HNGA 5DS8A 3IKKA 4ONOA 3WNNA 1RVFL 3TFKC 2LQRA 3S35X 1NWOA 3NFSH 2DMHA 4A7UA 4GKNB 2JKJA 4ODVH 3S4SB 1O0VA 5E8PB 2DH3A 4ANWA 1V3JA 5EU7E 4KDTC 1TTGA 2FBRA 2H3NB 3S3JA 3AT9A 4ACPA 2H26A 5J56B 1TO5A 1F3DJ 4NN5C 1PKQE 3BPLC 4F7PB 4N2AA 4NQEB 2K1MA 3CWGA 3OAUL 1DBBH 1OTSD 3QXDA 3JYCA 3VXRD 1S9WA 2WWOA 5FM8A 3UAEA 1HOCA 4R26H 4XMTA 3PDOA 3GMPA 1AXSA 2E7HA 3FUEA 4QRRD 3VMPA 3WDHA 4JFFB 5AZUA 3MC0A 5FUOL 3L17A 2AJSL 4FQJL 3TIDA 1NCWL 2EICA 3V6ZB 3MRGB 1DVZA 2M2DA 5KN5B 2BSSB 3CFKB 5FX3A 3NPSB 2LFEA 3L5JA 1KN4L 1XH3A 2CGYA 2H1XA 2ZKHH 1TQTA 3FPXA 3BKYH 4FP8H 3T8MA 1NDTA 5I18L 1AZRA 2VXUL 1FYHB 3GK8H 3CDGA 3W56A 4JFPB 2ETWA 3RGVD 3CV5A 5IVXA 1A7NH 4Y1TA 2CHNA 3BLPX 4J12A 2PXYC 3ZO9A 1B4JH 4IGBA 4S1RL 4GW1A 5GGUA 4NN5B 4TNEA 3D18B 2DWTA 3WS6A 5EMYA 1NGZA 4LO9A 4BFJA 4Y1AD 1NCHA 4RMRA 3DJ9A 3KXFD 4JRYA 5DO2D 3ZKMC 1OTUD 4BFFA 4YGVA 3CK0H 1MW2A 3AWGA 3UCRA 4HU8A 1TOXA 4MLIA 1QRKA 4YXKL 5BW7C 2EUWA 2P4AB 3P77A 4O00A 1QSEA 4JGNA 1RJCA 2D0GA 4MDRA 1O6SA 3NJNA 2CSPA 1HKLL 3CVIH 3NQIA 4B9GA 4NXKA 4LCWA 5BXFA 1WF5A 3W11C 5GXBB 2VM3A 3NSXA 4PJ5D 1IGIH 2BK8A 1GGCH 1AZCA 2C9SA 5A2AA 2Q3ZA 5IB4A 4RESB 1O9ZA 2VAAB 4FXGA 4UWQB 1M7IA 4PGCB 4JFEB 1FV1B 1F58L 1CGXA 2PXYB 2NZ9C 3QFGA 2E59A 3MBXH 1JF6A 4BFIB 3L3JA 1WEJH 2EXYD 1MH5A 1EO5A 2V37A 3LZNA 4BSWA 1YEIL 4R4BB 1MHPH 4TNWF 3RVUC 1B0IA 5IVZB 4HV8A 3BIAX 4HX1B 2GUOA 3OKNB 8CGTA 3M07A 4AZUA 1C5CL 4OF8A 2HLFD 4Y4KB 1U3HD 2CLVB 4J4PA 1KIPB 3MLTB 4MD5A 4CGUB 3IFPB 1GA2A 3GS7A 3JVGA 3HNSH 4L29A 4ZMYA 3VFRB 2CQVA 3OR7B 2X2HA 3QEQA 4OI9A 4MD4B 4N6RB 3RZCA 1MIEH 5CAYB 4GQZA 3QO1A 3T0EE 1M1XA 4UU9B 2AK4A 4XT1C 1R75A 4U6HA 5D9SB 5K1NA 4QI3A 2GW5A 3PQYE 5JPMA 5E9DE 1B0WA 2WZ6A 8FABA 5TE4L 4HUXA 1CGSL 5I8CA 3SDXA 4G8GB 2R69L 3VXMD 3MV7B 4ZOEA 5TH2A 4NAJA 5GLYA 4YSOA 3L5IA 4AENA 1U95B 3QFJA 2OR7A 3MRHB 5DCCA 4GIAA 4MA7L 1AZVA 3QUML 3EJCA 4PWEA 3M6DA 3S4SG 3SPVB 1LVEA 2R0LH 3Q8BA 4KNQA 4GXUN 5CEZD 4AZ8B 1WZ1L 4GB9A 2VZOA 1F3RB 4FZEH 1G6RH 4PWFA 1QATA 1AP2B 1P69B 1SMOA 2ADJB 3AREC 4APQA 5EBWB 4NEHB 1EFXD 5CR1A 5FFLA 4P3DB 5AW5B 2BVPA 5CBAB 4E42A 3W0WD 1HU8A 2A9ML 3T4AA 1G5AA 1RZ7L 1PQHA 4C2MA 5FYJH 2VXTL 2H0FA 3QFDB 4LHQB 4TF4A 4F8QA 1G1CA 1ZVSA 3P9WB 2EXTA 1CXFA 1UACL 5KVEL 1AS7A 2E76C 2H2PC 1UOKA 3U9UA 2YUJA 2WWKO 3GHEL 4WDIA 5T5MD 2FWLB 4N2BA 3UFIA 4O2FA 1OT1A 3O4LB 1UYWL 2GEQA 5DVPA 4DETA 2G5DA 3PV7A 1DQQA 1M7XA 4X6DE 3F3HA 1USQA 4XAKE 3BVWA 4DIXA 1NBCA 1U8CA 1L7IH 2WJ7A 2B7DT 1FC1A 2Q3XA 3OKKB 5DRXB 4HWBL 1KN2L 4I4WA 3H0TA 4V11A 2OK0L 3K2KA 5JPNC 2AAAA 1CQKA 3F5WB 1ZIBA 5IJVB 4OSUH 5J9PA 2D7TL 4HJGA 5C07B 4JHAH 4NIYE 4J39A 4AVIA 1ED3A 2CH8A 2X70A 4IBUA 3BD3A 5GQBA 3ARGC 4I48B 5DJDB 4HPHA 3U1PA 5JLZB 5CZKA 1QLFB 4XI5C 1WPCA 1IW7D 4P5KB 2NT0A 2NZIA 2LT9A 5KEZA 5F9JB 4FJZA 2WYZA 4X6DF 3O3AA 2ZSWB 2YAQA 5C0BB 1BYNA 4K3JH 3VFVB 4DT2A 3JTTA 1F4WL 2X2UA 4MMXA 4XOAA 2OMUA 5EN2A 4UQEA 1RJZA 1SXSA 3QDJB 4QRUA 5FOBA 2X40A 4ONHA 4YHNA 3P11H 4QY8B 2LR4A 2P5WA 4NNPL 4NHUA 5DMYA 1DBKL 1JDAA 1A4BA 5E6SB 1RZFH 3LXAA 3QA3B 2EXWC 3G08B 5CMAB 3AMLA 1ITBB 5FO8B 1ZHBA 1ZTMA 5JPNB 2YSSB 2QLVB 4PS7A 3LN5A 2D3NA 5E2WL 1XT5A 3EYUL 4ZDHB 2R15A 1D3CA 3SN6N 3V0WH 3L4CA 4MA1C 5J8OA 2Y5EA 3CU1A 5CLTA 2F8OA 3BZFB 1Q8MA 3HLAB 1R3JA 2NNAB 4IHBA 5EDXA 3GKWL 4QOKB 3ARGB 1S7TA 1B3IA 1CD0A 2AXFB 1H3PH 1YMMB 4K8RC 2H3XC 4MB5A 2IGTA 2YMTA 4AKOA 3RTLA 1V3LA 2F7OA 1XGZA 5D7SL 2NYKA 4DAGL 4TUKH 3BGMB 4GMSH 4MZ3A 1A7BA 3D4GA 4QF1A 4XCCL 3NRQA 4BH8B 2FZ3A 1S78C 1MVUA 1QO3A 4MA3A 1RHHA 1AQDB 3CH8A 3DARA 1D9KD 2MIZA 2MTPA 3DO7B 2PNDA 1IEBB 3EDEA 3C9NA 1YDPA 1VZGA 4HYTB 1AJ7L 1UUNA 3PJSA 3V6OA 1RHFA 5LB1A 5CLXA 5KUKA 3VXRA 4BQ6A 5CCKL 5I6NA 1OALA 3VTAA 2NW2B 5KYWA 4NQSA 3IDYB 1S7XA 2WBKA 2IXQA 1RIHL 2CLRA 4M7JH 4GA6A 1J05B 3AY4C 4GMTH 2HSIA 1SJVA 4X50A 4QRRA 5E6YA 2ZOKA 1Y6NR 4YWGL 5G55A 2HUHA 2HWZH 5IMOB 3BH9B 4AONB 3P0YL 2JJUA 5AAMC 3OMAB 5DS2A 4YUEL 1XXDC 4WJKB 1AGEB 4OZFB 2JA6A 2ATAA 4OF3A 4NT6B 4XN7A 3H2PA 3RGVA 1AG6A 1OM3L 3RNQB 1JV5A 1B9KA 1UB6B 3GHPA 4KKCD 5LDUA 3BKJL 3DETC 3WENA 3T0ED 1IQWH 3V4PL 4M93C 3GINA 1S7VA 3DGGA 4FMFA 5DC4B 4KK6D 2X05A 3N1GC 3U46A 4LLVB 2GJZA 3HMWH 3I6LE 15C8H 3ZDXE 2E9JA 4UYQA 3O9WD 4Q6IC 4Y1AA 5DD1L 5F3BB 4PJGE 1IFHL 3KXFA 4C4KO 3VMNA 3TASA 1RZIA 3U7WL 2HN7B 1YQVH 3QRGH 5T3ZE 3QQDA 1BYOA 5IW1B 1ZMYA 1VFOA 4XNZC 3QJXA 3NN8B 4LLQB 4WFGE 3SGEI 3V4UH 4JRXB 2G2PA 3ULAB 3L9YA 1XGQA 5FHAL 2J43A 4X9GA 4Z7VE 2ZUSA 4K4KA 2OMWB 4OJFH 1DBML 1FF5A 1GC1L 3VFWB 4U6YA 4N8VA 4J3WA 5T8IA 3ZZ1A 1AIZA 3TEYA 1XGYH 3ZDXF 1FYTD 4M93B 5DMIH 3IFNH 3CFDB 4PJGF 1ZTXL 5DD6B 5IBTH 3ZKND 1JGUH 4ZT1A 3VCLB 2GC4C 2XKUA 1IO4C 2RQEA 1PZ5B 3SGJC 3UO1L 3GXFA 1W0WB 1I9JL 4YDMA 4PLNC 4KJQC 2R1WA 2BMKA 1DLHA 3VU1A 2FUQA 1JCVA 3MMEA 3I50L 3TU6A 1YAIA 4XNZB 1OGSA 4XAKD 2O26U 1Z2KA 1DQLH 2DLFL 2NY1C 3S3BB 3CSGA 4GG6B 2ALAA 4BQCA 4PH8A 1BWWA 3LH2H 1TU2A 1MPAL 1N5YH 1U36A 4ENZA 3NIFF 4HFUH 2WXMA 4ZRGA 5BMFH 1BM7A 3GF8A 5DEZA 1CFSA 5AVRB 3R7RA 1EO8L 1P84J 4BSVB 3S88L 1A6UH 5C9JB 3B3BA 2UX7A 4S1QH 4U6XB 3KS0J 3VXMA 1XGPA 5CCHE 1UQSA 2UXTA 3GTKA 3RY4A 4FL4C 3WKYA 3OPUA 5HHOB 4W6YB 1HZHL 1Z66A 1XHHA 4TSCL 2VWEE 2ENSA 2YOAA 2BWDA 2CRMA 3M86A 4KK5D 5GGVH 2K4AA 3FSOA 5HHME 4WI8A 2VUYA 1PYUB 3IDUA 3X2QB 1AKJB 3VA2C 4KKQA 2R0ZL 2Q8AH 3ZOAA 1Y1DA 3ZN6A 3L1OH 3LZPA 1EFXA 2BVOB 3EHBB 5DHMC 3FU5A 3FAXA 2NY1B 4DCQB 3VDCA 1GIGH 5JW3L 2K9UA 5F88B 4HG4J 2BVEA 3RWIB 2GFBB 2EH7L 1WV7T 4C83A 3O0RL 2D03H 2WINA 3RX5A 4Y5VC 1CXEA 4MAUL 1IX2A 1OPGH 3LNIA 3NH7L 4PD4J 1HYRC 1BXAA 2IWKA 3IN2A 5DO8A 1JTPA 4JM4H 4F1SA 2DS4A 5D5MB 3ZT7A 3TEWA 4WCYL 1TT6A 1V54B 1CD8A 4ZX4A 1NLBL 2NY7L 3FFCE 3REWB 4FL4B 1FNGB 2Z4QB 4NHCH 5DD3L 2IBZX 4Y4HD 3TC9A 2IDQA 4OZFG 4BV1A 1N59B 3KGRA 2W8CA 3GBNL 1OAYL 1U8NB 1YAZA 2BSDA 1CE1L 5FYKL 1DR9A 3TPUA 3LKRA 4OFDA 5EIIB 1YNLH 3QJZA 2WM0A 3MFGB 3ESVF 1VCAA 3VXQB 3ZR6A 4A39A 1PX8A 3TM7B 4HGWA 4HHAA 5JTWA 3HBPA 2YMXL 3FCTB 1PKQA 3QP3A 4OGZA 1NUGA 3FCSA 2YK1L 1A3LL 5B8CC 2CK0L 4HOZA 1A6WL 1CXKA 1IQDB 1EMTL 5HVWA 5KTEL 1MFAH 1Q38A 2W94A 5GS1A 4J8QA 4WK2B 4Y5VB 1XGUA 4AAYA 4MDJA 5DQJA 3TYFB 2G60H 5T33L 5D4IA 2I69A 3QVAA 1DQDH 2F18A 4NKOB 5F6IC 3ZMEA 4TQEL 4RWHA 2IMMA 1JDCA 3JTBA 5DHXB 4G7RB 1KLUA 4UNIA 5E8OB 2CE6A 3OJVC 3ISRA 4CMHC 4ZXBA 2BJML 4HHGA 2R2BB 4LASL 4RAUA 1NIFA 2XBZA 3E6HA 4WO0A 4P2QE 3X17A 1T2QL 2XZAH 3V0IA 1WGOA 4X4ME 5C1MB 1MFNA 3KHQA 1NGXA 1SMDA 4K9EL 1NOAA 4A7TA 1QW8A 2XC8A 3BUBA 4P3CL 5EBLB 4DPCX 4MJ4A 4Y2DC 4YDLC 2WQSA 3A4FA 3I6LD 5FUCC 4HWEL 5KW9L 1JPEA 5I82A 4JFDE 3WO3B 5CCGE 3L5XL 1OA9A 4B7IA 5T3ZD 3HZVA 4NQCA 1CFVL 4HMCA 1CQYA 1E40A 4NNYA 4TPRL 4WFGD 4TNWK 2NY2C 5INCB 4EI6B 4JFXB 3S97C 5LGYA 4WNQA 3ZHNA 3TNNB 3P0VH 1ZK5A 2EINB 2NY0C 1PFOA 3UBHA 2VOTA 3OXRB 4HJSA 5F96L 4QXTA 3G5ZB 1D9KA 4R9HA 4BA8A 1NC2B 2CHZA 3CN0A 4P9HH 3VXOB 1J5IA 3FQNA 4PRDA 1B0GB 1KC5L 4P9MH 1H8LA 1VHPA 3O2WH 3NCYP 4JHWH 2AEWA 1A1MA 2B08A 1G7PA 3G6AB 4YR6A 1BG9A 4KKBD 5E5LA 3QIBB 4WI5A 2ESVB 4D2NA 4WFEE 3U2SB 4BXSV 3KLAA 3GMRA 4N9GB 4YN3A 3SPIA 3OAWA 2WLIA 4HC1A 1EEUA 4Y2DB 4YDLB 3CLEH 3AQYA 4KMTL 4CC1A 1MJUH 1PW3A 32C2A 3Q01A 4G2AA 4NUJB 2ZXWB 1OK0A 5C09E 4UV7H 3LKNB 3NP4A 1WFOA 3N04A 4FFZA 5KVDL 4QHUA 2YA0A 1N0XL 1TZIA 5DYGA 2WO3B 1KTRL 3GSUA 3X1FA 2BS71 1CFBA 1GY1A 1BVOA 3FOLB 5GRVL 3L5WB 3BCFA 5F89B 1GJIA 4BYHA 3P2DA 3EO0B 3MRDA 3QCTH 4WNJA 2NY0B 3V5DA 4C58B 3T0EA 5EC2B 3VG0H 1EDHA 2NQCA 2NPLX 3BX7C 4EF3A 3N42F 1LWJA 2EDMA 2KHAA 3VNYA 2AJXL 2YMOA 5L0QB 1DN2A 2WANA 4ABVA 4JQIL 1DLFH 5DUBB 1ET5A 5GS0L 3O9WA 4RRPG 1SVBA 1CVSC 1CGVA 2F2HA 4NUQA 4Q52A 4FMVA 2DQHH 3OHXA 2E5EA 2V3FA 3SDCC 1JF1A 5CEZH 1ZV9A 1SLXA 3NZUA 1YRKA 4M61A 4NQEE 3HCVA 4KUZH 3VWKD 4UDTB 1SYVB 1RIUL 5F7NC 1MRDL 3DX6B 5HHMD 1PD6A 5ADOH 3K72B 4NO5A 3HRZA 5EIIG 4PWHA 5AYUH 4IBQA 5JOFA 1JPGB 3I3DA 4DTGL 4KNSA 4M43H 4DMRA 2DDQH 4JFFE 4QR7A 4BFRA 5C9KA 1IAOA 2RH0A 1LE5A 1TMCB 4U1MB 1X7QA 3F12B 3T65A 4ABUA 4W9EC 1IAKB 3PGCA 3HN5A 3QAQA 1KB3A 1FYTA 5C1BA 2V5TA 4WI2A 1AS6A 1SVZA 2R59A 3O6LH 2AV1B 5D1XC 3II2A 3V0AC 3BH8A 3AQZA 4QRPB 2XV3A 4GIPD 5DZ9A 1YLEA 1JOIA 1IIKA 2OSLA 3WTXA 2I60H 4CVZB 4FQQB 1XGTB 1YUHA 4EO5A 1T4WA 2B3RA 1Z0MA 5I73C 4MQXC 3AS3A 2GPZA 3RDTD 2WWMD 4CSTA 3SOBL 3MCG1 1WCMA 3FFCD 4L8BB 3QEUB 4WI7A 4L4TB 5KYUB 4JM0A 3SDCB 1ZT1A 3B56A 3BUYB 2APSA 3P0GB 4X6DA 4TQHA 3MLSL 3OMIB 3RJQB 1KLGA 4NBZB 3WHE1 4PJ7E 4BXVA 2HX8A 3DUUB 2WN2A 4PJ8D 4B9ZA 3EYQD 3VGFA 4Z77A 1WBYB 3NJIA 4Z3HA 2ATPA 2F53B 3F7RA 1B88A 3K6DA 5I76A 3AG4B 3T8XA 5CD5D 4KO9A 1CUOA 4E9SA 2JK5A 1PEZA 2EDEA 4MX7A 4Y7OC 5E1HB 3FUIA 1DTUA 2WZ5A 1KCSL 4TSBH 1K4CA 5E7FA 2X4TB 5BPPA 3EO9L 4UTCA 3MRLA 4DERA 5DHVB 5GGVY 4R0LC 4ZMVA 3ZVVA 2X53A 3NVQA 2XQBH 3TPKA 2OBGA 3DSNA 4U2ZA 5E4AA 3UEQA 2W0KA 2F58L 2XXMB 1KXQA 3KGUA 5GIRA 4K7PL 4X8JB 4XPBH 1DMSA 5HD8D 3NIGB 5DZLA 3BIKB 1ZLEA 3MXWL 4ZMQA 4XCYB 4PJ7F 5I73B 4XHJC 3S37L 4RZKA 1QRNE 2MMXA 3LKQB 4HUCA 2GBAA 1AVAA 4FEMA 3LKPA 4IMKA 4EJ1C 4YSCA 4HKBA 3HC3L 4K3DL 2BIQA 3OHMB 5EUKA 3S8FB 2PW1A 3B3IA 3FONB 3U0TB 4LSDA 4P2QD 2AITA 4Z1PA 1IEHA 3APNA 4N4YB 2OMXB 4GQQA 2VM9A 3CHOA 5D7KE 3NJVA 2DMGA 3GMQB 1U93B 1T7ZA 4JAMB 4LHUD 4S10A 1LLAA 4HIEA 1PG7L 2GY7B 2ZUWA 1FZKB 3BI9X 1VEOA 1NWPA 2NX5B 1BQKA 3PGFH 4JRWA 4NZRH 2SEBB 3RZWA 4F92B 3T8VA 4AKQA 4MQ7B 2ZXQA 3VA6A 2AS5M 4LRIA 3PWJA 3L2MA 4Y2LA 3GSNA 1U3JA 4UDUA 5SV3A 4R0LB 1WISA 3IGFA 4JFDD 3CFJB 4O51A 4NKDA 1E5VA 1MNUL 4ODHL 3VH8B 1RLBA 1CL7H 3UG5A 4IU2A 2F7PA 3ESPA 3ME0A 2KI6A 5ABAA 1E67A 2A1WH 4Y4HA 1QOKA 5FO7A 3U30C 3DRQB 1KY6A 5JHDB 2EDFA 1NFDB 5EEXA 4NZTL 3D12B 2J73A 3K2IA 3KJ6L 1DN0B 3NCEB 5LBSL 1KMGA 2OXGA 4RIRA 1MFCL 4U1SB 5TE6H 5LQBL 1VC3B 4BRVA 1G7JA 1YHPA 2VKWA 1JK8B 1KJMA 1QUNA 3FO0L 4N1EA 4JFZL 5FA4B 3INOA 4HC1H 4PM1A 1UHVA 5K9JL 3HN8A 4E41B 4HUVA 4WFED 4FFZH 4ZO9A 1QLRA 2GTWA 1NQBA 1RP9A 2UY6B 4LBEB 4N2HA 5HHVL 2ICWB 4M8RA 1MLBA 4NFBA 1BXUA 4DFIA 5C09D 1RD6A 4LLWA 1X5XA 1CF8H 1FDOA 1NCOA 2B63A 4FXTA 3PCYA 1J1XH 1KEGL 3KDPB 2ITCA 2VQ1B 3O6ML 1IFGA 3AG1B 3U30B 3UTZB 2J1YA 1DSFH 1CO1A 1PIGA 1AHWC 4GFTB 2JKWA 1T1ZA 2ZKMX 5I1KL 1S9YB 4AM0Q 3W2DL 2XN1A 2CPUA 2TRYA 2VITA 3AM8A 5KWYC 35C8L 1C12B 1MRFL 2FX9H 3BVNA 4K23L 4V1DB 4Z95L 5KBMA 2KMWA 4JJ5A 3LB6D 4Q8BA 1K5NA 3GT6A 4KZDH 4I3SL 1LM8V 4MZ2A 4PJGA 4LSSH 4JPIA 5C0FB 3ZE2E 2EIDA 5C07E 1ND0B 2CDGB 1AZNA 2HH0L 3RL2B 2KZKA 4Z6AT 1LWRA 2IH9A 1WP6A 2MCPL 1JNHB 2UZYB 4NQED 1OCZB 2GB2A 5I6MA 4F7EB 1BFOB 4NOHA 2QPFA 1JRHL 5FCUL 1GZPB 1PZAA 2XG4B 4X42A 3ASOB 3T2OA 3EFFA 3W39B 5EN3A 1I4FA 4JFFD 3SE3C 5IMLA 4LSRH 5C0BE 3FO1B 3OKOA 3TLRA 3TESA 3FN9A 1E2ZA 2FJGB 3DO4A 3QDJE 4PP1C 3CFUA 1MCWW 5E1IA 2HRPH 2IQ9H 5EO1B 3TFKD 5C18A 4IK7A 1I1AD 3ZE2F 4X99A 5LHDA 4YDVA 2BY1A 5C08E 3V0JA 1K3ZA 3VXPB 3VB8A 5HI4C 1GC1C 2P45B 1JK9A 2CR6A 3QDMD 4OJCA 3JT0A 2VKXA 4WI3A 4ZFQA 1KG0A 4HHWA 3VI4B 3V4PB 4FI7A 4PJ9C 1KJ3H 1W72A 4R8WL 2VDRL 1XF2B 2IGLA 1LO4H 2QQKH 4PRBA 4DO4A 5J7CC 3BP7B 3V0DA 3ZL4H 1BOYA 1YMME 2CA4A 3LPWA 3FT2A 3BD5A 4L1TA 1ADWA 5CR8A 3UTPE 2OV0A 2R9HC 5C0RL 3H7BA 4YDKH 2VPXA 1MRCH 2OXHA 3BVUA 3HFML 4XVOA 4KGLA 5D1QC 5EWIH 1PF3A 2OX5A 4ZO7A 5LNGA 1KLFA 3LZRA 2QQNH 1T6VN 3EF4A 1TJIL 4PS4L 1AR1B 3WFBL 5A2LH 1A7QH 2WNKA 2J25A 5I8EB 3VH8G 1AGCA 4Z0BH 3IJEB 3NTCL 4X4XB 2N0KA 1KGIA 1NPNA 3PDDA 3GMMB 1JWMA 1WWBX 2CJSA 2JKIS 3VWKA 3NAAL 1QRND 3LKOB 5I5RA 2TRHA 4LB8A 1PX3A 2WK2A 3A67H 4WNSA 4HZLB 1G9MH 5AB2A 5FR3A 4AE1A 4GAYB 5GS3A 1DEDA 1QLEH 3ARFD 5T3XE 1JBJA 4NDMB 5ICYA 2IAMB 3CX2A 2ZUTA 4R7DB 2XWBA 2X4PA 3DECA 4JKPH 3K8LA 4NZDA 4OI8A 2DM4A 2C3WA 3PNRB 3ZKMD 2KUTA 1HVXA 5PAZA 2NW3A 5A2CA 3BHBA 1AC0A 4TTDC 1EDQA 3GSNH 2ICEC 4J3OH 3HKFA 4LMQI 5D1QB 2MOQA 4ZUSA 2WSKA 3MV8B 2ARWA 4P06A 1G7IB 2WWNA 3LJ3A 4U1KB 4H8QA 3ZBMA 1YEHL 4YSUA 1FHNA 3VGAC 1C7SA 3RDTA 3GZOA 2LFGA 3HJ0A 3MV11 3WAJA 1T80A 2MPAL 3FFCA 3MFFA 4L8DA 4LDLB 5D7LB 1IBBA 2XTSA 2YAHA 3OKDB 2ISDA 3WNMA 1SLVA 3NOIA 1X5LA 4XBEH 3RWGB 4PJ8A 2A6KB 2NZ9D 2P8PB 1LO0H 6PAZA 2IDSA 5FUZL 1DBAL 1O9VA 1H5NA 3IR7A 3QO0B 1CIDA 1UD6A 3D85D 2DM2A 2X6CA 4L05A 5D6DA 3K5SA 4D3CH 4OVVA 4X6FA 3RVUD 1E0OB 3PNWB 4H0IA 1E8ZA 1TTBA 3E2HB 3MRMB 3ENEA 4V2CB 2ZWZA 4JRXE 2BDNH 1FSKB 1VGKB 3CPLA 1YNND 1ZANH 1FFPA 4F33A 1D5BA 1NTDA 4YLBA 1A6AB 3ZTJG 1MY5A 4TV3A 2ICEB 4N87A 2DZEA 2J8UB 2ORBH 4M1DL 5JIPA 5DJ8A 3OD3A 3KWWB 4J8RA 1RJLB 5CZXC 1UVQB 3VGAB 1ZLDA 3CXDH 4P23C 2ZWLT 5DSCB 1EBPA 4XODA 1CI5A 3KWUA 4B53A 3DV4A 3TH4T 4YX2H 4XNBA 3KH4A 3P9MA 4OCSL 2B4CL 1A4CA 3NCJH 3P9LB 4P2QA 1EVUA 4NZJA 3CLWA 5IB3B 3PJLA 2ZWSA 4IOFD 2VZUA 4LHUA 5DJXA 5K9OB 2VISB 3DIFA 3SOTA 3SO3B 2JI3A 5GSRA 3EH2A 3L5HA 3EYSL 3AXIA 1QR1A 2R7EA 4WTXA 3QS3A 1TSHA 2VDPL 1J1OL 1PT0A 2FLRT 1KENH 4W4OC 5T3ZH 3RVVC 4H25A 5DRZB 4GG6E 4YDJB 4L2YA 1NUNB 1L9MA 1TQVA 1ZVNA 2KZWA 4JFDA 3ARED 4XMLH 1KF9B 1PEWA 2F5BH 3C09C 1I8AA 5C07D 2WXLA 2VCOA 1JNNH 1PYWB 4K9EC 4XC3H 1N8OE 2P47B 4GUPA 4ISVB 4NWUL 3BLBA 4P23B 4JY6A 1GYCA 2B9AA 3ZYOA 5DJ6A 3NCWA 1UM4L 4U6VH 4U0RC 4L8SB 2QLYA 3BISA 5EO9B 3MU3A 3H0GA 3IFOA 4X6CB 4AQ1C 3GSRA 4AQAB 1MCHA 1OVZA 1MHHA 2IOOA 4PRPE 4DKAA 1SJHB 1QABA 4G6MH 1MCOH 2FDBP 4W9FC 1BHGA 2VMJA 5I6OA 2D7MA 2H5UA 2XV0A 3QDJD 5FXCH 2XJKA 5C6TL 1A6ZB 3S3SA 4DEUA 4DO6A 3EW3B 1PTZA 5C08D 5MEOA 3GJEA 5GRZA 3IT8D 4CDHA 4P5MB 4F80A 7FABL 5BJTA 5C09A 5IV2A 5T5FA 1UZ8B 1W72H 2Y5TB 4EVNB 5JA9A 5DJ2B 3L95B 3C09B 4ZUUA 4X4KA 3VXUE 2B1AL 3EH4B 2X1XR 4I0KA 4HUKB 3LD8C 1FNEB 1H5BC 5KSBA 4LL4A 5FHBH 3PABA 1NANH 1YMMD 4UUJA 1HEJC 4XI5D 5LWYL 4PV8B 1CBVL 4LF3B 5JIHA 2ZCZA 1EJOH 1N0LA 4OLVH 4GKSB 4ALAL 2ROYA 5ESQA 4AQ1B 4PJIB 3HZYB 5HDBE 2Z64C 1LQBC 2FBJL 1H3WM 4Z5RB 1IC0A 1IGCL 4AGNA 5CJXC 2JQZA 4HISA 3SULA 2AGJH 5KG9B 3ZZQA 3GLEA 4P5RA 1HWGB 2QVKA 5ECJE 3C8KB 1D6VL 4FLRA 4JY5H 4F91B 3HLKA 2EXWD 3K1DA 1VFBB 4WW1B 3CSFA 4F7PA 4HF5L 4NQEA 5A2JH 3BQUC 2H7WA 3BLKA 1Z32X 2XN9E 4QRQB 1IC7H 3GHBL 1SHMA 4LEEA 1F4AA 1RZJH 1F6AB 5T3XD 3KYNB 1R9FA 2CHXA 4PJEB 5GS0C 3LD8B 1H5BB 1YEDA 2K6ZA 1YEGH 3BJLA 1D5RA 4JFFA 3QJVB 2B15A 5HDBF 1FNSH 4K8RD 4DGYH 3N85L 1EHLL 3P30L 4M6ML 4DVBA 1DJYA 4Y5XC 3TIEB 1CE6B 4JO1L 4UT6L 4G42A 2PYFA 1TUPA 3CC5B 4ELDA 2X3BA 2V17H 4LGPB 4G6KL 1I1AA 3NFPA 3MRKB 1WZAA 2N7SA 5KS9A 3WJMA 4RA3A 5T1KB 4AL8L 3O5AA 2CO1A 1E6JH 3S8GB 4DKFH 4KY2A 1R24B 8PAZA 1DUYA 3C60B 3HR6A 2MOGA 3QQNA 2W80C 2Z93B 3QDMA 4U1LA 4MSWA 5ERWB 1D5ZA 1YEEL 3WD5L 5HP5A 5J13C 1RZKH 2PJHB 2ZYHA 3VSQA 4HKJB 1YYLH 2WLZA 5I8KL 5AZ2L 4DH2A 3BDYH 4JQVC 1UENA 3SB3A 1LO3L 3WL9B 3MNWB 4HALA 1P9MA 5HY9A 4AYFA 5DI8B 3BQUB 1L6ZA 1WT5C 4PJ7A 1KXVA 5JIMA 2W60B 3P4LA 1A6PA 3EH5B 1ZWIA 5D72L 1H9DA 5E51A 2BOCA 3SKNB 4G7QB 3DC0A 3FB7B 2D4DA 3N91A 5KJ4A 2OMZA 3UZQA 2CUIA 4YS4A 3QWNA 3UADA 5GGRB 1BYPA 4PCTA 4M5SA 5IOPB 1R5IB 2XOTA 3O41B 1ZHLA 3DVGA 5HI5C 2NRDA 2VH5H 5JQ6H 3EGDB 4Y5XB 3LXBA 1C7TA 2B2XL 1HINH 3NFNA 2B0SH 4N2IA 1OE2A 3BN9C 3CIQA 4ZFZB 43CAB 3VACA 3BWUC 3GSXA 1VPOH 5IWLC 1LILA 1OQXA 1JNJA 1GPOH 2YD5A 4B60A 3DETD 3MNVB 2QDWA 3BZDA 3KMDA 1QRNA 4ODWB 2YD0A 1TJGL 3HJEA 3SYQA 4ZTPH 3U0WL 3HU3A 3ARFA 5AB1A 3VRIB 1AD9B 2QFPA 4IM8A 1BVLB 2KQAA 4JG1L 3SYCA 4BWWA 4UM8B 2KDGA 1R47A 5FUCE 5BCAA 2P43B 5F7UA 1TKWB 2H6PB 3ATAA 1WYJA 3KE0A 4M48L 4KRLB 4GRLD 4N25A 1W6WA 4WI6A 5L2KB 3TT1H 5K59E 4Q4IA 3L7EB 1ZT7A 2GIXA 5JUEH 2P28B 2QQQA 5BW7A 3MLTA 1F3JB 4WWKC 3EYOB 3H3KA 4ELMF 1FFRA 2PTTB 1CLZL 2ZCLL 3JWDL 3VFRA 1T7WA 3Q48A 4PGJA 4W9LC 4WAFA 5HGDA 3US9A 4Y16B 2AJVL 3ATEA 4MASA 4HCFA 3PGDA 3I6GA 3WN5A 2ZOWA 2ZAHA 1NCBL 1TPXC 1QSVA 3KPQB 2BXZA 5BVJA 1Z5HA 2WXIA 2Z9TA 3B7UX 3P2TA 4WW2C 2EUXA 1A6TB 3BSZL 3KPTA 3K6OA 4I1RA 4W93A 4BQ9A 3T0AA 5HJ3B 3APMA 2OJ1A 4R4FH 3O8XB 2IPTL 3B37A 5K59F 3QT2A 4AJYV 3ESOA 5DFAA 2XN0A 1ORSB 3B83A 3D85A 1U95A 3GRGA 2G6GA 5DRNB 4MMZA 1BZDA 4B27A 4PRPD 1JV2A 2G2RA 4KJQD 3NRPA 1TETL 4KI5C 1ZIAA 4JR9L 4UINH 4O58L 4TRPL 1K2DB 1S5HB 2FATL 4ZOCA 2FO4B 3N0PB 2OTUA 1BDYA 4WWKB 1DE4B 5T5FH 4HOMA 4AVRA 1F86A 3RWDB 1E2VA 2NY1D 4LFHG 4NFCA 4AMXA 4UBDC 2A68D 1MW3A 1BQHA 1JGLL 5E6IC 2PJJA 3UPRB 3TBTB 4Q89A 2JSFA 5CZVL 1A66A 4ZFGH 3VXUD 3WEAA 1IBHA 2KT6A 1SMYD 1U8QA 1TPXB 3LZFL 3QFDA 4ORGA 4QRPE 4DNLA 4F20A 4GA5A 4AGOA 1KTKE 4WW2B 3UTSD 2A6DB 4NCC1 2Q10A 1KXTB 2K4WA 3MCYA 4MS6A 3D33A 2QGBA 2YU9A 1LO5A 5A2BA 1ODUA 4FZ8L 3TURA 1PSKH 3MUHL 5EHFA 4E9RA 4YJZL 5E8NA 4RWYH 2AAVA 2NXZC 4BZ2L 3OZ9L 4X5XB 4MB3A 5AYTA 4LAQH 3G5VA 5D55A 4NSKB 3K71B 2YFNA 1T5XB 2Z31C 2K3HA 3OKKA 4WKZB 4Y5YC 4F58H 5F0JB 4BA0A 2UUDK 2F53E 2VN6A 5DJAA 5B38A 4X80L 3LNGA 3S37X 3AREA 1BPVA 5B1CA 5E08H 3KL0A 5C07A 4J28A 3WKMH 4HFWB 3RA7H 4XBPA 2J1WA 4XMKL 2NY6D 5E2TH 1ET7A 4WJ5B 1CTMA 4HKZB 1TZOA 3SYOA 2CO2A 3CZFA 5HGAB 4MNGE 1OGTB 2BSCA 2XN9D 5E6IB 5C0AB 3QJRB 3QUKA 5JLZA 5D1XE 5AW2B 1NIAA 3Q6GH 3BIBX 4I18C 4AQ8C 3KYMB 4Q97A 1PG7X 1O6VA 1NBZA 1U58B 4HW6A 3Q44A 2NTFA 5EPMB 1J5CA 4QDGA 3NIGE 1G1KA 4Z3FA 2O5JD 2J20A 4G71B 5A3IC 4WKXA 3VFVA 4JCWA 1F8TL 2OM5A 4N0YL 1BJ1H 3B1UA 3SKJL 5CGMA 3BRDA 4XXWA 2NXZB 4PBDA 4DZ8A 5IEHB 5ISZB 4XC1H 5I0VA 1Y1UA 4JVPA 4HD5A 1FVCB 3MRJA 4W4NA 5TGBA 3CD4A 3EYVA 1NLDL 2A77L 4MA8H 1Y1WA 5C0GA 2ZSVA 1IL1A 5C08A 4K5LA 5K69A 2QJDA 2EO7A 4Y5YB 4UOQA 1QKZH 1J0YA 5KVEE 1MUJA 2YSSA 3FRPA 2AANA 4R2GC 3VX0A 2OMVA 4KTEL 1NOFA 2NX5E 1L0PA 4L4VB 4UI2A 1WWWX 1WC7B 3TBCA 4PS3A 2APFA 3HLAA 1EGJL 3ARDC 4WK4B 2J88L 2EYRA 5HHNA 3NIGF 4TKWA 1MLCB 3F7KA 3WFZA 2EYSB 3BSGA 2JFCA 5I9QB 3G6JE 2DI9A 1EWHA 2IWEA 1P4BH 4NKIL 4NPYB 4W9KC 3GM0A 5D96B 2YXWA 4MJJA 3WEOA 2J55A 3UAFA 3F8UB 4IRZL 4XTRC 3IGUA 4BH8A 3HIZA 4TQPA 2IH8A 4U3XA 1LEGB 2DD8L 3PFQA 2Q6WA 1MCSA 1KGWA 3MLUH 1NC4B 3OKEB 1RZGA 4IRJC 1NGQL 1N10A 3NUKA 4ECNA 2E86A 1E90A 3DX0A 4HCRL 4N90E 5I19L 1ACYH 4LCYB 1BD2E 1RU9L 1UWYA 5C2BH 6FABL 4R2GB 1IILE 1UKSA 3K6SB 2DQIL 3WE6B 4K5MA 1MFVA 3IAGC 1EZLA 4E41E 1UH3A 3G6JF 4HVBA 5JHLL 2OCJA 4ZQKB 1Z7JA 1Z1WA 2CO7B 3O81A 4FQ2L 3ARDB 3KLKA 4QHMB 2WOBA 3E8UL 5KJRH 5A7EA 1XCTA 4Y2DD 2PR4H 1HSAA 5IM7A 3SCMD 1FUNA 1E6OH 4PI2A 3J27A 1E3ZA 4WHYG 4OLUL 1SEBA 1E5AA 1NA8A 3B6SB 2EEBA 3LEYH 2WKLA 4XMPL 3SDYL 1G9EA 2JB6A 2C5DC 4FHBD 5TDNB 1SM3H 3ATBA 3H7LA 2NY2D 1EAQA 2LVEA 3P3UA 5F3HB 1JZDC 4NZUL 3FN0L 4J6RL 4ZK8A 5DDHB 3S5YA 3WEMA 2VDLH 2I27N 3SBRA 4AQEB 2NY0D 1P4IL 2NYYC 3H4FA 3KPSB 4IRJB 4FQCL 1NFIB 5K9KA 1FFOB 5CP7B 3RWHA 5C0EA 2JIXD 1Q1JH 3VSUA 4V1DE 4M1GH 4O02A 2NVXA 1I7ZB 2FD6H 1WFUA 4HS3B 5F9WB 4ZPVB 2X4SA 5I1JL 5F3BA 2BW4A 1G43A 3DX9B 4AK1A 2V7NA 1YUKB 2RJMA 3UYRH 1BBJB 2A9CA 4YHKL 5EU3B 1PU0A 3CCHA 1J1PH 1EEZB 1PY4A 3B9AA 5D1ZC 1IGTA 4YSTA 3MRNA 3MKKA 3D25B 4GRMA 4HUUB 4QJ3B 3MUZ1 5AUMA 4XPHL 5C8JB 2ZTBA 2EE0A 1A3ZA 4HK3N 1BZOA 1YN6B 2CBPA 4U1IA 4EN3B 4HDIB 1T89C 3L08A 4GP8B 3T9WA 3OKLA 5B1BB 3IMRA 3MN8A 4KZEL 1Z5LB 3N6YA 5IR1B 5E95B 2O5NA 3EBHA 4XPGL 2ITEA 3KW7A 4G9FA 2KC0A 4QLWA 2V2XA 3WJJC 5FB8B 4NN7C 2DTML 1OK8A 4ZMNA 5I66A 1IBGL 4WEBH 3T2NL 1MWAL 3RU8L 3DIDA 1S3RA 3UJTH 2X1PA 3OC5A 5D7HA 3O3EA 2NUPA 2WQRA 3MBEC 4G8IB 1BXXA 1EAOA 5DD6A 3T0VA 1BF8A 4QRPD 5HYJA 1UWXK 1FL6A 4O9HH 3ZYZA 1C1EL 1VJSA 2W65B 3L3KB 4EZMA 4GW5A 2CMRH 4Q6IA 2YJLA 5IUCA 1WIPA 2QQLH 3MNMA 3C5JB 3WGVB 5BV7L 2Z0UA 4GRLA 5KYNA 2YIHA 1RJYA 2R23B 2YRPA 4OFPA 5D1ZB 3BFWA 3F01A 1BZ7B 3VI4E 2UUDH 2AEPH 5FFGA 4BZYA 5GLFA 2X4NA 4GQ9H 2X6MA 2R0KH 3CC1A 3OGCA 4TUUA 1GL4B 1LNUB 1QAWA 1UCBL 2FHCA 3GSQA 4Q4EA 4FLOA 5AZEH 3ASWA 2FQFA 4G3YL 3LQZB 4HLZH 4MNHA 3WEXA 5I8OL 2BWQA 2B4CC 2FR4A 3FHEA 1QEWA 2QADC 2YHGA 1NPJA 4IKJA 1ES0B 4DGVH 3IN0A 4XH2B 4U49A 1HHGB 4MVBC 4WY7H 2XWDA 1JVOA 3I75A 2ENGA 3GUFA 2HUEA 3IETB 2MPVA 1T20B 1BP3B 4OCXH 1SY6A 3TTYA 3ZMRA 4BSVA 1UGNA 3TWCH 3LZQA 4WEMB 5GISH 3MNZB 3BSHA 2IPKB 5D1XD 4NP9A 3IU3B 1HK6A 2YJQA 2WVTA 2FSEA 2KZBA 1A2YB 3H42L 5INDA 3VI4F 1P7HL 3OMNB 5TF1H 4AC2A 1A0QL 4PRPA 2DQUH 1YMHB 2BC4B 2Y5QA 4MQXD 4LSTH 2JKXA 3Q43A 3F84A 2UWEE 5IHBA 4G43B 2GG1A 1ACXA 3IKCA 1NFAA 5DUPL 3DX7B 3DXAB 4PHXA 5D2NA 3KYOB 3GJFA 5DFVC 1NBVL 3GJFK 1ZTXE 3QK0A 5FKPB 2BVOA 3LN9A 1X3DA 5ETUA 2EKSB 3T09A 3QIUB 4X7SH 1GXEA 2ZCHL 4LL9A 2K45A 2CRZA 3OLDA 5L6YL 5I26A 3DROB 2QADB 3IPBA 4NQVB 4OUUB 1CFQB 3RWIA 4DKDC 5MI0C 3VXUA 3OPZL 1MSPA 2COQA 4JHBA 5AB9A 3F62A 5DT1L 5G5DB 3MV8E 5EH1A 1PDKB 2QVTA 1Q9LA 1YEJH 3UTSA 1DFBH 1W15A 4JPVH 2EDKA 4L3CB 4KJPC 1HFUA 2VDPB 1JXKA 5MHSE 5A6MA 2XZCL 1LD9A 2YPVA 1U8KA 4XVSH 2XFXA 2ZF8A 3ECBB 2UWEF 3T6ZA 3HI6L 1AH1A 4JDVA 4EMZA 4ZSOE 4PTUB 3WIFB 4NO0B 1HXKA 3HU2A 4FS0A 3BAJA 4XHJD 1A7RL 1E4WH 3CZGA 2EDWA 1HE7A 1FVDB 5EUOF 2CA3A 2YD2A 4K3EH 4URTB 4ZOAA 2BWIA 1A1NB 4PGDB 2XRAH 1S3KL 3UZVB 1OT2A 2E8YA 4V2BA 3WUWA 1BIHA 2HVKB 2UY7B 3N55A 5ITFA 2DLGA 3IM1A 4XN1A 2ZOTA 3MROA 1EQWA 4JM2C 5K39B 5JOPE 4M5YL 2NY5L 2DQ6A 2JKSA 4KTDH 4X5LA 1BD2D 4ALAC 1ETJA 5T3XH 2ZXGA 2XN9A 2H3KA 5SV4A 1RY7B 1RSFA 2L7JA 2Z0BA 4E41D 1M71A 4K8RH 5T5ID 4GPVA 1F1AA 1WWAX 1FORL 2W59A 3NSFA 5LVEA 2EUZA 1INEL 4LLMB 1QA9B 3MZGB 4IEFA 2DKUA 4NENA 5F0PB 1S4IA 3WG7B 1SDYA 1DCLA 3N43B 4K5PA 1XMWA 1BF2A 4CC0A 2O5ZH 1CU4L 4R7NA 3FB6A 1XCWA 4AWJC 3UDWA 2JQAA 1B4RA 1I8MB 1E27A 2FJHA 4U3SA 1QTPA 4RNRB 5DK0A 2D7PA 3U1SH 1NEZB 3WFCL 3ZE0E 5D71L 4O02H 1RZPA 2AVFA 2WVVA 4XZ4A 4NN6C 2EE2A 1A4KA 2PWEA 2RQ8A 5C0ND 4V1DD 3HS0A 3D3VE 4D0CB 4IIQA 2HG5A 2NT1A 3U25A 5B8CA 1ZXKA 3RWCB 3G7TA 4RMWA 4RFNC 5ALBL 1DQVA 3LNFA 1MEXH 1P7KB 4M5ZL 3WY4A 1HYSC 3CMOL 2BX5A 4AL8C 5EU4B 1RMFH 3NACL 3RWEB 1M3JA 1KJVB 2A6ED 4BSJA 1P4UA 2VLJE 2BY0A 4JCLA 4MNQD 2F5AL 1RULH 2M1KA 2WAQA 4EI6A 2WGNB 1J5HA 1PQZA 3ZE0F 4FQLH 4HGKC 3L3HB 4N8CH 3TNNA 2O6FA 4PRAA 4S2SA 3HG1B 1HDMA 4AYGA 1MXDA 4X6CE 5DTFB 3G5ZA 4XCFL 3FT1A 4Q9CA 3VXOA 1AD0B 4ELMA 4UTAL 1DDHB 1B0GA 2EACA 3PWUA 1EIBA 3LEVL 3S2AA 4RDBA 5L9DL 4QNPF 1DZ0A 4NN6B 5CN3A 3MJ8A 3VSVA 3HC4H 3NEEA 4NUPA 4OGQC 3Q9QA 3GQFA 2Y36L 1OB1A 4TULL 1RUQL 2MCG1 3K1KC 4XB8A 4Z7WA 3HE7C 4XNUL 1TWCA 1AGDB 1AE6H 2GSIB 5I75C 2VRQA 3T4YB 5J4MA 4RFNB 1B9ZA 3SCMA 5DR5H 1T0MB 5FKAB 2BNQA 3AS1A 3GRWL 3GBMH 5F9DC 3VW3H 1HN1A 3TCXA 2AJZB 1VEPA 4Z3JA 1VGEL 5KAQG 1PLBA 2YAFA 1UM5L 1Y0LA 2DYPB 3GTTA 4OIIH 4X6CF 5I1CH 3B1TA 3M45A 5F89A 3MCLL 3QNYA 1UASA 2APBA 4MJIB 5D4HA 4MZIA 4N3TA 3WSQH 2WHVA 5GRYA 3EDDA 4E2OA 4ANXA 2ZXAA 2VLKD 4NOBA 1SY6H 2JIXA 4X98A 2Y7LA 5IHLB 3QG6A 4LCIH 2J5LC 4PRHB 1XF1A 5A43C 4KJWD 2FBOJ 5GSVB 4XNYL 1WAAE 5IGXH 5MEQB 3LZOA 3QDGE 4PP1D 1IGMH 2B3IA 4ODTL 1UWEL 3JWDC 4Y4FD 3F65A 4A2EA 3HE7B 4Q9RL 1JTTA 3I6KB 2XPGB 4D9LH 5I75B 2YAPA 1DP0A 1X5IA 3PUUA 5HI4D 1NM4A 4CKVX 2EVIA 1RV6X 3GJFH 4PUBH 3IDGB 1NCDH 1M7UA 3DX6A 1OCWL 2D73A 4LT7A 3FT3A 4B95C 4JHUA 4PJ9D 4X8XA 4RFEB 1V10A 1H15B 1JUFB 4PREA 5IHZB 3FT0A 4Q56A 1S5IL 3MO1B 5TFSL 4M8QB 5ALCH 3CJJA 2J21A 1WAAF 2GIMA 4OCRH 2R9HD 3UAJA 3MGOB 3GSVA 4WVRA 5KVDE 4BK4A 4QRPA 4H8VA 5LAXB 3MV8D 2J5LB 2YPVH 4M7KH 1NMAL 4FQQA 1JAEA 1BZ8A 5AEAA 4N0RA 4YK4C 2CKBA 4Y2OA 3WY2A 5MHSD 2E4TA 3O4OB 5CINH 3SPJA 1BOGB 1Z9SB 2C1OA 4N2CA 4FOMA 4DP8X 1R5WA 1FPTL 2X44D 4M3JA 3ZRFC 2QFRA 2R2EB 3J7HA 3QEHB 3BUYA 4DQAA 5EA0H 3HC0B 4I9XA 3RUGB 1HXYB 3RRQA 3AT8A 4JG9A 4M7LT 1NEZG 2AK1L 4G82A 3PP4L 1E4XH 4U6TA 1WBYA 3D7PA 3U4BH 3FT4B 3WLWD 2LU7A 3QJQB 2XIDA 2AZUA 2IV2X 1N67A 3IB4A 1K6QH 1KOAA 2GUYA 4MCYA 1DANT 3L2LA 1W80A 2GJ6B 2VTFA 3L9EA 3QQ4B 4IU3A 5HHPA 1QBAA 5JOPD 1PAZA 2ZP8A 1F6LL 5EORL 3RFZA 4MNGA 4JDZB 2J5WA 2VPZA 1B0RA 1O7SA 4WI9A 3QUMA 3VFNB 4TTDD 5EZJA 3SE9L 5AVZB 1TITA 1JPTL 5D1XA 3ULSA 2WBXA 1E8XA 5CJQL 3BFQG 2LABA 2XTJB 2NSMA 5IEKB 1ZC1A 5PCYA 5L88L 1A1OA 3C6SA 2W9EH 3QZWA 3BIKA 5LNEA 2WXRA 1E5YA 2PW2B 2BIOA 3AUWB 3O2VH 4I2XA 4JG0L 3WNIA 4G7YL 1ZEAH 4JGMA 5I17A 1ZLSL 4EDXB 2IQAB 3GSWB 1RUAH 3LHPL 3QUYC 2JTYA 1CDJA 3GNMH 5I2IA 5H37G 5I1IL 2FJFA 2BVUA 5L2KE 4G80B 5ICXA 3GI9H 4PJHE 1OPOA 3L1FA 3VWJC 4LLDA 1SJEB 2EIJB 1FZKA 1FZJA 4P99A 2Y07L 4S0HA 4PLKD 1UB5B 3D3VD 2Y7SA 4P4RB 2FYVA 2F19H 1EV2E 4B50A 1V7NH 2CM6A 4ODSL 5A6IA 4JPWL 2HPTA 1D5MA 2C9QA 1XDTT 3REVA 4R0LA 3RY6A 1HQ4B 3EO1A 2O61A 3G6JA 4N2FA 4QT5A 3VH8A 1T1WA 4FFVD 1KYOJ 5BUPA 3TO2B 4XRCB 2VLJD 1U91B 3LN4A 3OAUH 1MJ8L 2GITB 4M7LL 5CZXD 3NABL 4P23D 3V0GA 1JXFA 3L3DB 3MA9L 4XCNA 3RFRA 3NDYE 4UCFA 1I82A 3AACA 4PMFA 4Z7NB 4F1ZA 5I15L 1A7PL 4PJHF 3S0PA 2EEFA 25C8H 1G7HB 3QUYB 4R5VA 5SWZB 3WIIH 4YSEA 1KBBA 3HHSB 3WFHA 2FT8A 4Z0XA 3VFOB 3C5SB 1OSYA 4FQJH 3GO1H 5HTSA 4NZ8A 1BD2A 4JL1A 1ZPUA 3UG3A 1T22B 5LKNA 2PP8A 3AROA 3LSOB 4QHNB 1KN4H 3VRJB 4E41A 3KDMB 1OAUH 4CRPA 5I18H 4BM7A 1RIVH 3BWUF 4MKTA 3T2LA 2ICWI 4CN6A 2ICWJ 1AY1L 2G0LA 4NRXA 2IJ0C 1FC2D 4LBEA 2DTSA 3FTVA 3EUUA 5BOPA 3JXAA 9CGTA 5F1KC 4MJ6B 2ZWKA 1N2RB 1HEZA 3AZUA 4LNRA 3BFOA 1FG2A 1ZSDB 5JO5A 4HIIA 3PLXB 1RUPH 1GHFH 3LHAA 4IKKA 1SFOA 2E6JA 4X8GA 3QJOA 2AXJA 5E5UB 5SX4H 5DLLA 3UTZA 1PQEA 3MLVL 5G4OA 2ZNWA 4DN3L 2YEZB 4KDLA 5DEGA 4CJ0A 3JTSB 4PG9A 3SO5A 3QJHB 3RLSA 1JPFA 4YXKH 2CG9X 4K94L 3QHFH 3KPNA 4V1DA 3FTWA 4AE0A 4OGYL 1IAII 1EUTA 2G30A 3FSZA 4TVPL 1Z3GL 5AKTA 1URZA 4KI5E 1U8IB 4R90H 1IGFL 3Q2WA 4HIJB 1MZYA 5D6CA 1YNKL 1KGJA 2FWOB 3QDGD 1IEAA 4YLCA 2Z91A 3B34A 3DIVA 2X38A 3JUYA 3MYJB 5JW5B 2W92A 2VMEA 4MNQA 2UZIL 4AH2B 2YGQA 5KBPA 1E4JA 1JNHA 3KGTA 2A83B 4WW2F 2HKFH 1KTBA 5C0AE 1ROCA 2OL3A 1BFOA 1KXHA 1NGPL 2VL5A 2VIRA 4GIOA 2Y0SA 3U4EA 1Q0XH 1J12A 3FK3A 5I6PA 3HPLA 2PP7A 1BVKA 3EDFA 1YEIH 4LSPH 1W0VA 5JZ7C 1UG9A 1S7WB 4BKSC 2YPKB 1JDDA 1P2CA 3EOTL 5IFHL 5TE7L 3P4MB 1GGIH 1AHWA 3G6DL 1GOHA 3WLBA 4PGBA 1U8OB 3GTJA 4FG4A 3SGKC 2JKRM 2AP2A 5IP4A 1J86A 3VQMA 5ISZE 2PCPB 3P2BA 3D0LA 5D93C 5AW9B 2BIHA 2CKBH 1KZYA 2EECA 2GJRA 4TOYL 3WTSA 5T1KD 4M6NL 4PCYA 1I7RA 1JN6B 5JHAA 2YQGA 3CZUB 5F7DB 3R8BB 1URIA 5KSAD 5EEUA 3QJSB 2FAUA 3N9GH 4FQXC 5IF0A 4DUVA 1FNHA 1QHPA 1E5CA 3VI4A 4D7ZB 1RH8A 1CGSH 2DMCA 1I7TA 3IJHA 2G9KA 1WFNA 1PLCA 1HH6B 5AAWC 3Q05A 2RBLA 4KV5E 3GIZL 3SJVE 4QLRA 5GS0D 2VLKA 2CW0D 2ARJB 4MA7H 5BV7C 3QUMH 3SE3A 5CGYD 1LP9B 3HUJB 5CM1A 4GS7B 4XAWL 4CSSA 3X12B 3PAVA 1U3NA 2DPKA 1WZ1H 3D0VB 2X2IA 4IJ3C 4M1CD 4HPOL 3ZTCC 5B39A 4EE2A 2MQ0A 1DQJA 5D93B 3A6CH 2HJFB 2Q9OA 4Y4FA 3BVTA 2WB7A 3ES6A 1YPZE 3SZKC 4MBRA 4LKCA 1UT2A 2X2YA 2EQDA 1RI8A 3MYZA 2WXGA 1L8FA 4BDVB 3HN3A 5T1DL 3QSKB 2FCBA 2BHUA 4X7FC 1HSBA 5FTJA 2VXTH 1TCMA 2UWEA 4HZLA 1GMEA 3LNEA 1MWAB 4KDVA 4KV5F 5IMKB 3PWPE 3ULUC 3IVKB 3BAIA 1UACH 4PJ9A 2R1YB 5KVEH 2FB4H 2O4EA 3HG2A 1L9QA 4L1SA 3PFUA 4O2EB 5L2KD 2HFEA 5IQLA 2Z7YA 5EUOA 4ZAKB 3SE8H 2XKSA 1DO5A 1LHZA 4PJ6A 1UYWH 1J8KA 1G8JA 1B4LA 4LEXL 4UQAA 5ID0B 3SBPA 4Q0XL 5BV7B 1WD9A 5JMOC 3M7OA 4CVWA 1Q16A 5IB5B 3VXNB 1YPZF 4KDWA 5HI5D 1G7IA 5SWQB 3AAZB 4TNVF 4IJ3B 2HX7A 2FECL 2HJLA 4XO9A 4OCMC 3BZEA 1MFBL 5EZLA 2XQ0A 4YL9A 2JCWA 3KPSE 2D7TH 3WXWH 1HAUA 1ICTA 3BN9D 3U9PL 4FGMA 1NGYB 3W5NA 2AEOA 1F4YH 2N56A 5KSUA 1UH4A 2AJUL 4BH7B 4B3VA 3ZW3A 5CBEB 2C3XA 1HCZA 3NESA 3IR6A 4ZSOA 3MLRL 3PHOB 1BECA 2CLZA 1L3NA 2XHNA 2ZYIA 1QBMH 2OCFD 1SXBA 1JZ3A 5IFJB 3A3YB 3LOWA 4ZYKA 4R3SA 2JA7A 3V6FA 2UZXB 2BIPA 4LBAA 3HZMB 4LLYA 3F00A 3IRCA 2LGNA 5C0CD 1VGKA 4PW9A 4X7CC 1E65A 1TVHA 1A6AA 3D08A 3MX0B 1XF4A 5CP3A 5BO1L 4Z78A 2ZJSH 1T2XA 2AV7A 3MV01 1U8MB 4WWKD 2LU4A 3GMOA 3LEXA 3HE6A 4JZNB 1DJHA 2FL5B 3L48A 2VW4A 4IS6B 4OFYA 5E2WH 2Z3FA 4NJ9L 4XN5A 3W37A 4PJDB 2NY5C 3H85A 4KY1H 3RG1C 3ILPB 2V9QA 4RCAA 4D8PB 1CMOA 2H1PL 5ACZA 3MV9E 4IBYA 4N2NA 3OV6A 1MIML 5EULV 3OUGA 1P53A 2W0FB 2XBTA 4XNXH 2VC2L 1AZBA 1JCKA 5DJZB 5M7QA 5IB3A 2Y7NA 4KKNA 5FO2A 3CBRA 4G83A 5D7SH 3T6WA 4HZAA 4W9GC 3AJ7A 4RMVA 5CGTA 4DOHB 43C9B 3GTPA 3ZKXC 3D3VA 3EBGA 3ZTJH 4X0KA 4XCCH 2YBRB 3T3PE 2PPCA 4BHUA 3O3UN 5C6WH 3AB0C 3HNVH 1OAJA 1AFVH 1T0NA 4KJYB 2QSVA 3SQBA 2P49B 2KQNA 4AW7A 2EIEA 2OL3H 3TEZA 2VLJA 5GS2D 5B3SB 4YAQB 3W9EB 5IW6B 4UBDD 3RKDC 5CCKH 3O3BB 5C0AD 4ISVA 4P23A 4ZTEA 3QI9D 1A9BB 1NCIA 4ERSL 1DEEB 3I6SA 4F7MB 2L7EA 5DJ0B 1RIHH 1MG2C 4ZMAT 4PRNA 3K4ZA 2V3DA 2IANB 4IK6A 4YWGH 2WOYA 4XWOC 2KH2B 2W81C 4QO1B 1H3GA 2JA5A 1HIML 5E94B 3P0YH 3T3PF 5FM4A 3TO4C 4KROC 4YQXL 2WD0A 3TBSA 1YECL 1SF5A 3PWVB 2NXZD 5CEYB 2J2ZA 1VZHA 4YUEH 2X0VA 1D5XB 3ZKXB 5J1AB 2R0WL 4U0QB 1R3KB 4OLWL 3UBXB 2Z31D 4WTZG 3ELQA 3BKJH 3AB0B 1T5WA 2CJTA 4PY7B 3FUDA 2JMRA 2AI0H 3L95A 5ENWB 3PU7A 4H88L 1GZHC 1QDNA 1MKFA 3QISA 4E5XA 1FNEA 2OPCA 4LPYA 3GWJA 3KL3A 1TTCA 3BE1H 4PV8A 3SJVD 3U7WH 3LVTA 2VDML 3QWRD 2NSXA 4GT7A 5L4IA 3ARPA 3RWJA 5KAQF 1BAFL 1UD3A 1P7QB 3WFDL 5HGHA 1MI5D 3FL7A 4CU7A 1LE9A 2KPWA 1PCSA 1OWRM 5B3JE 1T3FA 4KROB 4YHML 1SJXA 5D7JC 1WAAA 2VL4A 2XA3A 2QKIC 4XVTL 2C3GA 3QDGA 3B2MA 2FEDD 2H6UA 2R4SL 1HHIB 1QI5A 1TYJA 3AUVA 1Q72L 4WO4C 1FAKT 4JB9L 2V9TA 2Q2EB 4P49A 3UCQA 5FEBA 2CWRA 4R2GD 4QRQA 1ZTXH 1FVEB 4LQFL 4XMZA 3VFUB 3PWPD 4U1HB 1KY7A 1L9TA 2ATKA 3ZUCA 4HXBH 5DVLA 1HZKA 3WKQA 1FCCA 3RX8A 3W9DB 2E56A 4HIPA 2MJWA 3O6FC 3S5LB 2DYSB 1I9JH 2R56L 4Q9QL 2PKDA 1RZ8B 3D5OF 2B8OT 2PLTA 2HVBA 1CT8B 2W07B 1DL7L 3ZGHA 3I50H 2WN3A 3TIEA 4ZMOA 4BINA 5D7IE 1TZGL 3FW6A 1CYXA 3CC5A 1OWWA 4KX9A 1A9VA 5IMMB 1NH6A 3E0GA 1FFNB 4XTRD 2WP3T 5T1KA 1SJMA 4RISH 5CJXA 4CMMB 4CJ1A 1R24A 2C4XA 2QKIB 1KTCA 5GRVK 2J1ZA 1E3FA 1ZA6B 3KPSD 3WFEL 2FRGP 5KSAA 2ZZUT 5AB0A 4P2RB 3H6AA 4ATWA 3UJIH 4EOWH 5DI8A 1EO8H 4LARL 3TEUA 3X13B 3D9AL 3IDMA 4OKVA 5H2BB 3S88H 2GBVA 5MEPA 1PD0A 3UZEC 3WY1A 4UV4L 2F08A 1MHCB 3FB7A 3S5ZA 4JQIA 4N2GA 1E50A 3QPXL 4GXFA 1WZLA 5D7IF 4CC4A 3FQXB 4OD2B 5GGRA 3O6FB 5IOPA 1KNOB 4TSCH 5CP3H 2M8XA 1OF2A 2BSRA 3I02B 2XN2A 3CUPB 3Q8EA 3HS8A 4I3RL 5HHQA 4CVUA 3CZJA 3ZL2A 3EGDA 5BRPA 4IQHA 2R0ZH 4HZ1A 2ILLA 2ZPKL 5DLML 2GSGB 1HD5A 4ZPTA 3LMJL 4JFOB 4OLZH 4ZFZA 2FJUB 3ARQA 1DVSA 2Z92A 2YC1B 4JM2F 3WEBA 5KBKA 5TQ2H 2FK9A 2BPBA 2WZ0A 2NYYD 2FT6A 1NIDA 3FJTA 1UD4A 2E74C 2F68X 1A4AA 3AITA 3ARZA 5A6LA 1CDGA 3VG9C 2YKKA 3BP6B 3MBWB 4MAUH 3MV9D 5JQHC 1WFIA 2LE9A 4M4RB 1R3HB 5B6CA 1M05B 3DRTB 3DTXA 4M7ZB 5L2KA 1KTDB 2PWFA 4PJHA 2WUCL 1HH9B 3DSFH 4JKNA 4O5LL 2YEVB 4HBCH 4LPVA 2EIZB 3IMVA 2FNBA 3UBXG 1UA6L 3HU1A 5A7BA 1KYUA 4JO2L 2QR0A 2OMYB 1BJ1J 5IJDC 4GO6B 1P6AB 5GRUL 3SKMB 1ZGLB 3RVXC 5IIEB 2QPSA 2QV4A 3IXAB 2QVMA 1GR7A 2YMXH 5IWLA 4X7EC 2X1QA 2YK1H 3M8OH 2WXPA 3H9HA 3QG7L 4PRHE 4GKZA 3BWZA 4KK8C 4R83A 5FTLA 1A6WH 2JJTC 2Y3NA 5J6GB 4B96A 3WMPA 3VG9B 3MBED 2COVD 3QWOB 5KTEH 1NGWB 1TQBC 3GUTB 2KLTA 1NBYB 4WUKL 4MD0B 5T33H 4JZJC 4U3HA 1MFEH 4YIQA 3R18A 3CFEA 2FLMA 4QXUL 3F58L 1GTFA 5C0CA 4MZRA 4UIMA 3H54A 5I1AB 4WWOA 2XKNA 4KRNA 1K8DA 3G3LA 1BW4A 4AJVA 1AG0A 4LASH 4PYGA 4WWKA 3TNMB 5DHYA 5JDSB 3JWNC 3DDFA 3RWDA 1T2QH 3RGBA 4TTGA 3EGSA 2BP5M 4MHHG 1GGYA 2QADD 3CZLA 3IBOA 4HKXB 3WN6A 1UFGA 3UPRA 3ZX1A 2VRKA 2H4EA 1V7ML 4D7PA 2F1EA 2C1PA 4F7TB 1UH2A 4YC2B 3CZEA 5SWSE 1I75A 1I8UA 3D4ZA 4WW2A 5E7BA 4HWEH 5KW9H 3S5LG 3D6GA 3HB3C 1NJ9A 3ARBD 5BO0D 4FFWD 5C0DB 1CDUA 1WD8A 1BZ9A 1PY0A 2P7TA 3L5XH 1TQBB 5DJCA 4HK0A 4EI5A 5KOVC 4M6AA 4TPRH 2XWZA 4ZW8A 3ARYA 3C6LC 1M7DA 1FN4B 4GLRI 2ZKHL 4NSKA 3BKYL 2X28A 4QTHA 4FKKA 4R5XA 5BZWB 4ZFFB 3GK8L 5BVPL 4DN4L 2DL2A 5DFVD 5F96H 4WENB 5F1NB 3GFUA 3PLYA 1S7QA 4KMQA 3QR1A 4LGSB 3Q1EA 2GJ6E 4N68A 1KC5H 2MHAA 5DQDL 3ALPA 4NKQB 1B4JL 4ZUVB 4D9QD 4K94C 3WNKA 1T7VA 1OGTA 5ECGA 5C0AA 2Q7YA 3QI9A 4KAQL 2IIJA 4H5SA 1UXSA 4WEEA 4RH4A 5TJWK 2ZQKA 2A9NH 4HPYL 4GOSA 3KBFA 3HB3B 1UD8A 4GI6A 4GAFB 4XPTL 4AZDA 1OHQA 5DYFA 5KVDH 2BIIA 3E8VA 2C7UA 3F04A 4UIKH 1ZS8B 1J87A 1PNDA 2EDDA 5JW4N 3UYPA 2Z34A 2BY2A 2L0DA 3E6FA 2R51A 2O5YH 2VE6A 4FE9A 3INUL 1DVXA 1DQMH 1WTLA 3F7YA 1FVCA 3K6IA 3VGBA 3EOBB 1KCVL 2JB5L 1TMOA 5DEFB 3CZSA 1IGIL 2FO8A 2Z31A 2Z7UA 4Y5YA 3VE0A 3ZDYB 3RIFF 4P5TD 5MERA 1NFKA 3N1FC 4FERA 4KHTH 1R5VB 2I9LA 1TJHH 3CVCA 3DV6B 4BK5C 4YFLI 5DRWB 4JM2D 5T1LA 1WEJL 1X9RA 3OL2A 2AJXH 2ITDB 1ZLVK 4XZUB 4JQIH 3RJOA 5GS0H 4E68A 2NSQA 4XNMA 3MRQA 1VFUA 1FL3B 2OI9C 3P3YA 5A16B 2EDHA 3DPBA 4I18A 3SJVA 4KKRA 2YD4A 2HFFA 3DVNB 4H1LB 5GZND 4AQ8A 2VGLM 3QWRA 3X2MA 2GK0B 3MR9B 3KYAA 1AOZA 2R39A 5H4YA 1MI5A 4QAWA 3FU0A 4PN6A 1RK0A 1MRDH 2N4IA 3OWRA 1PD1A 1SDDB 1RPQA 2K9FB 1V5JA 4QRAA 2IH3B 3CHPA 1MIEL 4KXZI 4BELD 1I85A 3IEAA 1YPZA 2HFGL 1ZT4B 4TNVK 1IBDA 3K6SA 1VFAA 2W9DH 1L0XA 4P48A 3QRFM 1D5IH 2DMBA 4HLEA 4IBTA 4K7FB 4ZQKA 3PWPA 2XICA 3PREA 4X7TA 3PS6A 1J88A 2NDFA 3FYIB 1N3NA 5C71A