4FG2A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellotetraose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg2A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg2A02
5GLXA 2HCZX 3CZBA 4FG4A 2ENGA 5GM9A 3SULA 4AVRA 3X2HA 1WHOA 2BH0A 2JNZA 1WHPA 3M3GA 2PNWA 2G6GA 3SUMA 3X2LA 4L48A 3X2PA 3D30A 3SUKA 4JP7A 4FERA 2GAEA 3X2IA 1OA9A 2PI8A 4JJOA 1BW4A 1OA7A 4JCWA 3X2JA 2KQAA 5GLYA 3X2OA 4FFTA 4JS7A 3ENGA 5H4UA 3FT1A 4JP6A 1HD5A 3X2GA 4ZM7A 3X2MA 3FT9A 1WC2A 2VXQA 2G5DA 1N10A 2PJJA 1BMWA 3X2KA 2AE0X 4ENGA 4FG2A 1BW3A 1L8FA 2PICA 3X2NA 3SUJA
chains in the Genus database with same CATH superfamily
2NY3B 4PRHD 1DTUA 1OGTA 1OPGL 1W0WB 2OM5A 3GTQA 1J0IA 1LP9E 5LNEA 1UXWB 2EICA 1RJZA 3NABH 3FFOA 4PJBE 1B3IA 3PWPB 2K6YA 5D1QD 5DLMH 5DURB 3RGVD 5HYFA 2Y7QB 3FQRB 5E8PB 4HPYL 3INUH 4BFFA 1QO3B 3MXWL 2G0KA 2Z6FA 4QY8B 3QRBA 1HSBA 4L8SB 2OKMA 3QT2A 1IC0A 2IGLA 1JXDA 2DMKA 1DMRA 4OZHF 3GTJA 3Q1EA 4EO5A 1R4XA 2R1WB 5CJBA 1IL1A 1ZTMA 2K3TA 3PHOA 4S1RL 4PWEA 3NABL 4YX2H 4G9DA 2WLMA 1J0YA 2EDQA 4IKKA 4Y9CA 3SBPA 4DVBA 3C5XA 5C07E 3F83A 2WUCH 4P46B 1QBLH 4OM1L 1FJ1B 2JA6A 3AQDA 3Q48A 3TU6A 4WU7B 5C0EA 2BFVL 4ZJ9A 4F92B 1IKNC 3TT1L 2DLEA 1QSEB 2NUTA 5LGJB 2YPLE 1ET5A 3IDNA 4JPWL 1FNFA 2ODHA 3TEYA 2CBQA 1ONQA 3TN0D 4L5FH 2C7UA 3TJEL 4O51A 4N2LA 1KC5L 1QPKA 2NY4D 3V10A 1NL0H 3HMWH 4LP8A 4AL8C 5JR1H 3CC5A 5GS2H 3CHOA 2DJUA 3MUGB 1LO4H 4LFHD 2Q7YA 1TQSA 4KK8C 3RGBA 3AXLA 2IG2L 5B1KA 2OQJB 3JVGC 2BW4A 2NDFA 3GBML 1YUKB 2BOBA 5DJDB 3UGXA 1JZ8A 4JREC 2CDFA 2JKNA 1EMTL 3ZHDA 2H4EA 1BIHA 1OTTD 4PWFA 4JLRA 2PYEB 3WMSA 4PH8A 5H35A 5ACMA 5DA4A 3KM2A 3O2DL 1NCAH 2NCMA 5CZKA 2ZCHH 2IH1A 5AOZA 2E6JA 4YHNB 4PJAF 3AY4A 3Q43A 1QRNB 4MJ5A 3M46A 4WLCA 1OF2B 3NCYP 3UO8B 3WE6A 3H0GA 3FFCB 43C9B 2ARJA 5J5EA 4JHZA 2BNUB 1HZKA 5EUOF 4LSVL 2B77A 4KU1A 1WG3A 3GO1L 4WY7H 5C3TA 4YZFE 5DMKA 2R27A 4JPIA 4U6XA 3RWHA 4D7BA 3AM8C 4ODTL 1WC7A 4QJ5B 1LO2L 4LCUB 1KLGA 5HY9B 1OP3H 4BFKA 4DTGH 1QTPA 2E56A 5I0ZA 3DYOA 5DRXB 4XWOD 3DIVA 4Y2DC 5GGSY 3TVMC 2HRGA 4YHYC 1FVEB 1I8LC 5TE6H 4TQIA 1R3KB 4AE1A 4XTRC 5LCVA 1JDCA 3ERXA 2QELA 1YEDB 1DL7L 2F54D 3GJFB 3N3EA 5DD1H 1A7QL 2ZOKA 4HIHB 3HMXL 3VO0A 3K3QA 4HU8A 3FH7A 2X6MA 4LNRA 5L9DL 1YQVH 2HT4C 1H3PH 4BHUI 1AO7D 1G7JB 5DMGD 3HTLX 1KPVA 3P77B 1IFHH 3T08A 4L18A 3A3YB 4GRLC 3MGAA 4HGKC 3ILPB 9CGTA 2XG4A 3GTKA 3NFNB 1WUZA 2QDWA 2DYPA 3LXBA 1NCWH 4F58H 1NPJA 2FSEA 4N86A 2XWTB 4HZLB 2BM3A 1B6UA 3CD4A 2GITA 4WFHD 1A5FL 1DDTA 1HESA 1YEEH 4A7UA 5DI8B 1RUPH 1N0XH 4DN3H 1NGWA 4LU5L 4PSRA 3D85B 5D7JC 2NYYD 3GC3A 3IMRA 2L7UA 3ZKMC 4X6EB 3ARDD 5GJTH 3K5SA 2HVKA 3NFPA 4HPHA 1CICD 2IH8A 4XP5H 1RIUL 1T89C 3GRBA 3GTVA 4GO6B 5IG7B 3RILA 3X2GA 3O41A 5EIQA 3SE9H 4HFWA 3I50H 3QEQA 4WO0A 2PTTB 4JE0A 3HZKB 4GKOA 1LO5B 3RTQB 4PJHF 5KYWB 3FTYA 5DYOB 2R51A 1JZDC 3F58L 3T6ZA 1JRHL 1JTPA 4GXUN 4JHUA 2DKSA 3WFBL 4UQ3B 2JNZA 3MKKA 2VISA 4R2GD 1UKTA 3CLEL 3QARA 2Z4QA 4YS4A 1SLVA 1AHKA 2AQ3A 1QRNA 4MJ5B 4N0YL 2H5UA 4XPAL 2GCYB 2C3VB 2F53E 1YEJL 2YXVA 3QI9A 4W6WB 1Y6KR 4E41A 4KQ4H 1Y07A 5G2NA 1SJEB 1U93A 3GRWH 3ASWA 5E9DD 5ICUA 3GS4A 3SDCC 5E6ID 2IQ9H 3BN3B 2XN9B 3MLTA 5SWZE 5KUMA 3T0WA 2P9RA 1RXLA 3LS5H 3PHSA 1T2XA 3MLZH 4HEMA 5KSVB 1O5DT 3SYQA 3TYFA 1N70A 1CE1L 3JV6B 2HLFC 4IRSB 2A6ED 1I8IA 3C87A 4Z7OB 3HU3A 4W9FC 4DK6A 2WVSA 2VXQH 1DMSA 1T2QL 2P42B 3FQXB 4PJ9D 2YFOA 5B1AB 5B3SB 4ZAKB 2YC1B 1YYLL 2C1OA 1PZUB 4X4ZA 3L9EA 2YD4A 1O7VA 4WTWA 1MI5B 1RPUA 3PFUA 2RIKA 4JFTA 1KYUA 2ZOKB 1HC1A 3QUXB 5BO1H 1FJ1A 4KHXH 1OTUC 4EOWH 4AK2A 2H41A 3MJ9A 5BZXA 2CUIA 3T1WA 1PY9A 4PJEB 2Z64C 3ZUNC 4WZ9A 4MMXA 4GJTB 5E51A 3TIDB 5JOEA 4IM8A 4MNGA 4E9WA 4PLNC 2Q5BA 3GSXB 4H8UA 3EFOA 3BLPX 3FS9A 4ZMVA 4WUUE 5DYGA 1L9NA 1KG0B 1SXBA 2YO3A 5HI4C 3X2OA 3AWGA 4MS8D 4W93A 1H15B 1NC2A 2JCCB 1M57B 2AXWA 4JG9A 5DDHA 4LOUD 2EO9A 3QQ7A 1KLFB 3IN2A 2RMNA 2RJMA 1RJYB 2Q76A 3HE6D 3IJ7A 4JDVA 2E7LC 4PTUA 5I9QB 4FADA 1WTLA 1MG3C 2J6EA 1F4XL 3MV9B 4LVHC 4K8RL 5CSZA 1FL6B 1YLEA 4JFDE 4YHNA 3SKJL 3QEQB 2FWOB 4QOKB 5MHSD 1TVBB 1G1YA 1HI6A 5ADOH 1PU0A 7FABL 1Q0YH 4FQQA 4WUKL 1NCTA 4LEOB 4POZC 2JKIS 2FGZA 4MCMA 3E6FA 5J57B 1EJFA 1GPOH 5KVDE 4NIYE 3D85A 1KDIA 3P1VA 4AUYA 1GZQB 2JKSA 2NUPA 1HH9A 2BC4A 1CGUA 2IV2X 1VAHA 3I02A 1XH1A 5HPMB 4G80B 4YFEA 5GRUL 5F97E 2IPUG 3ZQ9A 2CGZA 5CD5D 1O6SA 1P5VA 4BWUA 3QORB 2V2TA 2JQAA 5IOPB 5PAZA 3QP3A 1KMGA 3DJSA 1FDIA 3CZFB 4JM2A 4FQXD 4G6FD 4MD5A 2VZ1A 4PD4K 4GG6B 2VH5L 2WKGA 1I85A 4FD0A 4DZBA 5GZOD 1JHTA 3LNHA 1NCIA 2BJMH 3IDYB 1WFUA 4BUQA 1UD8A 4P2RA 5K59F 2KZ1B 1QSEA 2FEEI 1HDMA 4PW3A 5CMAA 3FSWA 4BWWA 5KAQF 5KZCD 3Q3GB 3NZUA 2WQWA 4MAUH 4HF5H 3ZTJG 4P46A 2EEBA 3UG5A 5J56B 2COQA 5IK3A 1RK0A 5FV2A 1WDAA 2AMUA 3PWNA 1YNLL 2GI0A 2J55A 1P5UC 4J3OG 4IRJA 5C09A 4HJ0D 1P84J 5HI5D 1PVHA 1X5YA 1L9RA 1S7QA 1QTYT 5TDNB 1X44A 1NCDH 3MNZA 1IEAB 1QABA 1PIGA 4KDTA 3MGTA 4IMLA 5BV7B 2AQSA 3DETD 3LIUA 1AAJA 1KCKA 2Q7AA 4LCWA 4XOCA 2IAMB 4Z7VF 1UM4H 4N85A 4A66A 4LDEB 1TEFA 4UUJA 4L8CB 2XXMB 4XP9L 1KBVA 3B7YA 3FSAA 5HJ3B 3RNQB 4OJYA 3RWIB 2IAND 4G5ZL 4BK5A 2VERN 3EO1A 3SKOA 1SEQH 2H2PD 3V95A 4IBSA 1BMZA 4V1DB 1SDAB 5I82A 4UQBA 1OAYH 1KIPA 2VIRA 4XP4H 1I3VA 2AJZB 1ZTXE 3ARBA 1AO7E 1RK7A 2H2SD 4I3RL 5HGDA 3KPSA 2P7TA 3T9WA 5E08L 4L9LC 2WTRA 3VDAA 5IHUH 1G7IB 1JXFA 4BKTC 5ID0B 4PIRF 1TQTA 2Y07H 4R7LA 3TASA 2NY3C 3CJJA 2YOAA 3IJYA 5AW9B 5T1KD 2WVVB 3GLZA 4GH7B 4ZX3A 4KQ4L 5C08B 1QFUH 4BFIB 4G3YH 4ZMPA 3FTXA 4N4YB 4AE0A 2BZCA 1K5NA 3SE4C 3NA4A 3CC5B 4PJFE 5F7UA 4QO1A 3R8QA 1KBKA 1J1PH 2BDNH 4U1GC 3S7GA 3WJJA 3G04A 1A9EB 1YUHA 1MDAA 2K7QA 1I3GL 1LEKB 2FK9A 3I3DA 4MYPA 5FWRA 2WYZA 2C3GA 3DBSA 5LGJA 2E7ZA 1C5BL 3EZ8A 3H9YA 5J6GA 3HZYB 4C56E 1EBAA 4IKIA 5IB1B 2NX5B 5KVGL 2PR4L 5D1QE 1M1XB 1J1OH 1XD1A 2AZAA 2BNRB 3RZCD 2FJHA 3DJRA 3HU1A 4G8EB 1ID2A 4HDIB 1HSAA 4ICXA 3KYOA 1T7WA 4DWHA 3IBOA 2HTKD 1SYVB 3ULVC 1I85C 2OCFD 2XWXA 2N59A 1QA9A 4NUMA 1CDIA 4ZS7L 4CAGA 2X9WA 3HC4L 4M7LT 4LCCC 2VDMH 2J8UE 2ZXDA 4L3FA 4AJVA 5KN5A 1PQFA 3OMAB 3I84A 1N7ML 1TOXA 3OR7A 5E4IA 3RWEB 4G1MA 4F8LA 4UB0H 3HKFA 4IBUA 3WFZA 2VLJB 1QSFB 2JV6A 3X2MA 4JFPA 3NSXA 1KSRA 5IWLA 2F8XC 3BQUB 2H32B 1UWXH 2Z31D 4L4VA 3GSUA 4NBYB 5F1IB 5LAXA 2QFRA 1TQUA 3MOAL 1QLEH 1NEUA 3BMWA 2IDQA 1EANA 3X1FA 4I0PB 3U48A 4IU3B 3TM6A 5IREA 1SOQA 4OAWB 2X6BA 5T5ID 4PRAB 1HE8A 1MCLA 1UZ6E 2VERA 3BP4B 3NVQA 4M5SA 1ASPA 3VFRA 3D39B 5BRQA 3LRGA 1OLLA 4B9FA 3VRIB 4UT6A 3MMEA 5HDOA 4NQCA 4PY8J 1XBDA 3NPSC 3CVHA 2JKWA 3V0EA 1ZHBA 3OAUL 1KJVA 4JHWL 3RGHA 2X4UA 5I75B 4ZXBD 4Z95H 3SKJH 3NIGE 5C0DA 2R69H 5FUOL 3HFML 1AQKH 4R26H 3BMVA 5E1GA 1X7SA 1WZKA 3LZNA 3N1QC 4NQEE 4Z7UB 2VN4A 1S7UB 1WE5A 2VDLL 5D1XE 4LLVB 1CYWA 5ES4B 1F1GA 3F7QA 2X70A 4JFOB 3BWZA 1XB6A 2LTQC 3O3UN 1XGZA 4GI9A 3ILQD 3ARED 4GAJL 3AMLA 2JB5L 5I73B 2FATH 3L4ZA 4X2UA 1S9VB 3NFSL 3LD8C 4NN6B 4EXKA 3QZBA 4OGYL 4F9PA 3O9WD 2FH8A 2L04A 4UT9H 4AGNA 2FUQA 2B59B 3P11H 5GZNA 4DP4X 1A7OH 1JV5A 4MA8H 4JR9H 1DQVA 2IMMA 3VTTA 2UZXB 3KYKH 5DEFB 1CZ4A 2LOEA 1ZOXA 1MXDA 1ADQA 4OLVH 3K1DA 3NACL 4N0CD 3SKMA 1KB3A 1I3RA 4GAJH 4HMCA 3UTOA 1U8KB 4KDWA 2YAHA 1IV8A 1XF4A 4MNQD 4NKDB 1YNLH 3PUUA 2RQ8A 4G72B 3X1GA 3ZK0A 3IN0A 1ZMYA 1EA9C 3V6ZB 3UJTH 2ICEA 1E28A 4IDJL 3KM1A 1MJJB 4POUB 3WNMA 4WWOA 4FFZL 1ET8A 4O58H 4RDQF 4R5TA 2F5AH 2ADJB 4U1KA 1ZVSA 5L88L 2QSQA 2VDPH 2W88A 5I6XB 1KJMA 4DPAX 1VPOL 3BO8B 1MCCA 4N22A 4Z0XB 4QTHB 3U36A 2CDGA 4X0KA 3NCFB 3P4MA 4W1TA 3VNZA 1FORH 3SQBB 2EC8A 4HS8L 5C0JB 1I9IH 1DSYA 2YS4A 4KWUA 4P4KD 4AGMA 4R0LB 3SY0A 2JI3A 1CGVA 3A47A 1C5CH 1UH4A 1AW8B 5F7MC 2EEOB 4L8DB 4ZNEE 5B1BB 1IM9B 3WFBH 3T6XA 3OG6B 4NKMA 4OGAD 2DWSA 2BP8B 2D9QB 2V9UA 2NYKA 4OZ4A 2EDFA 4Z78A 5D1QA 2H8PA 3QDGA 3MOBH 4J3UA 4PP2B 1G5AA 2EKJA 2EJ1A 4QF1B 4WW2B 4WSKA 4X8JB 2HG0A 1ETJA 2G3NA 1TVHA 5C8JA 3PQYA 1E5ZA 2APWA 2XXGA 4PB9L 4BJLA 5KJ7E 4U6VL 2Y36H 3FYEB 5EA0L 1KZQA 1YMMB 4JX0A 3S2AA 4EXPX 5C0JA 3RPBA 3B1UA 3D2UA 1MRFL 5B3NA 1YY8A 4P2OB 3UP6A 1OGPA 4NC0B 5EF2A 2R2HB 5L4MA 3N41F 4DEPB 5EBLA 1IBFA 3MLZL 2NTSP 2C45A 2ESVE 1SDDB 4AX3A 3D3VD 1WH0A 4PS3A 5D4JA 4D9LL 4EVNA 3EJRA 1PMYA 3HHSA 4J3OD 3IJ8A 3IXTB 5E24E 5KVGH 1LQSR 2NY6B 2QQNL 3O45B 2H26B 4JRYD 4ZPVA 1R3JB 3OJ2C 3M86A 5FYJE 3Q7JA 2R1XB 4NWUH 4EZLA 3ESOA 2H0PA 3D2UD 3T5WA 4EQ3A 2ADYA 3U7WH 1I3RB 5IFJB 3GMOA 1CXLA 5FDWB 3MCKB 5T1LA 2HX7A 5CZRA 3EG9A 3HNVL 4N0CC 5DHVB 2F7IA 2O5ZH 1E18A 4DKEL 1OT1A 3U9UA 1RZ8A 2OYKA 2UZIL 1OWWA 1AO7B 1HH6A 4NZRH 1ZLVH 4Q9QL 4WWID 1TPXB 4X8CA 4Y2OB 2QSTA 3D2UB 2Y5TA 3UX9B 1WS8A 3WD5H 4AYEC 4JANB 4YZFF 4AKQA 2HT3C 4LIQH 2A3TA 3H2WA 3FT4B 3HNSH 3NIFB 2E2HA 2P5WD 3KBPA 2NYZA 2YAEA 2VUKA 3DX2A 1WRFA 1D5BB 1NIFA 2VLRB 1IC7H 2R69L 3OKYA 4U7MA 4YIQA 4S1DD 3SDXA 4GS7C 4BUHA 4ONOA 5AYQA 3EFFB 3CVHB 4K5PA 4XC3L 4C56D 4P2OD 4XX1G 1WBYB 3JWOH 3ECQA 3N0AA 1NCDL 4UQEA 4PV9B 3VRIA 1I7TA 4PP1C 3BIKA 3K6SA 1S3RA 3VFRB 1ADQH 2APXA 1LWHA 2V7NA 1CF8H 1ZY9A 1NDGA 4GB9A 3C60D 1UENA 3CN2A 1T66D 3G9AB 3PPSA 4YVNA 5B1JC 4OVVA 4FFWC 3ZT5A 1Q9OB 1GZPB 1ZA3A 2NX5D 1IM9D 1LYQA 1HL8A 3CFCL 1P2CA 1A14H 3K7UA 5DJ2B 3CFDA 1V3LA 4AUUA 1NPUA 4IDJH 4L2LA 4KY1L 2H32A 4M9PA 4TN9A 3EW3B 1H3VA 3P4LA 1A7OL 3P4OA 5FOBA 3TCLB 2Z92B 4GI8A 2AGJH 5I6KA 1GOFA 4WO4B 2ZSWA 2I9LB 4XCYB 4G1MB 5I1GH 1UT9A 1U8KA 4P5TD 3IR7A 1QBML 4JFFE 3HHRB 5C7ZA 3SSGA 3V0WH 5CLZA 5KN5B 4FXKC 4A7SA 4G43A 3NZHH 1AFVH 4QHUB 1MPAL 3T8XB 3GZPA 2Y06L 3MNMA 4IEFA 3T2PA 3CZBA 3HHSB 5I8KH 3C8DA 2YU9A 1FFPB 3EYOB 4FCHA 3TBYA 2HA1A 2EO7A 4XNDA 1OP4A 3B2UC 3UO1L 3PREA 3K2UL 4PWKA 3S97C 3TL5A 5KS9A 2LLNA 1AG0A 1J8HE 1T7VA 5K39A 2QKIB 3KDMA 3BIKB 3RPIB 1F90H 4X4YB 3LSOB 1ZGLA 3GBNH 4ZXBA 2IDFA 4DSYA 3PY9A 5BPPA 1NPNA 1CE1H 4NYLB 1GYAA 1HAUA 1S7XA 4Y16D 4AEHH 2KI6A 4AYFB 3VXSD 4N2DA 4OCYL 2DLIA 2IBBA 2ZUSA 5IB2A 5K5YA 2E7BA 5TE7L 1ZA6B 3LKNA 1OCCB 1NGYA 4BFIA 3SDYL 1JS4A 2L8AA 1PFCA 1A1NA 2C9UA 1F42A 1NC4B 4KKBD 4KK5D 3VD2A 1D5XA 1GYCA 2XTSA 3C5ZA 1VC3B 4K3DH 5F9JA 5H2BA 3CNKA 5HI3C 1W0VB 4ZFOB 2NNFA 3HLKA 3QDJD 4PGCB 4AYGA 3VMNA 5FHAH 1B2YA 3X2KA 1QFUL 5SWSB 4O02L 4KV5E 3AXHA 3PNWA 4LLMA 5FLVA 2BSEA 3DXAD 4LKCA 1EHLL 1NBVH 2D7OA 2XN9E 2DY2A 3EO1B 4IRSC 5F0MB 3VXPA 1P4IL 5D7LE 3SGJC 4KJPD 7CGTA 2WWKO 1Z5LA 4CU6A 2HSIA 1U8NA 3WXVL 4X9GA 3GSUB 1QFWM 2ZCLL 1AD0A 4UQIM 4EZJA 1YMHB 4NDMA 4Z7OE 3RLSA 2JQMA 4FABL 4KKBC 4F2EA 1F3RB 4ZM7A 3L4UA 2QVKA 1SVCP 1A6ZB 1FFTB 4UF7C 5D70L 4KKNA 4F7PB 1UKQA 2NZ1A 1QWUA 4QLRA 5T1JA 2AFNA 5JHLH 4PJIF 1WBZB 4BFOA 1OZUA 1SHWA 3N41B 3S8GB 3WHE0 1W8EA 2XBTA 4XMPL 5AZEL 5IUSA 2KC0A 3CFUA 1JPTL 3QQDB 2XKNA 3DX9A 1FZKA 1T5XB 2QHRH 2YD5A 2BP3A 4KO7A 5IQ7L 5DJCB 5KVFH 4X4XB 4B96A 1E4KA 2HLAA 2PYFB 2JKXA 2HFEA 3MRGB 3Q9QA 4FTDA 2OMNA 1YEGL 2J2ZA 5C0AA 4I48A 3KW7A 4C83A 3KBHE 3Q44A 4GAGH 1LILA 2FJFB 5DR5L 4X5LA 4AUJA 5D7JB 1DCLA 1K5NB 2EDWA 1TZHB 1G7PA 2Z1KA 4GT0A 3MYZA 4JY6B 4N2IA 1AQDB 1G6RB 1KXHA 4HIIA 4L8DA 1OT2A 4XVTL 1YC7A 4M8VA 4FXTA 5K9OB 2R59A 4JDEA 1ZHBB 3ULUH 4TNVK 4ZW3A 2PYED 1HX0A 3EXJA 5F21B 3X13B 1U91A 3EYUL 7TAAA 4JO3L 3EIFA 3JVFC 3KL5A 1JAEA 2ICWB 1KXTA 3G5VB 5CSZB 3LQMA 4NQEA 2P8PA 4I0PA 3HG3A 3SCMB 3BPNB 3QYCA 2CM6A 2C9AA 5HJ3A 3RNQA 1S78C 4WV1B 2HPOA 4HLJA 4OLYH 1KLFA 2XY2A 4OB5L 4X98B 2GABA 5F1IA 3FUIA 1CF8L 3PV7A 5AW0B 1N8ZA 2V17H 1BOGA 1PPIA 3VXUB 3X17A 1JZ5A 15C8H 1EZUA 3LZRA 1XF5B 2YAPA 2GBVA 1QSED 5I30H 1YEKH 3EOAB 4UAHA 3PWLB 5DFAA 2MQCA 2EIZB 4KDTC 5AUMB 2BOCA 3HN8A 3SGJA 4NLHA 1AOHA 1NGQL 5DEFA 2CJUL 3IDJA 3VFMA 4Q6IC 5IMKA 1ZHLA 5T5NG 2OMYA 1TCRB 1FNGA 3CUPB 3T1FA 3O3AA 4QTIH 4BSWA 1A4JB 3FHEA 2W65A 4XNMA 2BVPA 1HDMB 1RFDH 5BS0A 3WO4B 2A83B 4EE2A 5EZOH 4XC1H 3V52L 3BFOA 1PCXA 1U3HD 2C1OB 5F9WB 5IBTL 1JHTB 4N1HB 3E0GA 4Y7MA 5E56A 3HE7D 3ASOB 3D05A 3KL3A 3WUWB 3G04B 2NTFB 4NC1E 1IVTA 4M02A 5FGBC 2QPEB 4MXQD 1BBDH 1W72B 4JFDA 2GBTA 5EZIH 4ZTOH 5FGRA 4CC4A 4MNHA 3HBQA 4HQQH 2WXPA 1D6EB 2OP4L 1BP3B 2NY3D 2X6AA 2DQMA 5E4AA 1IM3D 4YPGB 2PNWA 2FQDA 2ZXGA 3BKMH 4X6FB 4WFEE 3KAAA 4H26A 5KVMC 3E6HA 4KPHH 4XHJC 3QO0B 2PNDA 4PU2A 1WQVT 1AOZA 3CIAA 2HWZL 3ESUF 5F7FA 2YLHA 3MODL 4TRPL 5LGHH 4WI3A 2C1PB 2HKHL 4JGMA 4U1SB 3REWB 1DVFD 3QUYD 4QGTA 3EO9L 5D6DC 4CMHB 4EDWH 3OPZL 2DLHA 3D69B 3AG4B 4KJWD 4V2CB 2EUXA 1SBBA 3LH8A 3B4NA 4HBQA 5E2UL 4HBCL 2GTWB 4XXDB 1R5WB 3X2NA 3C60C 4KKLD 5C0IB 3DSFL 5F88B 4A67A 4P46C 5B38G 5BMFH 1IBHA 4L3ED 4PGDA 2YQBA 5E6ZA 3VI4A 4CC0A 1AD9A 2AJSL 1MNUL 1FL3A 3OAYK 4P2OC 5E2VL 5GS0H 5DD6B 1AR1B 3EOTL 3O3BA 4HUUB 4WWKA 4PJGB 3VG9C 3IJEA 4NNXB 4QKXB 5CUSH 5M94B 4M3HA 3L6FB 3T65A 3II1A 3TO2A 2PO6C 4X7CC 1DQIA 1PKQA 2PPDA 4HCIA 1IC5H 1MHCA 3RB5A 3O11A 5DS8A 2AC0A 4QDGA 2BSED 3DXAA 5E2WH 1GHFL 4XNYL 1INDH 2B8OT 2VPXA 1NIBA 5TE4H 4JG5A 4MMXB 3TIDA 4WI9A 4JVWA 1GAFL 4HJGA 4ABUA 2HH0L 1F56A 3VI3A 4PREB 4HEME 3T3MB 1WIPA 1DVSA 2BNRA 2B4CC 2V8LA 1Q1JL 1QRKA 2WMPB 3KPQA 3HZYA 5FTKA 2EKSB 4K9EH 1BVKB 1U8JB 4L5FE 4RMBA 3OAWA 2X89A 4W9CC 4AQOA 5LNDA 2HFTA 3ARBC 4RMVA 4ISVA 3GUTA 1EO8H 1V7MH 2A6JA 5E6IA 1NCNA 5E9DA 2ZXBA 3IETB 3BWAA 3ZGHA 3VWKC 4XVTH 4Z7UF 3UYRH 4KJQC 3VFGH 3FFCD 4I5BB 2EXYC 3S2CA 5KVFL 4PHXA 1MJ8L 1AXSB 1QRND 2DOCA 1ILSA 2EYTA 4C4UA 1XR8B 4U6YA 4D9RE 2YUJA 4O2CA 2Y23A 3T3MF 4LSPH 1FVEA 3F6JA 1UXLA 1HIML 3UTTA 4URTB 4XCNA 1VLXA 5DR5H 1OP5K 3RNKA 5I1LA 2E74C 4TVSa 1BZ9B 3QHZL 2XPGB 3NJMA 5LN8A 4C59B 1CI3M 4LRNL 4CMMA 2DEXX 4FQQB 4FHJA 3EH4B 3GGWB 5IVXE 1FQ9C 5INDB 4AM0B 5EU6D 1BVNT 1CICA 1IFGA 3ZHLA 3BP6B 4CVWA 4C8XA 2IXQB 3QUHA 4J3OC 3NACH 3TURA 2BHYA 4RZKA 1D5MA 2VDPB 5M7QA 4TUJA 5GZNC 5BVPH 4U3HA 3AJ7A 2OMVA 1LO5A 4HCFA 1HHHB 3MFFA 3ZSSA 2ZWZA 1ACCA 3VXSB 3LNIA 3X1EA 2XZQL 3KPNB 1QPPA 2GSMB 4K2UL 4Q6KA 3ENGA 5F7HA 3SE3A 4NPYB 2AK1L 4ESKA 2P48B 1PD1A 4AMKL 2DQTH 2JE8A 3U82B 3AABA 3BH8A 1NGWB 2R29L 1IGTB 5HHPB 4GY4A 2EEDA 2Z7ZA 3ARGA 3JWDC 3D18A 4PJBB 3S34H 3UC2A 5IESL 2FSEB 3A67H 3D52A 4J39A 1IKOP 4HLZG 2K9FB 4ZBJA 2A77L 5I1AB 3UTQB 4ZQTA 1ONQB 4UNVA 1BBDL 2KLSA 2VL4A 2NY4C 2OMUB 2WB7A 1FHNA 1WYJA 2DZEA 5DURD 5EBGA 1NLBL 3F7LA 5JHLA 3FTVA 1MAJA 5JUEL 1FE8L 1D9KD 4Y4KB 2CKBL 5J0BA 3BP5A 5B21A 2H3XC 2J1WA 1OAYL 3MRFB 5BQ7A 4J3OF 1RIVL 3PLXB 1CFQB 4GKLA 4YSDA 3T2QA 5IESH 2DQCL 3VSQA 1UGKA 1WWWX 4FQCH 4G1EA 5EOQL 4IQHA 4GW5B 3MV7E 1PQHA 1MIMH 3H6JA 3PGFL 4LL4A 5BW7A 2F19L 3TF7C 4AC4A 1IILE 1SIWA 3DMRA 3X2JA 1LQBC 4J12A 5B7EA 8FABB 2W59A 2PXYC 4FXGC 3V4PL 3BKJL 3ECBA 1T0MB 5LUMA 1ITBB 2D31B 2NR6D 1GC1H 3MCLH 5D7KE 4C56B 2X1QA 3O4OB 4X7FC 1XGPA 3G6JA 1A1MA 4YBHA 3IFLH 4OCMC 2ARJB 2MCMA 3MNDA 5SX5H 1IW7D 1BFVH 3CFNA 5E70A 3T0AA 1TQCB 1OF2A 2E5EA 3MLRH 1OAKH 4JO8A 4YE4L 1IGIL 3ZX1A 4WEUD 3GBEA 3DGDA 5EHFA 3D69A 3LDBC 2CQVA 1NOAA 1U9KA 3G5YB 3GSVA 1LGVA 1F02I 2GK2A 1TLMA 3NQIA 2BZDA 4I18B 1KACB 4JMXA 2X1WL 4CMMB 1BYNA 5T3XL 1ML0A 3C09C 1LMIA 3FAXA 4GUOA 4WK2B 2Q87A 1ZLUH 3SJVD 1AP2A 1QMUA 4GW5A 5BRZD 3G5XA 2Y2TA 4YR6B 3QYNA 4X7SL 1KTLB 3BVNA 2I27N 5AVRB 4FQJH 3DDFA 5F7EH 3FO9A 4YE4H 5BQ7B 5BRZE 2C4FU 5AALA 2UZYB 4ZYKB 4DHLA 4P2YA 1MH5B 5B38A 2FGWL 5DWPA 3RWGB 3ULUL 3CCHA 3N0PB 3QJTB 1CLOH 5EN2A 4F9LC 1GMEA 3VH8G 2A7BA 3FQXA 3GJFH 4YO0A 4EI6B 4PCKA 2O6CA 3A5VA 3FU3A 3L13A 1EWHA 2ZUVA 5E94A 5I1HL 4Q9BA 3S8FB 3RWJA 1TZIA 2X2JA 3EYFB 3CHPA 3RUGF 2VUMA 2H9GB 3D18B 4G42A 3RVWD 5IJCC 3VGAC 1REIA 2CAKA 2XPYA 3HBZA 3H9ZA 1LE9A 2CGRH 4DEWA 1J86A 3CZJA 1ZT1A 1JWMA 1MJ8H 1R5VA 5FO7B 3FBKA 4JB9L 3HCVA 4NUJA 2WLKA 3MV7D 1A6AB 4OD2B 1S9YA 4HLZH 2DQUL 1WITA 3ROOB 1U3HB 3SE8L 1U8HA 3RDTA 1G9MC 1ZJBA 2VDRB 4IIQC 4TUOA 3ZMNA 4BDVB 1UXWA 1FBIL 4JFUA 2BNUA 5C07B 4LP5A 2KKQA 3J2PA 1P6WA 3DHUA 4NQEB 3IMSA 3UCRA 3WE6B 5C0IA 3VWJA 3CTTA 3I6LE 3RWFA 3LIZA 4K71B 2X4OA 5JW4M 2H32H 3C5JB 4WDIA 3CBJB 3IDYC 4K71C 3O41B 4J6RL 5C6TL 1DSFH 2XPGA 4YHLL 2FYYB 3GKWH 1HKFA 3UAFA 1E7UA 4ODVL 4QAMB 3ARZA 4XMVA 2ZYRA 3GBLA 3PQYE 3IDIB 3S5LA 2F7OA 3VYNA 5L6YH 5G5DB 1F3JB 4R7DA 3WLBB 4IOSA 4PRHB 3VFWA 2I5YL 3SGKA 2G6GA 5F7DB 4HLEA 1DVUA 3RAJL 4CC1A 1HEHC 3Q13A 4MA3A 3CFEB 1FE8H 1K8IB 2UVEA 5JA9A 4KHTL 1EERB 2AXGA 1ASOA 3CX5J 2K6WA 4ISVB 3TEXA 3V4VA 1JPFB 1PKOA 4KXAA 2NUTB 4JRXB 4HUNB 4A63A 2IVFC 3KPQB 3EJUA 3G5WA 3FTWA 4HJSA 1OO2A 2C9SA 3NIDB 4AQ1A 1USQA 1RL1A 1UXSA 5I6OA 4HK0A 3L1GA 3INOA 4CUCA 4WK0B 3IVKB 1V3JA 3PXLA 1R3KA 2Q86B 1WBXB 3G6DH 4R84A 1JFQL 3V5DA 4PRDA 5F1OB 4RH4A 3QE5A 3QIBB 3CU1A 4L3AA 1V5JA 1TZ8A 4MS8C 4GRLA 4KI5D 4L3CA 5FAAA 1MRDL 4M7JH 4CN4A 2XFXA 3T0BA 3PL6B 4A2MA 5FOJA 1TKWA 1I9IL 4NQXB 1OA7A 5C3IA 3EDFA 3QJHA 1VESA 1XF5A 3FB7A 5CUSL 1ZHNB 2B7DT 4DP8X 4WUUB 2IGFL 3MBXL 5IUCA 5DJXA 3GPSA 5F96H 1CBJA 1ZV2A 1IGIH 3GSNB 4LSQH 4PG9B 5ANMA 1MI5E 4NO2B 3F7RA 3UTZA 3QHFH 1GHFH 5I5IA 2Z31A 1QRNE 3MXVL 2EAEA 2YRPA 3OF6A 3KWXA 4OFYA 3AMKA 3K6DA 2YMOA 5CCGE 2OULB 3UMNA 4L48A 3CXFA 5DVOA 5L0QC 4AZUA 5IMMA 3RIFF 4NO3A 3H3PL 5IKCA 5F0JB 2X1PA 5DJ6B 2FIRT 5LBSH 4ES9A 3TEZA 1NAMH 2CJ3A 1M9WA 3VFNA 4ZI8A 3DNKA 1JWUA 2FBJL 4UTAH 3VD4A 1TT6A 3IMTA 5D7IF 2F74B 3SKNA 4P04A 1C12B 3TX4A 3QDMB 3OQ3B 4WSJA 1N10A 4Y19A 5I1EL 4UDUA 4FCAA 4ANVA 4NM8L 4AJ0A 1H8NA 3L8QA 5ETUA 3STLB 1G6RA 4HIIB 4BQBA 3ATEA 1F8TL 1XR8A 2DD8H 1G7PB 2DQIL 3IEAA 4HV8B 5I5RA 4JMNA 4RETB 5AOIA 1NDMB 2DQDL 2NY5H 32C2A 1XTLA 4PRID 1RZJH 3VW3H 4JRFA 4QLWA 2K1MA 3V0GA 1AQKL 2BLFA 4JHAH 5E4EB 3KPLB 4QGYA 5L2KE 1AIFB 1DBKL 1U8LA 2GG1A 2OLDA 4G5AA 2LGNA 4JPVH 4AWJC 3P0YL 5EIIA 5I0YA 4XAWH 5DRNA 3ILQC 3SDAB 4KUZL 7PAZA 3BXNB 5EUOA 4KH2A 2HH0H 2VJ0A 4BQ9A 2KS0A 1GVIA 1RJCA 3BN9C 4KOCA 3VNYA 4IEFB 4Q9QH 2YD3A 4M6OL 4JO3H 1E4XH 4ZTPH 3FQUA 4GXVH 1Z5YD 1F00I 2WINB 2YOCA 3FRUB 3GLAA 2BW5A 1KJ2L 4FGMA 3WKYA 4AL8L 4GUQA 4NC1C 2R0LL 3PWLA 2ARJQ 3QXAA 1B4TA 1UJ3B 2E6PA 1U2HA 2PW2B 5IQ9A 3V5KA 4BV1A 4L8BB 4KLNA 3QYMA 3KPRD 1DJZA 3RUGE 3FQTA 2H0EA 4N3TA 5CCKL 2OAAA 2Z7YA 4HX1A 4FKKA 3LZOA 3UG4A 4IGBA 5C18A 3NJXA 4KVCL 1P4LA 5HVFB 5DHVH 1PBYA 4KFMA 4JB9H 3VH8A 3TJHD 1FYHB 4NZUL 3EJSA 1UACH 1ZLDA 4KKAC 1UB5B 2XWRA 3VFPB 3W0WA 2CD0A 4AAYA 4ODVH 4M43H 3MRPA 2EDKA 1NGQH 3FU7B 4N90D 4TNVF 2CR0A 2VDQH 2WXNA 3BZEB 3U2JA 4JGUA 1G84A 3D25B 3MTXA 1RAMA 2DM2A 3BVUA 3V4UL 1A14L 4G59C 2EVFA 3QQ3B 4ZMLA 1DBJL 1KTCA 4Q4EA 5DZNA 3RVVC 4ALAL 2VLLB 4DO4A 1N9PA 4Z7WA 1HHIB 1X4XA 4L23A 4MXQC 1RFDL 4AGQA 3NIGB 4QHNB 3KPPA 1QKZL 1F4YH 4KRPD 5BRPA 4OZHB 1FO0H 2IDSA 2QZ5A 2Y1ZA 5C0BA 4ANWA 3BIAX 1MCNA 3ULVE 5LGYA 4LOVA 4EDXB 4OKVA 2BVQB 5B4MC 4JM4L 2AK4D 3CFJB 3E9TA 1BW8A 2FX9L 5DQJA 3M8OL 5T33H 3CPUA 2ZSVB 1BX2B 1CD0A 2P80D 5IBLC 5ID1A 4YNYA 4RZCB 3AB0B 1L5GA 3R06B 1GOHA 1NSNL 1EVUA 2GI7A 1VIWA 4JO2L 2GTZA 2I25N 1M6OB 2XQYG 2JB6B 4KC3B 5I5MA 2Q0ZX 1VFMA 3TYGH 5B8CA 1J7VR 2XZAL 3R18A 2V9TA 2WV3A 4R96B 2RQEA 1WBZA 4TQ8A 1H3XA 1T03H 3QI9C 4F7PA 2XWBB 3M8OH 4S11A 3VE0B 3F7YB 2VW7A 4A7TA 1LL1A 3WAKA 5CM1A 2VC2B 2A9CA 2A38A 2E7MA 1WV7T 1DQKA 1QHOA 4HK3N 4AG4L 1ZEAH 4MD0A 1XAUA 3LPWA 5I16A 3MLSH 3Q2CA 4H20H 5EOCH 4ZT1A 4AENA 2O5YH 1FAIL 4K7PX 4WFGD 5KSUA 4ZX6A 2VXUH 4B9YA 2I60H 4F8TA 2BMKA 4DT2A 4P59L 3TIWA 5A2BA 3L4TA 5EC2B 3S35H 3JWNG 2WAQA 1T5WA 4MQ7B 2BNRE 1HHGA 2E86A 3W1ZA 2D73A 4X7SH 4DP5X 1ZVHA 4Z3EA 5JPMC 1MFUA 2Y6SD 4UNIA 2NZ9D 3DYMA 1OM3L 4OJDH 5KANG 3PDDA 4QT5A 2MHAA 1YN6B 2VE6A 4NQSA 5EEZA 5E2WL 1M9SA 2X41A 5DUPL 2G3ZA 4LBEB 4DQAA 4GXUM 1VGEH 2A6KB 3ARPA 2Z91B 4K94H 3DI3B 5DUML 2A6DA 1RPKA 3QQNA 5D2LF 3C5ZB 4N25A 1GJWA 2OYLA 5GSVB 4DVRL 3HC4H 3C60B 2ZG3A 3S35L 2VXVL 5I1HH 3RY5A 2WQVA 1X4ZA 1O6TA 4HJ0C 4LL1A 5HI5C 1ECZA 4PJXE 3OXSA 3QUMA 1OK8A 4HIJA 3F85A 1VCBC 2OL3L 4H5SB 4OZIE 3ORJA 4F7CB 5HGAB 1AGFB 1U8IB 2B2XH 4GQQA 2DMRA 1JGVH 1PG7X 2XVGA 1MXGA 5HHQB 3FJTA 3MRDA 5ALCH 1INEL 2E4FA 5JHLL 3G9VA 2XRAH 5AD0B 2JJTA 1KCUL 2DL9A 1ZGLB 4FTVD 3V5HB 3RGVC 2HN7B 1DN0A 1ETA1 5CD3B 2JI2A 3DVIA 1X4YA 4N0RA 1XGYH 3BSZL 4QTHA 4QEGA 3S5LG 3AGWA 4X9HA 1G7HA 1FFQA 1L4IA 3I3EA 3J8F7 1PZAA 2A6HD 4AMXA 4WJG3 4Z5RB 3RX8A 5D72L 5CZXC 4ZOCA 4BA8A 3UZQA 3ZKSD 4AMWA 4CVXA 1DJGA 2YQ2A 3FB5B 5HGHA 5J9PA 4ZMQA 2Y24A 3MI6A 4YHML 1USZA 4GFXA 3C09B 4V2BA 4WUKH 4AIZB 1QI3A 3CXHJ 1KFAH 5C6TH 4MQXC 3EH3B 1CT8A 4JFZH 3VE0A 3E8UL 1YO4A 5IJVB 3EYVA 3JQOB 4NZDA 2EYRB 3KW8A 2H6PA 3APMA 1FNEB 2BIOA 3FT0A 3HI5L 1MHHA 3U9PL 3CMOL 4HSCX 1CBVL 1R27A 1UWFA 2OMTB 3LHAA 5HHVH 3L7FA 4HZ1A 1PDKA 3VXNA 4PGCA 3CSGA 5HI3D 5DRWB 2CUAA 3NZHL 4QRPE 1LXMA 1WF5A 3FOMA 3O9WC 4XMZA 4Z3GA 2VOTA 1CI5A 1J88A 5JQ6H 2XN1A 1NFIA 2F08A 5JHAA 1FN4A 1JGUH 1S7RB 3UAAA 2V2WA 4GA5A 2QHLA 3GMPB 2WXMA 1ZVYA 2X4SB 2XKSA 4Z78B 4OIIH 4PSPA 2E27H 4Y5VA 3VSVA 4Y89A 3FZUD 2GJRA 4KI5C 1X5XA 3C6SB 1BZDA 4HSAC 3O5AA 4F8NA 4BKSC 5JLZA 3GTTA 2VXTL 3SQOL 5DO2D 4OQTH 3SDDD 5EF1A 4K3JL 2O5XL 1NMBL 2FTAA 3IGKA 2XQBH 4LPWA 1X5LA 2R83A 3FU7A 4GW4B 1BYOA 3QVAA 3RPIA 4QT5B 1MIML 1ZWIB 3PGFH 3BLBA 3HR5B 4EEEA 4RSYA 5ILTH 4P23C 1S9KC 5EF0A 5BZZA 2FNWA 1OAZH 4Z76A 4JPQA 5C08D 1BZ7A 3GMLB 4U0RC 3U83A 4U1JA 3G6JF 3HLAA 4GKZB 4D0DB 1Q16A 1AS8A 2G2NA 2X44D 3RFZA 3OB0H 5JIHA 2FLMA 4X5PA 1OSEA 3QQ4B 5E03A 1FNSH 3FQTB 1RSYA 4BELD 1PYWB 2XV2A 4WO4D 1QSFA 2DI9A 5HYSA 1UM5L 4L8BA 4I3RH 4NKDA 2HMID 3NIDE 4OZGB 3MJ9H 2FBJH 2VM9A 1QI4A 3F7YA 1VJSA 3TEUA 2BIPA 4UM9D 4GA6A 1AZUA 5D1XC 4YUEL 3ULUD 3O45A 2B63A 2N7SA 5ACZB 1FSKC 2W07A 2QVFB 2P5WE 3SYPA 1NAMA 1IZJA 2WP3O 1JV5B 1AGDA 4OCWL 3AS3A 1NDGB 2VXSL 1YYLH 2IAMD 4FLQA 4YXKH 1PX3A 2A2QT 2GK0A 3UAJC 2CMRH 4Y4HC 1A6VH 1M6OA 2CBTA 1TO5A 4N2AA 4ADGA 1JV2B 4ETYA 1RZFH 5ISZD 2R2HA 4Y1SA 3D50A 4PY7A 5IEKA 3NZ8A 4LARL 4QRSB 4QRRD 3VTAA 2I69A 4I77L 1E5VA 3WN5B 5H8DA 1FNHA 1KCSH 3CZSA 3JYCA 2HJLA 5FO8A 4IOFC 1IUZA 1NDMA 1MNUH 1LDPL 2XVKA 4NM4L 2BIMA 3EYSH 1AA6A 1DANU 5EU4B 4PMEA 1V10A 3H7LA 2VPYA 3ZL2A 1AGEB 5J7CC 4L4VE 1J05A 4I1NB 5KZCB 3FT4A 3IWUA 1RV6X 5CILH 5JYMA 3IGAA 3MX0B 3NEEA 1A4AA 1YPZE 4NUPA 2L0DA 4AVKA 1Y5IA 1AYOA 4ABWA 4UYPA 1A4KA 3FCSB 2DDQL 4D7ZB 3OXRA 4Y5VC 5L2KD 1TR7A 3FPXA 4LMQE 2KBGA 2H6UA 4QRUA 1SY6L 2GHZA 4HAGA 4NI3A 4OCXH 4TUKL 5LKNA 1PDKB 3OKKA 3HG1B 5F89B 4Z7IA 1RK1A 1IJNA 2PWHA 2RAMA 2JMRA 3Q1SH 5KSBB 1KULA 3BHBA 3RWIA 4IK6A 2WNKA 3L3OB 3P0GB 4MXWH 1M05B 3BSZH 1IT9L 1E50A 4NBXB 1L6XA 3BAEL 4W9HC 4B9GA 4JRXE 1CTNA 3FN9A 2X9XA 4IKLA 2PO6B 5DZPA 3QJHB 2EO1A 3VXRB 1IGJA 3OVUB 2JCCF 4C55A 5GGVH 3WDIA 2M1KA 1HXYB 2WJ7A 1OE3A 3HFMH 1SPDA 2ZUYA 1UFUA 4HWBA 4G6AD 4PR5B 3BQUD 3L5WA 4EVNB 4X6BA 1YNTA 4MLIA 1IGML 4J7RA 5DHEA 3GXMA 1UXSB 4GW1B 5KVFE 4D8PA 3II2A 5IFAH 4PYGA 1A7QH 2B1OA 4NCDA 3DV4B 4JRXA 4LP4A 1BM7A 3KPLA 2H7WA 4E9TA 4ZX5A 2VRAA 4CMHC 4B53A 1CJYA 3B8SA 4K9JA 2XN0A 4HXBH 3HIZA 4QAWA 1IFHL 3TNMA 3ZTEA 4LLUA 2YUVA 2FT7A 3FQ2A 4GKNB 1RZIB 5IW6A 1T1ZB 1XB3A 3TBSA 2K6ZA 4Q9RL 5DK3A 4L9DA 5FM8A 5DZJA 3MLWH 2BSSA 4HT1L 1SUHA 2UYLB 4ZXBC 3QUXD 3FHQA 3HR6A 5IJBC 1H9VA 3JTBA 4OZIF 3LKPB 2CNZA 2A1WL 2Z93B 1XFPA 3E6FB 2JJVA 4GBXA 3BH9B 1NTDA 1J8SA 1QZNA 4HS6B 4A7VA 2VABB 4RGMB 5LN4A 3LKOA 3OB8A 5A2CA 3OMNB 2VM3A 4DK3A 1I9EA 3CG8A 2OV0A 5EEVA 4OI7A 4MDJA 4CNIB 4ODBD 4TPRL 5C07A 5I1CH 2JA7A 4NPJA 5DLML 3QWQB 4MGXA 4Q2ZA 3WUWG 4PG9A 3IRZA 3VXQB 4P48A 3NPZB 2OMBA 2CRIA 3UTSA 2VDNH 4Z7QE 4ZUSB 4PRPD 4CGUB 1OGYA 4M8UA 3JV4B 4WAFA 1DUZA 4RWHA 4JRLA 4HPOL 4UQAA 4X7TB 5EN3A 4ZO7A 4YDLC 5A2AA 2IALA 1N68A 2D7NA 5HVHC 4JDTH 4NP4H 2WHVA 3ZXAC 2CBMA 1EZSA 5AAMA 2PMZA 2K70A 2ROYA 3EYQD 2EH8H 5KBMA 2ATPA 1CLYL 3BPNC 4PUBL 3SCMC 1GGYA 5I28A 2YPKB 3Q6GL 3NEOA 5SX5K 5E94B 1M1XA 3ME0B 2VZTA 2PR4H 1D5RA 1YDPB 5J6GB 5IHZA 1ORSB 3E38A 4KITB 1UT1A 1DQDL 4RSVA 2VUOA 2VQTA 1LEKA 4IBLT 1INEH 3LXCA 4XZ4A 1ZTXH 1CL7I 3ZR5A 4H0LC 3CFJA 3GBMH 1F58L 3DX6A 4J3WA 6PAZA 2WIMA 4KTYA 3O3EB 1V7NH 3QAZC 3DTXB 1MHEB 5BO1L 2WO3B 3L5XL 3MRIB 1T03L 3NA9H 4AXWB 2L3BA 4AONB 5HPMA 3N06B 3NRQA 4N26A 4PWHA 3DUUB 2ZCHL 2XA8H 2ZYSA 3UYRL 3TBWA 3RVTD 3RY6A 4Z3HA 4H13C 3UFIA 3WELA 2X40A 3ZIMA 1IBGL 1HTYA 2JJUA 2FWOA 5GGUB 2CPUA 3W0WB 3L3OC 4N24A 1VZGA 4P23D 3VRLF 1QZ1A 4GSDH 3S4SA 3ZZSA 3SDCA 3CQQA 1AKJD 1HOCB 4IGBB 2UWEE 4JDVB 5GRXG 4J8RA 1T7XA 1BZQK 3SJVE 1MAML 1S5IH 3CK0H 3F5WB 2XRAL 4UTAL 4G6JL 1LO2H 1ZHKB 2A68D 3T3PB 5AWNH 8FABA 3MRRB 3IJ9A 3SN6N 1W6WA 2AK4E 4FULA 5G4MA 1F3DH 5D8JL 3P4NA 5CGYD 5C09B 3P2BA 4MA1C 4PW9A 5CNHA 5DEGB 1WJ3A 2IIJA 4LIQL 4DW2L 5AKRA 3I75A 2NAPA 3JUZA 2A6IB 5IROA 3IMUA 4PJEA 4OIIL 2KQNA 3LHPL 1Y1VA 3GHEH 4HDIA 2V3FA 4UT9A 1K6QL 3RWJB 3POCA 4NHUA 4LLWB 4UIKH 1WZAA 1KIUA 4JFVA 4UTBL 2Q8AH 4E41E 2P5EB 2WVTA 3VA2C 1JPFA 3QNYA 4FQXC 4N6RA 1KLUB 3BD5A 1QAWA 1TIUA 2J3SA 4OU3A 1RUQL 3H6AA 3WS3B 5DJ8B 3FT3A 4RIRB 5EUKA 1U3ZA 5TH2A 5GRVL 1B4JL 3O0LA 5B1JA 5FIEA 1QNZL 3TYFB 5KG9B 4H1LB 5IQOA 1LJMA 1WFIA 2MTPA 1HYRC 4C4BA 5I73C 1IGTA 4M8RA 1WAPA 1AP2B 4PJ6A 1TWHA 4LCYB 4XN7A 3CPLB 3EGDB 3HA0A 4M7LH 5ANME 2VL5A 4DZ8A 4FA6A 3IAGC 1WZ1H 3TYGL 4YN3A 3G6AB 5F7KC 2DF3A 1UHVA 4JN1H 2P7TB 3MAWA 3VJ6A 4J3SA 3S9DB 3RTQC 2NY2D 4QOKA 2BRRL 1YEFH 2NW2B 3HZVA 4OI9A 4G70B 5I76A 1JUFA 4J4PA 3KWUA 3RWFB 2QKIC 3WJMA 4E9RA 1FVDB 1NDTA 3JTTB 1HCFX 5DJYB 3I9GL 2E3VA 4MSWA 4U7KA 5ABAA 2NSQA 1SHXA 1GH7A 3QCUH 1OCWL 4PJHA 5ESAA 4R2GC 5FYKL 2ED7A 5JW5B 5KYYB 1LP9B 3OZ9H 4HD5A 4P3DA 1B2WH 1MCJA 2IH1B 3HG4A 4UINH 2DB8A 5F71A 4LPXA 4EN3D 4EUPB 3MXWH 5I24A 1H5NA 4ZMAT 4LHUG 1T1XA 1R5VB 3PDGA 2IQ9L 2AV7B 1BLNA 2EDJA 4HJEA 4KZEH 1KCRH 1XXFC 2G3XA 2XXFA 4KNTA 4NO0D 5D6CA 3FCGA 3X12A 1L9PA 2AVFA 1JRHI 2FL5A 1QSVA 4Z18A 1R9FA 3SQRA 3QFDA 4KJPC 2GT9B 3TLRA 1MRFH 3QWRD 3EJJX 3RUGA 6CGTA 4Q14A 4QXUL 3Q3GA 4DNLA 3TCXA 5EULV 3UDWA 1XGRA 5JO5A 3QQ8A 4JCWA 2J1XA 3KPSE 3U4AA 3BX7C 3VFOB 5MHSE 4BZ2A 2HG5A 3HAEA 5IMLA 4PS8A 3P73B 2WMPA 3VG0H 3U0TB 5BMFL 1MJ7L 2EC9T 2UZYA 1CFTB 1YEDA 3N40F 3WMQA 1BJMA 2QQNH 2WXIA 1KV7A 4WEEA 4YZWA 4D0BB 3QORA 2R4SH 2V2TB 3L5HA 4HC1L 3QC8A 3EOTH 1RHHA 2R7EA 3R4RA 5AW7B 4EBQL 1RD6A 5EDXA 5FKPA 4DGVL 2PN5A 1E6JL 2A73A 2A99A 4Y5YA 5HHPA 2CG9X 1T6WA 3G5XB 2NUPB 3FCUB 1QASA 2XN9A 3MLTB 4YC2B 1TTBA 1XGYL 2YPLB 1RULH 2EYSA 1FYTE 4MAYD 4C54A 2OJEB 3FHAA 1NJ9A 2ARWA 1LM8V 4GSDL 3KLAB 1H6FA 2E75C 4KKCD 4FAAB 1PJ9A 4KI5E 2OXGA 4DJMA 5JW4R 1WD9A 4UMSA 3DRQB 1TQBC 2MOGA 4ZFFB 2NY7L 3EAKA 2FSDA 3SO3C 2V37A 2OMVB 4PVNA 3HE6C 5HHXH 1CE6B 2HFFB 4L0YA 4UV7L 3SGDH 4QRTA 3OL2A 5AWNL 3O3DA 1L0YA 2AQQA 3OZLA 1BXXA 1Z3GH 4KX8A 3HZKA 2VITA 1U3YA 2PTTA 3HZVB 2A9AA 4TLSA 3REWA 1FYTA 3C08H 3EJPA 1JWSA 5HYQA 1N67A 4UOZA 2EYSB 1ZT1B 1WCBB 1QX1A 4Z8FL 3DV6B 1WZLA 4D0CB 1P53A 1LE9B 5CEYB 3RVTC 4GLRH 1CXEA 1QVOB 3OKNA 1OTUD 1OTSD 1YQ2A 5KS9F 1PZ2A 3SOBH 4H8VA 4Q9RH 1Q90A 5D71L 4FMKA 5DC4B 5IM7A 1TXKA 2VAAB 2UY6A 3RU8L 1EFXA 2Z65C 1OOWA 1CK0H 3U0PA 3AS0A 5A43C 3NMEA 3LIZH 2BVYA 3CH1B 2VMJA 3K0WA 1URLA 3PIQB 2OMUA 1B9KA 1CO1A 1RI8A 3AAZA 3DIFB 5L9DH 1ORSA 3DVGA 4Z8FH 4M5TA 4UIKL 3GJFA 4GEJA 3NGBB 4OFQA 1CMOA 1I7ZA 2XYBA 3ATFA 2BP0B 4F58L 1CD1B 4KVCH 4UNTA 1YEHL 4NKQB 4S1DC 3OGCB 4KK5C 3TEWA 4ZFQA 5EDSA 1WD8A 2JIMA 1NEZA 4I3GA 4OLYL 5DJZA 1SFDA 5F9OH 1S7SA 4MAYB 2Q6WA 2YN3A 1R33A 3BKYH 5FUCE 4XO4A 3FOLA 4ZMOA 3QORC 2DH2A 4S0TD 2ZP9A 4PRPB 2Y69B 4K73A 2WXJA 5DD6A 2IGTA 1KOAA 2Y7QA 4XP9H 3C5SA 1RIUH 4O58L 3F12A 4MCNA 4WFHE 2DBJA 3U1QA 1CWVA 2CHDA 3S4SB 3B2UD 5E5MB 4XXWA 3NZSA 3RTQD 3TO4A 4ZFFA 4KKCC 2MCPH 4YGAB 3BP6A 2Y07L 4XN8A 5A6LA 3SYCA 3GGWA 2WTOA 3VJ6B 4EIUA 1L9SA 2ZIDA 3D33A 4XBGB 4YL9A 5IHUL 3CLEH 5T8IA 3NBNA 1RUML 1RERA 3FN3A 4GSQA 3PAYA 4OIBA 3TNNA 3QDGE 3UG3A 1U58A 2JIQA 2CMRL 5IJDC 4B9JA 4NO0B 3AXLB 3MROB 2R2BA 5ITFB 5D7LD 3JTSB 1OP9A 3NA9L 1TZHA 4NJ9H 4PJ7F 5CBAA 5IHBA 5IW6B 3BKJH 3DTXA 3TN0C 1G1OA 1DE4A 4NUGH 2HKFH 1V54B 2VB5A 3CN1A 3NCXA 4ZD3L 4HKZB 3ZHKA 4ZMXA 2XG4B 4FNQA 2O5YL 1ZPLA 4XB8A 3P3RA 1PLCA 2J2ZB 4JZNA 5C0AB 4IBQA 1KPVB 3P77A 4H8HA 1IQWL 1KGXA 4RX4A 2MCG1 5MENA 1I3UA 1BEXA 4JHVA 2FWUA 4XO3A 5TFSL 4LKXA 4U1NB 1IBGH 4U1LB 2IPUK 5CCJA 2LV4A 1XCWA 3NSJA 3RUGB 3W56A 1I75A 4MFHA 2DQHH 2LR4A 5EEYA 5AW5B 5BOPA 5DUPH 3FRPG 3OJDA 2VDKH 4WRLA 3ARGB 3TVMD 4H8WH 5IIEB 3WXVH 5FYJU 4KHXL 3RWDB 3B83A 2AEIT 5AB9A 2HVJA 4P8QA 5EU7C 2HLEB 1NAKH 1GS7A 4K94L 1UJ3C 4ELKB 5DC2A 3ZKQD 5AYTA 3N5AA 4HUUA 3ARFA 4WWKB 5CF3A 3QFJE 2VSMB 3HI1A 1T0NA 2R9HC 3FQRA 5E8PA 2Y5EA 3X2QB 2XBDA 3FN0H 3ULVF 4AL8H 2FR4B 1HOCA 3HAEG 2N7AA 2F2HA 3OKEB 2Z8SA 4KODA 5F88A 3T2LA 2HPTA 1FVDA 3JTTA 3ARTA 3PP3K 2GTWA 1N6VA 5LGKA 1XF1A 2K8MA 1F2QA 3WUZA 5AW3B 1MNNA 3BGMB 4JFFD 3N55A 2JTDA 1Z9LA 1Z9NA 1U91B 3GSRB 5KSAA 3QIWC 5SWZA 1Q0YL 4ZFOA 5FECA 1FV1A 3T4AB 1OHZA 4OLXH 4FEIA 1IGMH 3QB7C 3TZVC 6TAAA 1G9EA 3CXDH 4I0CC 3HG0A 1RY7B 4YPJA 3VMPA 3VVWA 2AI0H 2YSSA 2R23A 2MSPA 5KJRL 2ZX5A 4K3EL 4BXVA 2VDRH 2BSSB 3ZRFC 4P5KB 5JDSB 2Z35B 5HTSA 1D7DA 5GS0D 5K69A 4ONGH 2I7SA 3DSNA 4MNHB 3L4YA 4N9OB 4JKKA 3RA7H 4BM7A 1LEIA 2EXTA 4X9BA 1DBMH 3KLSA 3UAJA 2WUBL 4I48B 5EEWA 1JOIA 2N0MA 3B2XA 1CN4A 3MU3A 1KYAA 3K8LA 3D0AA 4GG6E 5FFGA 4GG8A 3B9KD 1EIBA 4U6HA 5CKAA 1R3HB 3AY4C 5L0QB 2NLJA 5K39B 4EN3B 1UZ8B 2CCVA 4UILL 1HNYA 2BJML 2WQ8A 3CUPA 1A5FH 1PNCA 5FF6B 43CAB 4Y4HD 1NAMB 3UL4A 3TC9A 2F1BA 3MA9H 3MGOB 3PHOB 2H1PH 2XWEA 1B4LA 1OK0A 4MAUL 4A1RA 5CLTA 5FR3A 3SD5A 4DERA 4W9ZA 2EIZA 1U4EA 4ODWA 3SE9L 1OV8A 3DA0A 4GBXC 4N2EA 2IWEA 5FOBB 1XGTA 5IB5B 3KYMB 2GTQA 2Q9OA 1IB5A 3VXMD 4MZ2A 3BPLC 3KVQA 4YDZA 4FJYA 3RGVB 4BXSV 4X98A 3F58H 2MOVA 4NQDA 4D9RD 1A6WL 4YHIA 3VI4F 25C8L 3GI9H 2N4IA 2ITDA 4Y8AA 3HFFA 3V6FB 5KW9H 2V5RA 1LD9B 1LNUB 1VADA 4KROC 4CW1B 2XWJB 2RR3A 1FZOA 1AGBA 2XICA 3A67L 2V7NB 5SWSA 1U8QB 1MUJB 5FGSA 3Q8AA 2DEWX 4G5ZH 1ERNA 4V1DE 5ITBL 4PGBB 3BYYA 3STZB 2OTPA 3RJQB 4BK8A 4KK6D 5J8OA 1NGPL 4CVZB 4IHBA 3EFFA 3BDXA 2GJ6E 2BP5M 1K8DB 2XTJC 3T4YA 5DD5H 5LJYH 2X4NA 1AI1L 4HETA 4R4BA 1I8MB 2MQ0A 2E7HA 4JZOA 5JHDB 3WLWD 3OQRA 4FYSA 3QUMH 5TQ0L 3U4EA 1DP0A 3MNVB 5DA0B 3ZDZE 4U3SA 3DX6B 5ACLA 3FL7A 1I4FA 4LEXL 3OV6A 4LLUB 4F7MA 4DGYL 3O6FA 5DD3L 4XH2A 3O6ML 4NRYB 4F3FB 2NNCA 5ICZA 4YSPA 1R5IA 4OF7A 5DJCA 5MERB 4Y7OC 1MVYA 4Y2OA 2XIBA 2D7QA 3DRTB 3L9RB 3MJ6A 4PJBF 2I7OA 3ARQA 4F7EA 5EEXA 2EILB 4XN1A 2CHZA 3SBWC 2C9QA 1L6ZA 2VN5A 1VSCA 4IIQB 4Z7QF 3VTMA 1D2OA 1ZHLB 3TV8A 4PJIE 1GYWA 2H6PB 1CQKA 2GJ6A 2EEFA 3B2VL 2R8SH 1YECH 5GS1C 2R2EB 3DURB 1PZSA 1XGQB 1YCSA 2PCYA 4MXVE 4S10A 4OZGA 4UQ2B 4P2QD 3BEVA 3RRQA 4ZUSA 5IBUB 4XO9A 4IRZL 4YL4A 2OK0L 4AKPA 3FU8A 4ZDHB 1MFVA 4JO5A 4W9JC 4Q2ZB 1L7TL 4Z3FA 2A0LC 4QCIB 1P2CB 4Z23A 5HD8C 4MMZB 2O5ZL 1L3WA 2EUWA 5EB9A 4KJQD 1W80A 2J6WA 4Z9KB 4CRPA 4G7YL 5EO0B 4I0KA 4Z76B 3M3GA 1IGFL 3GS7A 2JVUA 1TJXA 1H0DB 1QLEL 4YAQB 4M4RB 5AZ2L 3IKCA 5FW7A 3WS6A 4GLRI 9PCYA 4JQXC 4PV9A 3SPVB 2QGBA 4KH9A 1BVNP 3IFNH 3P30L 4PRBB 3CDCA 3BUPA 3DX8A 1TJMA 4R97C 2DLTA 4FP8L 3MCG1 1H6EA 6FABL 5JIKA 1MF2H 5G55A 3HG1E 2ZWKA 2WZPA 1HOEA 3ZZLA 4NKMB 1IIIA 1FO0A 4RESB 3IFPB 4JM0A 4JY6A 5IT2L 1A7RH 2DQJL 2PO6D 1G4MA 3D3VE 3GDCA 4JO1H 4FJ6A 4MDIA 4PAZA 5DFWH 3GMPA 5FUOH 4YSSA 4AV4A 4EN3C 3NG5A 3BGFB 4XO8A 3C12A 2XHNA 1EJ6A 3T8MA 3L45A 4LBEA 3NAAH 4ZAKC 3VXRE 1FZKB 1T5XA 4HHAB 5D93C 3IDGA 3US1A 2ZKXA 1TQCC 4AEIL 1H0DA 4K15A 4LHUD 1T2JA 2KQMA 4K3JH 5JQHC 3PAZA 2X4QA 3R1GH 4NQUA 3KBFA 3O6FC 2YBRA 3HPLB 1N0LA 2X42A 4OGYH 1T1WB 1T5KA 1NCWL 1S5HA 3QUYB 1VDGA 4P57B 3BE1H 3TESA 2W60A 1CGSH 1U8CA 4Z7QB 3DX4A 2PXYB 4FXGB 2C3HA 3W39A 1H8LA 3QAQA 2PPCA 4YEEA 3VXRA 3NJHA 4L1TA 1N0XL 2LHAA 2IEPA 3B7RL 3ET9F 1YHPA 2DIJA 4YHZH 2R69A 2YEZB 1I7RA 3DHPA 1FO0L 4MNGE 3UZQB 3GKWL 4M61B 2QTEA 3SKMB 2GJ6B 3O2WL 5F70A 1CG9A 4N8VB 5HHNA 4UT6H 2DQEL 2JLPA 2FX9H 2X4QB 2ZOUA 3ZMRA 2VDNB 4NENB 4APXA 4FHKA 5LXVA 3HR5A 3J27A 4Y4KC 1BFOA 3HG1A 4L37A 5F89A 1C5DB 1GJUA 4AY0A 1PT1A 1ZLWK 1KENH 1XCQB 4A2HA 2VLMD 2Y6TE 4N2NA 4WK4B 1ANUA 2R9HD 3T71A 4XI5D 1KEMH 3SPHA 1CD8A 1X9QA 3K91A 4G7RB 3QZWA 4KZDH 3QDME 4M9OA 2CKBA 2UUDK 3ZL1A 5E8NB 1OB1A 1AY1H 5TF1H 4EN2A 5KS9E 3EDJA 3L17A 2VLKE 4YEFA 2OSLA 4BE6A 4BUGA 1A7NL 3FO0L 4CKVX 4Z7WB 2VDKL 2Z9TA 4XB7A 4Q74A 3MLSL 2UX6A 3PHAA 3F6LA 3LZFL 3ML8A 4XX1E 4ES8A 4JANA 3UGEA 3DX8B 3B3IA 4D3CH 5AL0A 3FT2B 4CVZA 3OB0K 3NZ8B 3LEYL 5ABDE 2Y4SA 2Y2YA 2H0FA 2EH8L 3QCVH 3M7OA 4YAQA 5GZOC 4NP4L 1BFOB 4M5YH 2L7EA 2OZ4H 2WXHA 5IVXB 1T6BX 3G08A 5D7HA 5T1DL 1KB5L 4N8VA 1OAKL 3PABB 2B9BA 4B5EA 2JJTC 1CGXA 3MCKA 3MO1B 2OTWA 2NXZD 1E28B 4B3EA 5EEUA 3RIFK 4R4FL 4XOAA 4TQEL 5B3JE 4YWGL 3V7AG 2EDMA 4RAHA 4WNQA 1GGCL 1SDYA 5CZVH 3QXAB 3KXFA 5E9AA 3Q8CA 4OZFB 3QQ4A 5I15L 4QOKD 1GRWA 4P9ML 3B5GA 3JBG7 1BQHB 3KJ4C 1Q9OA 1ZA3B 2J25A 1MFCL 5LVEA 1LE5A 1MQKL 3UPCA 1GAFH 2VWEE 4QRAA 5FUCC 5FO9B 2SEBA 3LRLA 4NO5B 5I74C 1FCGA 4PJEE 2IDTA 2YD6A 4E36A 3R8BB 1VF5C 1A22B 2QQLH 4X9IA 4ZNCD 3ULSA 2R0KL 3SDDC 1PPYA 1AHWB 1HT6A 2XN2A 4WEBH 1TTFA 3BD3A 3SY6A 3WNPA 4I2XA 3WD5L 4X6DF 1V3MA 4NRXA 1J8HD 1EO8L 1V7ML 2FUTA 2RTTA 5CEZL 1MLCA 5I8OH 3H85A 1A6TA 1QTSA 5IVXF 3MNVA 4JREB 4MAYC 4HV8A 1MQKH 4HKJB 4OZ4B 2NYYC 5EORH 1FPTH 3FONB 2RFXA 4L4JA 5E99L 4TQHA 1FG9C 4QRFA 2X4NB 3MLPA 2OZNA 4N28A 1MFEL 2VR6A 3QIUA 1Q9KB 1X3DA 4AGOA 3EXLA 4XGZA 4HKBB 4JY4B 3FT1A 2Y5TB 3LTVA 3PJSA 1Y7VA 3E2HC 1T7ZA 3GIVB 5CGTA 4JO4L 2WWNA 3OJVC 1RMFL 4XC3H 1CR9L 5FCUH 4ZMYA 4PJIB 3DDGA 4YDJA 2TSBA 3FNKA 3D9AH 3MBEA 1BF2A 1J1XH 2Z31B 3JSSA 4PJ7B 4F1ZA 5F0LB 3X14B 2ICWI 4OF5A 2X53A 3GSNA 3HB3B 3QJRB 4LQFH 1VFOA 3EOBA 4M48L 1X6NA 3NJNA 3GRGA 2V5MA 5EU5B 4ZMNA 3V6ZA 3BPCB 4C57C 3IBEA 4XNUL 2WWMD 2PW2A 5IQ9B 3CN3A 4L8SC 1OGAA 4H8QA 4WI2A 4I9WE 2LU5A 1IGYA 1FHGA 4B9KC 3E3QC 2FJGA 1S5HB 1A1OA 2Z8VC 5F7WC 4APQA 1O9VA 3GEWB 4ONFL 4ALAH 5DGQA 2QQKH 2Q86A 2H45A 4H1LH 5E0QA 1O9WA 5K59E 4WTZA 1S7WA 3RL2A 2CZNA 4AW7A 4Z7OF 5IF0A 4PTTA 4M3JA 4HJUA 4YGVA 3QO1A 3WTSA 3TO4C 1TEYA 2X2IA 2YD1A 5D2NA 5F9WC 3BSZA 1OOAA 1S9VA 5EOTB 4GMSH 2D4FA 2ZYHA 1HD5A 2VSDA 5DD3H 2RHEA 4PJDB 1DCEA 1SJXA 2X4TB 1YUHB 4OJCA 3LB6C 1Z5HA 3FCTA 2JF1A 4U3SB 2WLIA 4MDIB 4WTQA 3GXTA 3R19A 3V0HA 1XHHA 4I18C 3OXSB 3QUMB 1IGCL 4HIJB 4UZGA 4UOJA 5DHXB 1CS6A 3X2HA 2Z35A 3P9MA 2YFNA 4OD1H 1KTKE 2EDRA 1F1DA 2UWEB 3MV8A 1JK8B 1G0XA 4RFNC 4Q4IA 4TKWA 3OPZH 5IGXL 3VB9A 4YDNA 4YUEH 5HDRA 2OZ4L 2P8LA 4KDIA 4R5XA 3MODH 5LGHL 3MZTA 3QHFL 3WFHB 2FD6L 5FCSH 3KPSB 5HJGA 3C8KA 2Z4TA 3TZVD 3ZVVA 4XOBA 5IMMB 1UB5A 3MV9A 1UZ6F 1FGNH 3VWJB 4IU3A 1HQ4A 3VSTA 4M8QB 1SVZA 3D39D 2AVGA 2D0HA 5D1ZD 3LRHA 3KLKA 1AS7A 2EP6A 5HYEA 3NCYS 4L8CA 4QCIA 3SGEI 4NZFA 1JZ4A 3MLXL 3HC0B 5HDQL 1NMCC 3GXUB 1P7QB 3VCLA 2A9MH 5DJXB 2E76C 1FH5L 2IWFA 4R90H 2ICEB 4PJFB 3TA4D 1XGTB 3M88A 3OMZA 4OJAA 1XAKA 3MRKB 3AGVA 3AU1A 1I8KA 1KXQA 1XIWA 2LLGA 3HRZC 4OUUA 4FFZA 4MWFB 3EFOB 1XCXA 2H3KA 1UGNA 3DBXA 2DM3A 2BNQD 2N7BA 3MRLA 2DTSA 3I6LD 1RULL 2Z0BA 2H9GA 3L2NA 5DK0A 2XJLA 4JG1H 2OPCA 5C1BA 2UZPA 3QJOA 5TTRA 2GPZA 2WWKT 2DEYX 1HCYA 3QUXA 5EIIB 1MAKA 2ZXWB 3P0YH 4W4OA 1CTOA 2GAZA 4XXWC 5IB1A 4N5UA 5FW6A 3L3KB 5LBVA 2DYSB 3OKOA 5BNXD 5C0CA 4ANUA 4LHUA 3SHSA 1R9TA 3ARUA 2VPZA 2NY2C 3BUIA 1T0PB 1IIKA 4KRPC 1DBML 1AACA 1DE4B 4HUKB 1TEGA 1ZXKA 4ZUUB 5KWYC 4N9GB 2GVYA 3RKDC 3IDIA 3S5LB 1YNJD 5FLUA 1GZQA 1AMXA 3K71B 5IW1A 4JO4H 3ECVA 5ID0A 2Z7WA 1PNDA 4YLBA 3HC2A 3MUZ1 5FXCH 4YHMH 3T0VA 3G5YA 5CCKH 4WDIB 2AERT 3MRCA 4NO3B 3HMXH 3ZKXB 4ZSOE 4RBPK 5E5MA 4TS6A 4XP6H 3S3PA 3US0A 5TDOB 3AFLA 1I7UB 3QG6A 3ESNA 5FYKE 5ESQB 3BD4A 3E9UA 1FBIH 3IRCA 3PV6B 4ICWA 3AXIA 4YVUA 4JO1L 1VZHA 4F5CA 1OAXH 1CL7H 4IOIA 3BVVA 3HUJA 4S1SL 1E0OB 3SB3A 2HJFA 4GAYB 5SWZD 2ZP8A 3BGFC 3IPBA 3CDGB 4JFFA 5IG7A 4GIPD 2V0AA 2GFBB 1NJ9B 4YSEA 2XIIA 1IAMA 4X6EA 5SV3A 1M3IA 2PF6A 3W38A 4MMYB 2YPLA 4L4TB 5EWIH 3IJSA 1QFPA 3FZUC 4NN5B 1RK0B 1SLXA 2CA3A 4WJKB 3VUAA 3EYFA 1I7ZB 4G8EA 1A2YB 3QEQE 4L1BA 2GJ6D 3NTCH 3BKYL 1RZ7L 2XV0A 1NQBA 4MJHA 4EI6A 2PI8A 3BAYA 4OR1A 3DIFA 4XR8C 3FW6A 5T5FA 2Y1VA 3PXJA 3RIAK 3HS0C 5HYJA 2GJJA 3V6OA 5C71A 4BCYA 4KTGA 4BZ1H 4B0MB 2WCSA 3VXOB 4U2ZA 5IY5B 3DOHA 5IMOB 1VERA 1ETZB 1NM4A 1YG9A 3KPMB 1Q9LA 4PJBA 4MMZC 3QQ9D 3VFSB 4YJZL 4FQCL 3D34A 1ZT7A 2AJXH 1Z7JA 2DWEA 3LQAH 3X12B 1P9MC 3L95B 5DWUL 5CEYA 1J5OL 2WVVA 2VW6A 3AADB 1U92A 2Y7LA 4JQIH 3NP3A 3BH8B 1SJHB 3QIWD 1TITA 5MEND 2VXUL 2WQSA 2G3MA 4H20L 2R92A 4XBGA 2F18A 2YKLH 2VRKA 3CDYA 1O0VA 3MCLL 2JIRA 4KPHL 2MMXA 3MBXH 4RAVB 5L4JA 4F9PC 1XH3B 4P9MH 4PRNA 1A7NH 3QDAA 4TOYH 2VMCA 4PTUB 1MWAL 3B3BA 1FZMA 3M1CA 4XNQB 4JQIL 4BZ2L 4HBCH 5F3BA 2XA3A 1VGKB 4JP7A 1CICB 2NW2A 1XL6A 5AOLA 4HWZA 3W81A 1QEWA 3V2AR 4AV0A 5JZ7C 1T0MA 1WFTA 4HH9A 3FOLB 3QCVL 4G71B 2BSRB 2VSCA 4DZ8B 3MRJA 1S7QB 3BUYA 5E5UB 1RVFH 4YDVA 3CPLA 4RGND 4HW6A 1F6AB 2G9KA 4URKA 2XVLA 2APTA 2XA8L 1BQHG 2EDXA 3D09A 1IC5L 3MUUA 1V55B 1ETZA 4IBWA 4AOFA 1KCUH 2WLJA 4IBTA 1BVOA 1Y18A 3GEFA 4FKEA 4A7GA 5FK9A 1VFAA 5CFHA 3ULUF 2QMJA 4LASL 4RNRA 1X5KA 5CU9A 4LZKA 3GSQB 5CZVL 3QR0A 1UWEL 5BUAA 1ZCRA 3QNYB 3LNDA 1QNIA 2EKSA 2FQGA 3V4VL 2Y6SC 3UTQA 5D1ZA 3EJCA 3K6NA 5M95B 4FZ8L 3B9KA 1A2YA 3QFJB 2X12A 1DO5A 4JY5L 1WICA 3DO7B 2M2DA 3WY1A 1PF3A 4O00A 3GI8L 1J8HB 1BD2D 4YXLH 3N6YA 5T3ZL 3S6CA 3I02B 4FQLH 1Q38A 2YRZA 3WKML 4FTVB 3TF4A 3N1PC 4HFUH 4L4TA 4LB8A 3IPFA 3VACA 4W9GC 3EGXB 3UBHA 2Y3NA 1CQYA 4HH9B 3GXNA 4HG4K 4TMPA 1QUNB 3LB6D 4WUUD 3HBPA 4I2XE 4HWUA 1FYTB 2UV3A 1OANA 4CVUA 4F7TA 1MLBB 3T3PF 1FL3B 1MCPL 2XV6B 4AH2B 1RJZB 4BH7A 1BQUA 1OGTB 4JAMA 4U0QB 2FT6A 4G7SB 3G6JB 3CFCH 4G7QB 3DX7B 3L4VA 3TFBA 3C2AL 1PG7W 5DO8A 4ZS6C 2APSA 3H9HB 2MOQA 3HCVB 3AREC 1E4KC 4NC2B 4GP4B 4WCYL 1TUPA 1VKXB 2MNUA 5CP7A 3ULUC 4P49A 5TGBB 2FECI 1UCTA 4JKPL 2AK1H 3WNOA 3EBAA 4M7ZB 5IW1B 4IW4C 4DKTA 2K9UA 2JKJA 3QNFA 4CN6A 3S35X 2EE2A 4FTVA 5GGQH 5D1ZI 2FAUA 4M62L 4XHJD 1B0GA 1Y0LA 2BNQA 2Y06H 1CDGA 4H0GA 1D9KC 4GKSA 3EJZC 1QKZH 1WK0A 4NQVB 4GOSA 1L9OA 2ILLA 3BZFB 4AQ1C 5JDJA 1HQRB 5GS3A 2VN7A 4N3UA 2ZKHL 5FA4B 4PJDE 3TVMA 3P73A 1JF1B 3NN8A 4PJXF 2BHUA 4LHUB 4POYA 3N43B 2DAVA 1U8JA 3UIYA 5C92A 2X3CA 1DVTA 1VFAB 3FULA 3ME0A 3TH3T 2YHGA 3O3AB 2VAAA 2PCFB 2DBLL 4IRSA 1U8MA 3GZQA 2JTYA 1IAIH 4N2OA 1Y0LB 1B6DA 4ODUB 4X4KA 4OF3A 2CO6B 2NVXA 1NGPH 4ONHB 1U95A 2XNAA 3MRHA 4EKJA 4YDVB 2YD7A 1MHCB 1DQTA 1M7IB 3T77A 2GIMA 2GBUA 4X0NA 3EOAA 3ZO9A 5JIPA 4FFYL 2XETA 3VXUA 3F62A 4ADJA 1XO8A 4MVBC 4OTXL 3UTSB 4PJFA 3MFFB 4TV3A 1IO4C 2AQTA 2D8KA 2VXSH 5AW4B 2FLBT 1BXUA 2CR6A 3C6LA 4DKAA 1JXGA 3VI4B 4G8AC 4UQ3A 5TQ0H 1MWAA 1BGXL 2QADB 3SCMA 1ZSHA 4NGHH 3RZCC 4UTAA 1MFMA 4M8QA 4LFHG 1G4RA 1AZVA 3O6MH 1J1OL 3A4AA 1ACYL 2AV1A 4P3CL 4YK4C 3RTQA 3FFDA 3SUKA 2PXYD 4NQTA 2EH7L 1XEDA 2J7LA 3A4DA 4LPTA 4GSXA 1EZLA 4WFFE 5DF0A 1UQSA 1DVFC 3GIZL 5I2IA 1SJHA 3FSVA 3UPRB 1NH6A 1A3QA 1YNTF 2DQDH 5EUOE 5FKAB 1JGDA 5FYLL 3U4BH 4Q97A 1T7YA 1UADC 3MLYH 4UQ9A 1ROWA 1F0LA 4J4PD 5FTNA 1KN2H 3D39E 1DJIA 5IR1A 3MOAH 1JNLH 3VD3A 3FCTB 3ETBF 4Y4KA 1MW3A 4WJ5B 5C0BD 2X10A 3ETSA 1EAJA 4GQPH 4N2BA 4WWNA 2QT6A 1KLUA 4ZFZB 3KLLA 3L3KA 3ZSTA 4QHMB 3HE7C 4LAJH 4OLEA 5AG9A 4UDTA 4M1DL 3HRZB 3V0VB 4ODTH 5A6IA 2PP7A 4PREA 1W6LA 4I0PC 3P3SA 2PWFA 2WBJD 3MRMB 3VX0A 1BHGA 4MCZA 3SDAD 4NKIH 4G9FB 3P0VH 1BZ8A 1A3ZA 3FQYA 3VGBA 5AVXB 4AM0Q 1IL1B 4K3HA 4LEEA 4GQRA 3VU2A 4DCQB 3W0WD 4ZFGH 3DETC 4KAQH 3Q6FA 5JIMA 1XF2A 4ACPA 2Y1AA 1NUDA 4FMFA 4MHHG 3QIUD 4NNXA 1YY9C 4KJYA 4HALA 4EZKA 1UUNA 1J18A 3L4CA 3K5RA 3KGSA 3QQXA 5DMKB 2AE0X 1R19A 2WQAA 3J07A 1PYUB 2O72A 4PJEF 1AD9B 1J48A 4Y4FA 5BCAA 4HOWA 2J5LB 1SM3H 4WNSA 5CEXB 3WY3A 5CS7A 5K9KB 1GCFA 1YN7A 3QG6B 2ZG2A 5GSRB 1XH3A 3W11C 2VDMB 5IV2B 4OZFH 3OKLA 4OW6A 3P11L 3ZDZB 5AVVB 1AXTH 1HS6A 2TRYA 1O5PA 3VDBA 3H56A 2VABA 4G8IA 1CIUA 1PZ5A 4AVIA 5HHMB 5JHMA 3ARRA 2ENJA 2RGSA 4OLVL 3TIEB 4UU9B 2V7HB 1AVAA 1HWHB 3L81A 3K6FA 2UWEA 3N44B 5DT1L 3L3IA 1NC4D 1MPAH 2VN6A 5FWQA 4YSOA 4ENZA 4P99A 4ORGA 5FB8A 2YD0A 3MV8E 5EU4A 2Q7YB 1JCKA 2ZX6A 1MCOL 3VI4E 2XN9D 1K85A 1ZJAA 5EZLB 4J5VA 4YHZL 4Z7WF 3VD0A 2D2CC 2IOIA 3FT3B 1BSIA 1T83C 2A1WH 1V3KA 1JRHH 1E4WL 1YAZA 2YARA 2YXMA 5E9DB 3KS0H 4JFSA 1R3IL 1WUNT 2BPBA 2DLGA 2E8YA 3ZTNL 4F7KA 1UWGH 3ECUA 1IEBB 3Q0HA 4XC1L 1F4HA 5C0CB 3V52H 3K4DA 3V9CA 5FTJA 5IEKB 4HMEA 1K83A 4RWYH 1KIUB 1EJOL 2QKIA 3KDMB 1JV2A 1ID5I 1TJGH 2OR8A 4UI2A 3U46A 4YQXL 1UFGA 5DJAA 1T1YB 4JKLA 1JNNL 4DGYH 1ODAA 2Y22A 1MW2A 3SDYH 3NCWA 3U7AA 1EZVY 2ZOWA 3K2IA 2OFQA 3M17A 2YGQA 4HJJH 3D0LA 4JUSA 4TOYL 5ESVB 3RI5F 4TVPH 5ACZA 2EIDA 4G6MH 3SBRA 3RFRA 5ERWA 3P4NB 3VXSE 2FRGP 3RVVD 3WFEH 4Y9EA 1MEXH 2PO6A 4TNGA 1RJLA 4ZK8A 1IC1A 3NOIA 2NSXA 2X09A 1ZHKA 1OGAE 3W37A 2FE0A 1BOGB 1PYQA 2VLME 3CVDA 4DEPC 5EU5A 3VCLB 3EO9H 4QR7A 1DQQA 2WSPA 4NUGL 4EKXA 5CO1A 1PCSA 5DJ2A 3CFMA 5BUPA 2XKUA 3F7VB 2MNJB 4MJ6B 1P4IH 5I17A 4X9YA 4D3CL 1CVSC 4KNQA 4OV6F 5I6PA 4IIZA 3WCYA 1BD2A 3DLQR 4TVPL 1RUKL 2ZJSL 3TJHC 4LF3A 4BD4A 2IC2A 4F8QA 4NWTH 5BVJA 3K6SB 3QWNA 3IM1A 1QQDB 1UYWH 3FUMA 4ZUVB 1FIGL 1SUJA 1A9BA 1UG9A 4G7YH 4JDEB 4H8WL 4FQIH 4PY8I 2ZXQA 4R0LC 1JK8A 4XE0A 3IKKA 1DVXA 5C07D 2PWDA 3WSQH 3S3CB 5A1AA 2RFXB 1D6EA 4AXWA 4IJTA 3MV7B 5HYSG 4ZUUA 5EPMA 3SPIA 4BA0A</