4FG2A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellotetraose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg2A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg2A02
2G5DA 1OA7A 2GAEA 1HD5A 3X2OA 1BMWA 1OA9A 3X2KA 3X2JA 3SUJA 2AE0X 3CZBA 4JS7A 3X2HA 3X2PA 3ENGA 2KQAA 4AVRA 1BW4A 2PICA 4ZM7A 2HCZX 2VXQA 3SUMA 4FG2A 4FG4A 2BH0A 3X2NA 3FT1A 4FFTA 5GLXA 5GLYA 3M3GA 3X2LA 1L8FA 4JP6A 5GM9A 1BW3A 4JJOA 4FERA 1WC2A 1N10A 3D30A 4JP7A 3SUKA 2PJJA 2G6GA 3SULA 2JNZA 3X2MA 2ENGA 1WHOA 3X2GA 1WHPA 4L48A 2PNWA 3X2IA 3FT9A 2PI8A 4ENGA 4JCWA 5H4UA
chains in the Genus database with same CATH superfamily
3FU9A 5E5MB 2JSFA 5E94A 3I9AA 3ARWA 3CF2A 1HX0A 3HNTH 5F9OH 1OOAA 4KGLA 3C6SA 1H6FA 1PJWA 1YY8B 2NXYC 2EC8A 3EYFB 1T04A 2H0EA 4Y9EA 1UVQA 1UTDA 2OCFD 1B4LA 1RL1A 1U8OB 3RWDA 2R83A 3LSOA 5C3TA 2H1PL 1MVFA 1UD4A 2DQEH 1N64H 2OQJA 2XTJD 4YVNA 1MG3C 2VJ0A 3BKYL 3C09C 4I0KA 1CFNB 1T7ZA 4PJCA 2Q20A 3UDWA 3TZVB 2LLNA 4MS6A 2EKSA 2ZCHL 4G8FA 4GB9A 3X1EA 2VLRB 5I0WA 4O02H 2P8LB 3AM8A 2APWA 5F72S 4JHVA 3ZTJH 4FXTA 4HSCX 2X2IA 4GKNA 5CEZD 2FTAA 5HYSA 3LKNB 4RBPH 2G4EA 3HN5A 4JFXA 1ZD6A 2WWKT 4JFFE 2WXJA 4GUQA 1JP5A 4BQBA 4Z7QE 4NUJA 5G4NA 1YNND 2W9LA 1YECL 3HRPA 4I3RL 4NZTL 4L3EE 1H6UA 4I0PA 4K5OA 5JHLL 2OA9A 2A69D 2ZXQA 2GK0B 2VJXA 3HUJE 3NJHA 4Z6AT 4IIZA 1NUNB 2R4RH 3LPOA 2CKBA 1BLNB 3P4NB 4TOYH 5DFVC 5LBSL 1U8LB 4MHHG 4FQJH 5LHDA 4BKLB 2JCWA 4A7VA 5KANI 1ZMYA 2VC2B 1KZQA 4E9SA 3UJTL 3VGDA 1VZHA 1AI1H 1K4DA 5D1QC 4L2LA 1O7DE 4UQDA 2W9DH 1GYCA 2X4RB 4HGMA 3QORB 4PD4K 4ABVA 2F6AA 1YDPB 2IF7A 1IAKA 2E7MA 4MAYB 3QJVB 1P2CB 1S7WB 2DIJA 1U2YA 3EW3B 3FT9A 3MCYA 1HEHC 3QUXD 5FPIA 3DTXA 5FTJA 1GYUA 1Q9OB 5IQNA 3AUWB 5GIRB 1CD0A 1IQDA 5FB8A 5I1KL 1W0YT 1HSAA 5ILTH 5DRZB 5GGSA 3W9DA 4JHWL 3DX6B 5DUBB 3DV6B 3E7JA 4P9HC 1ZLWK 3TWCL 1IGFL 4HIJA 2NY5L 4Y5VB 3NCJH 1NBYA 5DO2C 3LRKA 2J1XA 2M1KA 3IRZA 1A4JB 1KWGA 2EDYA 3L7FB 1WEJL 4DOHE 2WOYA 3MZTA 4EEEA 3GSNL 5AOKA 2OXHB 3NK4A 1CIDA 1MIEH 2IH3A 4PJXF 4OGYL 2GK2A 5EZIH 4TRPH 2EXWD 3L7EA 3BN9C 5ALCH 1FVCA 3SOBL 2BOBB 1ET8A 4U1JA 4ZPVA 3UTPD 1BQHA 4ZYKB 3G3LA 4O2CA 5DJDA 3NJNA 1TF4A 4L0YA 4N2GA 1YZZA 3BAWA 1ITCA 1GGBH 2B1OA 1T4KA 4OCYL 5KSAC 3EOAB 4YLQT 3T2NH 2PCYA 3OXRA 4L1HA 5DMJB 1MCBA 1IILE 1MF2L 2Y3NA 1P53A 2BY1A 4GP5B 1LO5B 1QWNA 3P0YL 1R3JA 3KG5A 4P2QD 2BVQA 1SXAA 1KTKE 4HYTB 2VZVA 2Y06L 4TULH 4BQCA 5E9DB 2PWGA 4Y5YA 5K33A 2PICA 4H8WC 1E4KA 4L0PB 3ULVD 1E8ZA 2KBGA 3S3DB 2ZKMX 4J3OG 2CUMA 1OLLA 1FVDB 1VCAA 4PHZA 5T8IA 1AZNA 3D39D 4I2XB 4OD1H 4D9QD 2CG9X 2YXVA 1KACB 2FB4H 1W9XA 4HCGA 3PXHA 1HYRC 3PP4L 4KZEH 1X5LA 5K9KB 4FRWA 5CINH 2UY7B 5KS9B 1EFQA 1N67A 1X5MA 2BCKB 2DRUA 2GJRA 3QIWC 1JNLH 4CMMA 4KLNA 2EEOB 1K3IA 1XF3A 4MXVE 4WU7A 3UTOA 1A3ZA 3QNXB 4LO9A 5I73C 2YD0A 1E7VA 1SVBA 1T5XA 3QUHA 3HAEB 4GQZA 2BP5M 4NUPA 2W60A 4M1DL 4OCSL 3UBXI 4MMYB 3H54A 3PWPB 2Y06H 4TULL 2HH0L 4BH7B 1JPSL 2XVLA 1LE9B 2BWIA 1YAZA 4XZUB 3BW9A 3WFZA 2CGZA 3JQOB 4RDBA 4J3OH 3ESNA 1QLEB 4GP8B 1BAFL 1VADA 4HLJA 1ZC1A 3UAJA 4TUKL 3IRPX 1E6OL 1B0WA 4M8UA 3WS3A 3B2MA 3IMSA 5DYOA 1BMZA 3ARSA 3FCSA 1KB3A 4KROB 2IV8A 1S7TB 3SGDI 5J06A 4KKBD 3EFOA 4O9HL 1SHXA 3UAJC 3QAZB 4F8QA 3B9AA 2Y69B 2V3FA 3FB8A 2P8MA 1ZIBA 3WG7B 2ADIA 2WUBL 1ZA6B 4CDGC 2DWDA 3MV8E 4KVNL 1QEWA 1P7KA 2Q5BA 3M88A 4EE2A 1OSZA 5F0LB 4KO5A 1S7RB 2O5YL 4Z7NF 1UHEA 3QUMH 1LK2B 1R24A 3OZLA 4G5AA 5CEZE 5EEWA 4G11A 3ZKNC 2GJ6D 3QZNA 4J2QA 2W81C 3C60D 1QI3A 5IB3B 4XP6L 2JIOA 1CT8B 4UILL 4YDLC 2DEWX 2QKIA 4DEPB 2EDNA 2OZNA 3UZVA 2P24A 2WXFA 1Y7VA 5GGRB 1VAHA 2BXZA 2YAMA 4AWJC 1NMAH 2GSGA 3ZT6A 2VH5H 4PS8A 5I66A 4RISL 4WWKD 4LL4A 4P5SA 5GGVH 3MFGB 3FO1A 3EFFA 3EYOB 2X4UB 1DVZA 4NQCA 4XVJH 3RZCA 3LB6D 4LCCB 1KEGL 3GTQA 2ZSVB 1ITBB 3CFEB 4QHKJ 3L4ZA 1UT2A 2NSMA 5I6OA 5J9PA 2WO4A 1IJ9A 4ONGL 2BLFA 3ELQA 1YQVH 3BIKA 4IOIB 5ADOH 4L1LA 4R97C 3MRNB 3PHOB 1F6FB 2IXQA 4YHYB 1UM4H 3ZDZF 5HHOD 2JIQA 2BSEA 3PWVB 3KXFD 1JK8B 3IU3A 5AZEL 4MRBA 1D5ZA 4MNHB 4XC1H 4XCYA 2F1AA 2P49B 3CZNA 1A1OA 4JRXA 3JWNH 4X9GA 1ZXKA 1I1FB 5KVDE 2MNWA 2WHVA 1CTMA 4UV7L 1VGEL 1TENA 5AB1A 3LCYA 3VXNA 2MEJB 5I18H 5J5EA 4X5XB 4FYQA 3ARDA 5E99H 4E0RA 4ZSOA 3HZMB 5H4YA 5FA3B 1B0RA 4IKIA 1GTNA 3T0EA 5SWZB 2EACA 3WIFB 3ZRCC 2Q2LA 3QR0A 3IFLL 4JFQA 5C0CA 4FG4A 4WUUE 3APCA 3ZBMA 3IGLA 1ICTA 3SPJA 3PUCA 3N1MC 1TSRA 1B0GB 1PG7W 1IC5H 2BP3A 4I88A 4NKOB 2VDNL 1XSIA 3HFMH 4URTB 5CJBA 4BHUA 1RUPH 1RUKH 5TFSH 2P5PA 2EE2A 5T3XE 5K59F 4JY5H 3T1FB 4OQ1A 3CWGA 5D6CA 1VRSA 2E8YA 5JXEA 5DQJA 1MXGA 1WAAA 3FN0H 1SLXA 1T22B 2BNQD 3DHUA 4G6AD 4KXZI 3O8XD 2PABA 1V7NL 3UIZA 3VXTB 2P28B 3NJLA 4UYPA 3BAXA 1W15A 1E67A 1PD1A 2ZQKA 4HOZA 5EULV 5D6DA 4ODVL 4I3SL 4XCCH 1I1RA 3QUYB 4PVNA 1ED3A 4LQFL 1DCLA 4NNYA 4OJFL 2ROXA 1EU1A 4XNZB 4TTGA 2R7ZA 2Y7NA 5T33L 3QDGB 4KGJA 4M43H 4NUMA 3CFUA 4JHWH 4GQ9H 1A14L 1U93B 3QIBD 3G5YA 4PRDB 1A3RH 4YNYB 5SWZA 2OJEA 3WIFA 3KNBA 1S7VB 3QHZL 2XWEA 5FKPA 2QBWA 1RZKC 2VITA 3WDIA 1N26A 2FJGB 3L9RA 4LP4A 2VLMD 1BYNA 5I30H 2ZUYA 3SE9L 3RU8L 4PTTA 3C6EA 2ITFA 5BV7H 3FF8A 3QGVA 1ZE3H 3R1GL 1U36A 1B6DA 4DPBX 1D5RA 4Q9RL 4X6FA 4J3SA 2AXHA 1H5NA 2DQGL 2FIRT 3F7KA 3U0WL 4GAYA 1A66A 2IH9A 4C58B 4J6IA 4N2OA 1S5HB 4OF6A 4C59B 2VQ1B 2ZICA 1LEKA 2B3RA 3KWXA 2WKGA 4JFDA 4PJEF 1WP6A 3VTMA 5JOPD 1CQKA 4JEGB 4TLKA 1T83C 3LPWA 4AVHA 3V5HA 4CGTA 1BIIB 4EKJA 5CAYB 4TNGA 3ZTNL 4UTBA 2IPUG 4PY7A 1RLWA 4YHLL 3BEWA 4KI1A 2JQMA 4M8QB 2DLFH 1Z5LB 3BWSA 5BVPH 2I25N 2VM3A 1IAIH 5FO9B 4NPKA 1S9VA 5I0DA 2B2XH 4AAYA 2QDWA 3II2A 5AW4B 1ASOA 4DKTA 5KJRL 1NSNH 1NUDA 1W8EA 1XAKA 3F7VA 5DJYB 1XVSA 3K71B 4P4KB 3IBOA 1PYUB 2Y1VA 3M7OA 1MREL 1Z32X 1TKWA 2GEQA 3T3ME 4Z18A 4KMTH 3EJPA 2L7QA 3ZHDA 2ARWA 3GRWL 4X0KB 3MHZA 4BRJA 1BGXL 5DYGA 4PRID 1CFSB 3CDGB 4Y4KC 4PP2B 3ZL4L 4N8VA 5FGBA 3ZKSD 4NENA 3IDXL 3RQ3A 2D7MA 4JANA 5E95B 4JR9H 3UACA 3QR1A 4JPIA 5H35B 3VXSE 2V17H 1ZGLP 5LBSA 1Y1VA 4PRPA 4M9OA 3WN5A 3WS3B 2ZKXA 4RMSA 4X6DA 2O61B 4NQVB 5EO1B 3F12B 5T1LA 2R1XB 4PGCB 4KJYB 2QJDA 3X2NA 5JHLA 1C5CH 1MVYA 5T3ZH 1BSIA 1XTLA 5L4FA 1QFUH 3B9KC 4N90E 1EHAA 1QW9A 4OIAA 4DETA 4GQPH 1LDPL 1Z9NA 4LVNB 1E8WA 4W9EC 2YARA 2BVPA 2GI7A 3KBFA 3N44B 3U9UA 3AS3A 4X6DE 1AI1L 3SGDH 2MQ3A 4XNYL 1UG9A 3U6XS 2MCPL 2A6JB 1NCNA 4BDVB 4OZHF 1S8DB 2E76C 5SV3A 1MQ8A 1QKZL 2EDHA 3H85A 1SF3A 4XNQB 3I02A 4DW2L 3DMMD 4PJDB 4HG4K 4ZNCD 1IGYB 2BIQA 3MV7B 5E9DE 1Y6MR 2G5BA 4GRLD 3VSVA 4XMPH 3S6CA 2MKLC 7CGTA 4Z7UA 3OJVC 1BEXA 3EO1B 2ITDA 2VTFA 3IPBA 2BNQE 2NSQA 5DZOA 2FZ3B 1E9PB 3SGKA 1QHOA 4YFEA 1PMYA 3W5MA 4HLZH 4NNXA 1KXVC 4N0UE 3SCMC 1DQTA 4GKSA 3T9WA 3GMQA 2WW8A 3NZ8A 3SPIA 2H6PB 4Z3IA 4TLTA 2OMBA 5D1ZA 4QHLA 4P59L 1S3KH 2EDLA 2AERT 4ONGH 4FJ6A 1KXVA 4ANWA 1N6UA 2C9PA 2JCCE 1J1OL 3C6LA 1HL8A 2LOEA 1MCSA 5BS0B 3KVPA 1HQRA 1MPAL 1JWMB 2PTTA 4MX7A 1AQKL 2BIMA 3TM6A 2X44D 4PJEA 5DMGC 3SDDB 3MV7A 2PYFA 2XFGB 1SVZA 3ZL1A 5E2VL 2C1OA 4QTFA 3HE7A 4LLDA 2F9BT 2C7FA 2I07A 3AMKA 1U4EA 3K6FA 2OW6A 2A6JA 4B41A 5I17B 1DFBH 1DLFH 2EH8H 3GC3A 1WA1X 5A2IH 1NJ9B 3IGKA 1SDDA 4M7LT 1QR4A 3WD5L 4X9FA 2VQTA 4Z9KB 4DKEL 3H7LA 1S3KL 1DMRA 3S34H 4BE5A 1K2DB 2EDEA 3KLSA 4CILA 2AJXH 2EEXA 3WTVA 3BP7B 5FV1L 1Y18A 4Y2NA 4JFDD 5DZLA 2IAMC 2Q8AH 4PRNA 2JF1A 5IJVB 5BZDA 4ZW8A 3FTUA 5TQ2H 3NA4A 1OAKL 3KPMA 2XQYG 2YRLA 5E4OA 4B9FA 4X8JB 1GR7A 5J6HB 1MWOA 1EJ6A 1Q0YL 2EDFA 5DEGB 5DHXB 3OKEA 3GSOB 4XNYH 5G4OA 2XCMC 3C9NA 5EBWA 4L3FA 1U2HA 4XB7A 3HLKA 3KJ4C 4JJ5B 3CJJA 4HGWA 5HGAA 4MAUH 4TMPA 3F05A 5CEYA 3D0LB 5GRVL 2P5EE 2Q2EB 2CWRA 3T77A 1JYNA 3LOWA 4JFFD 1HHKA 1E2ZA 5EEVA 4GW4B 3M1CA 2VERN 3D4GA 4RNRA 4OZ4A 4YO0B 2VR4A 3U46A 2XRAH 5A2BA 2C9RA 5B7EA 4XRCB 4UB0L 3W0WA 3AW5A 5AW3B 1I75A 1ZHKB 2VPZA 1ET5A 1CE6A 4IKNA 3EGSB 1MFBL 3CNKA 1VC3B 2DF3A 3PREA 4XVTL 3V4PL 1RIHH 1CJYA 4YSEA 3RILA 1HOEA 5CN1A 3B2VH 1WC2A 4R7NB 1WICA 3Q13A 3DO7B 2QFPA 4FZ8H 3MJ8A 5HYSB 4GW5B 2ADGB 4CGUB 4DT2A 4M6NH 2RMNA 2XBDA 5B22A 2J6EL 1JGLH 1N3NB 4L3CB 1FSKB 5ID1B 4ELDA 3QH3A 4Z3HA 5IFJB 2B7DT 3V6FA 2I60L 2P8PB 3RKPA 2IEPA 1FIGL 4JHBA 4JFDB 2VLJD 4LCYB 5FW7A 1KYAA 4POYA 5IOPA 4N2HA 3THMH 1R47A 3G6JF 3EJQA 3LTVA 2XC8A 3MUUA 2ZYHA 4FQ2H 4HK3J 1JUFB 3EOTH 4YC2C 1M6OA 5HGAB 1KCBA 4GSDH 1Y6NR 1HK6A 4ZFOA 2J1KA 3D34A 1QA9B 1HHHA 1CI3M 2ZP8A 3QEGL 4UT9L 1LNUA 3BPLC 4E41B 4R0LC 3PYCA 4XBGA 2W1NA 1NBZB 4JY6B 3TPUA 3DECA 1T4WA 5J3HC 1U8PB 4PBVC 5JZ7C 3OM3B 2CRMA 5TQ0L 2ZKHH 5E8PA 2CBPA 3CV5A 1FLTX 1INEL 3DSNA 4FQLL 3IFOB 2UXVA 2W5PA 2XIDA 2MCAA 4ZW5A 5FTLA 1GC1C 4LNRA 2XNAA 3QG6A 4YLCA 4HKXA 2FECI 2V7NA 3PUUA 3HUJF 4YSPA 2WIMA 3TBSB 1XXDC 1TVHA 3PV6A 4J3BA 5B3JE 5H2BB 3V6ZA 2FEEI 3PF2A 5FTNA 2XA8L 1CVRA 4H1LA 1XEDA 2J4WH 2LQRA 1XBDA 4YHNA 3TA3D 4QAWA 3FJTA 3TH3T 5LVEA 4KRPC 2E59A 3OKLA 2BX5A 4HWBH 3ULAB 3MJGX 2QR0B 5AKRA 3NCBB 5DQJB 1KPVA 3ELAT 2F7QA 2XY1A 2ZKHL 3ARQA 4OZGF 4CVUA 5JOFB 1FV1B 3DX7B 4GRLB 4RESB 2CHNA 5SV4A 3TA4D 3CXFA 4NAMA 2L3BA 3A5VA 4R3SA 4GSQA 1DQKA 3FCGA 2G0LA 2PN5A 2XVBA 2HMIC 2KDGA 1DHKA 4D9QE 3OKLB 4MMXC 2R2HA 5DWUL 1HL4A 1RJLB 4QHNA 1ONQA 3CXHK 2WQWA 4MDIB 5LN8A 1S7XB 4KPHH 4M61A 1IEAA 3BZEB 2ESVE 3PP4H 4NO3A 5GLXA 1KBWA 2GT9A 4AMKL 4LSSL 1AKJA 1KYFA 3EDKA 1MOEA 1SN5A 3WTWA 1SOKA 4OLWL 4EN3A 4W70A 4BD4A 5GZOA 5JR1H 4CW1B 2X05A 5JW5B 5IVXB 5E2UL 5LWYL 5GZND 1XB6A 3KYKL 1A0QH 5L2JA 2G5BB 2E6JA 4NJ9L 4AVKA 3SY0A 1EK3A 3V5KA 1VFMA 3OVUB 5LCVA 1KZYA 1YEFH 2AAVA 4YX2H 2NDGA 4JFOA 3WNMA 1O7DC 1CD1A 1BVLA 4N86A 4QCIB 5C0BE 1MNUH 4PJCE 4XNXH 4BYHA 5KBPA 4JS7A 2PR4L 1KIQA 2CMRH 3MRNA 2H2SC 4EUPH 3CFBA 4R96B 5AKTA 1OHQA 1TTAA 1DJWA 3HI1B 2ZP0T 5IB4B 5DD1L 3O6FD 5E7BA 3FU7A 1I3UA 4A2DA 5IHUL 3QK0A 4F37K 4KTGA 2ORBH 2G2RB 5F8QC 1GIGL 3RFZB 4P23A 1N8OE 3EJYC 4U1KB 4X8GA 4PJAA 4LKCB 3RZCC 4JFFA 5C9JA 5HYJE 2JJVA 1C8QA 3U4EA 3VO0A 3CSGA 5JR1L 1TDQA 1XL6A 2P24B 3W0WD 3QC5X 5ITBH 3FQNB 1HAUA 3QO1B 3EJTA 1UA7A 4GH7B 1VPOH 1CICD 4R7LA 3PV7A 5INCB 5GRZA 4MD5B 3WMPA 5HHQB 4IU3B 1G8JA 3MJ8B 1JGDA 1G7PA 1XGYL 2FNBA 5DHMC 1YEWA 4DUVA 1NWOA 2AEQL 3GWJA 1RZFH 2HLAB 3BQVA 1FZMA 4DN4H 5DZVA 5EO0B 1HINH 2PCPA 5FS5A 1UGNA 3SOTA 3QCVH 4IRSC 2JIXA 3TWCH 1XCXA 1PT1A 2NOYA 1WUNT 3ASNB 3LY6A 2H32B 3WD5H 5C0CE 3I74A 1JYVA 3JV0A 3FQXA 2J43A 3GS7A 5HDBE 4YR6A 4QD2E 1TU2A 4O00A 4ZFZB 2EXSA 3RAJL 1MCJA 4OLEA 3ALXA 1MIML 2FDBP 3G5ZB 4JFHE 1KN4H 4JP6A 2OP4L 1WBXA 1UYWH 3C5SB 3D85B 3ALWA 3HS0B 4TVPD 3AXLA 5EBWB 4FNQA 2ADFH 2IGLA 4MMYA 1SVCP 1MFCL 4G80A 3MBWA 3DBXB 2AEQH 3HC0B 3MOBL 4GRWB 5B39A 2SEBB 3VFNA 2AK4E 3ECUA 3HG0A 1OAYL 1CZ8L 3DV4B 4CMMB 3E8UH 3VD4A 3OPZL 2AI0L 5I5RA 4NQQA 3X12B 3BP7A 2XXGA 4RGMB 4RGOH 3DLQR 3PHAA 4B9IA 1ZGLB 3PS6A 4Y7MA 2I24N 4Q6IA 3X12A 4EDXA 1ZTXL 3QDJD 3KPQA 1PGRB 4JFEA 3FH8A 2BFVL 2VUYA 4KX7A 3U4BL 5KG9B 3FT2B 2ZYIA 1BX2A 3SKMA 2AMUA 1FYTD 3KYAA 3TIDB 4A6YL 3A47A 1C12B 3CMGA 5F7FA 4MS8D 2VDOH 3VFWA 1P0SE 2WVUA 5HHXL 4OV5B 3KCPB 4NCC1 3W81A 3E80A 3WMQA 2NUPB 2NW2A 2F5AH 3HE6C 1NEUA 1TPXB 3VFOB 5MEQB 4OFDA 2Z0UA 2C9VA 4NM4L 1S3SA 4RSVA 1OCOB 2H2PD 4FQ1L 3AXLB 1AO7A 1CDBA 1JNLL 1IB5A 4PJCF 2FR4A 4LOEA 4X5RA 3CXDL 1P6WA 3U7WL 3WOVA 2AK4A 4NOBA 1J0IA 3L9EA 1TU2B 1VEMA 2Y7SA 1K6QL 3RIFK 1YMMD 5KVDL 5AVZB 1WO2A 3ZYJA 5DD5H 3UX9B 2AHIA 1J9RA 2OMXB 3HOGA 5EOQL 5DVLA 5I6PA 1P4BH 1R5VB 3ULUF 1FSKC 4F1SA 5KN5B 1UWXH 1YECH 2VLKD 3LHPH 3DROB 2YAEA 5GZOD 4CVZB 1OTSD 4Y4HB 3IEAA 4LMQE 5EZPA 4QRPE 3BH8A 1TJIL 4NQTA 4RQQA 1JPFB 1AW8B 1S4IA 1JGDB 1G7PB 2Q7YB 4N5ED 3BQUA 3D52A 3SKJH 1FL3B 2D2CC 1DVFA 1H3XA 4NQSB 1JGUL 3MRLB 5DMIL 5DJ6B 5C0AB 1YAIA 2XG5B 3O45A 4DGYH 3VXOB 2K7QA 1NIAA 1N6QH 2G3MA 2CLVB 1DQJB 4MMZC 2OJZL 3WIHH 1E8XA 1N4XL 2B63A 1UT9A 1IGML 4JM2B 3NJIA 3BKYH 3LNGA 5HPMB 1BVKB 1HQ4A 1MFCH 1DR9A 3WNOA 5HYJD 1Q0XH 4KNUA 1UM6L 2X6BA 4UNIA 3RNQA 5C0FA 1DLHA 4PYGA 1C7SA 2A5UA 1DDTA 4LHUB 3VI4B 3SDAA 4N2FA 4X4MA 5I6MA 3QJQB 4Q2ZA 3AGVA 3UAEA 4DKEH 3ARFC 4WW1B 1F6AB 2HKAA 4XNBA 1SF5A 3AB0C 2ZXCA 1JCKA 3US0A 3BH4A 2E27H 5TE7H 2EYTB 3UC0H 4DCQA 4N8CL 3FQUA 4MSWB 4BK5A 4HWEH 4L4VB 1PQHA 1KT2A 5HGDB 5DMIH 2VDLH 1NINA 4HKBB 5D4JA 3V4UH 2J2ZB 2CIIA 1R6VA 2E56A 4N8VB 2R0KL 2V4LA 5I8CB 1OCZB 1JGEB 3JWOL 4A7GF 1YYML 5IUSA 2OL3H 5L4IA 2H2SD 4YHZL 1JHKL 5FYJH 3NZSA 1U8JB 5CIPA 5FF6A 5SX4I 1OK8A 3VGFA 3JV5A 5DT1L 3HKFA 5DU7A 3ROLB 2WINA 1T2QH 3BIBX 3NA9H 4BWUA 3F7YA 1KGJA 4R3SB 2EKSB 4G8FB 3KLKA 2YR3A 4N8VG 3RWIA 2W9DL 4HUWB 4EAEA 3ULUC 3Q5YA 2YN5A 5I1CL 4K15A 4FFYL 1N2RB 1LO3H 1OKEA 1EBPA 3CLFL 3RVXC 2YSTA 1QFHA 1QLEH 4XT1C 2HVKB 3KLAA 3TBYB 5JOFA 1QUNB 3LHAA 2BXYA 3F7YB 2VPXA 2AJUH 4DP6X 1MCLA 4LVEA 2CHZA 1UD8A 3OJ2C 3O6LH 5BJTA 3FYIB 4UZUA 5IESL 2OZ4H 4HETA 1UZ8A 1Z3GL 4BELD 2K7PA 15C8H 1E65A 4FNRA 5F3HA 2X10A 2E4FA 3SO5A 3KW7A 5J57B 1MCOH 5FF6B 1XH3B 4TVPL 2VMEA 4LDOB 4CBZA 2BS9A 3GO1L 4J39A 4X6DF 1GS8A 2QLYA 4MCZA 1LEIB 2ITCA 1JGUH 2JKIS 2ICWB 2XN9E 4YSTA 2I9TA 2Y5EA 3FQ1A 5DDHA 1G7IB 2C1PA 3IDYB 3SO3C 1KT2B 3ECWA 1QKZH 2D3JA 2HT2D 2ZOOA 3WIIH 4DCQB 1N4XH 1WBZA 3IFOA 4FMFA 2AQRA 4OCXL 1JPSH 3NDZE 4ZAKA 3WJMB 3SJVA 5LJYH 2YSSB 1IGJB 3ZKXC 4PG2A 5KYUA 3MRCA 2HZHA 5FOBA 3RZWA 1QASA 3Q6FB 4Q4IA 5HI5D 4AGLA 2OJEB 4LDEB 3FO2A 1MCNA 1MZYA 4WWID 4HJ0D 1A3RL 1L8FA 2IWKA 5LG1A 4E41A 2OXGA 3DXAA 5TDPB 1ETZA 2BVEA 1M3JA 1C08A 5A16A 1EEYA 4UDUB 3UTZB 2YQBA 4I2XA 2ZIDA 3BVXA 4ILDA 4P49A 5AZ2H 3SE8H 4AT6B 4HHAA 4R2GB 4Z95L 3DGDA 3CZFB 3A4EA 4D8OA 1BQKA 1LK3H 4MNGA 5B1KA 3QIWD 5JUEL 3B2DC 4PS4L 4P2QA 1UB5A 3HBQA 5F7DA 3V6FB 2ZXDA 1G9MH 2VLKA 3BGFB 3MN8A 3NJXA 5INDA 3HBPA 2FATH 3ECVA 4HH8A 4HVBA 3GMNB 4PBDA 4PRHB 2YK1L 4R7NA 3CN1A 4WCYH 3BWZA 2NNAB 3OG6B 5KW9L 1UCBL 3GMNA 1HAWA 4S11A 1MWAH 1ZWIB 4NKQB 3U2SB 4KQ0A 4JAMB 4V1DE 5ESVB 3ZX1A 2MTAA 4F2EA 4XOEA 5F1OB 4BWWA 4U3XA 1F1GA 3H9YA 1JXFA 1CE6B 4RGOL 5KSVB 1EXUA 4L8CA 2NW3B 1E32A 4GW4A 2A73A 4APXB 4KJPD 3R06B 1NC4A 4WK2B 3ETTA 4F58H 2IFFL 4G6JL 1IAIL 4P2YA 3LEVL 3J27A 3QS2A 5D7JB 5I1LB 3OAZK 2GHWB 3MBED 2K8QA 3L4UA 3M1OA 1LP9B 1CE1H 4PJGE 4L4JA 3U7AA 2Z3FA 1U3HA 3U1QA 4Z0BL 3GZKA 3MR9B 4HGWB 4N2MA 1BOYA 1QHPA 1VGKB 2QQNH 3IGAB 1KEML 2HX9A 3GSOA 5LAXA 4YBLC 4AGMA 4JRXB 2AANA 1TJGH 2EEFA 3FO2B 1A6TB 5DQDL 1XD0A 4KKZA 1ZHBB 3MJ9H 4TYUA 2J1YA 1JK8A 3HE6D 2YSSA 4PHXA 4U1SB 4H0HB 2CRIA 1N9PA 4KVNH 4LOUC 1A21A 3NFSL 2XKSA 5HGBB 1BXXA 3NFPB 4X4KA 5IFHL 2RB8A 5I18L 4IGBC 3KPQB 1I85A 3HNVL 2KDYA 3QQ3B 4IRZL 5L6YL 2WSDA 2I5YL 1YDPA 1ACXA 1FORH 2PUQT 3VW3L 1U8NB 1UQSB 1L7IL 1U91A 4KV5F 4QO1B 1I8AA 3OMNB 1ECZA 2BHZA 4D0DB 3D09A 4MB3A 5F7UA 4M6MH 3P54A 4HS6A 1WJ3A 5EOTA 3EH2A 1WSST 1EGJA 4JFEE 3DPBB 2XQYK 1LDPH 4MQXC 4MVBD 4O2EB 1PX3A 5FO8A 1S7SB 1S46A 2XPYA 1OSPH 3L4VA 3MYJB 4YH6A 2XWBA 3Q5OA 2N7SA 3KHOA 1PFCA 4MX7B 5LO7A 1NDGA 3NZUA 3HS0A 1IBFA 5ITBL 3ZDZE 3LXUX 4H20H 3STBA 3EOYG 3QDGD 3K3QA 5F1NB 1BVZA 2YA1A 1VB9A 2VIRA 3HVDA 2WB1A 3PU7A 1HH6B 4K8RC 1KGUA 5ALBL 4GKZA 5AWNL 1TQUA 4XNMB 4JO3L 2VLJB 5IJKA 1L7IH 2H0PA 3II1A 4HS8H 1O7SA 4NNXB 1PD0A 1WCBA 3QC8A 3KHQA 3QNYA 4RGNC 3T2NL 1AANA 3QUZC 4GKSB 5HHOA 3O8XC 4JO5A 4ODSH 1YJDC 2HT4C 1IMHC 2BSED 4F37F 3E6FB 2W07A 2R7EB 4XN5A 4DJMA 3EO9L 1MRCH 4WY7L 1CDCA 4Y19E 3QWQB 4JM2C 2HVJA 4G5ZL 4NC0B 5ISZB 2N0MA 1YC8A 4Q56A 4XGZA 5CZKA 1JZEA 3LVTA 1S3RA 2Y2WA 3N41B 1E4HA 4YZWA 1F4XL 3C08H 4ZAKD 2QGEA 4B7IA 3HAEA 3MCLH 3CH1A 4UM9D 1FO0H 3EJRA 3T0VA 3FQYA 1B4TA 1I9EA 3WUWA 1BYPA 3IN0A 3SDAB 5E5MA 5E94B 4UQ2A 2ZOKA 4JQIH 1QLFB 1O0VA 1KIRB 3MXWH 4ZUWB 3NP4A 1S7UB 6PCYA 2G2RA 5J6SA 4ISVB 3C2SA 4N2AA 1BA9A 1FNHA 1ULVA 2CDEB 3L6FA 1C5BL 1R9FA 3WGVB 2EIBA 5JXED 3QIWA 1E9OA 5KANG 2X4TA 5EEXA 4HUKB 3E1F1 3FOLB 4YXHH 3UJIH 2VDNB 4OT1L 1BVLB 4QCIA 3L4CA 3L3OA 1HHGB 1NCUA 1FL3A 1NWPA 1MAJA 2R1YA 3N85H 2B2XL 4BRVA 3GM0A 2W94A 1JPFA 2RR3A 3B9KD 5FUZL 1I50A 3IGFA 1TQCC 1HH6A 2CK0H 3H2QA 1BOGB 4TUJB 1A7QL 4TUOB 4ZO9A 4DNLA 4UQEA 5D7KE 1JGIA 1DQDH 4LSUL 5FX3A 5BUGA 4AC4A 4BZ2L 2D3NA 4I4WA 4YDZA 1UXWA 4OF5A 2OMVB 4PM1A 3BKJH 4LIQH 3QRLA 4NLAA 1G0DA 4TNWF 2XN1A 1NCDL 2NXZC 5AAWA 1I3RB 3V0IA 1FFRA 1GA2A 1X4ZA 3QUML 3TN0A 25C8L 3EH5B 4DTGH 4X4YA 1BXUA 5BUAA 3EUDA 4TNVF 3O5AA 3QWRD 4ZOEA 3VRIB 4KKLC 4IK7A 2FR4B 5T5ID 2ZF9A 2J6WA 5FLUA 3SGJA 3CU1A 4XO5A 4H1LG 5FO9A 2YKKA 5DSCB 3BUPA 3QCUL 1NBYB 1QD0A 5DR5L 3PG2A 4DPCX 2G2NA 3L4WA 4YIQA 4GRWF 3LKPB 3VXRB 1UWFA 5EIIB 1U9KA 2JJUA 3W11D 1YUKB 4S1RL 2UYLA 3FO0H 4WUUD 4N1EA 4NP9A 3P4MA 4PJFB 2XI9A 1EZVX 3OL2A 1Q9OA 4Z95H 3GSNH 3OJDB 2EUXA 3ZT5A 3BKMH 1I7UB 3BMWA 4ZFGL 2FT8A 4YHOL 1NGZA 3P73A 4NRYA 5E23A 5FO2A 5DMGD 2IH1A 4TLUA 4LNRB 4LMQI 2N0KA 4KJQC 3CX5J 5ICYB 1FZKA 2VWEC 1TOXA 1CF8L 1GGUA 2EH7L 1W0VA 1SM3L 2F74B 4QYAA 1GRWA 3DUSA 3RDTC 3X2KA 1TCRA 1NBZA 4Q0XL 4L8CB 3GBMH 4TQIA 3MRQA 3U48A 2C26A 3H9SD 4XP4H 4C55A 4JPVH 5I1JH 3TYGL 3EHBD 3NIDF 2KUTA 1P5VA 4PRIA 4R4ND 1Q94B 3POHA 2CA3A 4Q6IC 5AW5B 4WKXA 5ELIA 1N5YL 3JWNE 3GTGA 2JTDA 3Q5TA 2ZE0A 1TNMA 1OW0C 2QKIC 3GBDA 4W68A 1YYMH 1R19A 3D08A 1JF5A 3V0HA 2A6HD 3U1SL 4ELKA 2A6IB 1MWAA 2X87A 4RFNB 3KGSA 4GFXA 4KTYA 2EVFA 4LIQL 1I4FB 1TPXC 5I5JA 4C2MA 3VFUA 4WW2F 2GUOB 4LARH 4LKXB 1VKXA 4P05A 1F3DH 5AW2B 4YOKA 1ZLEA 4Z7QB 5I1IL 4PLJD 1UH3A 1AE6H 4GRMB 2RQ8A 3P02A 1B0RB 3NJMA 1X5ZA 4R83A 3NN8A 4UM9B 3S34L 4JVUA 4NQCE 4PJAB 2FQEA 2O6PA 5I15L 4HT1H 2J88H 1I8MA 3CUPB 3TIEB 3C9NB 2C8NA 3L5JA 3NJVA 3FUNA 5IROD 1PF3A 4GW1A 4ZO6A 4Z0XB 4ETQA 1F13A 1MY7A 4HEPG 1VEPA 2HRHA 1H9VA 4K7PX 1I7UA 4FFVC 4JREB 4AGPA 2HFGL 2EDQA 4O5LL 5IHLB 1I7RB 1DO6A 2EDDA 3MNWB 1I82A 3SE6A 5IKCA 4JFOB 1MDTA 4GLRI 1MJ7H 2ZWSA 4PEEA 3P0VH 3QUXB 4XR8C 1D3CA 5HSFA 4MNQB 4JUTA 2XXMB 1QZ1A 2C45A 3QUXC 4PGDB 3ISRA 4B60A 1OGYA 1BECA 3QUKB 4FXGB 2DLEA 4LCCA 2XRAL 4RFOH 1KJ2L 2VSKB 4HCFA 4OFQA 2GT9B 3DX3A 3I6LE 4YPGB 2V8LA 2YD7A 3WFBH 2DEXX 5IB2B 3KPRD 5KVGL 1J5HA 2JK5B 3UZVB 3IMUA 2EJ1A 3X17A 3D25A 4WTXA 3B2VL 1B88A 4X4YB 4Z5RA 1OE1A 4MA3B 2WINB 1IGCL 5JPNC 3ROLA 4LBAA 3B4NA 5JOEA 3FSOA 2F7RA 2CUAA 3WKMH 3FRPA 1I9JH 1S7RA 1PKQA 1ML0A 1NSNL 1P7BA 2IDQA 4YGVB 3AS1A 3TVMA 2B16A 3CDCA 4TUJA 3AS2A 4Z7WF 1AD9A 1N59B 1P7KB 2GY5A 1MRDH 2CIIB 1DBAH 4IK6A 1RK1A 5JYMA 2TSBA 2R2BA 4RFOL 2JE8A 1JV5A 2BVUA 4M4PA 3QEUB 1HHGA 3EBGA 1U30A 3TH4T 3GSWA 3GSXA 3MUJA 1E4XI 4K5MA 5JIHA 2P5ED 3CBRA 4FMKA 3SCMD 3N55A 5I16B 3GINA 1MH5A 4QRTB 2AV7B 2HFTA 1T20A 2R2EA 2WK2A 5GM9A 4XP5L 5J11B 4IJ3B 4ZPTB 1P7QA 1ZHLB 5CXPA 3DKHA 3O9WC 4PV9A 3WXWL 4OSUH 3HNTL 5F9OL 1GGCL 1K3ZA 1MI5E 3I02B 2LFEA 2X38A 3K5SA 2DV6A 3UO1H 2DICA 3KR3L 1YN6B 4KITB 2CHXA 1KN4L 4XVTH 4WTZG 3N0PB 3TFKC 4BDVA 2OMNA 3K4ZA 3V0DA 4N1HB 1HHIB 2A2QT 4YK4C 3MRLA 3U9UB 2K0RA 1HN1A 1LNUB 1O5DT 1YPZE 4F5CE 3QAQA 2A83B 2BSSA 3SD2A 3WKQA 4M7JL 3NFSH 1VENA 4UTCA 4RQQB 3C5ZC 1PD6A 2NR6C 4BFFA 1YNJD 4P2OD 1XF5A 4E9XA 5DURB 1JGVH 4J5VA 3MLSH 5E4IA 3BZFB 5L2KA 1EZLA 3OPZH 3T4YB 4NQVA 5LDSA 3S3CB 2VN5A 1XGRA 4EUPA 3O4LE 3BAKA 3VM7A 1JZ5A 5IOKA 5L2KE 2WV3A 1CVSC 2AEIT 3PHQB 4I9WE 4NT6A 4IOFD 5CZXC 1DBBL 4EIGB 1MVUB 3P9MA 1WPCA 5K9OB 1IIIA 2HG5A 4U1MB 3D9AL 1EJFA 1LO5A 3ZKQD 1JHLH 3MLRL 5L8JB 3W1ZA 2G3XA 1NFAA 2NY1C 4NSKB 5SWSB 1N8ZA 4ZMVA 5EC1B 1DL7H 3EGDA 4PRIB 5E2TL 2OYKA 4APQD 3NH7L 2FEJA 5CBEB 3Q6GH 1K5NB 1VERA 5GGUA 3S35X 2AABH 3AU0A 1EHNA 3BVUA 1HXMB 4B5ZA 4U1JB 1MG2C 12E8L 3QB7C 3ZMEA 4JRLA 3ZO9A 2NXYB 3VTTA 4UUJA 3DUUB 4OFPA 1A9BB 3OPUA 2EC9T 5CEYB 5AVWB 2YOCA 4AYDC 1S9VB 4YEFA 1XGRB 1USZA 2R69L 4HC1L 4S2SA 5JDSB 3FHEA 1XX9C 3BUBA 2O72A 3HMXH 1OL0A 2YD8A 3AT8A 3UTQB 1U8NA 1UQSA 4L3EA 2IH1B 3SZ6A 2ZX6A 5HD8D 2DLIA 3UG5A 4LVNC 3WTTA 1ZGLM 4PW9A 2B5IC 3ZXAC 1JWSB 5E8DH 4ZTPL 4XAWL 2Y3AA 1I9IH 1LMIA 2FLMA 2VN7A 3KPLB 3I9IA 1IKFL 1THAA 1IAOB 1NDMB 4HXAL 5IJVA 4OGAD 2FLBT 1LEKB 2OULB 1WAAF 5EUOB 4U1SA 5EU4A 5TH2B 3UPAA 4B50A 5IR1B 2DQDL 1UA3A 4ESKA 1JMZA 1YLBB 5FCSH 2FHFA 3VXRD 4AQEB 3NGBC 1FO0L 4UM8B 3F00A 3ZE2F 3SDXA 3KPRE 4HBQA 4K8RH 4AIEA 1ZTMA 1N68A 1CMOA 3SQBB 3CVIL 3ZKND 4GG6A 2NTFB 5G55A 3O0RH 4QT5B 3LDBC 5DWUH 1T0NB 4RAUA 1MREH 1GC1H 3X3FH 2W80C 2Z7WA 2RH0A 4AVJA 4N0CD 4J27A 1TETH 3ARGA 1JNJA 2JB5H 1FFTB 2YQGA 3D07A 1MEXL 3AACA 3POCA 1J8HE 4ZX4A 3P4NA 1ETJA 5T5NG 4XCFH 1OTTD 1H6TA 4M29A 1MHPL 2LE9A 1LD9B 5DZNA 4F9LA 3UCQA 1CUOA 5CZVH 5C0BD 4PJDF 1AKJD 3OR6A 4NSKA 1H0HA 3HZKB 1YJDL 5SWSA 2R1WA 3L1EA 2FO1A 3QXWA 1J88A 3H4HA 2QHRH 1OAUL 3ULVF 2BOCB 2A9ML 3N9GH 3V4LA 1V8HA 3R0MA 1MCIA 4PRHA 3WTXA 1SLUA 5FUOH 1WZKA 1FIEA 1QFUL 3F7QA 2R29L 4GI9A 5FYJD 4KK6D 2CK0L 2AK1L 3OJMB 1H15B 3TBCA 3UERA 5CO1A 3VJ6A 3Q8AA 3D50A 4FXKA 4GBXB 2Z8SA 4ZX3A 1KGCE 4KX9A 6PAZA 4ZI8A 1OD9A 3MRKB 5JW4Q 4JN1H 4OLVL 3TZVA 5AYUL 3EJYD 1OP3K 3VWKC 3WFEL 2GAZB 1XF5B 5L8LB 1EGJH 1FN4B 3FSWA 2OX5A 4WI4A 3O6FA 1OTSC 3U2IA 3BAEH 4HD9A 4RETB 5IMKB 2ZCHH 4XXCA 4CU7A 5DVKA 4IDJH 4P23D 2OJ1A 4AQAA 4ATTA 2E6QA 4OTXL 4DAGL 3FU7B 2H2PC 3HMWL 4F80A 2WPGA 3P4LA 3HNVH 1TJHL 4TS6A 2D03L 3WUWB 1ETB1 4ZMNA 2KLSA 3QHFL 5E6IA 4QRPB 1L9QA 1Q4NX 3KPPB 3E9TA 3WO4C 1JXKA 3AWEA 1DJYA 1WZAA 3DIVA 4NERA 3BWAA 5L7XL 3V95A 1CG9B 2BMKB 4L5FH 2BJMH 4ETYA 3TLRA 4F7TB 5GS3A 2VDOL 1U8IB 3I9GL 2KLRA 4WEEA 5L2KD 4PWFA 2RHEA 2XLLA 4FQJL 5F21B 3WDJA 3U2JA 3D2UB 1CYGA 3ALPA 4HDIB 3NEEA 3KZ8A 4X6DB 5IHZA 2BSTA 1AOHA 3WUZA 1QR1A 4LGSB 1Q90A 1FH5H 1S9YA 2YGNA 5HHOB 5D7IF 5F96H 3F58L 5ECJE 1L0XA 4PVMA 1MRDL 3FONA 4K3JL 3CZGA 4GKLA 2YEVB 4CDHA 1UC6A 3RB7A 4D9RD 3FFCE 4GRMA 3Q1SH 2O5ZH 3EFFB 3EYOA 4PBXA 1QBMH 1A6VH 2XWTA 3ATFA 2BSRA 4WVRA 1VFAA 3DX7A 3QQNA 3LQAC 2IGTA 4WSGA 4OZGA 3MRKA 5JXAH 4NBXB 1ACCA 5CIPH 2VM4A 5CU5A 1FL6B 3I9GH 5IEHB 2YAFA 1NL0H 1OM9A 4NM8H 1MFVA 4MJHA 3X1GA 3H4FA 1MLCA 2FJHB 4CNIA 1EHLH 2FLRT 4MKMA 4LASL 4IIQC 3SKJL 4OD3L 5CMAA 3EG9B 4YPGA 2XWDA 1A6ZA 1KPUB 2WBJA 4QXUL 5F6HJ 4FI6A 1LK3L 3V6ZB 1JHTA 3IE4A 4L3ED 1I9RL 5DVNA 4ZUSA 2AEOA 2VLLA 4P46A 4LVHB 3WENA 4PJ5E 2DWDB 4K5PA 2ZWZA 1ZHNB 3VXQA 3T2QA 1MRFL 1DQVA 2AGJL 4P4RA 1YHPA 2CLZA 1SBBA 3WJJC 1UACH 3ZZQA 3MROA 4BQ6A 1OZUA 5GS0H 5BPPA 4ZUTA 3WNNA 3RNKB 2F68X 1X44A 3GGWA 4XTRD 5KW9H 1HOCA 3GHPA 2BHFA 1F45A 3RWFA 4HJ1A 3QZOA 4C4KT 4WWOA 4ZNEA 3U7WH 2ENPA 4FNLH 2BE5D 2VXSL 3DOIA 4G8AC 5ICZA 4M7LH 4H2AA 2P4AB 1A1MB 3LKOA 5I8OH 4HWZA 2PXYB 5K5YA 2WTRA 3VFRB 1EHLL 4UOQA 1TJHH 2XJLA 4G7YH 4ZOCA 1TMOA 4MA1C 1ADQL 3K2IA 3T8XA 1MLBB 4M7ZB 2XWJB 2J88L 1HOCB 2VXVH 4U1GC 2PNWA 4MNQD 3ZN6A 2YAPA 2E7HA 4JM2A 2BP8B 1PZBA 3K8MA 4BJLA 1Q9WA 4CC4A 1IAOA 3PIQA 4ECNA 3KL5A 5KS9A 5G2NA 4YHZH 5C0BA 2XVGA 4UIKL 2Z7UA 1GPOL 4QRRA 2A6KA 2YPKA 1AXSA 1DQML 1SN2A 1KN2L 3PLYA 4PG9B 4CC4C 5I19H 2HUEA 3CSYB 4FERA 1TITA 4JKPL 4JN2B 5B1JC 5TPWL 4JZOA 3A24A 3IWUA 4PRHD 3BEVA 4AE0A 1NUGA 1P4UA 2X4SA 4N6RB 5IBTH 4BK8A 1BQLH 1G1YA 1J1PH 3AREA 4HUCA 1KULA 3CCHA 3WUWG 4Y4FC 3QJHB 3EGSA 1O5PA 2LFGA 1KJ2H 1GAFL 1M9SA 5E9DD 4F33A 2KHAA 3U25A 3TS8A 3IDMA 1UM5L 2E9WA 3KAAA 4HLZG 4PB0L 1F11A 1FNAA 2OMVA 4L9DA 4WTZA 1R0AH 1Y07A 2R8SH 1HL5A 5IBUG 4DFHA 2CALA 3ZUCA 2F19H 5BV7B 4W4OA 3FTVA 4UBDD 3QHZH 4XPAH 4QF1B 3VQLA 5I75B 2Z35A 4EVNB 4JPKL 5D2LB 5D2NA 2MSPA 1A1NA 3ULVL 3CD4A 3FONB 3SDAD 2HN7B 4JBSA 3HZVB 4L23A 1SY6L 4YWGH 4W4OC 5IWLC 3DOSA 3HZMA 4M9PA 3WO3B 3TL5A 2Y25A 2GHZA 3WY1A 1YEGL 1ZVHA 3DVGA 3NCYP 3FFDB 3T4YA 4HUVA 2GFBB 5E1AB 3BLPX 3T0AA 4FQQB 3UABA 1CLCA 4H25A 4U7SA 4X7SL 5KG9A 3QR2A 2WLLA 3IMTA 2H3NB 4V2BA 4NKMB 1MFDH 3PFUA 4NRYB 4U3SA 1NAKL 1G5GA 1A7BA 2OMTB 5HI3C 5ACLA 1Q8MA 2UX6A 4FFZH 3EHBB 2AVFA 4FQXA 4HS3A 1JNHB 3RIAF 5I2IB 4PJHB 1Z0NA 3H7BA 2WO2B 3H9SB 2ZKYA 4XPFL 2Z1KA 4EPSA 2VABA 4A7TA 2JELH 2QV4A 5IB5B 3ZHFA 2QHRL 2J12B 4XNUL 4MJ6B 4P3CH 4RA3A 5DD0H 4G5ZH 3CAFA 3K91A 3VD9A 1A3LH 1CLVA 5J9PB 1OGAE 2HX7A 5DXWA 4QOKE 3GTPA 2FX8L 5I76B 1MW2A 2JKRM 3M1BB 2FRGP 4GRWE 2VO8A 3M17A 4M6OH 5SX4H 3CFNA 3NSJA 2IWEA 5MHSD 3O6LL 1F6LL 3BSHA 1IGMH 2DQMA 2UY6B 1FDIA 4RDQG 1LO0H 3VRIA 4AYSA 3D4CA 4OUUA 2CKNA 3JT2A 2Z91A 1FFQA 4OCYH 3JTTB 4TVPH 2P5EB 2DWXA 3CK0L 5D1ZB 1PZ5B 1Q9KA 3FTGA 3QUMB 4NN5B 5DJ0B 2CNZA 2VXUL 1KUMA 2XKNB 3MLVL 1GZPB 4UQAA 1HHJB 4P23C 2Z8WC 1QOKA 4UV7H 2GI0A 4LEOB 3V8CA 3GXNA 5HYEA 3RWCB 3BPNC 3HS8A 3M8OL 3BPNB 3UJJL 3U0PB 1Q72H 1NGXA 3MGOA 2QADC 2H8PA 4BFNA 4XMLL 4DMRA 4HKBA 1A4AA 1BZ9B 1FPTH 4MJIE 4O2FB 4NX0A 1WA2X 2IMNA 2BK8A 3PY9A 3QO1A 5DYOB 1JHKH 2D31A 5FYJL 1HKLH 1NBVL 4S1QL 4L8SC 4ZXBC 2X1PA 4QT5A 2R15A 4B7LA 4F2MA 1CFQB 2W0PA 3IJSA 3ZE2B 4BH7A 1UJ3B 1OQOA 3RWDB 2WXMA 3RFZA 4PIBA 3KVQA 2DQJH 2HXAA 1RFDH 5B1CA 4DH2A 4A67A 1YY8A 4JM2D 4LPWA 3MTRA 3V6BR 3OXSA 3EYSH 5HPMA 4R97B 3FRUA 5K1JA 5EBLB 4D0CA 3X2OA 4FHJA 4HP5A 5IB5A 3VNZA 3VSTA 1UHVA 1H5BC 3OKKA 2VDOB 3OR7A 2KKQA 3MV9A 4I3RH 3VXUD 2A9CA 2QTVA 5I1DA 1G8KA 4K94H 4MNQE 4QRRD 3RVWD 1OE3A 2WTOA 3D2UD 3IYLW 2XA3A 3GHBH 1DSWA 3C87A 4JZNB 4TOYL 4Y4KB 3MREB 3RVUC 1DDHA 1DYZA 1CDIA 1TWCA 2W0FB 5DA0B 5GGTA 4HUUB 3ARED 2ED9A 4XWGL 5E08L 2IDTA 2KZ1B 3E6FA 5GPRA 4Z1PA 3PHSA 1RIUH 4PJXB 3DETD 3H3PH 3NFNA 2W59A 4M8RA 1R3HB 1FO0B 2YPLD 3QNYB 3WKML 4MMZB 1JF1A 2DW5A 3L1GA 3VXMD 2BVQB 3ARDC 4AENB 5C0IB 1NC4B 3LZFL 1IFGA 1S78C 3EF4A 4MVBC 2YKLH 3F7VB 3C8KB 1N5AA 5K39B 2PWDA 3D69B 3L81A 3D51A 4RZKA 2F1EA 4EQ2A 2Y4SA 4MJIA 4PPTA 1HCYA 5J1AB 5KYWA 3LS4L 1E90A 2XDHA 4BEIA 1NFDF 2EXYD 2ZG3A 1J87A 2I69A 1UURA 2R0WL 4U1NA 2YD3A 4PJFF 2PYED 4K23L 5EN3A 3HS9A 3ZUNC 2VH5L 4CKVX 1MVUA 5MEQA 1ACYL 5KSUA 1NQBA 1A4KB 4HD5A 5FO8B 5JPNB 3K6SB 3O3BA 2WCSA 3HE6A 3L7EB 4GBXD 4PLOB 5KVGE 2D4DA 7TAAA 4HAGA 2W9EH 1JXGA 3VFWB 4IRJD 4NBYB 3NT0A 5B38G 4TTDC 5K9QI 3ORJA 1S5HA 1IBDA 4LLUB 1MHCB 4NKIH 4NJAL 3VDCA 4LCCC 4JZOB 2VDRL 4RMTA 3BH9A 5DRNB 1AGFA 3OMIB 2YKLL 4PSRA 1JZ2A 5TK4A 3JYBA 1F4WL 4RGMC 1LO4H 2HKFH 4WW2B 5B8CB 4CBPA 3E9UA 3MRIA 1HSAB 1OB1A 2W88A 2F5AL 2QELA 3GXMA 2IO5A 1KB9K 3V0VA 5GHWH 2WLYA 5I1GH 3AUVA 4KZCA 3DTXB 3GDBA 4TM9A 3KM2A 4TQHA 4LOVA 4P8QA 3SDYL 4HJSA 2XN2A 1INDL 1NC2A 1YNLL 2DZEA 3DBXA 3WTUA 1U8PA 3EJJX 1VGEH 3LEYL 3JXAA 1DBMH 3T8XB 3WGUB 3WS6C 4HULB 4OIFA 3P3RA 4FEMA 5DI8A 2FT6A 1S9XB 1CGUA 1DVFC 2Z92A 1KTLB 3JV6A 1HTYA 3D85A 3FUKA 3IFPB 4DK5A 4W9DC 1ZT1B 5ERWA 3QC6X 1B4RA 4UIMB 4Z3EA 3B83A 1B9KA 4MCZB 4JB9H 1CE1L 3QUZD 1UJ3C 3MLWH 5MI0C 1LEIA 1PZSA 7FABH 1IEBA 4K9JA 4PJ7A 4AIOA 5B3NA 1S9KC 3OAYH 4ZDHA 1BLNA 3GHBL 3QPKA 2NY5H 4RMUA 3ZZLA 3FQXB 1P1ZB 1JZDC 1T7WA 4MB4A 2XZAL 2WZPD 2DH2A 1DL7L 4EBQH 4BZ2A 2Z7YA 1A4KA 3K6SA 2W0KA 3IS0X 5GLYA 5E6SB 3KWUA 1IQWH 1J7VR 4LHQB 1EIBA 5CR8A 5C09E 5JQIB 4ODHL 5K9JL 2HVKA 1QRNE 4UNUA 3TASA 3SPVB 1H8SA 2WLHA 2OL3B 4X6EB 5IBLD 1FVEB 1JTTA 1AXTL 4M5TA 1YLEA 1AJ7H 2F61A 1V54B 3D18A 4HQQL 2HH0H 1J8HA 2DPKA 3F84A 2OR7A 3D87B 1NCWL 2DYPD 4ZJ9A 4DP0X 2OTUB 3LIUA 4NUGL 5D7JD 4B97A 3IF1B 2CGRL 2DQUH 4J3XA 4XRCA 3W0WB 1QYGH 5C6TL 3ARVA 2XSKA 3TNNA 1C1EH 1UZ6F 3X2HA 1QSVA 1CDJA 2P1YA 4M43L 5I74C 3X14A 3ZKMD 2X4QA 4FLOA 4X5XA 3ESVF 1M56B 4P2RD 5IEKB 4E9TA 1X5KA 1ZRUA 3OD3A 5IGXL 5EZJA 4FQPA 4TUOA 4PJBA 2BVOA 1DQIA 3AXHA 4U1HA 4Y16B 3RFRA 1HDMB 3JVGA 4APQB 4ZD3H 5IJCC 2E27L 3DO3A 1CL7I 1UEMA 2VM9A 5JORA 1T6WA 3G9VA 1VZIA 4IHBA 3VI4E 4P59H 1FE8L 1OPGH 1E3XA 2J8UE 3HI1A 1A8ZA 4WEBL 5EB9A 3GYRA 4PJBE 3TYFB 3SKNA 1DQQA 3O41A 4HIEA 1WCMA 4Z0BH 2NVYA 3IDUA 4N90D 1H0DA 4YL4A 1V55B 1YUHA 3IAPA 3QIWB 1A7NL 5IW6A 3AB0B 1EZVY 4WW1A 1NCAH 5EUKB 2H6UA 3INOA 2GB2A 2I27N 1CFVH 2FO4B 1AY1L 4CADA 3KPSE 3QRBA 2VR9A 5EU6B 2VXUH 2WCGA 3D30A 2X4UA 4XE5B 3CG8A 1HE8A 1MEXH 2YPVA 2VSDA 3K6OA 4PW3A 3GMLB 5E6RB 5EZJB 1SYSA 4KJPC 1EPFA 4JPVL 5I1JL 2HUHA 1ZTXH 4KKPA 3V10A 2HMID 3RL1A 1S78D 1ZLDA 5HDQH 1YEEH 5LGKA 1CFMA 5IW3A 1JXDA 4JMXA 3ETSA 2CO1A 3FB5A 4YC2B 2PYEE 1TJXA 3G6JB 3RDJA 2DB8A 5TQ2L 1A7NH 3KYMA 3E8VA 3LKQB 1G43A 1FN4A 1PZAA 2A0LD 3MODH 3WKPA 4ADJA 3PGCB 5I71B 4D7ZB 3UAJD 1A47A 5JW3H 1HJBC 1U21A 2AQTA 3UJTH 3SCMB 4N1CA 5J12B 1BREA 5D70H 4WUUA 1KF9B 2JJTC 3RVWC 1J8KA 5CD5D 2C7UB 1K6QH 4PJ6A 4H40A 2VXQH 3NAAH 5LBGA 3WE6A 3FCSB 4C83B 1KOAA 1Q94A 5TDOB 4HQQH 1ZLVH 1XCWA 3EH3B 4AQ8C 2HB0A 1WV7T 4JFYA 2PETA 2PTUA 4OZGE 4PS3A 2EXTA 2H47C 4PB0H 1YPZA 2V7NB 3SUKA 3Q2NA 1NDGB 4PB9H 4Z7UB 1PYWA 4AZ8A 2R8SL 3G04A 2XNAB 2GJ6A 3QG6B 4WZ9A 5KVFE 1J1XH 1CIUA 3E0GA 4H2CA 4U6TA 3AC0A 2YD5A 5BO0D 4O2EA 1EXHA 3HFML 3OZ9H 4NZ8A 3DUSB 1NC2D 1LEGA 5GS0D 1KDIA 5TF1L 3DGGB 5DS1A 3TT1L 4RCAA 2UXGA 1TO5A 4JFPB 3CH8A 1HILB 5D7KD 3KPRB 1FE8H 1KB5B 1ZIAA 3H9SA 3UBHA 3OTTA 3D85D 4JFEB 4K3EL 4P5TA 1L0PA 4QNPF 4K71B 1CL7L 2PJJA 2WXKA 3N41F 2DQFB 3RGVB 1DJIA 4Y8AA 4ZFQA 4K71C 7PAZA 4OF3A 4M02A 1JUFA 4KKAD 3RPBA 1NPUA 1JSYA 1QO3A 3X2IA 3BAJA 4E9RA 2Y36H 3FK3A 1T2JA 4LESA 3FFDA 1T6VN 1ZKAA 2LU5A 4B53A 3KPLA 5C09D 1KG0B 3UYPA 2OI9B 3BQUB 2WXOA 1DTUA 4KJWC 3VMOA 3IR6A 4L4TA 2WNWA 2XU9A 4IYKA 1VGKA 3X3GH 3K72A 3K7UA 5E99L 5FHAH 4JJOA 3RPIA 4JRXD 5I30L 1M1XA 5F1SA 1FQ9C 1URZA 4X98A 3L3GB 4DQOH 5HYJB 5A6LA 2MQCA 1M4KA 2XWZA 4L48A 1QBLH 3N43B 1BFSA 5D7JA 4WI8A 5GJSL 3SYPA 5I1LA 3ARDD 2DH3A 3MRJB 1MIMH 2X6MA 4X7TA 3X13B 5BO1L 3FQRB 3T0ED 2EDXA 1LO4L 3BHBB 1RU9L 3ZKMC 3GQFA 4F33B 5I8KL 2YXFA 1SPDA 1UH4A 4AYFA 3J2PA 4X98B 4JAMA 3MLUL 1H9DA 4FDWA 1IIKA 2XA8H 1QFWH 4M48H 4K73A 3AREB 3LZNA 3RL2A 1KJMA 3FN0L 2VISB 3FHQA 5EU6D 4Q0XH 5JIIA 2D73A 5EWIH 3RLSA 4XXCC 1IBHA 2NW2B 4FP8L 4PREA 3ZQ9A 2FYYA 4OCLC 5T3XL 4ALAL 1GHFL 1KG0A 2XWRA 3VXUB 3H9SE 2Y2TA 1FORL 3FAXA 3CHSA 3VH8G 3O8XA 1YJDH 3MNDA 2YBRB 3RGBA 4XMXA 4OIIH 1A5FL 3KGTA 5BZDB 5KTEL 5CJ5A 2X9YA 5ADPH 1R27A 1JWUA 3FF7A 4J2XA 4Y5XA 5C9JB 4U3HA 1EDQA 4AI7A 3CE1A 1NEZG 1GZQA 3BYYA 3KXFE 3IMWA 4HPYH 5A6IA 1NJ9A 1ZE3C 2UVEA 2AXFA 4JL1A 4QXTB 3KPRA 1B0IA 4HKJA 4OF0A 4JJHA 5MEPA 2CM5A 4FLRA 5EIIG 1HZHH 3D4ZA 3N44F 5IQLA 3L9RB 3HBZA 2D9QB 2X4OB 3R7RA 4S0SD 2DYPB 3I84A 3MLPA 4R6UA 1I8KB 1OT1A 1TZHB 3GBEA 5GRJL 1PYWB 1UOVA 5B1JA 1RIVH 3NSFA 3QDJB 1TEFA 5D1XA 1RHFA 3X1NA 1WBXB 1HKFA 4JO2H 5DHVH 5IVXA 1ZVNA 1EFXB 3B5GA 2IPKB 1T20B 1ZHNA 2V0AA 5AVSB 4TXVB 1IKOP 2F58L 1XH3A 4P07A 1RIHL 4OGAC 4FQIL 4NO3B 3S3PA 5HYSG 1O6SA 4Q6KA 4NO2A 5GGVL 2XZZA 3KLLA 5IVZB 1GGIL 3QEUA 2XKNA 2H4EA 5EEZA 3FTGB 3G6AB 2FBOJ 5GGQH 2AW2A 3QUZB 1OM3H 1SJEA 2EVHA 1SFDA 2V8MA 4BSJA 3DVNB 3Q0HA 3CU7A 2B4CL 5GS2D 1V05A 3RWJB 1E28A 4M3JA 2YQ3A 4DKDC 3PWNA 3TCLA 4XO9A 3FT4B 4F15B 1NCGA 2XWTB 5INCA 3CFJB 3H56A 3RWHA 3MXWL 4HC1H 5D1XC 5DVMA 4G8IB 5FYKU 3IS1X 4XP9L 3FAWA 3MRGA 1MCHA 4TVUA 3B2PA 1XR9A 5DGQA 1CYWA 2PF6A 1KCLA 5CGYD 5FA3A 3ZY7A 4DHLA 4BUHA 4GUCA 3S8WA 1NGQH 1I8IA 3QA3A 3UEZA 1PAMA 1JGEA 2O6DA 3JWNC 3OZKA 5H2BA 1WTLA 4F7CA 3WNLA 1P7HL 5BRZE 1A9EA 4CADB 1I1FA 5FFLA 3CMOH 4IHOB 3B9KB 2JIMA 4UI2A 1JTOA 2F54D 4Q9CA 3ENEA 4IOFC 3QEQE 4WV1A 2VR6A 2DM7A 4CC0A 1CICB 4X6CB 2PLTA 3D7PA 5EIVA 1ODUA 3N42B 2R1XA 2EUVA 1JD7A 1F6AA 3DA0A 2O61A 1SXBA 4OM1L 5EEYA 2LU4A 4WV1C 3SKNB 2DWSA 4WLCA 5HJ3A 1DUZA 3UBGA 4GUPA 1QVOB 2FE0A 3Q6GL 4XI5C 5CN2A 1QSEE 2ICCA 3MX0B 5T5FH 1BHGA 2EILB 2ZSVA 4LHUD 2A4EA 3BIAX 1LDSA 4HIHA 3RZCB 4KVPA 4NQCB 1CTOA 3QIUA 3LEYH 3W82A 4EZMA 3NAAL 3PDDA 2X2YA 4M7KH 4E9LA 2X6VA 2VUMA 1E60A 1Y5IA 3KJ6H 4MWFB 5CFAA 5K9QG 2G75A 2ZCKH 1F11B 4OJCA 3GI9L 1FFOA 1IZKA 1D5XB 2DAVA 5BCAA 1M1SA 1NANI 2G0KA 3S88H 1A65A 2H26B 5CILL 1VACA 4L4VE 2QKIB 3IRCA 5L8KB 1M2VB 2HRLA 3ZE0B 1QLEL 3ABKB 1FH2A 5D1QB 1QPXA 3BESR 1Y1DA 1VKXB 4X99B 2G3ZA 3GKWL 4GRLA 3FT4A 1P5UB 3TC9A 1DN0B 3K8LA 1FFNB 2WYIA 3WLWC 2PO6B 3OC5A 2C34A 2OW7A 4FQHB 2IANE 1FZOB 3WU1A 1ZXQA 2E2HA 2PO6C 5CGBA 1E8YA 3F7LA 3NTCH 3TTSA 4XO4A 1MDAA 2AKRB 5T5FL 4HCRL 1LHZA 5BRZA 4F8PA 2WXRA 4NM4H 1GSMA 3QZWG 2AE0X 2KT6A 3FHAA 3UPCA 1WWBX 5D7LE 2WZAA 4E5XA 2BRQA 4JO3H 2MOVA 4J3OC 5C07E 5EG6C 2X1XR 1BEYL 3VFOA 3B1TA 1QTPA 4KX8A 3F7RA 1U6AL 2X4OA 3H2WA 3MA9H 2OSYA 3ZO0A 1G7QB 1NC2B 1IGFH 1Z3RA 2I32A 1ZVSA 4HFUH 1R5IB 3VCLB 5T3ZE 4RGNB 4PRNB 5FYJE 2AJXL 2BC4A 5CCKL 5I1AA 2GSIB 3MRIB 2I9TB 3LQZA 1A7OH 4G6KH 1J18A 2X3CA 1ZS2A 1M6OB 2QV2A 2FEDC 2GJZA 4WJ5A 4LLUA 2XFXA 4B9CA 1N6QL 1Q0EA 3TURA 4DKAA 4S2SB 4Q9BA 4G3YL 5DTFB 5AOJA 1BEYH 2ZWNA 4GXFA 2VL5A 2DQHL 3IU4L 4HAFA 2IQ9H 2FYVA 3LIZH 2DMBA 2OR9L 3PAYA 3TNMA 3HE6B 4MQXD 1NM9A 4GO6B 4GW5A 3A67H 5C2BH 3KLAB 3KYKH 3TBYA 1CXHA 3BAYA 1RSFA 4WK0B 3GNML 2PCFA 2Y7LA 3FTSA 1FFNA 1NCIA 2R23A 5AKSA 2JCCF 4UU9A 1N8ZB 5CILH 3U6RB 2YEZB 4UB0H 4LVOC 3DMMB 3UC0L 3RWEB 3EUUA 3MA7A 5ISZE 3TEYA 2GABA 1VACB 3VXRE 2VDNH 1F2QA 2HG5B 4OZ4B 3BP6A 2VDKH 3REVB 3OHMB 1YMHB 1FFOB 5AD0A 3IJ8A 3MRJA 2BOBA 3BKCL 1OZTG 2ORBL 1BQSA 3FT3A 3O0LA 1TWAA 4OCWH 5CEZH 4UAHA 2E47A 2ODIA 5C0RL 3DJRA 3UGUA 4ZTOH 43CAB 5L2KB 2QHLA 5I8CA 1ASPA 1PLCA 5F0JB 3U9PL 4NI6A 4P48A 3LN4B 3BJ91 4DW2H 3MLVH 5F71A 1N0XH 4MSWA 1CG9A 2BMKA 3E2HC 5D1QD 4FNLL 5I1DB 3CLWA 4J28A 4F2ME 1OAUH 4M1DH 4XX5A 1WVZA 1BMWA 3D4YA 3FSVA 3BGFC 4JY4B 4ZK8A 3S96B 2BCMA 2ZG2A 3T5WA 2LVCA 1HZKA 2GY7B 4R2GD 5GSRB 4OJEH 3PL6A 1KIUA 5JO5A 2QPDB 1A25A 5DC4B 3WHE0 2FH6A 3BKCH 4G71B 4Y2OB 5DK2A 1PZ2A 3P2BA 4G7SB 4YE4H 4OCWL 4AXWB 4MMXB 2X40A 4LSRL 3BX7C 1XAUA 4AGQA 2ALWA 5KS9F 4QRTA 3FMGH 3VE0B 2RACA 3HRZB 1OAJA 3BAIA 2E7LA 3F12A 2DMRA 5T1LB 1NFDE 2JV6A 1OSYA 1U8LA 3L16A 4J7RA 3SUJA 3HC2A 5BZWB 3RURA 4JE4B 3DJSA 4OI9A 4QI3A 1AS8A 3RVTD 2BDNH 4I0PB 1B2WL 1AQDA 2D03H 3LN4A 4XP9H 1ET7A 1M2OA 2I26N 3AZUA 2YZ1A 4QLWA 1P4LB 3QJXA 3PWNB 1XF4A 4H8WL 1CPUA 1AKJB 1HI6B 5C0AE 2YUXA 2R1WB 2CGRH 2DQUL 2XTJC 4IBZA 5LB1A 2ZPKH 1SJEB 1SLVA 4YGVA 1LO2H 3V0WL 2VC2H 4XTRC 5FHAL 1WZ1H 5ACMA 1VJSA 5AAPA 3H8NA 4AGNA 3H6JA 1JDDA 1EMTL 1B6UA 3F5WB 5DJYA 3K71A 3UGEA 1S7TA 4OM0L 1E9PA 3RJOA 3J8F7 1DO5A 3T04D 3RWEA 3CPLB 5F70A 1JZ8A 3ZDZB 1F3JB 3D0VA 4PJCB 4UU9B 4HUXB 3MRDB 3HI5H 4X4ZA 2AK1H 2MWCA 3FUEA 1NEPA 1T0NA 1PLGH 2YGPA 4WEBH 5EUOE 1XGTA 1HJCA 5TDNB 3JV4B 4OJDH 4OFYA 5E2WH 1Z5LA 1AZZC 2ZJSL 5GS2H 2P42B 5C7XH 3NCCB 4MD4A 4AOKB 2YUZA 2OLDA 3CBJB 4PGDA 3V6OA 5H4ZA 3B2UD 2V9TA 4R0LB 4H26A 1E43A 4LCVA 3EYFA 5D1ZI 1PYQA 1GPOH 1T83A 3PABB 4FXKC 5FM5M 5JIDA 3L5XH 1ND0B 4MA7H 1AC6A 3X2PA 4ANXA 5M7QA 3GTNA 1KYOK 2L04A 2EABA 4FQXB 4P9HL 3QFDB 1K8DA 5GSVA 1M7XA 2GJZB 5IJBC 1U58A 4N0UA 1A2YB 2ZWYA 5B38B 3QFJA 4H0GA 4W9CC 3VFVA 1JXJA 4H25B 1YRKA 1V3MA 3T09A 4L8BB 4PG2C 5EUKA 2XBTA 2QZ5A 3K8KA 5ESAA 1D5IL 4JCMA 4LLQB 3DVGB 3B1UA 4WIQA 4Y9BA 4PTTB 4F9LC 4IRJB 3JVGC 4A2HA 2WAQA 2WQSA 3HC0A 3UTSE 4HUVB 1AHMA 1A9BA 5F8RC 5E9DA 2Y24A 2O5XH 5DHEA 1JPTH 4FZ8L 4Y1TA 4DZ8B 3HN3A 3S98A 2VW4A 3DOSB 3MUGA 5E5LA 2PYEB 1UOWA 5JZ7D 1HCFX 3G5YB 1HHHB 4PP2A 4KVCL 2A1WL 3O4LA 4AUUA 4X0KA 2HJFB 3OXRB 4QF1A 4YDIL 2YD4A 5TGBB 1UATA 2KLTA 4L0ZA 2X70A 2CCLA 3TF4A 1YEHL 2JI1A 2AXWA 4ZFZA 4G72B 3FCTA 5EH1A 2P8PA 2BOLA 3QORC 1AD0A 4JO2L 1QI5A 1HXKA 1R3LB 1IM3D 2HTLC 3VXMB 1WD8A 3HG5A 2PCPB 2RD0A 3A6BL 3MC0A 3OC8A 4MFHA 5AW0B 2EKJA 1E4WH 3QWOA 5DLLA 2NVXA 3BMVA 3ARGC 3ZDYE 3GLZA 5E4EC 2Z8RA 4Y4HD 5E6IC 4NN7B 4PY7B 3HI6H 1OB0A 8CGTA 1M2VA 1KBGH 3KXFB 4UT7H 1YPZF 5LGJA 4I1PA 2A6DB 3MSPA 1SN0A 2JIXD 5KZCD 4XVSL 1ORSB 1S5IL 4P4KD 4RNRB 1H3PH 4NQEA 4NZRL 5JHDE 1F1AA 4R8WL 5J13B 3B3IB 1FLRL 3WFCL 1EVUA 4ZSOB 1A6PA 2Z65C 4JFFB 4WHDA 3FT1A 3DX4A 3RY4A 2VMCA 4K7PY 1UWEL 4P46C 5D7SH 5I26A 3VG0H 5BW7C 5CEXA 2FIKB 1ETA1 2PP8A 3QORA 5LXGL 5D9SB 3LKOB 1X7SA 5IFAL 5EO9A 3FUDA 3GRGA 4JW3A 2G2PA 3JT0A 3W0WE 2FIKA 1UJTA 4EDWL 2K3HA 4MNHA 4PLKD 2WQVA 3GSQA 3HZ3A 4YHKH 1X5XA 3GGWB 1I1AA 3LMJH 1LEGB 1PKQE 3RWFB 2Q8BH 3AY2A 1FC1A 3W2DL 4W9IC 4M6AA 4W6WB 3N40P 4WGWB 1F86A 3I85A 2K4AA 3L3IB 1DN2A 4IOIA 3KS0H 5HJBA 2NYAA 2DWYA 1U92A 1E2VA 5HDLA 2JQAA 5L4JA 4IS6B 5DVOA 1ED3B 5BZXA 4J4PD 2FGZA 4PVLA 4DVBA 2DL2A 2XQYA 5DSCA 3J7HA 3FU8A 3MV9E 4JFED 4X83A 1PBYA 1M3IA 2HJKA 1S7XA 3FRPB 2OR8A 1NCCL 1FYTA 4FI7A 4I0CC 2G9HB 4P5TC 4P99A 4XPHH 3BFWA 4GKNB 3G5VA 1UZ8B 1GH7A 2CU9A 2YAHA 3O3BB 2QQQA 5T1MA 4XWOC 1A02N 5I1EL 4JQVA 3NSCA 1H8OA 1E0OB 1AMYA 1R9TA 5ID0A 1NFDA 1DVUA 2ZX7A 2VAJA 2WJ5A 5DJ8A 3U6XA 2X70B 1AO7D 1IGIL 1SJXA 3B56A 5LGHH 3RWJA 4G2AA 4OCXH 3BPOB 3W3BA 4C56E 4N2EA 3NPSC 2AK4D 3CQQA 3QUKA 4FXGA 4I9WD 4LT7A 4QHLB 3UL4A 3AQDA 4ZZFA 4JK0D 3A0OA 2FD6L 1N64L 3GMQB 3MUGB 5D7JC 5EPMA 4NDMB 4YHNB 5IV2B 2FX7H 1DBKH 3EZJB 5IVZA 3LQAL 2C3VA 1TJIH 3NSXA 2ZX9A 2G60H 5K1VA 4ANVA 1E50A 5GHWL 2LV4A 3E3QC 3QFJD 8FABA 3D2UA 1VADB 4N0YH 3H9ZA 4L8BA 3KPOA 3BZDA 4JP7A 3IMBA 2GTQA 1JV2A 5FGCE 5C0EB 5J0BA 3ZHLA 4S1SL 3PWPA 3B6SA 2BDNL 3GS4A 3FQUB 4FTVB 4I18C 1OSEA 1IGIH 1SUJA 3SB3A 1CU4L 5E6IB 2ZUXA 5DJ2B 4JKLA 1V5JA 4U1GB 1J0HA 5F97E 3BIKB 4GMSH 4MDJB 4AJWA 4P57B 4XOBA 2D0HA 4AYGA 5F9JB 3CFEA 1G6RB 4J12A 2KERA 3FFCB 1T1YA 3NACL 4NO0B 1TTGA 4ZMQA 4JFSA 4AQAB 2YMOA 4MQSB 5DK3A 5IMKA 2QGBA 4PJ7F 5MI0B 2GUOA 2P48B 4LKXA 1UENA 2HVJB 1I8UA 4LASH 4OGQC 3SBQA 4I87A 4POZC 4EOWL 2X4QB 5CD5C 2WZ6A 3C09B 2FX9L 3CXHJ 4ELKB 3HE7C 2XG5A 3O45B 3VJ6B 4BIKA 4YSAA 4GBXA 1N3NA 4JO4L 2VZ1A 1VFBA 2AZAA 2WVVB 4L3CA 5FK9A 5IB3A 2EYRA 2V3DA 2FVNA 3KEDA 4G3YH 2QQNL 4PU2A 2EEDA 1K9TA 2BFGA 1MPAH 2H8PB 4KV5E 1CXFA 1CFSA 4P9ML 3MLXH 4RRPA 1ZTXE 4M8VA 3F2LA 1OAYH 4Z7NE 4ELME 4ODWA 3HHMA 2Z31C 1W0WB 4Y4HC 4JREC 2VLKE 2AI0H 1CYXA 1HHJA 1EERB 5A2CA 2QVMA 4DGIL 4XZ4A 3WNKA 5KBDA 1MW1A 4YO0A 1OE2A 3QG7L 5BVPL 1JMXA 3HG2A 4L8DA 3S2AA 1NFKA 2WKLA 4K7FB 3OKNB 4F15C 3QORD 3RIKA 1A4JA 2LW3A 2V2WA 3EBAA 4R2GC 2J8UB 1AQ8A 5EIQA 4R9HA 1AA6A 5ICUA 3Q8FA 1RJCA 4KHTH 1IBGH 4OVUA 3QYCA 1NBVH 4OLYH 3UZEA 1I1AD 4HIJB 1KGCD 1A9VA 2PWEA 5EUOA 3V5DB 4TQ8A 2PI8A 4WU7B 4MJ6A 3PXLA 2BHYA 4FTVE 2ICES 5GIRA 2QSTA 3P0GB 4OTXH 1QX1A 4E42A 4AYEC 4PJAE 4NQEE 4TNFA 5EOCJ 2NX5A 4PGBB 5LAPA 2DKSA 2NY6D 1FWXA 4RMRA 4DZBA 1WS7A 3W37A 2IBZX 1NCWH 2C9XA 1ZLWH 4KC3B 2RCSH 1CXEA 3RX7A 2ZF8A 4YXLH 2EUWA 1ZA3B 2CXGA 2CR0A 4M1CD 3SIKA 3SGJC 3DX8A 2VAAB 2CA4A 4H8VA 3RP1A 4CUCA 1NPJA 4FMVA 3ULVE 1TYJA 2C1OB 4L8DB 3MODL 3QXAB 5IP4A 3FTZA 4DN3H 1RUPL 3RDTA 2MOGA 3BSZH 3FZUD 4AM0B 1CB4A 3NIFE 2APSA 3BD5A 1S5IH 5DC0A 4BZ1L 4E41D 3VYPA 3TGXA 1HZHL 2ROYA 4U6VL 5KYWB 1H3WM 4ODWB 3EGDB 1TLKA 4JO4H 5IFHH 2R23B 2WO3B 3LZFH 2OJZH 4H13C 2AFNA 4HC1A 5F7WC 4E5XG 1XSOA 1L9NA 2H6PA 3OGOE 4F1ZA 4P4KC 2GIYA 4AYBA 3C8HA 2CUIA 1ZK9A 2H32A 2FO8A 4BQ8A 2EVGA 2IPUK 4JFUA 3QJHA 5DR5H 2JKLA 1OIOA 3B7RL 2VL5B 5EA0L 2FUTA 4IOSD 1IFHH 4FOMA 3W39A 3LKQA 4Z3FA 3GF8A 2Q9OA 2IG2H 1W2KT 3BWUC 3Q2VA 3X11A 5JMRA 3FUMA 1MFAH 3G6JA 1PZUB 4AEEA 3QO0B 1UFGA 3ZQXA 3LSOB 4G6JH 1OP3H 4RDQF 2EE9A 3QFJE 4K4KA 4EMZA 4H20L 3MRHA 5BV7L 1JVOA 4FCAA 1KCSH 1T04B 1V27A 3W5NA 3UYRH 2B4CH 1DVXA 2ED7A 4P57A 4P3WA 1NC4D 4OD1L 1MUJB 4XE0A 2XPGA 5FHBL 2D7QA 3V7MA 1MELA 4GAGH 3EDDA 1ZEAL 4MJ5B 1WBZB 4NUGH 4XMWA 3VFMB 1SJVA 4AC2A 2XTSA 1TNNA 3IJSB 4MZRA 3H53A 4IGBB 4RMVA 4OQTA 1T2QL 3TJEH 3V9CA 4ATWA 5AAMC 5IB4A 3H9HA 2D7NA 1M57B 5KVEE 1RK0A 2X9XA 2BNUB 2IDCA 5IG7B 2R2EB 3QIUC 3IXAB 1IE4A 3RTQB 1CLOL 2RGSA 1F4YH 4FZEL 1KEGH 2XETA 1M7IB 1Q72L 4LPXA 2QT6A 3GSUB 4K2UH 1JV5B 4NDMA 4ANUA 5T33H 4A6YH 3LKRA 5IV2A 4DERA 1KB5H 1CDGA 4IBLT 2FD6H 4MQTB 1MN4A 3MFFA 1TJMA 2H0JA 1ES0A 1MCCA 3NCFB 4XMZA 4Y9CA 2KQNA 4UIKH 2VIRB 3BO8A 3U30C 4B27A 4F8LA 1P5UA 1N2RA 4YSOA 2Y1ZA 5TF1H 3TT1H 3SEPA 4X7DC 4BUGA 1D6EA 3EJCA 2JCCA 3QQ4B 3P11H 4DK6A 1C7TA 2WUBH 4HWUA 1TWGA 1KXTB 3RWIB 1E18A 1JBJA 1MHHB 2DQJL 4Q74A 5JQ6H 2ZD0A 4BV1A 1P6AB 2LU3A 3U9PH 1CL7H 3D18B 1IM9A 3FSAA 4F8OA 3O9WA 2Z9TA 2OL3A 2JK5A 3IVKA 4YEEA 2D2OA 2APFA 1E3FA 4TL5A 1T6BX 1ZPUA 3SDDC 5FYLH 2YA2A 4KZ0A 2J44A 3V0EA 2NY6B 1UXSB 1E5AA 5L0QC 3QUXA 2A3TA 2RJMA 5FDWB 4E9QA 1KLFA 2JKTM 5E51A 3B7SA 4WI5A 4RISH 4RV0A 2VE6A 2FL5A 1NLDH 2DJUA 5FYLE 2NX5D 3VFGH 4S1DD 4X6CA 4GW1B 4JQIA 4C4BA 1ZT4A 1IC1A 4HOXA 3JV6B 4A63A 5GS1A 3BXNB 2VYRE 3EBHA 2MCG1 4Y2DD 3RY6C 4GA5A 2NLJA 2J8OA 4OCMC 3GKZA 5BO1H 1U8QB 4FJZA 1U3NA 2HG0A 3NZHL 2XPGB 3WNJA 4OZFA 3WMSA 2NXZB 1QFPA 3BE1L 5I8KH 4OZIE 4UM9A 2IFGA 5IMMB 3RUGE 1BZOA 3G08B 3QDGE 3VWJA 4N85A 3MV7E 4PCSA 1XSJA 4PQXA 4S1RH 5DJ6A 1OK0A 2YD1A 3A4FA 3LN5B 2X42A 3GTTA 3QFGA 2DYRB 3C8DA 1RZFL 3FOMA 1E5CA 1JD9A 1GL4B 1PQZA 4Y4FD 4PI2A 5EZLA 3RX9A 3LH8A 4MNGE 1I4FA 4UINL 4YDVA 4ZOAA 1GHFH 1ZWIA 1D9KC 5ICXA 1EAJA 1NL0L 4HWEL 4R4NC 4KHXH 3TM7B 1V7ML 3I75A 3EHBC 4ZTEA 2WMPA 4CMHB 1QSFD 5A7EA 1ODAA 3UP1A 4ZAKC 4UDTA 4JG1H 3CFKB 3GSNA 2B1HH 3QXDB 5F7HA 1ILUA 4N6RA 3LPGA 2BOCA 1ZSDB 2HTKD 4G6FB 4F3FA 4Z7VA 1HESA 3ILQD 2JKNA 1I7TA 5IMOB 1H8NA 1MFEL 4NPYB 3HG1B 4TSCH 4RWYL 1EEYB 4UDUA 5BQ7B 1C08B 5F3BB 2YPKB 4XMKL 2CBQA 4H5SB 1Z2KA 2IALA 5D1XB 4XCFL 25C8H 1FNFA 2AJSH 4X7CC 3HHRB 2X6UA 3JWNG 4UINH 1X7QB 1RV6X 5KOMC 1KPRB 3VQ1C 4LSPH 3IPFA 5EDSA 1KWKA 1HHKB 3SBWC 4QRSB 4B6ZA 2AJZB 3TN0D 5IB1B 5DFAA 3OWRA 4PJXA 3DGCR 2YD2A 1AGDB 5CCHE 4YHML 1G9NH 1I8LA 1OAQH 3FBKA 3OG4B 4A1RA 4CN4A 4BFIA 5LUMA 1CN4A 1X4YA 3EDEA 2WTRB 5D5ME 1EZSA 3VFVB 4PJIA 4AQOA 3CZLA 3L2NA 1TEYA 3LH2H 4DGVH 5F7EL 5HVFB 5FB8B 2ERJB 2Y22A 1WE5A 4ENGA 4GAAA 3RNKA 3P4MB 3Q48A 4KKLD 4PJFA 2IOIA 4LOUD 3ZMRA 3BSGA 4PRIE 2WLZA 3BVTA 5F88A 1K4CA 1Y18B 3PABA</