4FG2A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with cellotetraose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 53
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg2A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg2A02
5GLXA 5H4UA 3X2MA 5GLYA 4ENGA 4FG2A 3CZBA 4FG4A 1L8FA 4JCWA 4FERA 3SUJA 4JP7A 3SUKA 3SUMA 1BMWA 3X2HA 3X2LA 2KQAA 3X2OA 2VXQA 1HD5A 2HCZX 4JS7A 2GAEA 4AVRA 2ENGA 3FT9A 1BW4A 2BH0A 1WHOA 3SULA 1N10A 2JNZA 5GM9A 3X2IA 1OA7A 3FT1A 2G5DA 1OA9A 3X2GA 4ZM7A 2AE0X 4JP6A 2PI8A 2G6GA 3ENGA 3M3GA 3X2KA 2PJJA 4FFTA 4JJOA 1BW3A 3X2PA 2PICA 2PNWA 3D30A 3X2JA 4L48A 3X2NA 1WHPA 1WC2A
chains in the Genus database with same CATH superfamily
1MIEH 2VXUL 3RVUC 2DLIA 1Q9LB 4U1NA 4HKXB 3NIGF 1HH6B 1Q9OB 4UQ2A 3ARBB 5TDOB 1C7TA 3QUZC 4WW1A 4KJYB 1UWGL 5DO2C 4DN3H 3GMOA 3PHQB 4HZLB 1NM9A 1VFAA 2LTQC 1XGQB 2JCCE 3Q06A 4NS0A 2P28B 1Q0YL 1TJIL 3CZKA 3CV5A 5FXCH 4XX1G 2X5PA 1CIDA 5L9DH 3VSTA 2O26U 4NO3B 4HLEA 2DLFL 1QRND 4OGZA 5F9JA 2Q7AA 1GTNA 5B6CA 2PTTB 1OPOA 3EF4A 4TXVB 5I8EB 5LGKA 3JT2A 1AKPA 3SYPA 4POYA 3EO9H 5C2BH 5GISL 2LT9A 3OGCB 3P9WB 3OJ2C 3ZRSA 1DBML 4ZO7A 1YNTA 2C26A 3FH8A 3MV9E 3DX8B 2ZSVB 2VOTA 1EBPA 3AXLA 4TNFA 4MA3A 3NJGA 4K7PX 3MZTA 3QUXC 3ZX1A 1BAGA 3PPEA 3FO2A 3HN8A 3GBNH 5JW4R 1MI5A 4F15C 4ODVH 3EGSA 4TUKL 1LXMA 3QG6B 4N22A 4BFBD 4ODBD 5J13C 5JIQA 3TA3B 3P4NA 5LXGL 5HDQH 5GGRA 4ZPTB 1KN2L 2RBLA 3V0GA 1F00I 5DYFA 5ID0B 1A9EB 4W6YB 2X6UA 2VQ1A 4L4VD 4LCIH 4WEMB 1ZVHA 5IUSA 2WZAA 3REVB 1MAJA 4LDLB 5KN5B 4YHIB 4I3SH 4M43L 2J1KA 4LHQB 5KBDA 2XIIA 2M83A 4XBPA 5KSAC 2FJSA 1C5DA 2BVQB 1E3FA 2AQPA 4X7TA 4LSVL 2BM3A 1ZE3C 2VLMD 4LVNC 4M4RA 2OZ4H 3MJ9L 2WNKA 1A2YB 1BAWA 4GQZA 4NGHL 5E2VL 1I7ZA 1BXXA 1NAMH 1ORSA 4P5TA 3VE0A 3TIWA 1P84J 2NY0D 4KOBA 4FXLA 3T3PB 3ZZ1A 3D0LB 1OWRM 1BIHA 1LEGA 3K6NA 3B6SB 2BWIA 2QEJA 1KULA 1F4XL 2OMUB 1JD7A 2O1AA 3DRQA 5I1DA 4UQ3B 1UUNA 1TTBA 2APBA 4JMNA 2F5BL 2KC0A 5T3ZH 1G43A 4BSJA 1S9YB 1WTGT 4ILDA 1XZ0B 2X6VA 2CLVA 2WINA 1PQHA 1IAIH 4J12A 5C8JB 3HE6B 4PV1C 2K4AA 4YAQB 3PGFH 3GXFA 4UF7C 2IH1A 4LCCA 1YNTF 2EEFA 5E8DL 1S78C 4AE1A 4JREB 1BXUA 1UWXH 5C3IA 1J48A 4G5ZL 1EEZA 1MH5B 2NY6D 3HNSH 4LIQL 3VRJA 1AD0A 3PGDB 1AR2A 3VFUA 4TUJB 5EEWA 3GMPB 2DN7A 4QOKD 3RVXD 2F74B 4LAQL 5BRZB 4ISVB 1PG7H 4OD1H 2AJ3B 3U82B 2BY2A 4L37A 4PV8A 4DP1X 3DETD 4WHYH 5TE6L 2GIMA 3JVFC 3D5OF 5T1KD 4K2UH 4Q9QL 1RIUL 3ZL4L 1TQSA 5DHYA 1CE1L 4F9LA 3CSFA 2ODHA 1ZV2A 2WO3B 1E5CA 1MF2L 1Q9WA 4N2FA 4G6ML 1KTLA 4O4YL 5B21A 1VESA 2L8AA 2CLRB 4F9PA 2ADFH 3LKQA 3NCWA 5T1JA 2YD5A 3PS6A 3TIDB 2EDHA 4WJ5B 4ADIA 2AAVA 2EAEA 2QTVA 4TSCH 1OCZB 1MJ8H 3MRJB 5IROC 5I5JA 1HE7A 3D18B 1BF2A 4QXUH 5ADPH 4N90D 5D1XB 1MCEA 5DLML 3WS3A 1NMCB 5D70L 1I8LA 1J9TA 4GO8A 2NY2B 4ATWA 4DGYH 2EIKB 3C6SB 3P9MA 1BQ5A 2VT0A 1D5BA 1ONQA 2PXYD 3W0WB 2PLTA 4PJIF 1ACYH 2FWOB 3K5RA 1OHZA 1AQKL 2F18A 5FDWB 3NTCL 4X8XA 2JSFA 4JMXA 3FRUB 4NWTH 3QCUL 4NBYB 1CMOA 3BJLA 4AQAA 3VNYA 4AVIA 3KBHE 3ZYJA 3V5DB 5F3BA 5T3XE 4KUCF 1SLVA 5F89B 4G8AC 3S2CA 3D51A 4M1GL 4U1IB 5FYJD 1M71A 1MNUH 2MPAH 3VFSB 1ZHLA 4WSKA 2R1XB 4JRXB 4WW2F 2WXLA 4RZCA 5HGBA 3RNKB 4RCAA 2LHAA 2OXGA 4AKPA 2WPGA 4AZUA 1MZYA 4NKIH 4BH8A 1GC1H 1T80A 3GXDA 2DWEB 4ODXB 4NQCD 1TZAA 3BDBA 4Y4KD 1DN0A 1CQYA 4G9FB 3UJIH 3BPCA 4R83A 4BFRA 2VDMH 2IF7A 1ZPLA 3QFGA 4V11A 2AEOA 2VLRA 2NSMA 1KCSL 4YDJB 1IL1A 4KH2A 1K4CA 1T22A 4RMWA 3GINA 4JFOA 1TZIA 5KVFE 5CN1A 3I75B 1AIZA 2KLRA 3RIFK 1KNOB 3KYNA 5H4YA 3SGEH 3ML1A 1F1DA 5GGVH 1NEZA 3PREA 3GKWL 4PBVC 1UA7A 4JQXC 3A6CL 1S7UB 4NO2B 4N68A 5KBNC 3HE7C 5DMJB 1W72A 3B2DC 3ULVH 4P2QA 1GY2A 4NM4H 1JVOA 3KPSE 5FW8A 4U1HB 4PJFB 2OTUB 2V2XB 1H5NA 1E32A 2V17L 3QYCA 4JRYD 2D31B 3D09A 3RA7H 4FLQA 3CPLA 5DWPA 4QRUB 2RCSL 3ULSB 1CR5A 3QQ3B 2C3HA 2VZVA 2XN0A 3HB3D 4PGCB 4ZX4A 1RZKH 3HUJB 4L2LA 4F7PB 2VW7A 3L3GB 1QYGL 3HU2A 5AAMC 3N43B 2QQKL 4EZJA 2F6AA 1HL5A 4K7PY 2CU9A 4IQHA 3KMDA 4DVRH 1YPZA 3KM1A 2ZOKA 3EFFB 1ILUA 3X11A 4OLZH 2J8OA 2FEEI 3WIHA 2A73A 4A7GF 3ELAT 3G5YA 1HHKA 2I07B 2ZE0A 3EBIA 4JFUA 4G6FB 3UPCA 3RTQC 4HOMA 3U9PL 4XMPH 4AVKA 5A7EA 1MCPH 4NFCA 5FK9A 5HYJD 2BE5D 1ESOA 5EO9A 4MXQD 5C2UB 1EFXD 2QBWA 1KBKA 1E7VA 1SJMA 2ICWB 3OR6A 4GRWE 1I7TA 5TTRA 4RMBA 1CL7I 5I1AB 4H8WC 2WQ8A 3CHOA 1BQKA 35C8L 3PUUA 4GH7B 4HCFA 3QNZB 5HHVL 1KB3A 4UV7L 2WP3T 2DWDA 1UWYA 1F1AA 2FX9L 1I1AC 2GUOA 3LHPL 4E5XA 5JOFB 2AKRB 4UIKH 3FSVA 4J1UA 2IDTA 3S4SB 5D2LA 2BFVL 4XZUB 3HU1A 5JIMA 1CICD 5A16A 1TWHA 1VEMA 4X7EC 3KWTA 3LHAA 4HWZA 1FH2A 2KUTA 2KZBA 3ARGD 4U2ZA 5IR1A 1T7WA 2YQBA 4E9YA 1SN5A 5CD3A 1BEYL 2XN2A 3OKMA 3OXSB 4OBSA 1T04A 5EWIL 1BWWA 1SN0A 2XJKA 2AEWA 3ATBA 2FQEA 1JDAA 4EAEA 4RNRB 3UC0H 3PAYA 5GRJH 3AS3A 3S3JA 2KPNA 1ZLWH 5D2NA 4EO5A 4NQEB 4FQCH 2E5EA 3IJ9A 1BQHB 1GS6X 3SKNA 1JK9B 1G9EA 2Z4TA 3B9AA 1KXTA 5C3LD 1NFAA 5DJ0B 4CMMB 2QLVB 1UD3A 2B3IA 3WHE1 3L13A 4L8BA 2F5AL 3HHSA 3OGOE 2IWFA 3KPPA 1KB5A 3APNA 4Q9CA 5BZDB 4GIAA 3JWNG 4EMZA 2HTKC 1XR9A 3SDCD 4QAMB 3CVCA 1U36A 4KGJA 1YPZF 3WELA 3AGVA 3ULUC 1PIFA 4EIGB 1SNRA 2CK0L 2DEYX 1OAYL 5E6RB 1BVLB 1UB6B 5I6NA 1IEBB 5FECA 5AKSA 1UADC 2XDHA 4Z95L 3O2DA 5I23A 1JXGA 3KLHC 1YAIA 3BGAA 2DQTL 2HKFH 4A7TA 1GTFA 5I18H 2DQEH 1IM3B 1BSIA 3QEUB 1FFOA 1WCBB 1KACB 3H8NA 1AGCB 1KTDB 4WWOA 3SBQA 5IB3B 1R3KB 1HSBB 1MLBA 4X4KA 3MI6A 3P0VH 3P4MB 4OKVB 5DI8B 3B2UC 3G08A 4FNQA 1FRGH 1TFHA 2VDMB 3LZLA 4HG4K 1AXSB 1DANT 4O5LH 4P4RB 3DVNA 2OMWB 1KLFA 1IQWH 3CFTA 2PYED 4Y4HB 4N24A 5DRNA 5T5FA 3E9TA 3ZE1E 2RFXA 5IFJB 3OB8A 1YNKL 2GFBA 2DDQH 4F2FA 4V1DD 5IQNA 2CO6A 3UBFA 5JMRA 4X5XB 1LGVA 1DVYA 5SWSE 2ARWA 5CEZH 3UCRA 4TSAL 4PWGA 1RK1B 3ME0A 3O3UN 3M1OA 5IGXL 1MHEA 2PWHA 3QI9B 4JFYA 1I9IL 4XVUD 3QG7H 3VA2C 3N9GL 1FUNA 4EI5A 4BSVB 2QSCL 3ARDA 1VPOL 4XTRC 1OP5H 4Q9RH 4GUCA 4XO5A 1H5BB 2IQ9H 1XF1A 5JA8B 1KCLA 4LASH 4JZOB 1QABA 1PX8A 2NXZC 1YQ2A 3V6ZA 3BSGA 2CJUH 5DD0H 1N67A 2D7QA 4JR9H 5C0GB 1N18A 2ZYRA 3CDCA 4PCSA 2Z91A 2CSPA 1V3JA 2W8CA 4G80A 1JGIA 3GS7A 1CXLA 4HIHA 3WNPA 2ATPA 1L3WA 1G7QA 4P5MA 2MQ0A 1U9KA 5T5NF 2RR3A 4AL8H 1ZGLB 2VN5A 2OQJA 4L0PB 3MROB 4GRMB 4GG6E 1DFBH 3CDFA 2AEQL 3HNVH 4PVBA 4KMTL 3KXFE 4P46D 3NSYA 1VGKB 4MVBD 4HPHA 4TVSa 4YIQB 1RJYB 1G4MA 2W88A 3BLBA 5I0YA 1IBDA 4K5OA 5J1TC 2B1OA 1XCQB 2MOGA 1HXKA 3U46B 1XVSA 1O9WA 1KLUB 4KY1H 4NN5C 1J5OH 2UVEA 2BP5M 1YEEL 1KGJA 1MWAL 1NMBH 2NPLX 2WBJD 2VWEE 3TYFB 4KX8A 3AU1A 3SDAA 3LAFA 5TE4L 1L9PA 2WMPA 3TZVC 3HRZA 1NGPL 4JHZA 1J0YA 1E9PB 4JP6A 1XGUA 3D25B 3CU1A 1A3LL 2A74B 5IP4A 1OAKL 1A6VL 3V4PB 1E18A 1CGSL 5E24E 3GSVA 2Z7WA 2XTLA 2GTZA 3U6RB 3L4TA 4ZS7L 1RY7B 1EAOA 1F3DJ 4OF8A 3VB9A 4U1KB 1KIQB 3A4EA 3A67H 5JPMA 2Y23A 5DVOA 2CQVA 1KENL 5IVXA 3RX9A 5HJ3A 3BEVB 4JEGB 3QULA 3RUGE 5CBEB 3CXDH 3M17A 4AWJC 3WIHL 3QUYA 4OUUB 4NKOA 2Q3AA 5FUZL 2WZPA 3P3YA 4IHOA 1KELH 1KXVC 2M8XA 3ZZLA 2UZIL 2SEBB 5D7IA 1QA9B 1WC7B 1ZKAA 2YQ3A 3ML9A 4GP5B 4YHMH 3Q13A 2BW4A 2GSIB 2W9DL 1MWOA 3GI9H 3BMWA 2O72A 4HSQA 2DM2A 2WKGA 4QRRB 4PJAB 2VDPL 3X2MA 2B77A 4PVNA 2EEDA 2WWMC 2IDCA 2G3XA 1JP5A 1ZOXA 1BF5A 1KCUH 5GSRB 2FWSA 2X6AA 2ZZUT 3O6ML 3F12B 5DEFA 2OW6A 1AE6H 5EIQA 5EOTA 3D39D 5KSUA 2BDNL 1F11A 5D1QB 2HPOA 3ASOB 3WFDL 4OLUH 4MGXA 3TVMC 5DYIA 3IAQA 3O8XB 2FATL 5B4MC 1DCLA 4L8SC 1JF6A 4AENA 4EXKA 5DT1L 4BELD 1YNJD 3EDKA 3L4UA 1VKXB 4HJJH 3UO1H 4PGEA 3CFEB 4ZMNA 1OGAD 2Y5QA 1G1YA 2CRMA 4M03A 1LL1A 4J3VA 4ZUTA 4E41E 1PAZA 2AXFA 3KM2A 2NZ1A 4OLXL 1XH0A 1OCCB 3LXCA 2ZF8A 1JNJA 2BRRH 1G0XA 2JKRM 1NBYB 3EJTA 3QPXH 4K8RD 1KFAH 2AQTA 4MDJA 4NPJA 3T4YA 4ES8A 3IFNL 5ABDE 4GLRH 4I4WB 2DWSA 4PS3A 1HZHH 2OR9L 4B27A 5I2IB 1CF1A 4QRPD 5G4MA 3DJ9A 5AKTA 2YAEA 3INUH 3ARRA 3ROLA 4OJFH 3L3DA 4FHBD 4LKCA 5IVXF 1M2OA 1SFDA 1SLXA 5T3XL 4C54A 1BZEA 4C4BA 4QDGA 1SYVB 1RVFL 1DLHB 1HXMA 3QB7C 2DM3A 2ZJSH 4KK5D 3IJSB 2A83B 3SUMA 2VQUA 2UY7B 5BV7H 1KY7A 2A3TA 2EIDA 1E3ZA 2UYLB 1DVFB 2NNAB 3NP3A 3O2DL 5H8DA 5ADOL 1CBVH 4DK5A 2VXTH 3MNVA 3ZHKA 4MJIE 3VACA 4UTBH 3QZPA 5LGHL 1YEJL 4WIQA 1J5CA 4XC1H 4HULB 4X98A 2ROXA 4B9PA 2G9HB 1A6AB 5C0CA 4N2NA 5FEBA 1GW6A 1P7KB 3WAKA 4CC0A 1WWBX 1XAKA 1H15B 1OSEA 2VDRL 1I1CA 3I9IA 4OB5L 4GG6A 2BERA 3C8KB 3NABL 5KYUA 2C7UA 1QP1A 2IANB 4ZRGA 1KC5L 3X3FH 5KVFL 2EDBA 1QFOA 4QT5B 1BYNA 4M29A 4EEEA 2C3WA 2EE2A 4KRPB 5F6IB 3KD4A 4AQEB 3CQPA 1YMME 1PZ3A 3L9BA 4RMTA 2VITB 1S9XA 4M62L 3SQBA 1MUJB 1QMUA 2H6PA 2EADA 1ZLSH 1NFDB 3BIKA 2VCOA 1YYLL 4JFDB 1Z1WA 3X1NA 3GUFA 4MHHI 2NW2B 3QZMA 1ED3A 4M5YH 3H9SE 3WSQL 2MH4A 3FAXA 3TN0B 5I74B 4MMZA 4YL9A 4LDOB 1OTSC 1SDDA 2YZ8A 5KJ4A 1AG6A 4LLMB 2XHNA 1WFOA 1JZEA 4B9YA 1HXYA 4GSRA 4HKJA 3BH9B 1HOCB 4IDJH 5AYQA 4HLJA 5I76A 1W80A 5KAQG 5ISZD 1P7BA 2NLJA 3MO1B 2XY1A 1BREA 3MVSA 3ZHFA 3FQTB 4UQCA 4YH6A 3WN5A 2MNJB 4WFFD 1BOGB 3A4FA 4NQTA 1JPSL 3RUGA 3ZR6A 2AGJH 2QQQA 3JQOB 4R0LB 2IGFL 3IMVA 4UDTA 2ORBH 5GIRB 4XHJD 2MCPL 4DF9A 3BP4B 1N5YL 4AKOA 3CH8A 2KERA 1K5NB 4P3DB 1FL3A 1LP9B 5F9OH 3TPUB 4TOYH 3K2MC 2KI8A 2WK2A 4M5ZL 4Z7QF 4B7LA 3RWEB 1QSVA 3E80A 3QQ9D 5GZOD 1LEKB 4DP8X 4QOKA 2IALB 1DMSA 2FLRT 4K3DH 5TGBA 3GMMA 5HGAB 4P2OB 5IBTL 3GI8H 1U8QB 2GAZA 4HSCX 1DUZA 2NY4B 2X1XR 4KK8D 1J87A 3QUXD 4E9XA 3FOLA 1QQDA 1ET5A 2D0GA 2AK4E 1Q16A 4J4PA 4YGVA 4EBQH 1KT2A 2G5BA 4TMPA 1XH3A 2YA1A 4AZ8A 3L3HB 5AVWB 1CR9H 3X3GH 1OLLA 1RULH 4ONFL 5HYQA 3KLKA 4E68A 4WHTA 4GSXA 3ZDZF 3Q8CA 3WD5L 4LRIC 3WJLA 1MFUA 3VD2A 5F1IA 4W9HC 2YGNA 5E8PB 1TJHL 1LHZA 1PZAA 4LLUA 4Z3GA 1DQKA 3MNZA 1HQ4B 3FFOA 4GAGH 3DX0A 5I9QB 1D5XA 1IBGL 5KJRH 2D4DA 3ECWA 4M02A 4Y8AA 3UX9B 2NTFA 1WT5A 2D7TH 3OJDA 4LMQE 5JNYB 4IOIB 1B0GA 4QD2E 4HHAA 4YE4H 1A9VA 2B4CL 4Z3TA 2DTSA 3BXNB 1U92B 2PXYA 3ARXA 3C5SA 5IEHB 3BPOC 2CRIA 4N2DA 5CS7A 3K0YA 2E6QA 3IMTA 3U0WH 2X1QA 4H7VA 1SBSL 5ANME 3E6FA 3HC2A 2D9QB 4H0IA 3ARZA 3AITA 5TH2A 3ARFC 3UPRB 2OZNA 2XTJC 3LEVH 2EDFA 3GK8H 3NSFA 1U4EA 4KVCH 4AEEA 1X7QA 3CN1A 4Z7OE 1I3RB 4LL4A 3ZDWA 1OWWA 4JY4B 4CKVX 5EU3B 3DTUB 2H26B 4ABQA 4MNGA 2JFCA 3DURA 4CC4A 2NY5H 2NNRA 1O7SA 4Z8FL 2AK1H 4NUGL 1A0QH 1SXZA 5F2FA 3OKKB 4NQCA 4Y4KA 4ALAL 4OZFA 4PCTA 4PYHA 1EHLH 2FO4B 3FRPB 3QXVA 4HJGB 4H0HB 2ICWJ 4AOKB 3Q8BA 4QYOB 4ICXA 1IIIA 2R83A 2ESVB 5J4MA 2CNZA 4IRJA 5J7CC 1JYVA 1UJTA 3GMNA 1LD9A 4JPKH 1FFPB 4LK4A 2VLJB 3BLKA 1XO8A 1YMMA 1U8LB 5FGCB 2H5UA 1H5BC 3L5XL 4OF7A 2WVVA 4HEPG 5GGRY 1NKOA 1XGYH 3DBXB 4G8GA 2XVKA 4JO1H 4NZTH 5EN2B 1TWAA 1X4ZA 4CA4A 2NY7L 4EKXA 4ODUB 2EDEA 5FWQA 2P49B 4AIZB 2WSKA 5EOCH 4JQVC 4ZMPA 1NL0H 3CXHK 5BXFB 4H1LA 3MBEB 5HVGB 5K9KB 1Z66A 2PETA 2VDQL 9CGTA 2Y22A 1OAQL 4MMYA 2KZKA 4LNRB 4D9LH 1T1XB 2JJUA 1WAAF 3S2AA 2BVUA 1TDQA 2CDEA 3WJMA 4X99A 1LO3H 1QPPA 2QKIA 3Q6GH 4JFWA 4LL9A 4S1RL 4TPRL 3U83A 2AEPH 1I3GL 3IDMB 4IRSA 3X12B 4UTCA 4BYHA 3CPUA 2XZCL 1UFGA 4OTXH 1HYSC 5SV4A 1BD2B 4DVBA 5GPRA 2ID5A 3BH8A 4K9EH 5CJOH 3VG0L 4ACPA 4Y88A 3MZGB 2H45A 5HYJA 2EE6A 4GRLC 2O5JD 3SOBL 1KTRL 5FKPA 2DIJA 4G59C 5LAXA 4KRLB 3C2AL 1EFXA 4KZEH 2AK4A 5FA4A 2WTRA 3MCLH 2WLIB 3CVIH 2WNGA 3P9LA 3Q5OA 4CVZB 5HPMB 2BNQD 1P6WA 2FL5A 3OHXA 1NGZB 4F8TA 3FTWA 1GY1A 4N4YB 5CZRA 2Y36H 4WV1C 5AAWC 3LSOA 1ZMYA 4FMVA 2HH0H 2VLLA 4JFVA 5EZPA 3AGWA 3UACA 1DLFH 2VZUA 4RQQA 3PV7A 4JO2L 3WLBA 4YHYC 2XKNA 5DC2A 3LPFA 4FL4B 1UACH 4M6MH 3K6SA 5MERA 1MEXL 3ARGA 2FLBT 2G4EA 1UM4L 2DYRB 4IHBA 5LBSA 3S5YA 4DW2L 3WUWA 3U0PB 4PRHB 2H7WA 5GS2D 1YYML 2J25A 1AR1C 2DQMA 2X41A 3EYFA 4GA6A 2VJXA 3COOA 1AFVH 5SWZB 3BPLC 5EPPA 4M7KL 4ZYKB 2CALA 3HZMB 4XO4A 5HYSA 2OJEB 5AVZB 3B7TA 4RAVA 3FB8A 3O5AA 1O0VA 1YLEA 4KHXL 1S8DB 4XXWC 5C0BB 5CEYB 4YWGL 3OKNA 4A39A 4K55A 2DQGL 4O02A 5BQDA 4EN2A 1W6LA 4M48H 1LILA 1FLRL 4L05A 2JIRA 2ZONA 2KMWA 4XPTL 5ANMA 2DQJH 1T20A 2C3VA 1KJ2A 1QSEB 2KQNA 3SDCA 3G5XA 3KR3H 2WJ7A 2P1YA 1Q9KA 2WJ5A 3KCPB 4PTTB 3PP3H 2LLNA 3VXQA 1Z3GL 3KYOA 3T1FB 1HH9A 3R19A 5E2WH 3OXRA 5F7NC 1I9EA 1JYNA 1D7DA 1GJUA 2DMGA 2VXVH 1HHHA 2W1NA 1V5JA 1FC1A 1AGBA 2L0DA 1FCCA 1TTRA 2Y1ZA 4MJJA 1HKLH 2IVFC 5LBGA 5EZOL 1V3MA 4PJ7A 3B37A 4JM2B 3REWA 3NZ8A 4KI5E 3EOAB 2R2EB 3MRCB 4RX4D 1IV8A 2DI9A 1SOKA 4FQ1H 5PAZA 1F13A 1B3JA 2WVUA 4TSBH 3L4ZA 1F8TL 4N0FA 2OFQA 3BFQG 2FH6A 2PKDA 3MTXA 4PSRA 4RFNB 1R75A 2OA9A 1NPUA 5J11B 4G7SB 3BRFA 5EA0L 4NHCH 3MRRB 3UYOD 5I71B 2NX5E 3VXUE 1T89A 3EO0A 2EXWD 3R06B 4WO0A 1QR4A 3QVAA 5L88H 5JQ6H 1T5XB 1G7MB 1T66C 4V1DA 4HUWB 4UIMB 1DVFC 3QXAB 4K7PH 3OJMB 4GW4A 4XP4L 3QRBA 3OBAA 5HTSA 1NH6A 4WU7A 5F96H 3TIEB 1NCCL 1D6EA 4MTMA 3BMVA 3V52L 1YN7B 2OPCA 2UUDK 4XI5C 1EGJL 2KLSA 1S7XB 5I8OL 3OMIB 5AW2B 3S88L 4MAYA 2FSEA 3N1QC 2EEAA 3NIDB 4DZBB 1YEIL 2PCXA 1RZGA 2D7MA 5GS0H 4L0ZA 3BGFB 3B3IB 4QJ3B 3NFPA 4OLVL 4ELMB 5A2IH 5I1KH 2R0ZH 4OCSH 4LU5L 3WJJC 4KOCA 1ITCA 3DI2B 1TU2B 4WTZG 5K39B 5LNEA 1GZQA 25C8L 2JQMA 4G8EB 4E42A 5H4UA 3EXJA 3D9AL 2HG5A 1S7RB 2NNCA 2LU5A 3HA0A 5AW3B 3L7EA 3NZHH 1A02N 2YPLD 4JP7A 3IBEA 4GFTB 2GIXA 5GGTL 4EVNB 5DTFA 3JBG7 4AQ8C 3CTTA 3FNKA 3O81A 4QY8A 3JWNC 1ZSDA 4P46A 3TONA 3OF6D 4PGDB 3ARBD 1UKTA 3ULUD 1G9NC 1VFUA 4QHLA 2PO6C 4PJ7F 3JTBA 2BWDA 4H26A 4NC1E 2R1WA 3B2PA 3Q3GA 3EYOB 3DWTA 3FQNA 4MX7A 1N64H 5DJDA 3BZEB 2H0EA 2WUCH 4FCHA 4GB9A 5DQJB 3SBPA 3HBPA 3KJ6L 3PJSA 4X7CC 3VW3H 4RLDA 5I1EH 2CGZA 2J2ZB 4PS4L 1EJFA 4JE4B 3PF2A 1KPUA 3EH1A 5E03A 1J0HA 4NCC1 2GHWB 2NW3A 3B2UD 5CSBA 3PXLA 4XN5A 3ATDA 2H1PH 3RAJL 1II4E 1RZJL 1RPKA 2HLAA 4FG0A 1INDL 4KXAA 3TCXA 2W60B 5GGSA 4CBPA 3T2NL 3STLA 4YUEH 3CK0H 1GHFH 2AV7B 2WTPA 2WIIB 3PGCA 5GRWA 2C5DC 1CD8A 1U33A 1X5HA 1B2WH 3EUUA 5GRYA 1PEWA 2C9XA 3IWUA 2K3TA 1JPFA 4H8PA 5CBAB 4M6AA 2ZWYA 4K5MA 5CLXA 2NYYC 1J1PL 3U9WA 3V2AR 5T33L 3WNNA 4U6XB 4Z9KB 4MXVE 1PLCA 5JYLA 2XV3A 4XVSH 5C0IB 3AQZA 5IHLB 2PWFA 1BWMA 4HBCH 2ZUTA 1Q94B 1JK8B 3ZL1A 5D55A 1DEEA 3SPCA 2AVFA 3WFCH 5JHLH 3JWOL 2AI0L 2JXMB 4HF5L 2VB5A 4N1HB 5C07E 1CURA 1P7QA 3TO2A 1IVLA 1LVEA 4WKXA 2NXZD 2TRYA 4L4TE 1TOXA 2BP0A 1KGUA 4HD5A 4WLCA 1MFBH 5AKRA 2BXYA 2GY5A 1WIUA 3RDJA 2DL9A 2Y2TA 4N2IA 4BCYA 3DTXA 3QS2A 4FC3E 4H0GA 3N1FC 2HJFB 3MLXH 4NQDE 5MP6L 1AOZA 3L95B 4XO3A 1I8IA 5LBSL 1KCKA 4F24A 1IAKA 3U4EA 5JPNB 3QDME 3BDXA 1OT1A 4YHZH 5HI4D 2FIRT 3LQZA 1PW3A 1T7XA 3T0EE 3CSPA 1B0RA 4KKNA 2OP4H 2WY3B 5IMOA 4XNUH 2HVJB 3HE6D 2BLFA 2J56A 1DP0A 2IAMC 3II1A 1YJDH 5SWQA 4TLUA 5L6YH 4GG8B 1V05A 4QRPA 4JM4L 2VPWA 4OM1H 4YSTA 2JJVA 3TZVD 4XX5A 2I5YL 1KIRB 2ITDB 1KJ2L 2WXFA 4I1NB 2A6JA 4S11A 2ZWSA 2WWNA 1DJHA 2IPUK 3O41A 1PEZA 3VMNA 2YD2A 3IJHB 2R93A 4Z7UA 4FMKA 5GGQL 3IPBA 3NJVA 3SDDA 2VLKB 2TSAA 5BRZD 1OP3K 3HZYA 4LLVA 1F4YH 1AXIB 5FYLD 1OW0C 3AM8C 4JL1A 1XF2A 4JKWA 3ZPDA 4RSVA 4YDVA 1NLDL 2NYAA 1L7IH 3EHBC 3BDYH 4BA8A 3VXSB 1SQMA 1GZHA 3EO1A 5H2BB 3MA7B 2EYSB 3L3IB 3PAZA 3QJSB 5IB4B 1U58B 4WO4A 3E9UA 5L2KE 2F7RA 4KLNA 1QASA 1X4XA 2E7MA 3CSYB 2K45A 1SY6L 2YGVA 2VIRB 2GT9A 2X4SB 1IGCL 4HGKC 4PCKA 3LZQA 2J12B 1NIDA 2AJUL 3F8UB 1JNHA 2BNRE 4X5LA 3KH3A 1BW3A 1J1OH 4N86A 1YZZA 4QO1B 3ZTJH 5DQ9B 1FP5A 5D5ME 1ROCA 4FGMA 4NDMA 3RPIA 2CW0D 2PTVA 2Z4QB 1FLTX 4CVXB 2L7QA 4NQXA 1URIA 4O51A 4I1RA 5KTEH 2AW2A 2WBKA 2Z31C 4JHAH 4O58L 4PRNA 1AJ7L 4X4MA 3VFTB 4JZJB 3PHOB 5KANI 4Z3JA 4PJIE 5LUMA 3BSZL 3KLSA 3U30C 2VDLH 1QLFA 1OGSA 1UHEA 1PX4A 5D1XD 2Y25A 4R97B 1NCDL 1J0IA 4XP1H 2NY2D 4DGUA 1MFCH 5F1NB 5B4MD 3X2KA 2X87A 3QUZA 2WQSA 2YBRB 1CLYL 5EFIB 4WFGE 5A2KH 2J55A 5C09E 4BBWA 1MJUL 3FUFA 3W9DA 1AGDA 5FA3A 1IMHC 1F4AA 5GLXA 3FT4B 4R5XA 5IESL 1D9KB 2J4WL 3TCLA 1UWGH 5HHOB 2ZUSA 3P1VA 4R90L 4Y5YC 5D7EA 3U7AA 1AD9A 43CAB 1NGXB 4X0KB 1SJXA 1AZBA 3BFWA 4PP2B 4YO0A 4CSSA 2NY3B 1TJIH 1X9UA 1QBLL 2CM6A 2FT6A 1CE6A 2ADJA 4Z7UF 5F7AA 3CX2A 5BW7C 4XO8A 4FKKA 4R2GB 3S48A 2ZKHL 4Z7VE 4JPIB 3SSGA 1OL0A 4PMFA 1J1XL 5CJXC 3RJQB 4K3HA 5F9WC 3QE5A 1INQB 5GISH 3UTTE 3ZT7A 2GSGA 4XMWA 3VRLF 1X5KA 4G9FD 3FHAA 1DBMH 4G7RB 3QUXA 3U9UB 5C07A 4Z7WB 3PNRB 2R29A 5DDHB 2Y7QB 2NT1A 4GAJL 4JFFE 3EXLA 3HLKA 1DVXA 1KGCD 3HVNA 2EVHA 3DX6B 5HGHB 1K2DA 3TJPA 5BVJB 1FAKT 2QT6A 5TQ0H 1E5ZA 3F7LA 1YEHH 2I60L 5AOMA 1DDTA 4XNZB 4NQDA 3GZPA 2ZWLT 3V4LA 4H8VA 2D3JA 4KDWA 4M1DL 5F93C 1K8DB 4JANB 5KSAA 2YWYA 3GTKA 1FZMB 4LLQA 5CP3H 1R24A 1X4YA 1IBBA 1FORL 5ICXA 3ATFA 5FO2A 1MVUB 4PJBE 4FNSA 3SGDH 3MMEA 3WGUB 4EZMA 4L18A 3U0TB 4M43H 5FYKH 5I1CL 4W9CC 3EJZC 3IF1B 1GYUA 1FL5A 1N12A 4HXAL 3E0GA 1EXUB 3GBLA 1E28B 4XMXA 4NGHH 2A69D 5A6MA 3ALXA 5DHVA 4HK0A 1EMTH 4JDVA 3P30L 4MNQE 5K9QI 4PH8A 2UX6A 3QGVA 5FS5A 2X2IA 1WVZA 5SX4I 2EXSA 4PWJA 5I1LA 3ZKSD 1OTSD 4UOW0 5EU4B 3C6LB 2HT4C 5AD0B 3BKML 4G6FD 2E47A 5AOLA 4TUOB 2CCLA 1TF4A 3I74A 1JRHH 1EFQA 4YDLB 3MYZA 1CU4H 3VGGA 1N19A 1ZS8A 1BM3H 1UJ3C 3D85B 5EEYA 2XPZA 1UXWA 1AQMA 5IB5B 4JJOA 3GMLB 5C97A 4OGQC 3VD9A 3QJQB 5L2KA 2QSVA 3HS9A 4C47A 5HYIA 1IC4L 1A4KA 4NYLB 1J8HB 2Y7LA 4N0UB 2OKMA 4AE0A 1T3FA 4EDWL 1MJ7H 2FIKA 4G5ZH 3ZMNA 1JUFB 4WUUE 3MLSL 1F42A 3S35L 3KVDD 4PJEA 4Y2DB 4WWKC 1JZDC 3BP5B 3LRGA 3TC9A 2Y7SA 1DQLH 4U6TA 1JHKL 2NVYA 2VDNH 4P5RA 4LO9A 3KEDA 1Z9SB 3DXAE 5T1DL 3WXVL 3B2VL 4AI7A 2KH2B 2C3XA 5I1GH 3WTWA 4DESA 2Y5TB 3EYUL 3BKYH 4W9GC 3BD4A 5C18A 2QJDA 4KNUA 4PJDA 4FP8L 1WGVA 2X9WA 3WEBA 4PJCB 3THMH 2VDLB 1O7DC 3MRFA 4NQED 4WI4A 4AGQA 1WA0X 3RFZB 2FBOJ 3GRWH 3CZGA 1U91A 2YEZA 1JMXA 2WNXA 1EEYA 1XL6A 2CO7A 3A0OA 5DHMC 5EV7A 4CVWA 4ZAKC 4F7TA 3T3MF 4LCUA 1UD5A 3F62A 4PP1D 3WTUA 5C09A 2E7LC 4FS0A 3C9NA 4O4YH 4P2YA 3NN8A 3FUDA 3WE6B 5JR1H 5IROA 1O75A 1IB5A 1QOKA 1UUSA 4OIAA 4P06A 2E4TA 4UU9A 2EDWA 4MFHA 1KGXA 2F54B 4ONHB 1RJZA 5FB8B 4FFZH 3JYBA 1FZJA 1OB0A 3E2HC 5FM8A 2JH2A 3QQNA 2ED9A 4YFLI 1N6QL 1L6PA 1QVOA 1QBBA 1FDLL 5D70H 3GTLA 2AJXL 4Z7VA 2ZXAA 2CGRH 2O5ZL 3PJNA 3TO4C 3MREA 1IT9L 4QRSB 2E7CA 4CGTA 1TEFA 5J1SC 2D8KA 4MCZB 2ZIDA 1E2ZA 1I82A 1Y18B 4KRMB 4NOFA 3UTTA 1NWOA 1T6BX 3TT1H 3RI5F 2Q76B 4IBVA 4ZMVA 5IQ9B 2VL5B 2G5RA 4NN6B 3QCUH 2AJVL 4Y1AE 3VM5A 3A6BL 2ZUVA 3O11B 5EU6B 3JTSA 2WP3O 2ZOUA 2GITA 3NZSA 4J5VA 2AQQA 4Y4HD 4GBXC 4F8OA 4XXDB 4ORGB 4N0YH 4G3YH 2FSDA 4POUB 2IFFL 1HWGB 2DQDH 2JWYA 5D1ZB 3GMQB 1W0WB 2V7NA 3UGUA 2Z64C 4KNQA 1ORQA 3B83A 4IK7A 4WFED 3VGBA 5A2BA 4GXVL 4HVBA 4QMEA 3ULVD 5DD6A 4PJBA 4QYAA 1FZOA 4PJDF 5CF3A 3HW7A 5D71H 3ARSA 1MREH 3ERXA 3WEOA 5BO1L 4XCFH 4EN3C 2A9ML 4WTXA 1BLNA 1QO3A 3CDYA 3ZXAC 1E4WL 1U3HB 3QRFM 2XXGA 4Z7NB 4JQXA 5K9OB 1KXHA 3D52A 4NJ9H 1OLZA 3IXAA 3HE7A 3FO9B 4JFZL 5EOCJ 5J1AA 4CUCA 1PYWA 3GKWH 5GS1C 5L0QB 1BGXL 1A9BB 3A6CH 5FOBB 2RMNA 4DFIA 4CSTA 3GDBA 3MJ7A 1IC1A 2XZAL 5FF6B 5T5MD 3KNBB 1GPOL 2YR3A 3FOMB 3KPQB 4U1JB 3TCTA 2LV4A 3VQMA 4NHUB 1L9NA 4QRQB 5CZVL 5AAMA 3QDJA 3A47A 5FHAL 5INCB 1OSYA 5TE7L 4ODTH 5E99H 1ZEAL 1YNND 3CDZB 5DJYA 4A7SA 3D7PA 3CXHJ 4XPHL 4PCYA 4RX4A 2PNDA 3BLPX 3QR2A 4IBWA 4LSUL 3O6LL 2J6WA 4K3JL 3CZEA 4WUUA 3HS8A 2YSSB 3RL2B 2DMRA 1V3LA 3FTSA 5FFLA 1HL4A 4PIRF 4LPWA 4NC2B 5KYXB 2AVGA 3FTGA 2OI9C 1A1NB 2IH8A 3U9PH 5IY5B 2EVFA 4JFXA 5D7SL 4XPBH 5J3HD 3CC1A 1MW2A 4MYWB 4GSDL 4R5VA 3VNZA 5ICYB 4BUGA 1ASPA 3H3PL 3LN4B 4HALA 5KVDH 3O0LA 1I1AA 3LKNA 4Q7DA 4KTGA 5BOJA 1GZPB 2FX7L 1WV7T 3T0AA 35C8H 3GBML 3UTZB 2BSRA 2PWGA 2VR7A 1JPEA 3DX9A 4PJ8B 4UV7H 1QFWI 1M2VA 5GRUH 1A65A 1Z5YD 2H0PA 5B8CC 4HJ1A 5BRQA 4DN4L 3U36A 4C56A 5KG9A 2FH8A 2VH5L 4KO9A 1JV5A 3EF7A 1T2XA 2P5WB 2ZOTA 2VPYA 4Y5XC 1FA4A 4TM9A 1U3ZA 1OOWA 5J6GA 5I8CA 3BWZA 4EIZC 5B3JF 2FJHB 3NCBB 1R5VB 1NSNH 2Z9TA 4Z7AA 2NY1C 2OMXB 1ECZA 5FOJA 5E0QA 2WHVA 4BJLA 1TUPA 2RQEA 2DLEA 3FL7A 4MMXB 4AX3A 2P8LA 1JGLL 1G94A 2YPLA 2E3VA 2HB0A 1H9DA 1RK0B 4R97C 2A77H 1N6VA 1QLRA 2HLFC 3QRLA 4APQB 3T1WA 1AHWC 3VFRA 4A6YL 2BSDA 2BMKA 3OF6A 4XE5B 3S0PA 3AACA 4ANXA 2PYFA 1A7NH 2XYBA 4UUJA 1F2QA 1N5AB 4HPOH 2CLZB 4NT6A 4Y1AA 2IQAA 1RUPH 2ZCKL 2Q8BL 1MAML 1U95B 1USQA 4JO8A 4HZLA 1JGVL 2PCPA 3QAZB 2R4SH 4TNVF 2QQLH 4PJHF 1P5VB 4X4YA 2YHGA 1ET8A 3CLFL 1AIFB 1ODAA 1SN2A 1L9SA 1OAYH 4NO3A 4F7CA 4MA8H 1Q1PA 1SFHA 4Z3IA 4BE6A 5D96B 4Z0XB 3CX5K 5GGUA 2N56A 4YHOL 3GGWB 3QO0B 3ABZA 3OGCA 4QIWA 4P57A 4D8OA 1TSRA 4Q6IC 2FEDC 2WWOA 4U1NB 3IMWA 4ZX6A 4UQ2B 3LEYL 5EU7C 4WW1B 5IBUG 1QG3A 2ZSVA 3GMOB 3P3SA 3TM6A 3LS4H 1ECYA 1S3KL 1VFAB 2VSCA 5GM9A 5F3HA 1ZK9A 3CMOL 4K3EH 1DVFD 3OAUL 4QJ5B 1JXDA 3QWRA 1KFGA 4Q58C 5F9JB 5IHHA 2DL2A 4ZPTA 5AUMA 2ILLA 5C0AE 1KJMA 3V0HA 3GSNL 4NOHA 1A9EA 2BVOA 4P5SA 2YN3A 1A7QH 5IGXH 1USZA 4XNZC 2V2TA 4LSPL 4PIBA 4DKFL 1YNTB 2VYRE 4O2EB 3GEFA 4KAQH 3NJLA 3C5ZC 2X4PA 3QAQA 3AXLB 4MA3B 2O5XL 2XQBL 2DBJA 4ZJ9A 3STBA 3WYRA 3FO2B 2FNWA 1E7UA 3KPLA 1L6ZA 3IAPA 5I17A 1PT1A 1MI5B 2FJFB 2H47C 5BO0D 5I6LA 4FQPA 3EGSB 4PRAA 1MQ8A 3JUZA 4UQIM 1T6VN 1UCBH 3ZDYB 1F5WA 2FD6H 1KCRH 3FQ4A 3P4NB 4QGTA 3ULUF 1FIGL 4KNTA 1WUZA 5E5UB 5LAPA 1WISA 4PRPD 4YXLL 3HVDA 5HHXL 3VU1A 2VQ1B 4JFDD 3WNJA 4W6WB 1BZ9A 5JLZA 3OLIA 4AY0A 4HCRL 5IWLC 3CWGA 2FZ3A 3TN0D 1VCAA 1C5DB 4LARH 2PO6D 4X7TB 1C5BL 2AEQH 5HJGA 4M4RB 3STZA 2A9AA 4KMTH 5KOVC 1TPXC 5C8JA 2VO5A 3RB7A 4NKQB 5DWUL 1BVOA 5D7HA 3VD4A 4YAQA 3QH3A 1I7ZB 4P5TB 1ORSB 3VE0B 2GJJA 3BC9A 5D72L 4LQ1A 4X8CA 2DQ6A 1KCVL 4TYUA 1W72H 4JHWH 3TZVA 3IT8D 4A2HA 5FYJU 1LEGB 4BUHA 1MH5A 3N85L 3ZDXE 1AGEA 4LT7A 2V7HA 2VUMA 2Y72A 4UB0L 3DRQB 5B38A 4NAJA 4JPSA 5I1DB 4EPSA 5HD8C 3WEMA 2YAHA 2DKUA 1NGPH 4W4NA 4N1CA 1VGEH 1MPAH 1DEDA 3FTYA 5LBVA 1A6VH 1FGVL 2GC7C 4OZGE 3I6KA 3LN9A 4P2OD 4ZSOA 4X6FA 4L8CA 2CLVB 2WINB 3Q1EA 3FJTA 4ZQTA 1OM3H 3LKOA 3TXAA 2VLME 5FWRA 5E00A 3QZWA 5T1LD 1EA9C 3RPBA 3ZUNC 1H8NA 4HIIA 1MOEA 2IH1B 4LCCB 3OZKA 1KENH 1FNSH 1KXVA 4DGWC 1OCWH 1EEZB 4FEMA 3WIHH 4Y9FA 1AD0B 2MMXA 3C6EA 4YSRA 5BZWB 4AAYA 1QFHA 4HS8H 5D7JC 3CNKA 2COVD 3F83A 2B59A 3OPUA 3FQ2A 3VFUB 5FLVA 1QTSA 1OA7A 1Z9OA 4F2MB 4DEPB 2ZYIA 1U8MA 3T3PF 1H6UA 3E1ZA 3W11C 3DYMA 4LVOB 4L37B 4PV8B 3MV11 3T8XB 1BV8A 3W2DL 4GKZA 2C9QA 3ML8A 2OV0A 3EOBB 3K1DA 1MKFA 2Y1VA 4D0DA 4F93B 5HI5C 2A9BA 2J5LC 3TVMA 5DHYB 3C6SA 4WY7L 3FB6B 2J8UA 2AXGA 4L8SA 1A7OL 3FFDA 4XHQA 1Q9WB 1QRKA 2FWOA 4UMGA 2KBGA 1KTLB 5F7YC 1SDYA 2FEEL 2OL3L 3LKQB 5ETUB 2GBUA 4LLWA 1R3HA 5DT1H 1V3KA 1OARL 3DSFH 1LO2H 3WEAA 4H25B 3F2LA 3HJEA 2JCCB 4NN6C 1QEWA 3MRNA 5BCAA 1KPVA 1M05A 4N2AA 1WITA 2G60H 5F0JB 5HHNB 3U1SL 1CL7L 1ZLVK 3WS3B 2Y07L 3RNKA 4UWQB 4PW9A 2ICEC 3P9MB 5CGTA 3IFNH 1A6UL 1D5BB 1ONQB 5C0AA 5CCGE 2YD0A 1J5IA 5IW1A 4ODXA 2EH7H 1HHGA 1ZVNA 2XTJE 1KB5H 2ZKYA 4NZ8A 4ZDHB 1KWKA 1Z32X 3CH1A 1WIOA 4MJ6A 2CR6A 3MV9B 3IPFA 5GGSY 4AQAB 4Y7OC 2ESVD 2VC2H 4YDJA 5F3BB 1I7UA 3EHBD 2QZ5A 2JIMA 2YLKA 1I8KB 2VLJD 3O2DH 1KNOA 1ZHLB 5AB1A 4XAKD 3POHA 4RZCB 3N5AA 1IKOP 5IIEA 4X8JA 3QJZA 4NWUH 2OXGB 4PMEA 3L1OH 1OE2A 2CBPA 5DHEA 5LGHH 4F5CE 4BH8B 1HNYA 1ZGLM 4YDIH 5L7XH 3VXOA 2W91A 4PY8I 4XMVA 3KGUA 1DN0B 3HI6L 4U1HA 2EZ0C 1MJJA 3BPCB 3GBEA 1WAAE 2CGYA 2BCMA 3OPZH 4WJG3 2VLRB 4JK0D 1IL1B 2X4OA 2J8UF 1K4CB 1ANUA 1NMAL 1L8FA 1IAII 1T22B 4I7ZC 4JFOB 4LOVA 1TZIB 5T5FH 4R26L 1SOSA 5E6IC 4MDIA 4F7PA 1BVNP 3KYNB 4KKCC 5FYJE 1NEZB 1XR8B 3PHAA 5GZND 5ACLA 3BKCL 3VSQA 3K3QA 2CDFA 2OBGA 1DBBL 2HVKA 1VZIA 4F33B 4N5UA 4P2QB 4AEHL 3DNKA 3FCSA 5E9NA 1YYLH 1F1GA 4OD2A 3GTVA 2YRLA 4XP9L 1BD2D 1Y6MR 2I07A 3CZUB 2NDFA 5C9KA 1JNNL 1URZA 3HPLA 5C9JA 4HOXA 4I1PA 3DGDA 1JZ2A 1JJUA 2FWUA 3CPLB 3HKZA 1PZ5B 2ICWI 3ELQA 2H4EA 1C08A 3IDXL 4BQBA 5CN2A 3V8CA 4X6DE 2CJ3A 3CFMA 2P8PA 1LO0H 1WBZA 1WFNA 1JPSH 3HN5A 4D0CB 3RBGA 2IGFH 4AJWA 3QIWC 1ZCRA 1YPZB 3E8UL 3KGRA 4M00A 1DFXA 2ZOKB 3MJWA 2GCYA 4TNWF 5AKVA 4HIQA 1OVZA 3X11B 3G5WA 4CAGA 2HJKA 1A47A 2A73B 4PJ8C 4WTWA 2F9BT 1KMGA 3G5YB 1HHKB 4EZLA 4DAGH 4M6NL 1XGRA 1VERA 3VI4E 4XCNA 2APSA 3PWPE 1UA6L 5FK9B 2HYMA 3QC8A 3ILPB 5DZPA 1KUMA 4Q0XL 4HS6A 1T2QH 4PRHD 5DZOA 1F3JA 3QNYA 4OM0H 1X9LA 3OR6B 1I7TB 3QO1A 2CA3A 1BPVA 4N2KA 4FQXC 4TN9A 5EPMA 1P4BL 4BK4A 5C0NC 3IWVA 4M8RA 4LRIA 4NQEA 8CGTA 3ARTA 3GXPA 2VPXA 2GUOB 4E5XB 4X0NA 5C0BD 4ZPVB 2DKSA 3O2VL 4CMMA 3DHMA 5IT2H 2ZAHA 4LCYA 4MMXC 5D2LB 3BPNB 4IMLA 4JY6A 2ZP0T 3VXRE 1TJHH 2CMRL 1TIUA 3FQUA 4WZ9A 5A16B 3N43F 4MAUL 1U8OB 4HWZB 1I8MA 1Y6KR 4UT7L 3G9AB 5IR1B 3N44B 5CD3B 5FCUL 3OKMB 5IFHL 1NCBH 4LL1A 4JGUA 4CS0A 1TTCA 2OMVB 3UG4A 1UEYA 4HBQA 5FW6A 1LDSA 1G8JA 4OUOA 4WUKL 3KBEA 3L3JA 1IGYA 1K4DA 3QWOA 4LQFH 3SKNB 4OSUL 1CFVL 1WC2A 1KXTB 1X5XA 4GAFB 2I69A 3ARFA 4JKLA 2NSXA 3DVFA 4JM2D 4U3SA 1R5WA 1RUML 4JG9A 2HT4D 4L8BB 3HHSB 4OKVA 4APXA 1KB5B 3D2UD 3S8WA 4IBQA 1XR9B 2WLLA 3S8FB 1LMKA 1YSOA 5JO5A 1D6VL 4ZMAT 4C2MA 3OQRA 1XFPA 4P4RA 4S0HA 3FYIB 4X5RA 3GTNA 1PKOA 3P3UA 3X1EA 3SYQA 1BBJA 4YS4A 5E70A 3TJHC 3TH3T 3SGEI 5IFJA 3CZJA 3AT9A 2G75A 4OVUA 1NCOA 4Y19E 1JWMA 4Q52A 4M7LL 4NUJB 3BE1H 3M86A 4RMVA 3TBTA 1AAJA 2VKXA 2KDGA 1FFOB 5E8OA 1A1OA 2F7IA 1MLBB 4PRDA 3B2XA 3HG3A 4WWKD 2ZUQC 3G08B 4XCYA 5JW3H 4LP8A 4C55A 2L3BA 5BUGA 3KLQA 5A2CA 5KUMA 3RIAK 3UXFA 4N0RA 5GHWH 4XVJL 1H5BA 1KLFB 1PG7W 4JZOA 1B0IA 4P49A 5L4FA 1WICA 6FABL 1F41A 2RFXB 2GFBB 1ZIBA 5EDXA 2CO6B 2ZXEB 5IMKA 5TD4A 5TF1L 1FDIA 4ANVA 4JQVA 2GUYA 4HJ0C 1XSIA 4NO0D 3HG4A 3R8QA 2VAAA 4RISH 4ZAKD 1MHEB 2EVIA 4K71C 4JFHD 4JFYB 2KKQA 3KPSB 3NA9L 4MA1C 1I8AA 3IFLL 1UZ6E 5H94A 4I48A 1ZGLA 4RA0C 3MROA 4GRMA 4X7FC 4EI5B 2XETA 3BQUB 3H9HA 3P73A 1FG9C 3ARDB 2FVNA 2BK8A 2R27A 4U1SB 1VGKA 4Z0BL 1CFSA 4X6DA 4ZD3H 4G6AD 4UINH 1W0YT 1IBFA 3V6ZB 3F6JA 2FB4L 1VDGA 1A7RL 1N8ZB 2XIBA 1SF5A 4KK6C 4S1RH 1FL6A 2Z91B 2E76C 3RB5A 3AROA 3TO4D 1GVIA 2XZCH 3LMJL 4HIHB 3C60C 1N68A 2ATPB 1T0PB 4GRLA 1G7QB 4P5MB 3DGGA 3JWNE 5BMFL 2ZTBA 3BESR 3WKNA 1ADQL 1E9PA 2IDFA 1DE4A 2OQJB 1SHSA 3QHFL 3VI4A 4D9QE 1JHTA 4FF9A 3V4PA 4P3CL 5LDSA 4FTVE 4CSZA 2DQFA 3CC5B 2OX5A 3SOBH 4WV1A 3V0WL 5AAWA 2P5EE 1UCTA 2JI1A 2XICA 4JBSA 3T8VA 2XACC 1HCVA 3ULVF 4GBXD 3MHZA 3IGFA 3AAZB 5CBEA 1WWWX 4AYMC 5EU5A 1CFQA 3JWDL 4WEBH 2WCSA 1EPFA 4M5TA 4DKAA 3L9YA 1MSPA 3AU1B 3SDAB 1VADA 2XQYK 4ZFFA 3TS8A 4JO2H 3HRZB 1FVCA 2PR9A 3FZUC 1XGUB 2JB6A 1NGWA 3CMGA 2EDJA 1MEXH 4MQSB 4XN9A 1G0YR 3GSVB 5C6PB 2Y2YA 4EN3D 5H4ZA 2GTZB 3TT3L 4PJAA 3FU8A 3FQWA 2Z34A 5I75C 4K23L 4TVPD 5JPMB 5AZ2L 3V9CA 5E9DE 4XXWA 3FUNA 4FQIL 1X5IA 2G2RA 5HJ3B 4LAJH 3QULB 2BIPA 4LDEB 1OAUL 3FULA 2ENJA 3CCHA 3FU6A 3GTTA 3M17B 3PWNA 3PE9A 4XO9A 4F58L 3QJOA 3QUYB 5EMYA 2BIMA 2BJMH 4NKOB 2MCG1 2UXTA 4A2DA 2DQGH 3SCMC 3AS0A 2V37A 4LSTH 2X05A 3G5VA 43C9A 5D7IB 4OZIE 4L3CA 3T2LA 1N8OE 5ACMA 1UT9A 2MNUA 2Y06L 3GRGA 3OC8A 5DZNA 3UZVA 3X17A 2ZKWA 1XDTT 2FNBA 1O6SB 1QI5A 4H1LG 4EJ1C 2JA6A 4HUNB 4KV5F 1U3NA 2XBTA 4LZKA 3GSXA 4YDNA 1X9RA 5JW5A 3ZHLA 1KJ3H 1TWFA 1NBYA 3X1FA 5D7LE 3DIFA 4WI2A 1GGBH 5F8QC 4XRCA 4XMZA 3RWDA 3MOQA 5DEFB 1BYOA 1V10A 3Q44A 4G7VL 5DJCA 3VD7A 5KSUB 1F11B 1U8HA 5EZOH 1YA5A 2IXQA 3BT2H 3UMNA 3IR7A 1AMXA 1IGMH 4XMKL 4AENB 1SIWA 1B4TA 2EDRA 2BOLA 2BSSB 2PWEA 4PGEB 3LVTA 1SYVA 3EFOB 1F8TH 4FFVC 1DLHA 5DJ2A 1T03H 1OK8A 4ZUTB 1KB9J 2VLKD 4DH2A 4PWIA 4ZMQA 5F1SA 1ZT1A 4QXWA 3FSAA 4LB8A 2NNAA 1DVFA 2OMTB 5EA0H 3LQAH 3T4YB 3VXSD 5C0JB 5L4IA 4XOAA 3MAWA 1NGYA 5DA4A 5DMKA 3IN2A 5I1JL 2B0SH 1F58H 5SWSB 4TNEA 1FYTD 5LDUA 4A1RA 4PJAF 3K8LA 4P07A 1CDGA 3FO1A 1H8OA 1NJ9A 1XIWB 3D39E 3EOYG 5DVMA 3ROLB 3V8OA 1KWGA 1IBYA 3L3DB 4NENA 1BQLH 3T0WA 1L3NA 4OFYD 4WFHE 3VH8G 3V52H 2GJZA 1HXMB 5I0XA 3NCFB 1GS7A 5FAAA 1OGAE 3Q2WA 3LRSA 4S0SD 3IB4A 4RBPH 1SQ2N 2BRQA 4WQOA 4EUPG 3WJJA 2MTAA 3CFBB 1NIAA 4DQOL 3MNVB 2NY1D 3NIFE 2A6IA 3LCYA 4PRPA 2H2SC 1NFDA 3GLZA 4AONB 5E1AA 1M3IA 4OZFH 4ENZA 5JIIA 4AQ8A 3ASNB 1E5UI 1UOLA 2HLFD 4P9HC 3UBHA 5C0CB 3GSWB 3MRBA 4HZAA 3V6BR 4S1DC 2O5YH 1JERA 1MFEL 3NCCB 2EIBA 4S1QH 4U0RB 4GG6B 5KYUB 2PO6A 4FTVA 1HEJC 4JG5A 2C7UB 1RZ7H 1UT2A 5CGYC 5CJQH 5CU9A 3PNWA 5FYJL 1D9KD 1HOCA 4MD4A 1H9VA 2YD3A 4ZTOL 2P5EA 3D69B 1BBDL 1CXHA 1HEZA 2PABA 4IBZA 5HHOD 2NY0B 3FT0A 2YO3A 5K5YA 3BYTA 1HESA 2W07A 3KLDA 1X7SA 1CFMA 1S9XB 4CRYG 2I27N 2NY3D 3SQBB 5T1MA 3VAEA 3FN3A 4BKSC 3T0XA 1A5FL 3BIKB 3VMPA 2YD1A 2FGWL 2V5TA 3BKJL 2I9LA 4MB4A 1ED3B 4OD3L 1LEKA 5CU5A 5FUOH 2E7BA 4DTGL 4MMZB 1SDDB 1MCOH 2X0VA 1N26A 1M1XB 2MRYA 3F58L 3KYKL 1HXYB 3RAJH 2H3NA 3MA9L 5I76B 5T1LA 1U2YA 2CUAA 2NLJB 4DO5A 3AY4C 3FQXA 5E9DA 2E74C 4BFJA 5EO0A 3FUKA 3RUGB 3GHBL 2R2HB 1OP4A 4GINA 4OW6A 3SKJL 1T83C 3LIZA 3OKDB 1JVLA 1A8ZA 2WM0A 3SPJA 3DOIA 1FL3B 3KWXA 1R46A 5JUEH 2JB5H 3K72A 4NUPA 4OF0A 2APXA 5HPOA 2OJ1A 3G6JE 3MOBL 4HH9A 2GBVA 5E8PA 1WEJH 2X2YA 5IW3A 2YPVL 4CADB 1HQ4A 3GMMB 2DJ4A 1Y6NR 5CR1A 2GAZB 4KI1A 1DUZB 1L4IA 3IGLA 3VWJC 1CZ8L 1NFDF 3FOLB 1QQDB 5PCYA 4YGVB 3QFJE 1ZXQA 3FC8A 3TBYA 4QTIH 3ZTDC 2IPUG 1XH3B 3VRIA 2EO9A 4AZ8B 1J18A 4HP5A 5ISZE 5JXAL 4M7ZC 1N4XL 3R7RA 5D7LA 3MN8A 2ZCHH 1C1EL 5JHMA 1DBAH 4WHTB 4GI9A 3KDMA 4IJ3C 5F1IB 5F7EH 1HIMH 3AWFA 3X2LA 1N0LA 2BP8B 2HFTA 3BW9A 4LLUB 2AJZA 3ISYA 4H88H 3C6LD 1D5XB 3S96A 2NNFA 2Q6WA 2UWEE 3SY0A 3T0DA 1I3RA 1LM8V 1LP9F 1QFUH 1WFIA 5G5DA 5C7XH 2NTFB 2IAMA 3TEWA 2KL6A 3RWHA 3S34H 1ZTMA 2X89A 5E5MA 3KH4A 4OGXL 2JA5A 1B0GB 3TYGH 4A7QA 2Z1KA 3GMRB 4O02H 5DO8A 3C5SB 2PXYB 4AYID 4JGNA 2EEOB 1VEOA 2DF3A 3UFIA 4N1EA 3F3HA 4U31A 5HD8D 1J8HD 5IZ7A 3NAAH 3O2WL 1LDPL 1KJ2H 3I50L 4Y1TA 2FO4A 3E6FB 4XGZA 4AM0A 1OW0A 1BZOA 3AM8A 2PWDA 2XQ0A 5K33A 5TH2B 4GI8A 1NWPA 4KODA 3W39A 2ESVA 4X9FA 5FKAA 1PCXA 1X7QB 1MRCH 1DQQA 1S7TA 3OMAB 3BRDA 2Q86A 3I6SA 3OC5A 3SJVE 3QXTA 3KW7A 1NEUA 1DQJA 3GNML 5KVGH 2G0KA 5C08E 5EZLA 4MNGB 5E1GA 2GTWA 4FE9A 5I1HH 4QTFA 3IVKA 3QPQD 3HZKA 3FH7A 4CNIA 3RL1B 4Y4KB 2P9RA 5BV7C 2JKIS 5KSBE 4OZFB 4ZFZA 2G5DA 3AJ7A 3I9GL 1KIUB 2AJUH 1JPST 4BWTA 4XNDA 2UXGA 3W11D 1TMCB 1AW8B 2Z31A 4IRJB 5GJTL 4G6JL 2J20A 3GMNB 3GIVA 1LD9B 2J73A 3N0AA 2R59A 3ZKXB 1WYJA 4P23C 2JELH 5IQ7L 1YMMB 2X6BA 5KYYA 1U2CA 4FI7A 5HI5D 2WVVB 4QCIA 2QVIA 4G8GB 1CD0A 5CJ8A 4PWKA 1A14H 3PWUA 4HUCA 2CKBA 3O4OB 1MFDH 1BD2A 4GPVA 4L9DA 4YEEA 4ZBJA 2O4EA 4P2AA 1AQ8A 2MTPA 3PRZA 4H1LB 2IPTH 3MC0A 4M9OA 1CZ4A 5IG7A 1IM9A 4RWYH 2WANA 5IESH 1GS8A 2X3CA 4MMYB 4N6QA 4BZ1A 4CVZA 4X99B 2ITCA 1P4IL 4YEFA 5BW7A 2QKIB 3MUGA 4HWNA 4NOBA 4IRSB 4EI0A 5T8IA 1K9TA 1WG3A 5CJXA 3QDGE 3PWVA 4MRCA 3MRQA 4OLYL 1TETH 1Z6JT 3II3A 3QORC 2YMXL 4S1SL 1G9NL 5IVZB 3G6JA 5B3NA 4J3OG 3UTPE 1J1XH 1YCSA 1DQDL 3BH8B 4UT6A 1BPLB 2Q2EB 3MLRL 5HYJB 3IDYB 1KF9B 3FCGA 5FKPB 5LAXB 3IRCA 1MHPL 4PRHA 1EFXB 5EEUA 5BOPA 3APMA 4IGBC 2D2CC 4IKIA 1IGFL 2AK4B 2WTRB 2HRPL 3P9LB 3KHOA 3M8OL 4YSPA 1JFQL 4R7NA 2A9CA 5FYKD 2FL5B 3OHXB 2XKUA 4PLOB 1YN6A 1D5MB 2QHRL 3GRBA 5AVYB 3VX1A 1I75A 3LSOB 2GYSA 4HPYH 2H32A 5LGJA 2VLLB 1GRWA 1S8DA 3FK3A 3IMSA 4R96A 1H3GA 3K46A 3F01A 4RQQB 2I60H 4M93B 4H8UA 3GS4A 5C7ZA 3SZ6A 5KVEH 1J10A 1IGTA 3EYSL 5MERB 3HFFA 2E9IA 3SO3B 3ARGB 4RGMC 3ZZQA 2QMJA 4YXKL 3WUWB 1RXLA 4UAOC 5FTNA 4HC1L 4KDTC 4WI9A 3H2PA 3EYFB 5DD1L 1DMRA 4MWFA 3FT3A 4KXBA 4KKCD 1P4UA 3UJTL 1D5IL 1QWHA 5HYSB 4G8IB 4PD4J 2F58H 4XMLH 5JOPD 3ARYA 4MB3A 3MJ8A 4RAVB 1FFNA 1S7QB 3GHPA 3FB8B 1QTPA 1ZLEA 1UKSA 1WFJA 2ROYA 5INDB 3FKIA 2QQNL 2F19L 5KS9A 2AQSA 1MZZA 5EBGA 5ANMB 3P2TA 3D2UA 3QC5X 1T20B 3K4AA 3LH9A 4MZ2A 2R69A 1KJ2B 3WIIL 4LHJB 4B0MB 3G5XB 1OY3B 4DP5X 5CCKH 3NFSL 4RVBA 1Q9KB 5EUKA 4Z7OB 3QXWA 1UJ3A 1ETB1 1F86A 4N20A 4IU2A 1TJMA 5DQDH 1Q1JH 4ALAC 3VXQB 1ZVSA 3IGAA 5C08A 3KYOB 4WI3A 1HH9B 1QAWA 1JZ5A 3R06A 3KLAB 3Q9PA 5ALBH 1CXIA 3O3AA 3OXRB 4MS6A 2BNUA 5ILTH 4LCWD 5HSFA 1HHHB 2JI3A 3Q6FA 4J39A 3P0GB 1AGBB 3WLWC 4CBZA 1DYZA 3FCUB 3D05A 4PJ7B 3FB5A 2E6PA 3REWB 3LDBC 3M1BB 1IC4H 3NZ8B 4PJ8D 4HWUA 3DMMC 5HDLA 5DS2A 3TV8A 3ENEA 4NO5A 1U41A 3IS0X 4WWKA 1NM4A 4N0FB 4FXKC 1UWEH 5I15L 1TZGL 3BGMB 1FAIH 5F0PB 1XIWC 4MXWL 2NYZA 3T04D 1YECL 2VDKH 4K8RH 2P5WD 3EO0B 4JJ5A 1EO5A 1G87A 4N3UA 3B3IA 1N0XH 4DGIL 5KW9L 3WXVH 3ILEA 5DK3A 4LRNL 4AMKH 1TMOA 4V1DB 4F8PA 5DD5L 2TAAA 3U4BH 3EKCA 4U6VH 3NJIA 4AEIL 2WQWA 1U8KA 4NO0A 2KQMA 1HQRA 2ZOLA 4GW4B 4ZAKA 5AVXB 2H0JA 4WCYH 1ZD6A 2E7LA 1P84K 5F7UA 1D6EB 4YOKA 3BWSA 1T4KA 2I7OA 1IEHA 2GK0B 1KLGA 1EZSA 3IJYA 2F53E 4XN7A 3PABA 2DPKA 4APQD 1QEXA 2BC4A 5F7HA 4PJHE 2N3JA 4MAYB 4PGDA 3ETSA 2FSEB 3VD3A 4JM2F 1RZGB 1TQCB 3X2QB 5F1KC 1TR7A 3HCVA 3JV6B 3MRKA 3NFPB 1RI8A 3SKMA 4Y9GA 4FZ8L 3BZEA 3DO7A 3TO4A 3KJ4B 1QLEL 5KAQF 4FYTA 1V27A 1N6QH 1GZQB 3A23A 4E42B 1JZ7A 4UBDC 1HHJA 1Q0XH 3FUIA 2HG5B 5LQBL 5BVPL 2EUXA 4AC2A 1SDAB 3GHEH 2VWEC 2QKSA 1A4CA 4FQ2L 5DTFB 3MX0A 1TJGH 1K3IA 1ZSDB 4HETA 3HJ0A 2ITFA 2ZX6A 5E8NA 2H41A 3TM7B 5E8EA 3V0IA 1I4FA 1K6QL 3WFEH 2FO8A 2QR0A 2Y24A 1PZCA 4QHLB 3ZE0E 2CDGA 3R0NA 4H26B 4N5EC 1S5IH 4GBXA 4OGAC 3TJHD 2WIIA 1GAFH 2G5UA 1JD9A 1A3RL 1TVDA 4YBHA 2BFGA 3FQNB 4MX7B 5DJDB 2F8OA 5ELIA 4MA7L 4KKZA 3PJSB 4NNXA 3NFNA 3OKYA 5SV3A 3NIDF 2A0LD 5IHZB 2QFPA 1B6DA 5BS0D 1KPUB 5CKGA 5JHDE 3QNFA 3TWYA 1PLAA 2NW3B 2B15A 5DJXA 5TQ2L 3H42H 5I6XC 3B9KC 4EN3A 1ZS2A 5ECGA 4GXVH 1ZIAA 5FO9A 4JFEE 3DLQR 3PYCA 3MUY1 2YU9A 4N85A 1PT0A 3STLB 1J88A 2KS0A 2DIEA 2F2HA 1B9ZA 2IO5A 2M1KA 2VXQL 4HEPA 3ULAB 3PGCB 1T1WA 1FFTB 1UM5H 4N0CD 4DP2X 4OQTA 2R51A 1JPFB 5GS1A 2IG2L 3RWJA 4HJTA 2XLLA 3ATAA 1WTLA 5FHBL 4GKLA 4JFZH 4UT6L 3RG1C 3FN9A 4F20A 3L95A 1N7ML 5AVSB 2CO2A 1IFHL 1GW0A 4LKXA 3JXAA 1DEEB 2W0FA 2H6OA 4N8UA 2R29H 2FHBA 1DJGA 3HBZA 3R1GL 4J6RL 3S3PA 4KXZH 1GPOH 1P7QB 3TO2B 1ADWA 1P0SE 4H5SA 1FNLA 3LN5A 5HHQA 2RD0A 4DIXA 1ZAGA 3CQFA 3IETA 1ROWA 2BP0B 3HMWL 5C0EA 2AHIA 4KK6D 3IXTA 3I6LD 4C58B 3AG1B 4D3CL 4P5TD 3IBOA 2WQAA 1J05A 4GUOA 3DTXB 4G7YL 1R3JA 3NESA 2CJTA 1Q4NX 4IM8A 3C60D 3RE0A 5IW6A 2OJZL 3Q1SH 1I8IB 1IAKB 1SRDA 3O6LH 3U4EB 5J6HA 1ZE3H 5M7QA 3KL0A 1MRFH 3LZNA 1DJYA 1T7ZA 1SMDA 2J43A 3MV8E 4HIXH 1MDTA 1IGIL 1N70A 3B3BA 4BZ2L 4V2BA 1B0RB 1VF5C 4FTDA 2P4AB 5DHVH 3DJZA 3HN3A 4KTYA 5MEQA 5I5RA 5E4IA 1VC3B 5ABAA 3UG5A 1QPKA 5SWQB 1FYTA 2MPVA 2IAAC 4HHWA 4QRPB 2FX7H 2DBLL 5CFHA 1OSZA 3DPDA 2R69L 5SX4H 2LQRA 5B8CA 3MLWL 3VWKC 3O3BA 2A6JB 2YAOA 2EDTA 4OFYA 3NP4A 3O41B 2IOMA 1R7RA 4M8QA 2F53A 3U7YH 3CJJA 3U2SA 4X80L 1VIWA 4Z7UB 3RVWC 3SDDB 1XF2B 3HZYB 4LLVB 2F7QA 4Y5XA 3V0DA 1QPXA 1U8IA 4U1GB 5DS8A 4CVXA 2VH5H 2Y6SC 3AY2A 5DMGC 4HXBH 4YDVB 5C0RH 4KKLC 5EBLA 5AL0A 4HT1L 2ZCLL 3GJFK 5B1AB 3LNIA 3VFTA 3PHOA 3NZUA 3EO1B 4ZUSB 1PZBA 2BY1A 1G84A 3QIUC 4WO4B 2ZSWA 1MRDL 1R0AH 1TITA 8FABA 4WRLA 4W9JC 2DMHA 3LNGA 4GUPA 3BP7A 1AHWA 1AGFA 1A6WL 1QHOA 2GT9B 4BSWA 4DEWA 4YPJA 5TK4A 3UAJC 2AABL 5I8KH 5EOQL 4QXTB 1CFNA 2YAQA 3US0A 1JNHB 3GXUB 3CUPA 5DXWA 5A40E 3J27A 1QSZA 1UYWL 4NDMB 3RPIB 1CYGA 1NCWL 2E8YA 4OFIA 1NEPA 1XEDA 2EP6A 1I3VA 4NQXB 4O51B 3IRPX 1F3RB 2FJGB 5E51A 2YD4A 4W68A 4DFHA 4PRNB 2WSDA 3GSQA 4QRAA 1MAMH 4X0KA 1NC4A 4WHDA 1QUNA 2FT7A 4JFSA 4RAHA 2YUVA 1CI5A 3UGXA 2BWQA 4P2RE 1QLFB 1RZJC 2XI9A 2FLMA 1VZHA 3NGBB 4NQSA 5J5EA 4L29B 2PPAA 4I9WE 4JM0A 1Y1WA 4NP4H 4Q6IA 1KEMH 3PXJA 2RA1A 5FM4A 4YHOH 1CGWA 4ONGH 4Y4FC 1NCIA 4I0CC 4HJIA 3DOHA 2VM4A 3QUZB 3D48R 2OMNA 1X44A 3F7YA 1WHPA 1GMEA 1Z9PA 3W9DB 1AGDB 2E0PA 5FA3B 3RDTC 1CLVA 4KJQC 2LTQB 1P9MC 3MV9D 4R7XA 4AT6A 5IB2A 4PG2C 3TCLB 5E94A 4IBTA 3KGSA 3W3BA 1EJ6A 1AD9B 5EBMA 3S36L 5EEXA 3B7SA 3ZKND 4YO0B 3SKOB 2L4OA 4OZHE 3VXTA 1PQZA 3JWOC 3V9EA 3OZLA 5FDYA 1CE6B 2ADJB 3UEQA 4U3XA 3OAUH 3AABA 4FQLL 4JL2A 1OD7A 1GGIL 5DZVA 3MU3A 1E30A 4HA1A 1EQWA 3V55A 3VSUA 4AV5A 1K8DA 2ARJA 3P11L 2GSGB 3C5ZA 3FONB 3W0WE 4DJMA 4Y2LA 3SBRA 3V4VL 4F7EA 1PLGH 5C07B 4FQJL 1E6JL 3L17A 3TJEH 3UROR 4KQ0A 4X6EB 1DL7H 4F15B 2E75C 3PFUA 4NNPL 5A3ID 2N59A 2O5XH 5J13B 1ULVA 2CR0A 3F65A 4R8WH 1K2DB 3HC0A 1RLBA 1UENA 3ZUCA 4CL7A 3HI5L 2I25N 2VISA 2EICA 3RJOA 1UHVA 4Y5VC 4NQDB 4JRXE 3BAWA 5IWLA 4KXCA 4S1DD 1H3TA 5KSAB 3HFML 1OPGH 2P42B 4LLQB 4P2QD 2NUTA 5GS2H 1R24B 3AREC 5ICXB 4P99A 1R27A 3MUZ1 5LG1A 3KWWA 3MMEB 3MV8A 3RHWF 4PLJC 3ORJA 5I1IH 4G9FE 4ZMLA 5ITBH 4OQTL 3TEXA 5B3SB 1F2XK 2JNZA 1FL5B 3Q2NA 2QVMA 1RUKH 4ZZKA 1TTAA 3OAZH 2C9SA 3QUKA 4HK0B 4JDVB 1JZ8A 1EX0A 4R4FL 2VN7A 4ZODA 3WFZA 4JCLA 5D72H 4FNRA 5HP5A 1NUFA 4Z7WF 3FMGL 2HWZH 4ZO8A 3KPOA 2XC8A 5I1LB 2WKOA 2Z7UA 3NH7L 4F1ZA 5GSVB 4UB0H 2CXKA 4UM9A 1NBVL 2Q0ZX 1NAKL 3C2SA 4WWID 1G0DA 2L04A 2P45B 1E65A 1E42A 4HYTB 3BP5A 2JIPA 4KX9A 4QHMA 5ESVA 5AVUB 4PJFE 4UILL 4XMTA 4DPBX 4HUMB 1FGVH 2CO4A 3BIAX 1ZS8B 2ZOOA 3QISA 1J5DA 2W65A 4IIZA 5T3ZE 1UXWB 5L2KB 4YQXH 1R19A 2AQNA 3HUJE 3D6GA 5D7JA 1HAUA 1A4KB 1O9ZA 4PJ6A 5JA9A 1T3FB 5GRZA 5DJZA 4DP6X 2FIKB 1KY6A 4TTDC 3RVVC 2ZPKH 2GABA 3NDZE 4MZRA 2BNRB 3DX7A 3ZOAA 4PJEB 4XB3A 1JHLL 2VXSL 5CMAA 1KN4L 3UCQA 5J6SA 1BXAA 1VHPA 3VWJD 4RDQG 4H8WH 3BJ91 3WE6A 1P6FA 2CBMA 2WQXA 3Q48A 4QR7A 3HU3A 4YK4C 3D4ZA 3VFGH 1XXDC 1CC3A 4K15A 4URTB 3HNTH 4HAFA 5L8KB 1SM3H 4Q8BA 4HEME 2LOEA 3IGUA 4N2BA 3RTLA 5FB8A 2Y69B 3JT0A 4PJDB 4P2RA 3FUMA 3VGDA 2E7DA 3MRFB 1FNEA 1GJIA 1D5RA 3SODB 5DVLA 1U91B 2YEZB 3U6XS 1EEYB 2CO7B 1PX3A 1I9JL 4F7TB 3BZFA 4LCUB 1Y18A 2Z93A 1A1MA 1CLZL 5C09B 3QXDA 5CN3A 3C9NB 5E6YA 3F05A 3X2GA 2E59A 3V0FA 4LSQH 1YDPA 5EO1A 2EO1A 3NN8B 3WXWL 3KPRE 3VFVA 4N9GB 1BX2A 3W9EA 3UTQB 3FUJA 1PD0A 4UU9B 4AJYV 1OAXH 4GUQA 2WKOF 4OZHA 1RJZB 3O4LE 2QHLA 1XB6A 2ICEA 5GQBA 1FZJB 3QRGH 2JI2A 3DV6A 3L9EA 3U1SH 4XXDA 4YDZA 4H20H 5G55A 3PIQB 5D1ZI 1UA3A 4Z7VB 4JQIA 4IRZL 1XBRA 3MREB 1Q72H 1F4HA 1A6UH 2JKNA 5I73C 1W0WA 1QFWL 1GCYA 1UEMA 3QEQE 4NAMA 3UTTB 1RZQA 5EUOE 3ULUH 5AW9B 3IDNA 5LB1A 3SGDI 1E6OH 2YUXA 4KK9C 5B38G 4XC3L 3MYJA 3GZQA 3MLUH 2Y0SA 4JFFB 1C12B 3HOGA 1MCWW 1DTUA 4BK8A 5EC1A 2GITB 2XXMB 3ZGIA 3MJ9A 3CZBA 1EXGA 1MCCA 4F3FA 4B3VA 1J0JA 1F18A 1QKZL 1JE6A 4WEUD 5KSVB 2H2PD 3BQVA 2V7NB 3U1QA 1KV7A 1HU8A 1ORQB 2VUOA 2IV8A 3PQYE 3HLAA 5JOEA 2YIHA 5KUKA 2ZUUA 3KPSD 1I1FA 4PJBB 1M1SA 1FZOB 5DD6B 4LSSH 2FBJL 3AVEA 4Y9EA 1LO4L 1KBWA 4JAMB 4UV4H 5KYWA 2GHZA 5D4IA 1JRHI 5FTJA 1I8UA 5E6IA 4Q56A 3BQUD 2ZYHA 3T77A 3FFCA 1BLNB 1P53A 1QO3B 3ARDD 3MRHB 4PWFA 2X09A 5D7KE 1RZ8A 5K1JA 4R26H 3Q9QA 1HWWA 3NQIA 3IXAB 3HE7B 5J1AB 2VDOL 4FOMA 1PYWB 3WO3B 1DQIA 1WD9A 2DD8L 3U1PA 4OJDH 1XSKA 1OCRB 3NRFA 4G5AA 3ILQC 2ZQKA 3MJ7B 3RL2A 4KI5C 1MCNA 4HQQH 4YC2C 3UJJL 2XRAL 3HIZA 2WXKA 1AS7A 4RGNC 3WTTA 4Y9CA 3BVTA 4KBPA 2XY2A 1OKEA 3MXWH 2XWJA 1A1NA 1F4WL 2YAPA 4ZMZA 4NPYB 2DYPA 3QDJB 5I30L 4UTAA 1BJMA 4MZIA 3ET9F 4LCWA 5AW6B 3PU7A 3QIWA 5DJYB 1GZPA 1DJZA 2LR4A 1JVKA 1RIVH 4LSRL 4PJ8A 4FG6C 2GBTA 4WU5A 1MVFA 4WUUB 3RTQB 3RZCC 1GSMA 4J3OC 2B7DT 1LQSR 1JI1A 3KS0H 2UV3A 3PDDA 4Z7NF 2DMCA 2YA0A 3E1F1 1A3ZA 2H3KA 5HGDA 4CN4A 4Z76B 2A38A 3FTGB 2AJSL 3SE4C 3EJYC 4FQXA 4JFXB 4Y1SA 3GUTB 3H55A 4HMEA 4PRBA 5DJ8A 3UP1A 4HKBB 2O30A 1VFMA 4HEMA 3MNWA 4UOJA 1CGYA 1I1AB 3LKNB 3M45A 5LCVA 3S7GA 1R5VA 4BHUA 1U8PB 1DQML 1P4BH 4HHGA 3S6CA 4XZ4A 2OMXA 4RGOH 1ZTXE 1ID2A 2BSRB 4F37K 1BW8A 4AH2A 2BHZA 3DX9B 3L1GA 4MMXA 5CM1A 3V0AC 3OKOA 3QUYD 3WNLA 1RK0A 2B63A 1IGJA 4NZUH 2WZPD 2OLDA 5FYLH 4KV5E 2F0CA 3E3QE 3HG1E 3U36B 4C56B 5KG9B 2CMRH 2HP4A 3S3CB 1FO0A 1JV5B 3UC2A 1IC5H 4IJTA 5MENE 3VJ6A 2ZKMX 3RY4A 1NQBA 1BFVL 1MCHA 2WQUA 4P0DA 3OAYH 4PAZA 1OTUC 3MACL 1P5VA 3O4LA 5DYOA 1IO4C 1RURL 3DA0A 2MOQA 2O6EA 5I8CB 4NC1C 1FYHB 4OIIH 5J6GB 4JHVA 2VQ4A 2F68X 4N2EA 4WUKH 3O3EB 4Z0XA 2CAKA 2P8LB 1E9OB 3NCJL 3NGBC 4ORZC 4OSUH 4DPCX 2DQHH 1KBBA 2WLHA 1DUYA 2R0LL 4Q2ZA 5IOPA 3QEQA 4PJ9C 2HKHL 1QLRB 2JIOA 2P46B 4ZUVA 3MODL 5EUOA 3VFRB 3SE9L 2BMKB 1RUMH 2DEWX 2W92A 1CVSC 2PYFB 4UUJB 3BWAA 3ZY7A 1SYSA 4N8CL 4DWHA 4JRLA 4NT6B 4Y1AB 1X7TA 2IQAB 3EH5B 2VO8A 1KPRB 2PCPB 2Q8AH 4PVLA 3CGTA 4YXHL 1QDNA 2X9YA 2YSTA 1JXFA 4X4YB 3L16A 2PUQT 4QRRE 2K6WA 2YPKA 3DBSA 3SE8L 2EKSA 3WLWD 4F7CB 1PY0A 2FAUA 3EG9B 3EYQC 1X5LA 1W0VA 2BS71 5GGUB 1YEFL 5SWSD 5BS0A 3D3VE 4M7LH 5A6LA 5IFAL 2J6EL 4P57B 2WAQA 4OCWH 3FTXA 1MIEL 4JFQB 1XIWD 1CXFA 2EUZA 5D1QE 3T6XA 2CRYA 4L1DA 1BQRA 4O2EA 4U6HA 3EBAA 3OSKA 4QIRA 3VVWA 1C5CL 1JZIA 2GI7A 5G2NA 4TL5A 4DCQA 3OSVA 2C9AA 3S37X 5JHBA 5F3HB 2EINB 2FJFA 1F6FB 4HH8A 3TTSA 1IEAA 4JQIL 4TQ8A 2ZYSA 5L9DL 3PWJA 4FULA 6FABH 2PNWA 2ENQA 3SDXE 2E27L 3MR9A 2XWEA 5AUMB 1KJMB 3CVBA 3MQIA 2BVOB 1BFTA 5F72S 4ZW5A 3EO9L 3WI9A 2QVTA 1DZ0A 1SVBA 2BSTA 4JVPA 2V2TB 1PNCA 3GSOB 3KDPB 5C0CD 5CEZE 4JN1L 3K80A 3SE3C 4LPUA 2X4PB 4PRIA 3GSRA 1BYPA 3O6FC 2NXZB 4KZDH 3KXFD 4YZFF 3GTGA 2XQYG 4P2CG 3KPLB 1U2HA 1A64A 4KHTH 5I17B 2V2WA 4X9BA 3T0EC 3GBNL 3UL4A 1G9MH 1YY8A 4PRAB 3QJVB 3C60A 5F9AC 4UBDD 4PWEA 1VZGA 1UWXK 3MLVH 5HDQL 4K7FB 2E4FA 4JO3H 4XWGL 2A7BA 3KWVA 4EIUA 3BVNB 4DPRA 2BHYA 5JLZB 1BZ9B 2E9BA 4LCIL 4PSPA 4WKZB 2AZUA 2FZ3B 1YEKH 4I3SL 1HNGA 4P3CH 3PV6B 2YQGA 4MS8C 4N5ED 3STZB 2VL4A 4AK2A 3WKPA 3M3GA 1ZXKA 2IANE 2OZ4L 4NN5B 3QH3B 3V0WH 3CLEL 1P4LA 4MCYA 2Y7NA 3H7LA 1NAML 1LK2A 1WCQA 5I26A 3TZVB 5L4JA 5BZWA 1AGEB 2V7HB 1GCFA 2JKTM 3V95A 3WEXA 5B38B 3MSPA 3QCVL 3L08A 4L3EE 3B9KD 1V7NL 4JFDE 3N50A 32C2A 3P02A 4PJ5E 4F2MA 3HG1A 1IZKA 3GXNA 3QIBB 4UTAL 3ZDYF 1T21B 1FI8C 5T3ZL 3I6KB 3QP3A 4ZSOB 4X6FB 4L8CB 4KVNH 5MENA 2B16A 1JBJA 4DNLA 3T8XA 3TT3H 3LKOB 1AO7E 5E00B 3QZWB 2WXQA 1IAIL 3R0MA 4J4PD 4HIIB 3EOBA 5AZ2H 2F8VA 3NPSB 3PGFL 4PB9L 5CUSH 3IGKA 4KUZH 4OAWA 2JKJA 3SCMA 1UZ8A 1K5WA 1AXTL 3FB6A 2YJLA 3LNFA 4NJAL 3MRPA 2OYKA 1JNLH 3WIAA 4F58H 1Y4ZA