3OUGA

Crystal structure of cleaved l-aspartate-alpha-decarboxylase from francisella tularensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
107
Chain Sequence
MLISVLKSKISYATVTGKDLFYVSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVDPTRENIKPKLVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase
publication title Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 27
structure length 107
sequence length 108
chains with identical sequence B, C, E, F, G, H, I
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02261 Asp_decarbox Aspartate decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3ougA00
1E5VA 1KQFA 1WCMA 1UHEA 4KO8A 5FTLA 3O5AA 1G8JA 3GTQA 1TWFA 3PLXB 1AA6A 1WLFA 3TIWA 3IR6A 1PQHA 2IV2X 5FTJA 2EEOB 1TWCA 4AONB 1E60A 3ML1A 1YLEA 4KODA 1OGYA 5GLFA 3QC8A 3HU3A 2PMZA 1R27A 1QCSA 1QDNA 4CRZA 3HKZA 4C2MA 1R9TA 3CQZA 2DMRA 4AOKB 1K83A 2R7ZA 2VPXA 3GTGA 3IR5A 5DYIA 3CF2A 2JIMA 1PYUB 1KQGA 1TMOA 1CZ4A 1UHDA 3HU2A 2E7ZA 1Q16A 3GTKA 1S3SA 2VPZA 4GA6A 5C1BA 4KDIA 2JA6A 4QIWA 4KDLA 1CZ5A 2E2HA 5B6CA 3FKIA 2R93A 4GA5A 2JIOA 4AYBA 3GTJA 1E32A 2VUMA 3QQ7A 1I3QA 1Y4ZA 1SIWA 3GTLA 2VPWA 1E61A 1SFOA 2JA5A 1DMRA 1H0HA 1DMSA 2R92A 2NAPA 1R7RA 5T5MD 2PJHB 2YU9A 2WAQA 3QQ8A 5T5ID 2KI8A 2JIPA 2V3VA 3OUGA 3TM7B 1Y1WA 1E18A 3QWZA 5FTNA 1EU1A 4AAYA 4CS0A 2VPYA 4D7ZB 2B63A 4KLNA 1FDIA 3GTOA 1G8KA 1CR5A 1AW8B 5FTKA 5EPPA 1PT1A 2NVYA 1FDOA 2JIRA 1TWHA 1IW7D 5DYGA 3GTMA 2WB1A 1PPYA 4CRYG 4AZDA 1PQEA 2C45A 1I50A 3H0GA 2NVXA 1TWAA 1TWGA 3DMRA 1Y1VA 3HU1A 1VC3B 3GTPA 5FTMA 1Y5IA 2JIQA 2NYAA 4RV0A 2JA7A 4DMRA 1PT0A 5C18A 2V45A 1H5NA 3IR7A 2Y0SA 1PQFA 1PYQA 2E2IA
chains in the Genus database with same CATH superfamily
1E5VA 1KQFA 2CW0D 1WCMA 3X2OA 1UHEA 1Y1WA 4KO8A 1ZC1A 3CZBA 5FTLA 3O5AA 1G8JA 3GTQA 1OA9A 1TWFA 3PLXB 1AA6A 2ENGA 1WLFA 2PNWA 3TIWA 1ZYRD 3IR6A 1YNND 1PQHA 2IV2X 5FTJA 2A6ED 2EEOB 1TWCA 1WC2A 4AONB 1E60A 1BW3A 3ML1A 1YLEA 3D30A 4KODA 1BW4A 1OGYA 5GLFA 3QC8A 3X2HA 3HU3A 2PMZA 3SUKA 1R27A 2PI8A 1QCSA 1QDNA 4FG4A 4CRZA 3X2JA 3HKZA 4C2MA 1R9TA 3CQZA 3SUJA 2DMRA 4JP6A 3X2LA 4AOKB 1K83A 2R7ZA 2VPXA 4JJOA 3GTGA 3IR5A 5DYIA 4FG2A 3CF2A 2BH0A 2JIMA 4L48A 1PYUB 1KQGA 1TMOA 3X2PA 1CZ4A 1UHDA 3HU2A 2G5DA 2E7ZA 1HD5A 1Q16A 3M3GA 1S3SA 2A69D 2VPZA 3GTKA 4GA6A 5C1BA 4KDIA 2JA6A 4QIWA 4KDLA 1CZ5A 2E2HA 4JP7A 5B6CA 3FKIA 2R93A 4GA5A 2JIOA 4JS7A 4AYBA 2PJJA 3GTJA 3X2GA 1E32A 2VUMA 3QQ7A 1SMYD 5GLXA 2BE5D 1I3QA 1L8FA 1Y4ZA 1SIWA 3GTLA 1N10A 2YUJA 2VPWA 1E61A 1SFOA 2JA5A 1DMRA 1H0HA 1DMSA 3X2NA 2R92A 2HCZX 2NAPA 3ENGA 1R7RA 1YNJD 2PJHB 4FERA 5T5MD 2YU9A 2WAQA 3QQ8A 2A68D 5T5ID 2KI8A 2JIPA 2V3VA 3OUGA 3TM7B 4ENGA 1E18A 3QWZA 4JCWA 1EU1A 5FTNA 5H4UA 2VPYA 4AAYA 4CS0A 4KLNA 4D7ZB 3X2KA 1FDIA 2B63A 3GTOA 1G8KA 3SUMA 1CR5A 1AW8B 4NOHA 5FTKA 5EPPA 1PT1A 2NVYA 1FDOA 2GAEA 2JIRA 1TWHA 1IW7D 2A6HD 5GM9A 5DYGA 2PICA 3GTMA 2WB1A 1PPYA 2KQAA 3X2MA 2AE0X 4CRYG 4AZDA 1PQEA 2C45A 1I50A 4AVRA 4FFTA 3H0GA 2NVXA 1TWAA 1TWGA 3DMRA 1Y1VA 3HU1A 1VC3B 3GTPA 2O5JD 5FTMA 1Y5IA 2JIQA 2NYAA 4RV0A 5GLYA 3X2IA 2JA7A 4DMRA 1OA7A 1PT0A 4ZM7A 5C18A 3SULA 2V45A 1H5NA 2G6GA 3IR7A 2Y0SA 1PQFA 1PYQA 2E2IA
chains in the Genus database with same CATH topology
1E5VA 1KQFA 2CW0D 1WCMA 1UHEA 4KO8A 1ZC1A 3CZBA 5FTLA 3O5AA 1G8JA 3GTQA 1TWFA 3PLXB 1AA6A 2PNWA 1WLFA 3TIWA 1ZYRD 3IR6A 1YNND 1PQHA 2IV2X 5FTJA 2A6ED 2EEOB 1TWCA 4AONB 1E60A 3ML1A 1YLEA 4KODA 1OGYA 5GLFA 3QC8A 3HU3A 2PMZA 1R27A 2PI8A 1QCSA 1QDNA 4CRZA 3HKZA 4C2MA 1R9TA 3CQZA 2DMRA 4AOKB 1K83A 2R7ZA 2VPXA 3GTGA 3IR5A 5DYIA 3CF2A 2JIMA 1PYUB 1KQGA 1TMOA 1CZ4A 1UHDA 3HU2A 2G5DA 2E7ZA 1Q16A 3GTKA 1S3SA 2A69D 2VPZA 4GA6A 5C1BA 4KDIA 2JA6A 4QIWA 4KDLA 1CZ5A 2E2HA 5B6CA 3FKIA 2R93A 4GA5A 2JIOA 4AYBA 2PJJA 3GTJA 1E32A 2VUMA 3QQ7A 1SMYD 2BE5D 1I3QA 1Y4ZA 1SIWA 3GTLA 2YUJA 2VPWA 1E61A 1SFOA 2JA5A 1DMRA 1H0HA 1DMSA 2R92A 2NAPA 1R7RA 1YNJD 2PJHB 5T5MD 2YU9A 2WAQA 3QQ8A 2A68D 5T5ID 2KI8A 2JIPA 2V3VA 3OUGA 3TM7B 1Y1WA 1E18A 3QWZA 5FTNA 1EU1A 4AAYA 4CS0A 2VPYA 4D7ZB 2B63A 4KLNA 1FDIA 3GTOA 1G8KA 1CR5A 1AW8B 4NOHA 5FTKA 5EPPA 1PT1A 2NVYA 1FDOA 2GAEA 2JIRA 1TWHA 1IW7D 2A6HD 5DYGA 2PICA 3GTMA 2WB1A 1PPYA 2AE0X 4CRYG 4AZDA 1PQEA 2C45A 1I50A 3H0GA 2NVXA 1TWAA 1TWGA 3DMRA 1Y1VA 3HU1A 1VC3B 3GTPA 2O5JD 5FTMA 1Y5IA 2JIQA 2NYAA 4RV0A 2JA7A 4DMRA 1PT0A 5C18A 2V45A 1H5NA 2G6GA 3IR7A 2Y0SA 1PQFA 1PYQA 2E2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5V A;  1KQF A;  1WCM A;  1UHE A;  4KO8 A;  5FTL A;  3O5A A;  1G8J A;  3GTQ A;  1TWF A;  3PLX B;  1AA6 A;  1WLF A;  3TIW A;  3IR6 A;  1PQH A;  2IV2 X;  5FTJ A;  2EEO B;  1TWC A;  4AON B;  1E60 A;  3ML1 A;  1YLE A;  4KOD A;  1OGY A;  5GLF A;  3QC8 A;  3HU3 A;  2PMZ A;  1R27 A;  1QCS A;  1QDN A;  4CRZ A;  3HKZ A;  4C2M A;  1R9T A;  3CQZ A;  2DMR A;  4AOK B;  1K83 A;  2R7Z A;  2VPX A;  3GTG A;  3IR5 A;  5DYI A;  3CF2 A;  2JIM A;  1PYU B;  1KQG A;  1TMO A;  1CZ4 A;  1UHD A;  3HU2 A;  2E7Z A;  1Q16 A;  3GTK A;  1S3S A;  2VPZ A;  4GA6 A;  5C1B A;  4KDI A;  2JA6 A;  4QIW A;  4KDL A;  1CZ5 A;  2E2H A;  5B6C A;  3FKI A;  2R93 A;  4GA5 A;  2JIO A;  4AYB A;  3GTJ A;  1E32 A;  2VUM A;  3QQ7 A;  1I3Q A;  1Y4Z A;  1SIW A;  3GTL A;  2VPW A;  1E61 A;  1SFO A;  2JA5 A;  1DMR A;  1H0H A;  1DMS A;  2R92 A;  2NAP A;  1R7R A;  5T5M D;  2PJH B;  2YU9 A;  2WAQ A;  3QQ8 A;  5T5I D;  2KI8 A;  2JIP A;  2V3V A;  3OUG A;  3TM7 B;  1Y1W A;  1E18 A;  3QWZ A;  5FTN A;  1EU1 A;  4AAY A;  4CS0 A;  2VPY A;  4D7Z B;  2B63 A;  4KLN A;  1FDI A;  3GTO A;  1G8K A;  1CR5 A;  1AW8 B;  5FTK A;  5EPP A;  1PT1 A;  2NVY A;  1FDO A;  2JIR A;  1TWH A;  1IW7 D;  5DYG A;  3GTM A;  2WB1 A;  1PPY A;  4CRY G;  4AZD A;  1PQE A;  2C45 A;  1I50 A;  3H0G A;  2NVX A;  1TWA A;  1TWG A;  3DMR A;  1Y1V A;  3HU1 A;  1VC3 B;  3GTP A;  5FTM A;  1Y5I A;  2JIQ A;  2NYA A;  4RV0 A;  2JA7 A;  4DMR A;  1PT0 A;  5C18 A;  2V45 A;  1H5N A;  3IR7 A;  2Y0S A;  1PQF A;  1PYQ A;  2E2I A; 
#chains in the Genus database with same CATH topology
 1E5V A;  1KQF A;  2CW0 D;  1WCM A;  3X2O A;  1UHE A;  1Y1W A;  4KO8 A;  1ZC1 A;  3CZB A;  5FTL A;  3O5A A;  1G8J A;  3GTQ A;  1OA9 A;  1TWF A;  3PLX B;  1AA6 A;  2ENG A;  1WLF A;  2PNW A;  3TIW A;  1ZYR D;  3IR6 A;  1YNN D;  1PQH A;  2IV2 X;  5FTJ A;  2A6E D;  2EEO B;  1TWC A;  1WC2 A;  4AON B;  1E60 A;  1BW3 A;  3ML1 A;  1YLE A;  3D30 A;  4KOD A;  1BW4 A;  1OGY A;  5GLF A;  3QC8 A;  3X2H A;  3HU3 A;  2PMZ A;  3SUK A;  1R27 A;  2PI8 A;  1QCS A;  1QDN A;  4FG4 A;  4CRZ A;  3X2J A;  3HKZ A;  4C2M A;  1R9T A;  3CQZ A;  3SUJ A;  2DMR A;  4JP6 A;  3X2L A;  4AOK B;  1K83 A;  2R7Z A;  2VPX A;  4JJO A;  3GTG A;  3IR5 A;  5DYI A;  4FG2 A;  3CF2 A;  2BH0 A;  2JIM A;  4L48 A;  1PYU B;  1KQG A;  1TMO A;  3X2P A;  1CZ4 A;  1UHD A;  3HU2 A;  2G5D A;  2E7Z A;  1HD5 A;  1Q16 A;  3M3G A;  1S3S A;  2A69 D;  2VPZ A;  3GTK A;  4GA6 A;  5C1B A;  4KDI A;  2JA6 A;  4QIW A;  4KDL A;  1CZ5 A;  2E2H A;  4JP7 A;  5B6C A;  3FKI A;  2R93 A;  4GA5 A;  2JIO A;  4JS7 A;  4AYB A;  2PJJ A;  3GTJ A;  3X2G A;  1E32 A;  2VUM A;  3QQ7 A;  1SMY D;  5GLX A;  2BE5 D;  1I3Q A;  1L8F A;  1Y4Z A;  1SIW A;  3GTL A;  1N10 A;  2YUJ A;  2VPW A;  1E61 A;  1SFO A;  2JA5 A;  1DMR A;  1H0H A;  1DMS A;  3X2N A;  2R92 A;  2HCZ X;  2NAP A;  3ENG A;  1R7R A;  1YNJ D;  2PJH B;  4FER A;  5T5M D;  2YU9 A;  2WAQ A;  3QQ8 A;  2A68 D;  5T5I D;  2KI8 A;  2JIP A;  2V3V A;  3OUG A;  3TM7 B;  4ENG A;  1E18 A;  3QWZ A;  4JCW A;  1EU1 A;  5FTN A;  5H4U A;  2VPY A;  4AAY A;  4CS0 A;  4KLN A;  4D7Z B;  3X2K A;  1FDI A;  2B63 A;  3GTO A;  1G8K A;  3SUM A;  1CR5 A;  1AW8 B;  4NOH A;  5FTK A;  5EPP A;  1PT1 A;  2NVY A;  1FDO A;  2GAE A;  2JIR A;  1TWH A;  1IW7 D;  2A6H D;  5GM9 A;  5DYG A;  2PIC A;  3GTM A;  2WB1 A;  1PPY A;  2KQA A;  3X2M A;  2AE0 X;  4CRY G;  4AZD A;  1PQE A;  2C45 A;  1I50 A;  4AVR A;  4FFT A;  3H0G A;  2NVX A;  1TWA A;  1TWG A;  3DMR A;  1Y1V A;  3HU1 A;  1VC3 B;  3GTP A;  2O5J D;  5FTM A;  1Y5I A;  2JIQ A;  2NYA A;  4RV0 A;  5GLY A;  3X2I A;  2JA7 A;  4DMR A;  1OA7 A;  1PT0 A;  4ZM7 A;  5C18 A;  3SUL A;  2V45 A;  1H5N A;  2G6G A;  3IR7 A;  2Y0S A;  1PQF A;  1PYQ A;  2E2I A; 
#chains in the Genus database with same CATH homology
 1E5V A;  1KQF A;  2CW0 D;  1WCM A;  1UHE A;  4KO8 A;  1ZC1 A;  3CZB A;  5FTL A;  3O5A A;  1G8J A;  3GTQ A;  1TWF A;  3PLX B;  1AA6 A;  2PNW A;  1WLF A;  3TIW A;  1ZYR D;  3IR6 A;  1YNN D;  1PQH A;  2IV2 X;  5FTJ A;  2A6E D;  2EEO B;  1TWC A;  4AON B;  1E60 A;  3ML1 A;  1YLE A;  4KOD A;  1OGY A;  5GLF A;  3QC8 A;  3HU3 A;  2PMZ A;  1R27 A;  2PI8 A;  1QCS A;  1QDN A;  4CRZ A;  3HKZ A;  4C2M A;  1R9T A;  3CQZ A;  2DMR A;  4AOK B;  1K83 A;  2R7Z A;  2VPX A;  3GTG A;  3IR5 A;  5DYI A;  3CF2 A;  2JIM A;  1PYU B;  1KQG A;  1TMO A;  1CZ4 A;  1UHD A;  3HU2 A;  2G5D A;  2E7Z A;  1Q16 A;  3GTK A;  1S3S A;  2A69 D;  2VPZ A;  4GA6 A;  5C1B A;  4KDI A;  2JA6 A;  4QIW A;  4KDL A;  1CZ5 A;  2E2H A;  5B6C A;  3FKI A;  2R93 A;  4GA5 A;  2JIO A;  4AYB A;  2PJJ A;  3GTJ A;  1E32 A;  2VUM A;  3QQ7 A;  1SMY D;  2BE5 D;  1I3Q A;  1Y4Z A;  1SIW A;  3GTL A;  2YUJ A;  2VPW A;  1E61 A;  1SFO A;  2JA5 A;  1DMR A;  1H0H A;  1DMS A;  2R92 A;  2NAP A;  1R7R A;  1YNJ D;  2PJH B;  5T5M D;  2YU9 A;  2WAQ A;  3QQ8 A;  2A68 D;  5T5I D;  2KI8 A;  2JIP A;  2V3V A;  3OUG A;  3TM7 B;  1Y1W A;  1E18 A;  3QWZ A;  5FTN A;  1EU1 A;  4AAY A;  4CS0 A;  2VPY A;  4D7Z B;  2B63 A;  4KLN A;  1FDI A;  3GTO A;  1G8K A;  1CR5 A;  1AW8 B;  4NOH A;  5FTK A;  5EPP A;  1PT1 A;  2NVY A;  1FDO A;  2GAE A;  2JIR A;  1TWH A;  1IW7 D;  2A6H D;  5DYG A;  2PIC A;  3GTM A;  2WB1 A;  1PPY A;  2AE0 X;  4CRY G;  4AZD A;  1PQE A;  2C45 A;  1I50 A;  3H0G A;  2NVX A;  1TWA A;  1TWG A;  3DMR A;  1Y1V A;  3HU1 A;  1VC3 B;  3GTP A;  2O5J D;  5FTM A;  1Y5I A;  2JIQ A;  2NYA A;  4RV0 A;  2JA7 A;  4DMR A;  1PT0 A;  5C18 A;  2V45 A;  1H5N A;  2G6G A;  3IR7 A;  2Y0S A;  1PQF A;  1PYQ A;  2E2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...