3OUGA

Crystal structure of cleaved l-aspartate-alpha-decarboxylase from francisella tularensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
107
Chain Sequence
b'MLISVLKSKISYATVTGKDLFYVSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVDPTRENIKPKLVDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase
molecule tags Lyase
source organism Francisella tularensis subsp. tularensis
publication title Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis
rcsb
total genus 27
structure length 107
sequence length 108
chains with identical sequence B, C, E, F, G, H, I
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02261 Asp_decarbox Aspartate decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3ougA00
1SIWA 1PYQA 5FTMA 4AAYA 5C1BA 1R9TA 2C45A 3QQ7A 1I50A 3FKIA 1DMRA 3CQZA 3QWZA 1PQEA 1QCSA 2B63A 2V3VA 2DMRA 2VPZA 1TWGA 1TWCA 2E2IA 3IR7A 1QDNA 2JIOA 5EPPA 1E32A 1PYUB 3GTQA 1AA6A 5DYGA 1TWFA 1R7RA 2EEOB 3IR5A 2JIRA 1E5VA 4GA6A 4KDIA 5FTKA 5T5MD 1IW7D 1YLEA 1Q16A 4GA5A 4AZDA 4KDLA 1Y5IA 1PQFA 2VUMA 1TWAA 3HU1A 2WB1A 1Y1WA 2NVXA 4RV0A 1KQFA 2R7ZA 3GTOA 1K83A 1SFOA 1KQGA 1R27A 2NVYA 2JA5A 3ML1A 1OGYA 3HU3A 3HKZA 1PPYA 5T5ID 2E2HA 3PLXB 2E7ZA 3CF2A 3GTMA 5FTNA 3GTGA 2V45A 2YU9A 3QC8A 2JIQA 4CS0A 3DMRA 1Y4ZA 3H0GA 1E60A 1TMOA 2WAQA 2JA7A 1CZ5A 1Y1VA 3O5AA 2VPXA 4AYBA 4C2MA 5GLFA 3GTPA 1G8JA 3TM7B 4AOKB 4DMRA 1H0HA 2JIPA 1CR5A 1AW8B 1TWHA 2PMZA 2R93A 2R92A 3GTJA 2VPWA 1I3QA 4CRZA 1PT1A 4CRYG 1FDIA 2VPYA 1E18A 4QIWA 1CZ4A 1DMSA 1S3SA 1H5NA 3GTKA 1WCMA 3QQ8A 1VC3B 4KLNA 2IV2X 1UHDA 3IR6A 1WLFA 3GTLA 5FTLA 2NAPA 3OUGA 3TIWA 1FDOA 1G8KA 1E61A 2JIMA 4KO8A 2Y0SA 3HU2A 4AONB 1EU1A 1UHEA 5B6CA 5DYIA 5C18A 1PQHA 5FTJA 2JA6A 2KI8A 1PT0A 2NYAA 2PJHB 4D7ZB 4KODA
chains in the Genus database with same CATH superfamily
1SIWA 4JP6A 1PYQA 5FTMA 4AAYA 5C1BA 1R9TA 2C45A 3QQ7A 1I50A 3FKIA 1DMRA 1N10A 3CQZA 1PQEA 3QWZA 4JP7A 1QCSA 2B63A 2V3VA 2DMRA 2VPZA 1TWGA 1TWCA 2E2IA 3IR7A 4ZM7A 1QDNA 2JIOA 5EPPA 1E32A 1PYUB 3GTQA 3X2JA 1AA6A 5DYGA 1TWFA 3X2PA 1ZYRD 1R7RA 2KQAA 4JS7A 2EEOB 2A6ED 3IR5A 2JIRA 1E5VA 2A68D 4GA6A 4KDIA 3X2MA 5FTKA 1L8FA 4FFTA 5T5MD 1IW7D 2G6GA 1YLEA 1Q16A 4GA5A 5GLYA 5GM9A 4AZDA 4KDLA 1Y5IA 1PQFA 4FG4A 3X2IA 2VUMA 1TWAA 3HU1A 2WB1A 1Y1WA 1ZC1A 4JJOA 2NVXA 4RV0A 1KQFA 2R7ZA 3GTOA 1K83A 1SFOA 3SUMA 1KQGA 1R27A 2NVYA 4NOHA 1YNND 2JA5A 3ML1A 1OGYA 3HU3A 1OA9A 3HKZA 1PPYA 5T5ID 2E2HA 1YNJD 3M3GA 3PLXB 2E7ZA 3CF2A 3GTMA 5FTNA 3ENGA 3GTGA 2V45A 2YU9A 3QC8A 2JIQA 4CS0A 3DMRA 2AE0X 4FERA 1Y4ZA 3H0GA 1E60A 1TMOA 2BH0A 2WAQA 3D30A 2JA7A 1CZ5A 1Y1VA 3O5AA 2VPXA 4AYBA 4C2MA 5GLFA 3GTPA 1BW3A 1SMYD 1G8JA 3TM7B 1WC2A 4AOKB 2A6HD 2ENGA 4DMRA 3SUKA 1H0HA 1OA7A 2JIPA 5H4UA 3X2KA 1CR5A 1AW8B 2PICA 1TWHA 2PMZA 2R93A 2R92A 3GTJA 4JCWA 2VPWA 3SULA 1I3QA 4CRZA 1PT1A 4CRYG 4FG2A 1FDIA 2VPYA 1E18A 4QIWA 1CZ4A 1DMSA 1S3SA 3X2HA 1H5NA 3SUJA 4ENGA 3GTKA 1WCMA 3QQ8A 1VC3B 2PI8A 3CZBA 4KLNA 3X2GA 2IV2X 1UHDA 3IR6A 1WLFA 4AVRA 3GTLA 5GLXA 2PJJA 2O5JD 5FTLA 2NAPA 3OUGA 3TIWA 1FDOA 2GAEA 1G8KA 1E61A 2JIMA 4KO8A 1HD5A 2Y0SA 3HU2A 4L48A 4AONB 2YUJA 1EU1A 1UHEA 1BW4A 5B6CA 2PNWA 5DYIA 5C18A 1PQHA 5FTJA 2JA6A 2KI8A 2CW0D 2G5DA 1PT0A 2A69D 2NYAA 3X2OA 3X2LA 2HCZX 2BE5D 2PJHB 4D7ZB 3X2NA 4KODA
chains in the Genus database with same CATH topology
1SIWA 1PYQA 5FTMA 4AAYA 5C1BA 1R9TA 2C45A 3QQ7A 1I50A 3FKIA 1DMRA 3CQZA 3QWZA 1PQEA 1QCSA 2B63A 2V3VA 2DMRA 2VPZA 1TWGA 1TWCA 2E2IA 3IR7A 1QDNA 2JIOA 5EPPA 1E32A 1PYUB 3GTQA 1AA6A 5DYGA 1TWFA 1ZYRD 1R7RA 2EEOB 2A6ED 3IR5A 2A68D 1E5VA 2JIRA 4GA6A 4KDIA 5FTKA 5T5MD 1IW7D 2G6GA 1YLEA 1Q16A 4GA5A 4AZDA 4KDLA 1Y5IA 1PQFA 2VUMA 1TWAA 3HU1A 2WB1A 1Y1WA 1ZC1A 2NVXA 4RV0A 1KQFA 2R7ZA 3GTOA 1K83A 1SFOA 1KQGA 1R27A 2NVYA 4NOHA 1YNND 2JA5A 3ML1A 1OGYA 3HU3A 3HKZA 1PPYA 5T5ID 2E2HA 1YNJD 3PLXB 2E7ZA 3CF2A 3GTMA 5FTNA 3GTGA 2V45A 2YU9A 3QC8A 2JIQA 4CS0A 3DMRA 2AE0X 1Y4ZA 3H0GA 1E60A 1TMOA 2WAQA 2JA7A 1CZ5A 1Y1VA 3O5AA 2VPXA 4AYBA 4C2MA 5GLFA 3GTPA 1SMYD 1G8JA 3TM7B 4AOKB 2A6HD 4DMRA 1H0HA 2JIPA 1CR5A 1AW8B 2PICA 1TWHA 2PMZA 2R93A 2R92A 3GTJA 2VPWA 1I3QA 4CRZA 1PT1A 4CRYG 1FDIA 2VPYA 1E18A 4QIWA 1CZ4A 1DMSA 1S3SA 1H5NA 3GTKA 1WCMA 3QQ8A 1VC3B 2PI8A 3CZBA 4KLNA 2IV2X 1UHDA 3IR6A 1WLFA 3GTLA 2PJJA 2O5JD 5FTLA 2NAPA 3OUGA 3TIWA 1FDOA 2GAEA 1G8KA 1E61A 2JIMA 4KO8A 2Y0SA 3HU2A 4AONB 2YUJA 1EU1A 1UHEA 5B6CA 2PNWA 5DYIA 5C18A 1PQHA 5FTJA 2JA6A 2CW0D 2G5DA 2KI8A 1PT0A 2A69D 2NYAA 2BE5D 2PJHB 4D7ZB 4KODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SIW A;  1PYQ A;  5FTM A;  4AAY A;  5C1B A;  1R9T A;  2C45 A;  3QQ7 A;  1I50 A;  3FKI A;  1DMR A;  3CQZ A;  3QWZ A;  1PQE A;  1QCS A;  2B63 A;  2V3V A;  2DMR A;  2VPZ A;  1TWG A;  1TWC A;  2E2I A;  3IR7 A;  1QDN A;  2JIO A;  5EPP A;  1E32 A;  1PYU B;  3GTQ A;  1AA6 A;  5DYG A;  1TWF A;  1R7R A;  2EEO B;  3IR5 A;  2JIR A;  1E5V A;  4GA6 A;  4KDI A;  5FTK A;  5T5M D;  1IW7 D;  1YLE A;  1Q16 A;  4GA5 A;  4AZD A;  4KDL A;  1Y5I A;  1PQF A;  2VUM A;  1TWA A;  3HU1 A;  2WB1 A;  1Y1W A;  2NVX A;  4RV0 A;  1KQF A;  2R7Z A;  3GTO A;  1K83 A;  1SFO A;  1KQG A;  1R27 A;  2NVY A;  2JA5 A;  3ML1 A;  1OGY A;  3HU3 A;  3HKZ A;  1PPY A;  5T5I D;  2E2H A;  3PLX B;  2E7Z A;  3CF2 A;  3GTM A;  5FTN A;  3GTG A;  2V45 A;  2YU9 A;  3QC8 A;  2JIQ A;  4CS0 A;  3DMR A;  1Y4Z A;  3H0G A;  1E60 A;  1TMO A;  2WAQ A;  2JA7 A;  1CZ5 A;  1Y1V A;  3O5A A;  2VPX A;  4AYB A;  4C2M A;  5GLF A;  3GTP A;  1G8J A;  3TM7 B;  4AOK B;  4DMR A;  1H0H A;  2JIP A;  1CR5 A;  1AW8 B;  1TWH A;  2PMZ A;  2R93 A;  2R92 A;  3GTJ A;  2VPW A;  1I3Q A;  4CRZ A;  1PT1 A;  4CRY G;  1FDI A;  2VPY A;  1E18 A;  4QIW A;  1CZ4 A;  1DMS A;  1S3S A;  1H5N A;  3GTK A;  1WCM A;  3QQ8 A;  1VC3 B;  4KLN A;  2IV2 X;  1UHD A;  3IR6 A;  1WLF A;  3GTL A;  5FTL A;  2NAP A;  3OUG A;  3TIW A;  1FDO A;  1G8K A;  1E61 A;  2JIM A;  4KO8 A;  2Y0S A;  3HU2 A;  4AON B;  1EU1 A;  1UHE A;  5B6C A;  5DYI A;  5C18 A;  1PQH A;  5FTJ A;  2JA6 A;  2KI8 A;  1PT0 A;  2NYA A;  2PJH B;  4D7Z B;  4KOD A; 
#chains in the Genus database with same CATH topology
 1SIW A;  4JP6 A;  1PYQ A;  5FTM A;  4AAY A;  5C1B A;  1R9T A;  2C45 A;  3QQ7 A;  1I50 A;  3FKI A;  1DMR A;  1N10 A;  3CQZ A;  1PQE A;  3QWZ A;  4JP7 A;  1QCS A;  2B63 A;  2V3V A;  2DMR A;  2VPZ A;  1TWG A;  1TWC A;  2E2I A;  3IR7 A;  4ZM7 A;  1QDN A;  2JIO A;  5EPP A;  1E32 A;  1PYU B;  3GTQ A;  3X2J A;  1AA6 A;  5DYG A;  1TWF A;  3X2P A;  1ZYR D;  1R7R A;  2KQA A;  4JS7 A;  2EEO B;  2A6E D;  3IR5 A;  2JIR A;  1E5V A;  2A68 D;  4GA6 A;  4KDI A;  3X2M A;  5FTK A;  1L8F A;  4FFT A;  5T5M D;  1IW7 D;  2G6G A;  1YLE A;  1Q16 A;  4GA5 A;  5GLY A;  5GM9 A;  4AZD A;  4KDL A;  1Y5I A;  1PQF A;  4FG4 A;  3X2I A;  2VUM A;  1TWA A;  3HU1 A;  2WB1 A;  1Y1W A;  1ZC1 A;  4JJO A;  2NVX A;  4RV0 A;  1KQF A;  2R7Z A;  3GTO A;  1K83 A;  1SFO A;  3SUM A;  1KQG A;  1R27 A;  2NVY A;  4NOH A;  1YNN D;  2JA5 A;  3ML1 A;  1OGY A;  3HU3 A;  1OA9 A;  3HKZ A;  1PPY A;  5T5I D;  2E2H A;  1YNJ D;  3M3G A;  3PLX B;  2E7Z A;  3CF2 A;  3GTM A;  5FTN A;  3ENG A;  3GTG A;  2V45 A;  2YU9 A;  3QC8 A;  2JIQ A;  4CS0 A;  3DMR A;  2AE0 X;  4FER A;  1Y4Z A;  3H0G A;  1E60 A;  1TMO A;  2BH0 A;  2WAQ A;  3D30 A;  2JA7 A;  1CZ5 A;  1Y1V A;  3O5A A;  2VPX A;  4AYB A;  4C2M A;  5GLF A;  3GTP A;  1BW3 A;  1SMY D;  1G8J A;  3TM7 B;  1WC2 A;  4AOK B;  2A6H D;  2ENG A;  4DMR A;  3SUK A;  1H0H A;  1OA7 A;  2JIP A;  5H4U A;  3X2K A;  1CR5 A;  1AW8 B;  2PIC A;  1TWH A;  2PMZ A;  2R93 A;  2R92 A;  3GTJ A;  4JCW A;  2VPW A;  3SUL A;  1I3Q A;  4CRZ A;  1PT1 A;  4CRY G;  4FG2 A;  1FDI A;  2VPY A;  1E18 A;  4QIW A;  1CZ4 A;  1DMS A;  1S3S A;  3X2H A;  1H5N A;  3SUJ A;  4ENG A;  3GTK A;  1WCM A;  3QQ8 A;  1VC3 B;  2PI8 A;  3CZB A;  4KLN A;  3X2G A;  2IV2 X;  1UHD A;  3IR6 A;  1WLF A;  4AVR A;  3GTL A;  5GLX A;  2PJJ A;  2O5J D;  5FTL A;  2NAP A;  3OUG A;  3TIW A;  1FDO A;  2GAE A;  1G8K A;  1E61 A;  2JIM A;  4KO8 A;  1HD5 A;  2Y0S A;  3HU2 A;  4L48 A;  4AON B;  2YUJ A;  1EU1 A;  1UHE A;  1BW4 A;  5B6C A;  2PNW A;  5DYI A;  5C18 A;  1PQH A;  5FTJ A;  2JA6 A;  2KI8 A;  2CW0 D;  2G5D A;  1PT0 A;  2A69 D;  2NYA A;  3X2O A;  3X2L A;  2HCZ X;  2BE5 D;  2PJH B;  4D7Z B;  3X2N A;  4KOD A; 
#chains in the Genus database with same CATH homology
 1SIW A;  1PYQ A;  5FTM A;  4AAY A;  5C1B A;  1R9T A;  2C45 A;  3QQ7 A;  1I50 A;  3FKI A;  1DMR A;  3CQZ A;  3QWZ A;  1PQE A;  1QCS A;  2B63 A;  2V3V A;  2DMR A;  2VPZ A;  1TWG A;  1TWC A;  2E2I A;  3IR7 A;  1QDN A;  2JIO A;  5EPP A;  1E32 A;  1PYU B;  3GTQ A;  1AA6 A;  5DYG A;  1TWF A;  1ZYR D;  1R7R A;  2EEO B;  2A6E D;  3IR5 A;  2A68 D;  1E5V A;  2JIR A;  4GA6 A;  4KDI A;  5FTK A;  5T5M D;  1IW7 D;  2G6G A;  1YLE A;  1Q16 A;  4GA5 A;  4AZD A;  4KDL A;  1Y5I A;  1PQF A;  2VUM A;  1TWA A;  3HU1 A;  2WB1 A;  1Y1W A;  1ZC1 A;  2NVX A;  4RV0 A;  1KQF A;  2R7Z A;  3GTO A;  1K83 A;  1SFO A;  1KQG A;  1R27 A;  2NVY A;  4NOH A;  1YNN D;  2JA5 A;  3ML1 A;  1OGY A;  3HU3 A;  3HKZ A;  1PPY A;  5T5I D;  2E2H A;  1YNJ D;  3PLX B;  2E7Z A;  3CF2 A;  3GTM A;  5FTN A;  3GTG A;  2V45 A;  2YU9 A;  3QC8 A;  2JIQ A;  4CS0 A;  3DMR A;  2AE0 X;  1Y4Z A;  3H0G A;  1E60 A;  1TMO A;  2WAQ A;  2JA7 A;  1CZ5 A;  1Y1V A;  3O5A A;  2VPX A;  4AYB A;  4C2M A;  5GLF A;  3GTP A;  1SMY D;  1G8J A;  3TM7 B;  4AOK B;  2A6H D;  4DMR A;  1H0H A;  2JIP A;  1CR5 A;  1AW8 B;  2PIC A;  1TWH A;  2PMZ A;  2R93 A;  2R92 A;  3GTJ A;  2VPW A;  1I3Q A;  4CRZ A;  1PT1 A;  4CRY G;  1FDI A;  2VPY A;  1E18 A;  4QIW A;  1CZ4 A;  1DMS A;  1S3S A;  1H5N A;  3GTK A;  1WCM A;  3QQ8 A;  1VC3 B;  2PI8 A;  3CZB A;  4KLN A;  2IV2 X;  1UHD A;  3IR6 A;  1WLF A;  3GTL A;  2PJJ A;  2O5J D;  5FTL A;  2NAP A;  3OUG A;  3TIW A;  1FDO A;  2GAE A;  1G8K A;  1E61 A;  2JIM A;  4KO8 A;  2Y0S A;  3HU2 A;  4AON B;  2YUJ A;  1EU1 A;  1UHE A;  5B6C A;  2PNW A;  5DYI A;  5C18 A;  1PQH A;  5FTJ A;  2JA6 A;  2CW0 D;  2G5D A;  2KI8 A;  1PT0 A;  2A69 D;  2NYA A;  2BE5 D;  2PJH B;  4D7Z B;  4KOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...