3OUGA

Crystal structure of cleaved l-aspartate-alpha-decarboxylase from francisella tularensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
107
Chain Sequence
MLISVLKSKISYATVTGKDLFYVSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVDPTRENIKPKLVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase
total genus 27
structure length 107
sequence length 108
chains with identical sequence B, C, E, F, G, H, I
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02261 Asp_decarbox Aspartate decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3ougA00
3TM7B 1Y1WA 3CQZA 1FDIA 1CZ4A 2R92A 4DMRA 2JIQA 1VC3B 5FTNA 1Q16A 1KQFA 5T5ID 1AW8B 4GA5A 2Y0SA 3HU3A 1PQHA 2VPYA 5FTJA 2YU9A 1QCSA 1WLFA 3ML1A 4RV0A 1TWAA 3TIWA 3QQ7A 5C1BA 1TMOA 1IW7D 2NVYA 2JA7A 3IR6A 1G8KA 2NVXA 2EEOB 2E2HA 3FKIA 3H0GA 2E2IA 2JIPA 5FTKA 3HU2A 2VPZA 2IV2X 1S3SA 3QWZA 2R93A 3OUGA 2VPWA 2WAQA 1TWHA 1SFOA 3GTLA 3CF2A 1PYUB 3GTPA 3IR7A 4CS0A 3DMRA 2B63A 1CZ5A 2JA6A 1G8JA 2JIOA 4AOKB 4AYBA 3GTJA 3GTGA 1SIWA 1I50A 1DMSA 1UHEA 4CRYG 1H0HA 5B6CA 4KLNA 4C2MA 1PT0A 1PYQA 4KODA 1R7RA 4CRZA 3GTQA 3QQ8A 2DMRA 1Y5IA 4KDLA 4KO8A 1E60A 5GLFA 2WB1A 1E61A 2VPXA 4GA6A 2PJHB 4AONB 1DMRA 1K83A 1PPYA 1PQEA 1Y1VA 5FTMA 1R27A 1Y4ZA 2JIRA 2R7ZA 3GTOA 1KQGA 5DYGA 2VUMA 1EU1A 5C18A 4AAYA 5DYIA 1YLEA 2NAPA 1TWFA 3QC8A 4KDIA 3HU1A 1QDNA 3IR5A 1R9TA 1TWCA 3GTMA 1E18A 4AZDA 3PLXB 1OGYA 1UHDA 2KI8A 4QIWA 2V45A 2E7ZA 1CR5A 3GTKA 2NYAA 1E32A 1PT1A 1AA6A 2C45A 3HKZA 5EPPA 1H5NA 1WCMA 1PQFA 2JA5A 3O5AA 5FTLA 2PMZA 5T5MD 1TWGA 1E5VA 2V3VA 4D7ZB 1I3QA 1FDOA 2JIMA
chains in the Genus database with same CATH superfamily
3TM7B 4ENGA 5H4UA 1Y1WA 3CQZA 1FDIA 1CZ4A 2R92A 4DMRA 3SUKA 2JIQA 4L48A 1VC3B 5FTNA 1Q16A 2HCZX 2G6GA 3X2IA 1KQFA 5T5ID 1AW8B 4GA5A 2Y0SA 1N10A 3HU3A 1PQHA 2VPYA 4JP6A 5FTJA 2YU9A 1QCSA 1WLFA 4ZM7A 3ML1A 4RV0A 1TWAA 3TIWA 3QQ7A 2BE5D 1TMOA 3X2JA 1IW7D 5C1BA 2NVYA 1YNJD 3X2PA 2JA7A 3IR6A 1G8KA 2NVXA 2EEOB 2E2HA 3FKIA 3H0GA 2E2IA 2JIPA 1BW3A 5FTKA 3HU2A 1OA9A 2VPZA 2IV2X 3SULA 1S3SA 3QWZA 3ENGA 2R93A 3OUGA 2VPWA 2WAQA 1TWHA 1SFOA 3GTLA 3CF2A 1OA7A 1PYUB 3GTPA 1WC2A 2A69D 3IR7A 4CS0A 3X2GA 2PNWA 3DMRA 2B63A 1CZ5A 3X2KA 2JA6A 1G8JA 2JIOA 5GLYA 5GLXA 3X2LA 1ZC1A 3X2OA 4AOKB 4AYBA 3GTJA 2PI8A 3M3GA 3GTGA 1SIWA 1YNND 1I50A 1DMSA 1UHEA 4CRYG 2KQAA 1H0HA 4KLNA 5B6CA 4C2MA 2AE0X 1PT0A 1PYQA 4KODA 4JJOA 1R7RA 4CRZA 4FG4A 1ZYRD 3GTQA 4JP7A 4FFTA 2O5JD 3QQ8A 3SUJA 3X2HA 3X2MA 2DMRA 4JS7A 1Y5IA 4KDLA 4KO8A 1E60A 5GLFA 2A68D 2WB1A 1E61A 2VPXA 4GA6A 5GM9A 2PJHB 4AONB 1DMRA 1K83A 2CW0D 4AVRA 1PPYA 1PQEA 1Y1VA 2A6HD 2PJJA 5FTMA 1R27A 1Y4ZA 2JIRA 2R7ZA 3GTOA 1KQGA 5DYGA 4FG2A 2VUMA 1EU1A 5C18A 1SMYD 4AAYA 5DYIA 2G5DA 1YLEA 2NAPA 1TWFA 3QC8A 4KDIA 3HU1A 3CZBA 1QDNA 2BH0A 2A6ED 3IR5A 1R9TA 4JCWA 1TWCA 3GTMA 1E18A 4AZDA 3PLXB 1OGYA 1UHDA 2KI8A 4QIWA 2V45A 2E7ZA 3X2NA 2ENGA 1CR5A 1HD5A 3GTKA 2PICA 2YUJA 3D30A 2NYAA 1E32A 1PT1A 1AA6A 4NOHA 1L8FA 2C45A 3HKZA 5EPPA 1H5NA 1WCMA 1PQFA 2JA5A 3O5AA 3SUMA 5FTLA 2PMZA 5T5MD 1TWGA 1BW4A 1E5VA 2V3VA 4D7ZB 4FERA 1I3QA 1FDOA 2JIMA 2GAEA
chains in the Genus database with same CATH topology
3TM7B 1Y1WA 3CQZA 1FDIA 1CZ4A 2R92A 4DMRA 2JIQA 1VC3B 5FTNA 1Q16A 2G6GA 1KQFA 5T5ID 1AW8B 4GA5A 2Y0SA 3HU3A 1PQHA 2VPYA 5FTJA 2YU9A 1QCSA 1WLFA 3ML1A 4RV0A 1TWAA 3TIWA 3QQ7A 2BE5D 1TMOA 5C1BA 1IW7D 2NVYA 1YNJD 2JA7A 3IR6A 1G8KA 2NVXA 2EEOB 2E2HA 3FKIA 3H0GA 2E2IA 2JIPA 5FTKA 3HU2A 2VPZA 2IV2X 1S3SA 3QWZA 2R93A 3OUGA 2VPWA 2WAQA 1TWHA 1SFOA 3GTLA 3CF2A 1PYUB 3GTPA 2A69D 3IR7A 4CS0A 2PNWA 3DMRA 2B63A 1CZ5A 2JA6A 1G8JA 2JIOA 1ZC1A 4AOKB 4AYBA 3GTJA 2PI8A 3GTGA 1SIWA 1YNND 1I50A 1DMSA 1UHEA 4CRYG 1H0HA 5B6CA 4KLNA 4C2MA 2AE0X 1PT0A 1PYQA 4KODA 1R7RA 4CRZA 3GTQA 1ZYRD 2O5JD 3QQ8A 2DMRA 1Y5IA 4KDLA 4KO8A 1E60A 5GLFA 2A68D 2WB1A 1E61A 2VPXA 4GA6A 2PJHB 4AONB 1DMRA 1K83A 2CW0D 1PPYA 1PQEA 1Y1VA 2A6HD 2PJJA 5FTMA 1R27A 1Y4ZA 2JIRA 2R7ZA 3GTOA 1KQGA 5DYGA 2VUMA 1EU1A 5C18A 1SMYD 4AAYA 5DYIA 2G5DA 1YLEA 2NAPA 1TWFA 3QC8A 4KDIA 3HU1A 3CZBA 1QDNA 2A6ED 3IR5A 1R9TA 1TWCA 3GTMA 1E18A 4AZDA 3PLXB 1OGYA 1UHDA 2KI8A 4QIWA 2V45A 2E7ZA 1CR5A 3GTKA 2PICA 2YUJA 2NYAA 1E32A 1PT1A 1AA6A 4NOHA 2C45A 3HKZA 5EPPA 1H5NA 1WCMA 1PQFA 2JA5A 3O5AA 5FTLA 2PMZA 5T5MD 1TWGA 1E5VA 2V3VA 4D7ZB 1I3QA 1FDOA 2JIMA 2GAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TM7 B;  1Y1W A;  3CQZ A;  1FDI A;  1CZ4 A;  2R92 A;  4DMR A;  2JIQ A;  1VC3 B;  5FTN A;  1Q16 A;  1KQF A;  5T5I D;  1AW8 B;  4GA5 A;  2Y0S A;  3HU3 A;  1PQH A;  2VPY A;  5FTJ A;  2YU9 A;  1QCS A;  1WLF A;  3ML1 A;  4RV0 A;  1TWA A;  3TIW A;  3QQ7 A;  5C1B A;  1TMO A;  1IW7 D;  2NVY A;  2JA7 A;  3IR6 A;  1G8K A;  2NVX A;  2EEO B;  2E2H A;  3FKI A;  3H0G A;  2E2I A;  2JIP A;  5FTK A;  3HU2 A;  2VPZ A;  2IV2 X;  1S3S A;  3QWZ A;  2R93 A;  3OUG A;  2VPW A;  2WAQ A;  1TWH A;  1SFO A;  3GTL A;  3CF2 A;  1PYU B;  3GTP A;  3IR7 A;  4CS0 A;  3DMR A;  2B63 A;  1CZ5 A;  2JA6 A;  1G8J A;  2JIO A;  4AOK B;  4AYB A;  3GTJ A;  3GTG A;  1SIW A;  1I50 A;  1DMS A;  1UHE A;  4CRY G;  1H0H A;  5B6C A;  4KLN A;  4C2M A;  1PT0 A;  1PYQ A;  4KOD A;  1R7R A;  4CRZ A;  3GTQ A;  3QQ8 A;  2DMR A;  1Y5I A;  4KDL A;  4KO8 A;  1E60 A;  5GLF A;  2WB1 A;  1E61 A;  2VPX A;  4GA6 A;  2PJH B;  4AON B;  1DMR A;  1K83 A;  1PPY A;  1PQE A;  1Y1V A;  5FTM A;  1R27 A;  1Y4Z A;  2JIR A;  2R7Z A;  3GTO A;  1KQG A;  5DYG A;  2VUM A;  1EU1 A;  5C18 A;  4AAY A;  5DYI A;  1YLE A;  2NAP A;  1TWF A;  3QC8 A;  4KDI A;  3HU1 A;  1QDN A;  3IR5 A;  1R9T A;  1TWC A;  3GTM A;  1E18 A;  4AZD A;  3PLX B;  1OGY A;  1UHD A;  2KI8 A;  4QIW A;  2V45 A;  2E7Z A;  1CR5 A;  3GTK A;  2NYA A;  1E32 A;  1PT1 A;  1AA6 A;  2C45 A;  3HKZ A;  5EPP A;  1H5N A;  1WCM A;  1PQF A;  2JA5 A;  3O5A A;  5FTL A;  2PMZ A;  5T5M D;  1TWG A;  1E5V A;  2V3V A;  4D7Z B;  1I3Q A;  1FDO A;  2JIM A; 
#chains in the Genus database with same CATH topology
 3TM7 B;  4ENG A;  5H4U A;  1Y1W A;  3CQZ A;  1FDI A;  1CZ4 A;  2R92 A;  4DMR A;  3SUK A;  2JIQ A;  4L48 A;  1VC3 B;  5FTN A;  1Q16 A;  2HCZ X;  2G6G A;  3X2I A;  1KQF A;  5T5I D;  1AW8 B;  4GA5 A;  2Y0S A;  1N10 A;  3HU3 A;  1PQH A;  2VPY A;  4JP6 A;  5FTJ A;  2YU9 A;  1QCS A;  1WLF A;  4ZM7 A;  3ML1 A;  4RV0 A;  1TWA A;  3TIW A;  3QQ7 A;  2BE5 D;  1TMO A;  3X2J A;  1IW7 D;  5C1B A;  2NVY A;  1YNJ D;  3X2P A;  2JA7 A;  3IR6 A;  1G8K A;  2NVX A;  2EEO B;  2E2H A;  3FKI A;  3H0G A;  2E2I A;  2JIP A;  1BW3 A;  5FTK A;  3HU2 A;  1OA9 A;  2VPZ A;  2IV2 X;  3SUL A;  1S3S A;  3QWZ A;  3ENG A;  2R93 A;  3OUG A;  2VPW A;  2WAQ A;  1TWH A;  1SFO A;  3GTL A;  3CF2 A;  1OA7 A;  1PYU B;  3GTP A;  1WC2 A;  2A69 D;  3IR7 A;  4CS0 A;  3X2G A;  2PNW A;  3DMR A;  2B63 A;  1CZ5 A;  3X2K A;  2JA6 A;  1G8J A;  2JIO A;  5GLY A;  5GLX A;  3X2L A;  1ZC1 A;  3X2O A;  4AOK B;  4AYB A;  3GTJ A;  2PI8 A;  3M3G A;  3GTG A;  1SIW A;  1YNN D;  1I50 A;  1DMS A;  1UHE A;  4CRY G;  2KQA A;  1H0H A;  4KLN A;  5B6C A;  4C2M A;  2AE0 X;  1PT0 A;  1PYQ A;  4KOD A;  4JJO A;  1R7R A;  4CRZ A;  4FG4 A;  1ZYR D;  3GTQ A;  4JP7 A;  4FFT A;  2O5J D;  3QQ8 A;  3SUJ A;  3X2H A;  3X2M A;  2DMR A;  4JS7 A;  1Y5I A;  4KDL A;  4KO8 A;  1E60 A;  5GLF A;  2A68 D;  2WB1 A;  1E61 A;  2VPX A;  4GA6 A;  5GM9 A;  2PJH B;  4AON B;  1DMR A;  1K83 A;  2CW0 D;  4AVR A;  1PPY A;  1PQE A;  1Y1V A;  2A6H D;  2PJJ A;  5FTM A;  1R27 A;  1Y4Z A;  2JIR A;  2R7Z A;  3GTO A;  1KQG A;  5DYG A;  4FG2 A;  2VUM A;  1EU1 A;  5C18 A;  1SMY D;  4AAY A;  5DYI A;  2G5D A;  1YLE A;  2NAP A;  1TWF A;  3QC8 A;  4KDI A;  3HU1 A;  3CZB A;  1QDN A;  2BH0 A;  2A6E D;  3IR5 A;  1R9T A;  4JCW A;  1TWC A;  3GTM A;  1E18 A;  4AZD A;  3PLX B;  1OGY A;  1UHD A;  2KI8 A;  4QIW A;  2V45 A;  2E7Z A;  3X2N A;  2ENG A;  1CR5 A;  1HD5 A;  3GTK A;  2PIC A;  2YUJ A;  3D30 A;  2NYA A;  1E32 A;  1PT1 A;  1AA6 A;  4NOH A;  1L8F A;  2C45 A;  3HKZ A;  5EPP A;  1H5N A;  1WCM A;  1PQF A;  2JA5 A;  3O5A A;  3SUM A;  5FTL A;  2PMZ A;  5T5M D;  1TWG A;  1BW4 A;  1E5V A;  2V3V A;  4D7Z B;  4FER A;  1I3Q A;  1FDO A;  2JIM A;  2GAE A; 
#chains in the Genus database with same CATH homology
 3TM7 B;  1Y1W A;  3CQZ A;  1FDI A;  1CZ4 A;  2R92 A;  4DMR A;  2JIQ A;  1VC3 B;  5FTN A;  1Q16 A;  2G6G A;  1KQF A;  5T5I D;  1AW8 B;  4GA5 A;  2Y0S A;  3HU3 A;  1PQH A;  2VPY A;  5FTJ A;  2YU9 A;  1QCS A;  1WLF A;  3ML1 A;  4RV0 A;  1TWA A;  3TIW A;  3QQ7 A;  2BE5 D;  1TMO A;  5C1B A;  1IW7 D;  2NVY A;  1YNJ D;  2JA7 A;  3IR6 A;  1G8K A;  2NVX A;  2EEO B;  2E2H A;  3FKI A;  3H0G A;  2E2I A;  2JIP A;  5FTK A;  3HU2 A;  2VPZ A;  2IV2 X;  1S3S A;  3QWZ A;  2R93 A;  3OUG A;  2VPW A;  2WAQ A;  1TWH A;  1SFO A;  3GTL A;  3CF2 A;  1PYU B;  3GTP A;  2A69 D;  3IR7 A;  4CS0 A;  2PNW A;  3DMR A;  2B63 A;  1CZ5 A;  2JA6 A;  1G8J A;  2JIO A;  1ZC1 A;  4AOK B;  4AYB A;  3GTJ A;  2PI8 A;  3GTG A;  1SIW A;  1YNN D;  1I50 A;  1DMS A;  1UHE A;  4CRY G;  1H0H A;  5B6C A;  4KLN A;  4C2M A;  2AE0 X;  1PT0 A;  1PYQ A;  4KOD A;  1R7R A;  4CRZ A;  3GTQ A;  1ZYR D;  2O5J D;  3QQ8 A;  2DMR A;  1Y5I A;  4KDL A;  4KO8 A;  1E60 A;  5GLF A;  2A68 D;  2WB1 A;  1E61 A;  2VPX A;  4GA6 A;  2PJH B;  4AON B;  1DMR A;  1K83 A;  2CW0 D;  1PPY A;  1PQE A;  1Y1V A;  2A6H D;  2PJJ A;  5FTM A;  1R27 A;  1Y4Z A;  2JIR A;  2R7Z A;  3GTO A;  1KQG A;  5DYG A;  2VUM A;  1EU1 A;  5C18 A;  1SMY D;  4AAY A;  5DYI A;  2G5D A;  1YLE A;  2NAP A;  1TWF A;  3QC8 A;  4KDI A;  3HU1 A;  3CZB A;  1QDN A;  2A6E D;  3IR5 A;  1R9T A;  1TWC A;  3GTM A;  1E18 A;  4AZD A;  3PLX B;  1OGY A;  1UHD A;  2KI8 A;  4QIW A;  2V45 A;  2E7Z A;  1CR5 A;  3GTK A;  2PIC A;  2YUJ A;  2NYA A;  1E32 A;  1PT1 A;  1AA6 A;  4NOH A;  2C45 A;  3HKZ A;  5EPP A;  1H5N A;  1WCM A;  1PQF A;  2JA5 A;  3O5A A;  5FTL A;  2PMZ A;  5T5M D;  1TWG A;  1E5V A;  2V3V A;  4D7Z B;  1I3Q A;  1FDO A;  2JIM A;  2GAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...