3OUGA

Crystal structure of cleaved l-aspartate-alpha-decarboxylase from francisella tularensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
107
Chain Sequence
MLISVLKSKISYATVTGKDLFYVSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVDPTRENIKPKLVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase
total genus 27
structure length 107
sequence length 108
chains with identical sequence B, C, E, F, G, H, I
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02261 Asp_decarbox Aspartate decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3ougA00
5FTJA 1UHEA 1SFOA 3HU1A 4AOKB 3QQ8A 3ML1A 3GTPA 2NAPA 2JIQA 1CZ5A 2JA7A 1VC3B 1TWHA 1TWGA 1FDIA 1YLEA 4KODA 2PMZA 5GLFA 1Y5IA 3HKZA 1DMSA 1PQHA 3HU2A 1TWFA 2YU9A 2JIRA 2JIOA 1SIWA 1Y1WA 1S3SA 1UHDA 2R93A 1TWCA 2JIPA 2NYAA 3IR6A 1QCSA 4AAYA 2E7ZA 1H5NA 1Y1VA 1QDNA 3FKIA 5DYIA 1E61A 1PT0A 2NVXA 1E5VA 1E32A 1KQGA 1PPYA 4RV0A 4AZDA 2JA6A 2V45A 5C1BA 2Y0SA 3GTQA 1OGYA 1E60A 5B6CA 3TM7B 1G8KA 4D7ZB 5T5MD 3GTGA 2V3VA 2EEOB 1TMOA 3QC8A 4GA5A 1CZ4A 1KQFA 1CR5A 1R7RA 2PJHB 3HU3A 1R27A 5DYGA 1H0HA 4GA6A 3GTLA 1WCMA 1PQEA 3H0GA 1Y4ZA 3DMRA 3IR7A 5C18A 3TIWA 1AA6A 5T5ID 1I3QA 3GTKA 2NVYA 1WLFA 2R92A 3CF2A 4CRYG 2VUMA 1TWAA 2C45A 1G8JA 1Q16A 3PLXB 2WAQA 4C2MA 2E2HA 1DMRA 3OUGA 4AYBA 1EU1A 4CRZA 4CS0A 2JIMA 1AW8B 2DMRA 4KO8A 1E18A 2VPYA 1PT1A 1IW7D 2JA5A 2KI8A 5FTMA 1PQFA 3QWZA 2VPZA 4KLNA 5EPPA 4QIWA 5FTKA 3IR5A 4KDIA 5FTNA 1K83A 3GTMA 4KDLA 1PYQA 2E2IA 2VPWA 3GTOA 2IV2X 3QQ7A 4AONB 4DMRA 3GTJA 1FDOA 1PYUB 5FTLA 3O5AA 1R9TA 2WB1A 2R7ZA 2B63A 2VPXA 3CQZA 1I50A
chains in the Genus database with same CATH superfamily
1L8FA 5FTJA 1UHEA 1SFOA 3HU1A 4JP6A 3QQ8A 4AOKB 4JP7A 3ML1A 3GTPA 2NAPA 2JIQA 1CZ5A 2O5JD 2JA7A 1VC3B 1TWHA 2A68D 1TWGA 1BW4A 1FDIA 1YLEA 4KODA 4ENGA 5GLFA 1Y5IA 2PNWA 3HKZA 1DMSA 3SUJA 2BE5D 1PQHA 3HU2A 4JS7A 1TWFA 2YU9A 2JIRA 2JIOA 1SIWA 1YNJD 2G6GA 1Y1WA 1S3SA 1UHDA 4FERA 2R93A 1TWCA 2JIPA 3ENGA 1ZC1A 2NYAA 2A69D 3X2KA 4ZM7A 3IR6A 1QCSA 3X2IA 4AAYA 2ENGA 2E7ZA 1H5NA 1BW3A 1Y1VA 1QDNA 3SUMA 3X2NA 3FKIA 5DYIA 1E61A 1PT0A 2NVXA 3SULA 1E5VA 1E32A 1KQGA 1PPYA 4RV0A 2HCZX 2PICA 1WC2A 4AZDA 2JA6A 2V45A 5C1BA 2Y0SA 4FG2A 5GLXA 2CW0D 3GTQA 1OGYA 2KQAA 1E60A 5B6CA 3TM7B 1G8KA 4D7ZB 3M3GA 5T5MD 3SUKA 3GTGA 3CZBA 3X2MA 2V3VA 2A6ED 2EEOB 1TMOA 3QC8A 1N10A 4GA5A 1CZ4A 4NOHA 5GM9A 1CR5A 1KQFA 1R7RA 2PJHB 3HU3A 1R27A 2YUJA 5DYGA 1H0HA 3D30A 4GA6A 3GTLA 1WCMA 1PQEA 3H0GA 2A6HD 1Y4ZA 3DMRA 3IR7A 4AVRA 5C18A 4JJOA 3TIWA 1AA6A 5T5ID 1OA9A 1I3QA 3GTKA 2NVYA 3X2JA 4FFTA 1WLFA 2R92A 3CF2A 4CRYG 2VUMA 1TWAA 3X2GA 2C45A 1G8JA 4JCWA 1Q16A 3PLXB 2WAQA 4C2MA 1HD5A 2E2HA 1DMRA 3OUGA 1ZYRD 3X2PA 4AYBA 2PI8A 1EU1A 1OA7A 4CRZA 4CS0A 2JIMA 4FG4A 1AW8B 2DMRA 4KO8A 1E18A 2VPYA 1PT1A 1IW7D 2JA5A 2KI8A 2AE0X 5FTMA 2PJJA 1PQFA 3QWZA 2VPZA 4KLNA 5EPPA 4QIWA 5FTKA 3IR5A 4KDIA 5FTNA 3X2OA 1K83A 3GTMA 5GLYA 1YNND 4KDLA 2G5DA 1PYQA 2E2IA 2BH0A 2VPWA 3GTOA 2IV2X 3X2LA 3QQ7A 4AONB 4DMRA 3X2HA 4L48A 3GTJA 1FDOA 1PYUB 5FTLA 3CQZA 3O5AA 5H4UA 2GAEA 1R9TA 2WB1A 2R7ZA 1SMYD 2B63A 2VPXA 2PMZA 1I50A
chains in the Genus database with same CATH topology
5FTJA 1UHEA 1SFOA 3HU1A 4AOKB 3QQ8A 3ML1A 3GTPA 2NAPA 2JIQA 1CZ5A 2O5JD 2JA7A 1VC3B 1TWHA 2A68D 1TWGA 1FDIA 1YLEA 4KODA 5GLFA 1Y5IA 2PNWA 3HKZA 1DMSA 2BE5D 1PQHA 3HU2A 1TWFA 2YU9A 2JIRA 2JIOA 1SIWA 1YNJD 2G6GA 1Y1WA 1S3SA 1UHDA 2R93A 1TWCA 2JIPA 1ZC1A 2NYAA 2A69D 3IR6A 1QCSA 4AAYA 2E7ZA 1H5NA 1Y1VA 1QDNA 3FKIA 5DYIA 1E61A 1PT0A 2NVXA 1E5VA 1E32A 1KQGA 1PPYA 4RV0A 2PICA 4AZDA 2JA6A 2V45A 5C1BA 2Y0SA 3GTQA 2CW0D 1OGYA 1E60A 5B6CA 3TM7B 1G8KA 4D7ZB 5T5MD 3GTGA 3CZBA 2V3VA 2A6ED 2EEOB 1TMOA 3QC8A 4GA5A 1CZ4A 4NOHA 1KQFA 1CR5A 1R7RA 2PJHB 3HU3A 1R27A 2YUJA 5DYGA 1H0HA 4GA6A 3GTLA 1WCMA 1PQEA 3H0GA 2A6HD 1Y4ZA 3DMRA 3IR7A 5C18A 3TIWA 1AA6A 5T5ID 1I3QA 3GTKA 2NVYA 1WLFA 2R92A 3CF2A 4CRYG 2VUMA 1TWAA 2C45A 1G8JA 1Q16A 3PLXB 2WAQA 4C2MA 2E2HA 1DMRA 3OUGA 1ZYRD 4AYBA 2PI8A 1EU1A 4CRZA 4CS0A 2JIMA 1AW8B 2DMRA 4KO8A 1E18A 2VPYA 1PT1A 1IW7D 2JA5A 2KI8A 2AE0X 5FTMA 2PJJA 1PQFA 3QWZA 2VPZA 4KLNA 5EPPA 4QIWA 5FTKA 3IR5A 4KDIA 5FTNA 1K83A 3GTMA 1YNND 4KDLA 2G5DA 1PYQA 2E2IA 2VPWA 3GTOA 2IV2X 3QQ7A 4AONB 4DMRA 3GTJA 1FDOA 1PYUB 5FTLA 3CQZA 3O5AA 2GAEA 1R9TA 2WB1A 2R7ZA 1SMYD 2B63A 2VPXA 2PMZA 1I50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTJ A;  1UHE A;  1SFO A;  3HU1 A;  4AOK B;  3QQ8 A;  3ML1 A;  3GTP A;  2NAP A;  2JIQ A;  1CZ5 A;  2JA7 A;  1VC3 B;  1TWH A;  1TWG A;  1FDI A;  1YLE A;  4KOD A;  2PMZ A;  5GLF A;  1Y5I A;  3HKZ A;  1DMS A;  1PQH A;  3HU2 A;  1TWF A;  2YU9 A;  2JIR A;  2JIO A;  1SIW A;  1Y1W A;  1S3S A;  1UHD A;  2R93 A;  1TWC A;  2JIP A;  2NYA A;  3IR6 A;  1QCS A;  4AAY A;  2E7Z A;  1H5N A;  1Y1V A;  1QDN A;  3FKI A;  5DYI A;  1E61 A;  1PT0 A;  2NVX A;  1E5V A;  1E32 A;  1KQG A;  1PPY A;  4RV0 A;  4AZD A;  2JA6 A;  2V45 A;  5C1B A;  2Y0S A;  3GTQ A;  1OGY A;  1E60 A;  5B6C A;  3TM7 B;  1G8K A;  4D7Z B;  5T5M D;  3GTG A;  2V3V A;  2EEO B;  1TMO A;  3QC8 A;  4GA5 A;  1CZ4 A;  1KQF A;  1CR5 A;  1R7R A;  2PJH B;  3HU3 A;  1R27 A;  5DYG A;  1H0H A;  4GA6 A;  3GTL A;  1WCM A;  1PQE A;  3H0G A;  1Y4Z A;  3DMR A;  3IR7 A;  5C18 A;  3TIW A;  1AA6 A;  5T5I D;  1I3Q A;  3GTK A;  2NVY A;  1WLF A;  2R92 A;  3CF2 A;  4CRY G;  2VUM A;  1TWA A;  2C45 A;  1G8J A;  1Q16 A;  3PLX B;  2WAQ A;  4C2M A;  2E2H A;  1DMR A;  3OUG A;  4AYB A;  1EU1 A;  4CRZ A;  4CS0 A;  2JIM A;  1AW8 B;  2DMR A;  4KO8 A;  1E18 A;  2VPY A;  1PT1 A;  1IW7 D;  2JA5 A;  2KI8 A;  5FTM A;  1PQF A;  3QWZ A;  2VPZ A;  4KLN A;  5EPP A;  4QIW A;  5FTK A;  3IR5 A;  4KDI A;  5FTN A;  1K83 A;  3GTM A;  4KDL A;  1PYQ A;  2E2I A;  2VPW A;  3GTO A;  2IV2 X;  3QQ7 A;  4AON B;  4DMR A;  3GTJ A;  1FDO A;  1PYU B;  5FTL A;  3O5A A;  1R9T A;  2WB1 A;  2R7Z A;  2B63 A;  2VPX A;  3CQZ A;  1I50 A; 
#chains in the Genus database with same CATH topology
 1L8F A;  5FTJ A;  1UHE A;  1SFO A;  3HU1 A;  4JP6 A;  3QQ8 A;  4AOK B;  4JP7 A;  3ML1 A;  3GTP A;  2NAP A;  2JIQ A;  1CZ5 A;  2O5J D;  2JA7 A;  1VC3 B;  1TWH A;  2A68 D;  1TWG A;  1BW4 A;  1FDI A;  1YLE A;  4KOD A;  4ENG A;  5GLF A;  1Y5I A;  2PNW A;  3HKZ A;  1DMS A;  3SUJ A;  2BE5 D;  1PQH A;  3HU2 A;  4JS7 A;  1TWF A;  2YU9 A;  2JIR A;  2JIO A;  1SIW A;  1YNJ D;  2G6G A;  1Y1W A;  1S3S A;  1UHD A;  4FER A;  2R93 A;  1TWC A;  2JIP A;  3ENG A;  1ZC1 A;  2NYA A;  2A69 D;  3X2K A;  4ZM7 A;  3IR6 A;  1QCS A;  3X2I A;  4AAY A;  2ENG A;  2E7Z A;  1H5N A;  1BW3 A;  1Y1V A;  1QDN A;  3SUM A;  3X2N A;  3FKI A;  5DYI A;  1E61 A;  1PT0 A;  2NVX A;  3SUL A;  1E5V A;  1E32 A;  1KQG A;  1PPY A;  4RV0 A;  2HCZ X;  2PIC A;  1WC2 A;  4AZD A;  2JA6 A;  2V45 A;  5C1B A;  2Y0S A;  4FG2 A;  5GLX A;  2CW0 D;  3GTQ A;  1OGY A;  2KQA A;  1E60 A;  5B6C A;  3TM7 B;  1G8K A;  4D7Z B;  3M3G A;  5T5M D;  3SUK A;  3GTG A;  3CZB A;  3X2M A;  2V3V A;  2A6E D;  2EEO B;  1TMO A;  3QC8 A;  1N10 A;  4GA5 A;  1CZ4 A;  4NOH A;  5GM9 A;  1CR5 A;  1KQF A;  1R7R A;  2PJH B;  3HU3 A;  1R27 A;  2YUJ A;  5DYG A;  1H0H A;  3D30 A;  4GA6 A;  3GTL A;  1WCM A;  1PQE A;  3H0G A;  2A6H D;  1Y4Z A;  3DMR A;  3IR7 A;  4AVR A;  5C18 A;  4JJO A;  3TIW A;  1AA6 A;  5T5I D;  1OA9 A;  1I3Q A;  3GTK A;  2NVY A;  3X2J A;  4FFT A;  1WLF A;  2R92 A;  3CF2 A;  4CRY G;  2VUM A;  1TWA A;  3X2G A;  2C45 A;  1G8J A;  4JCW A;  1Q16 A;  3PLX B;  2WAQ A;  4C2M A;  1HD5 A;  2E2H A;  1DMR A;  3OUG A;  1ZYR D;  3X2P A;  4AYB A;  2PI8 A;  1EU1 A;  1OA7 A;  4CRZ A;  4CS0 A;  2JIM A;  4FG4 A;  1AW8 B;  2DMR A;  4KO8 A;  1E18 A;  2VPY A;  1PT1 A;  1IW7 D;  2JA5 A;  2KI8 A;  2AE0 X;  5FTM A;  2PJJ A;  1PQF A;  3QWZ A;  2VPZ A;  4KLN A;  5EPP A;  4QIW A;  5FTK A;  3IR5 A;  4KDI A;  5FTN A;  3X2O A;  1K83 A;  3GTM A;  5GLY A;  1YNN D;  4KDL A;  2G5D A;  1PYQ A;  2E2I A;  2BH0 A;  2VPW A;  3GTO A;  2IV2 X;  3X2L A;  3QQ7 A;  4AON B;  4DMR A;  3X2H A;  4L48 A;  3GTJ A;  1FDO A;  1PYU B;  5FTL A;  3CQZ A;  3O5A A;  5H4U A;  2GAE A;  1R9T A;  2WB1 A;  2R7Z A;  1SMY D;  2B63 A;  2VPX A;  2PMZ A;  1I50 A; 
#chains in the Genus database with same CATH homology
 5FTJ A;  1UHE A;  1SFO A;  3HU1 A;  4AOK B;  3QQ8 A;  3ML1 A;  3GTP A;  2NAP A;  2JIQ A;  1CZ5 A;  2O5J D;  2JA7 A;  1VC3 B;  1TWH A;  2A68 D;  1TWG A;  1FDI A;  1YLE A;  4KOD A;  5GLF A;  1Y5I A;  2PNW A;  3HKZ A;  1DMS A;  2BE5 D;  1PQH A;  3HU2 A;  1TWF A;  2YU9 A;  2JIR A;  2JIO A;  1SIW A;  1YNJ D;  2G6G A;  1Y1W A;  1S3S A;  1UHD A;  2R93 A;  1TWC A;  2JIP A;  1ZC1 A;  2NYA A;  2A69 D;  3IR6 A;  1QCS A;  4AAY A;  2E7Z A;  1H5N A;  1Y1V A;  1QDN A;  3FKI A;  5DYI A;  1E61 A;  1PT0 A;  2NVX A;  1E5V A;  1E32 A;  1KQG A;  1PPY A;  4RV0 A;  2PIC A;  4AZD A;  2JA6 A;  2V45 A;  5C1B A;  2Y0S A;  3GTQ A;  2CW0 D;  1OGY A;  1E60 A;  5B6C A;  3TM7 B;  1G8K A;  4D7Z B;  5T5M D;  3GTG A;  3CZB A;  2V3V A;  2A6E D;  2EEO B;  1TMO A;  3QC8 A;  4GA5 A;  1CZ4 A;  4NOH A;  1KQF A;  1CR5 A;  1R7R A;  2PJH B;  3HU3 A;  1R27 A;  2YUJ A;  5DYG A;  1H0H A;  4GA6 A;  3GTL A;  1WCM A;  1PQE A;  3H0G A;  2A6H D;  1Y4Z A;  3DMR A;  3IR7 A;  5C18 A;  3TIW A;  1AA6 A;  5T5I D;  1I3Q A;  3GTK A;  2NVY A;  1WLF A;  2R92 A;  3CF2 A;  4CRY G;  2VUM A;  1TWA A;  2C45 A;  1G8J A;  1Q16 A;  3PLX B;  2WAQ A;  4C2M A;  2E2H A;  1DMR A;  3OUG A;  1ZYR D;  4AYB A;  2PI8 A;  1EU1 A;  4CRZ A;  4CS0 A;  2JIM A;  1AW8 B;  2DMR A;  4KO8 A;  1E18 A;  2VPY A;  1PT1 A;  1IW7 D;  2JA5 A;  2KI8 A;  2AE0 X;  5FTM A;  2PJJ A;  1PQF A;  3QWZ A;  2VPZ A;  4KLN A;  5EPP A;  4QIW A;  5FTK A;  3IR5 A;  4KDI A;  5FTN A;  1K83 A;  3GTM A;  1YNN D;  4KDL A;  2G5D A;  1PYQ A;  2E2I A;  2VPW A;  3GTO A;  2IV2 X;  3QQ7 A;  4AON B;  4DMR A;  3GTJ A;  1FDO A;  1PYU B;  5FTL A;  3CQZ A;  3O5A A;  2GAE A;  1R9T A;  2WB1 A;  2R7Z A;  1SMY D;  2B63 A;  2VPX A;  2PMZ A;  1I50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...