3OUGA

Crystal structure of cleaved l-aspartate-alpha-decarboxylase from francisella tularensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
107
Chain Sequence
MLISVLKSKISYATVTGKDLFYVSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVDPTRENIKPKLVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase
publication title Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 27
structure length 107
sequence length 108
chains with identical sequence B, C, E, F, G, H, I
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02261 Asp_decarbox Aspartate decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3ougA00
5DYGA 4QIWA 3OUGA 3HU3A 3ML1A 1PPYA 2PJHB 2JA7A 3GTLA 2VPZA 1CZ4A 1PT0A 5EPPA 3GTPA 5FTJA 2VPXA 1OGYA 1AW8B 2EEOB 2VPYA 4CRYG 3TIWA 2B63A 1WCMA 2JA6A 1R27A 4KO8A 2JIQA 5DYIA 2DMRA 3IR6A 4AYBA 3QQ8A 2WB1A 1TWAA 1E32A 2JA5A 4AONB 5T5MD 1G8KA 1CR5A 3CQZA 3HKZA 1TWGA 3TM7B 1Y4ZA 5FTKA 1H0HA 5C18A 3O5AA 2IV2X 1KQGA 4AAYA 4CRZA 2E7ZA 3HU2A 1PT1A 1I50A 3DMRA 3HU1A 1DMRA 1KQFA 1FDOA 3CF2A 1E60A 2JIPA 1Y1VA 1PQEA 1QCSA 4CS0A 3GTGA 1DMSA 1CZ5A 2NVYA 2E2IA 4RV0A 1G8JA 1S3SA 2R93A 1R7RA 2V45A 2JIMA 4KDLA 2VPWA 3GTQA 2NVXA 3QWZA 4KODA 1PQHA 3GTOA 2VUMA 2C45A 2NYAA 2E2HA 1FDIA 4AZDA 1K83A 1IW7D 4C2MA 2PMZA 1E5VA 1WLFA 1YLEA 4D7ZB 1R9TA 3GTJA 1UHDA 3PLXB 4GA5A 1I3QA 5GLFA 1VC3B 2NAPA 2KI8A 1PYUB 1PYQA 1Y5IA 4KLNA 5C1BA 5T5ID 3IR7A 1TMOA 1Q16A 1UHEA 1TWCA 5FTNA 1H5NA 3GTKA 3QC8A 1PQFA 2JIOA 2R7ZA 1E61A 1TWFA 3IR5A 3H0GA 4GA6A 5B6CA 5FTLA 1AA6A 2R92A 1QDNA 2Y0SA 1Y1WA 4KDIA 3GTMA 3QQ7A 2V3VA 2JIRA 1SFOA 2WAQA 1EU1A 1TWHA 1SIWA 1E18A 4AOKB 2YU9A 5FTMA 4DMRA 3FKIA
chains in the Genus database with same CATH superfamily
1OA9A 4QIWA 2G6GA 3OUGA 5DYGA 3HU3A 3ML1A 1PPYA 5GM9A 2PJHB 3X2MA 4JS7A 3X2GA 2JA7A 3GTLA 2VPZA 1CZ4A 1PT0A 3SUJA 2O5JD 5EPPA 3GTPA 5FTJA 2VPXA 1AW8B 1OGYA 2EEOB 1HD5A 2VPYA 4CRYG 3TIWA 2B63A 1ZYRD 1WCMA 2JA6A 1R27A 1YNJD 4KO8A 4NOHA 2JIQA 5DYIA 2A68D 2DMRA 3IR6A 4AYBA 3QQ8A 2WB1A 5H4UA 3X2JA 1TWAA 1E32A 2JA5A 4AONB 2G5DA 5T5MD 1G8KA 1CR5A 3CQZA 3HKZA 3M3GA 1N10A 1TWGA 4L48A 3TM7B 1Y4ZA 2PI8A 2BE5D 5FTKA 1H0HA 5C18A 2KQAA 3X2LA 1SMYD 3O5AA 2IV2X 4FERA 1KQGA 4AAYA 4CRZA 2E7ZA 3HU2A 1PT1A 1I50A 4FG2A 4JCWA 3DMRA 3HU1A 1DMRA 1OA7A 1KQFA 1FDOA 3CF2A 1E60A 3SUKA 2JIPA 1Y1VA 2AE0X 3ENGA 1PQEA 1QCSA 4ZM7A 4CS0A 3GTGA 1DMSA 1CZ5A 3SUMA 2NVYA 2E2IA 4RV0A 2ENGA 1G8JA 1S3SA 2R93A 2PJJA 3CZBA 1R7RA 2V45A 2JIMA 4JJOA 3X2OA 4KDLA 2VPWA 3GTQA 2NVXA 3QWZA 3X2HA 4KODA 1PQHA 2CW0D 3GTOA 2C45A 2VUMA 1BW3A 2NYAA 2E2HA 2GAEA 1FDIA 1L8FA 4JP6A 4AZDA 1K83A 1WC2A 1IW7D 4C2MA 2PMZA 3X2KA 1E5VA 1WLFA 1YLEA 4D7ZB 1R9TA 3GTJA 5GLYA 1UHDA 3PLXB 4FFTA 4GA5A 1I3QA 5GLFA 2YUJA 1VC3B 3SULA 2NAPA 2KI8A 1PYUB 1PYQA 1Y5IA 2PICA 4KLNA 5C1BA 5T5ID 3IR7A 1TMOA 1Q16A 1UHEA 1TWCA 5FTNA 2BH0A 2PNWA 1H5NA 3GTKA 3QC8A 1PQFA 2JIOA 3X2NA 3X2IA 2R7ZA 2HCZX 1E61A 1TWFA 3IR5A 3H0GA 5GLXA 4ENGA 4GA6A 5B6CA 5FTLA 1AA6A 2R92A 1QDNA 3X2PA 2A6ED 1ZC1A 2Y0SA 1Y1WA 4KDIA 3GTMA 1BW4A 3QQ7A 2V3VA 2JIRA 1SFOA 1YNND 2WAQA 1EU1A 1TWHA 1SIWA 1E18A 4JP7A 4AOKB 2YU9A 2A6HD 3D30A 5FTMA 4AVRA 4DMRA 2A69D 3FKIA 4FG4A
chains in the Genus database with same CATH topology
5DYGA 4QIWA 2G6GA 3OUGA 3HU3A 3ML1A 1PPYA 2PJHB 2JA7A 3GTLA 2VPZA 1CZ4A 1PT0A 2O5JD 5EPPA 3GTPA 5FTJA 2VPXA 1OGYA 1AW8B 2EEOB 2VPYA 4CRYG 3TIWA 2B63A 1ZYRD 1WCMA 2JA6A 1R27A 1YNJD 4KO8A 4NOHA 2JIQA 5DYIA 2A68D 2DMRA 3IR6A 4AYBA 3QQ8A 2WB1A 1TWAA 1E32A 2JA5A 4AONB 2G5DA 5T5MD 1G8KA 1CR5A 3CQZA 3HKZA 1TWGA 3TM7B 1Y4ZA 2PI8A 2BE5D 5FTKA 1H0HA 5C18A 1SMYD 3O5AA 2IV2X 1KQGA 4AAYA 4CRZA 2E7ZA 3HU2A 1PT1A 1I50A 3DMRA 3HU1A 1DMRA 1KQFA 1FDOA 3CF2A 1E60A 2JIPA 1Y1VA 2AE0X 1PQEA 1QCSA 4CS0A 3GTGA 1DMSA 1CZ5A 2NVYA 2E2IA 4RV0A 1G8JA 1S3SA 2R93A 2PJJA 3CZBA 1R7RA 2V45A 2JIMA 4KDLA 2VPWA 3GTQA 2NVXA 3QWZA 4KODA 1PQHA 2CW0D 3GTOA 2C45A 2VUMA 2NYAA 2E2HA 2GAEA 1FDIA 4AZDA 1K83A 1IW7D 4C2MA 2PMZA 1E5VA 1WLFA 1YLEA 4D7ZB 1R9TA 3GTJA 1UHDA 3PLXB 4GA5A 1I3QA 5GLFA 2YUJA 1VC3B 2NAPA 2KI8A 1PYUB 2PICA 1PYQA 1Y5IA 4KLNA 5C1BA 5T5ID 3IR7A 1TMOA 1Q16A 1UHEA 1TWCA 5FTNA 2PNWA 1H5NA 3GTKA 3QC8A 1PQFA 2JIOA 2R7ZA 1E61A 1TWFA 3IR5A 3H0GA 4GA6A 5B6CA 5FTLA 1AA6A 2R92A 1QDNA 2A6ED 1ZC1A 2Y0SA 1Y1WA 4KDIA 3GTMA 3QQ7A 2V3VA 2JIRA 1SFOA 1YNND 2WAQA 1EU1A 1TWHA 1SIWA 1E18A 4AOKB 2YU9A 2A6HD 5FTMA 4DMRA 2A69D 3FKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYG A;  4QIW A;  3OUG A;  3HU3 A;  3ML1 A;  1PPY A;  2PJH B;  2JA7 A;  3GTL A;  2VPZ A;  1CZ4 A;  1PT0 A;  5EPP A;  3GTP A;  5FTJ A;  2VPX A;  1OGY A;  1AW8 B;  2EEO B;  2VPY A;  4CRY G;  3TIW A;  2B63 A;  1WCM A;  2JA6 A;  1R27 A;  4KO8 A;  2JIQ A;  5DYI A;  2DMR A;  3IR6 A;  4AYB A;  3QQ8 A;  2WB1 A;  1TWA A;  1E32 A;  2JA5 A;  4AON B;  5T5M D;  1G8K A;  1CR5 A;  3CQZ A;  3HKZ A;  1TWG A;  3TM7 B;  1Y4Z A;  5FTK A;  1H0H A;  5C18 A;  3O5A A;  2IV2 X;  1KQG A;  4AAY A;  4CRZ A;  2E7Z A;  3HU2 A;  1PT1 A;  1I50 A;  3DMR A;  3HU1 A;  1DMR A;  1KQF A;  1FDO A;  3CF2 A;  1E60 A;  2JIP A;  1Y1V A;  1PQE A;  1QCS A;  4CS0 A;  3GTG A;  1DMS A;  1CZ5 A;  2NVY A;  2E2I A;  4RV0 A;  1G8J A;  1S3S A;  2R93 A;  1R7R A;  2V45 A;  2JIM A;  4KDL A;  2VPW A;  3GTQ A;  2NVX A;  3QWZ A;  4KOD A;  1PQH A;  3GTO A;  2VUM A;  2C45 A;  2NYA A;  2E2H A;  1FDI A;  4AZD A;  1K83 A;  1IW7 D;  4C2M A;  2PMZ A;  1E5V A;  1WLF A;  1YLE A;  4D7Z B;  1R9T A;  3GTJ A;  1UHD A;  3PLX B;  4GA5 A;  1I3Q A;  5GLF A;  1VC3 B;  2NAP A;  2KI8 A;  1PYU B;  1PYQ A;  1Y5I A;  4KLN A;  5C1B A;  5T5I D;  3IR7 A;  1TMO A;  1Q16 A;  1UHE A;  1TWC A;  5FTN A;  1H5N A;  3GTK A;  3QC8 A;  1PQF A;  2JIO A;  2R7Z A;  1E61 A;  1TWF A;  3IR5 A;  3H0G A;  4GA6 A;  5B6C A;  5FTL A;  1AA6 A;  2R92 A;  1QDN A;  2Y0S A;  1Y1W A;  4KDI A;  3GTM A;  3QQ7 A;  2V3V A;  2JIR A;  1SFO A;  2WAQ A;  1EU1 A;  1TWH A;  1SIW A;  1E18 A;  4AOK B;  2YU9 A;  5FTM A;  4DMR A;  3FKI A; 
#chains in the Genus database with same CATH topology
 1OA9 A;  4QIW A;  2G6G A;  3OUG A;  5DYG A;  3HU3 A;  3ML1 A;  1PPY A;  5GM9 A;  2PJH B;  3X2M A;  4JS7 A;  3X2G A;  2JA7 A;  3GTL A;  2VPZ A;  1CZ4 A;  1PT0 A;  3SUJ A;  2O5J D;  5EPP A;  3GTP A;  5FTJ A;  2VPX A;  1AW8 B;  1OGY A;  2EEO B;  1HD5 A;  2VPY A;  4CRY G;  3TIW A;  2B63 A;  1ZYR D;  1WCM A;  2JA6 A;  1R27 A;  1YNJ D;  4KO8 A;  4NOH A;  2JIQ A;  5DYI A;  2A68 D;  2DMR A;  3IR6 A;  4AYB A;  3QQ8 A;  2WB1 A;  5H4U A;  3X2J A;  1TWA A;  1E32 A;  2JA5 A;  4AON B;  2G5D A;  5T5M D;  1G8K A;  1CR5 A;  3CQZ A;  3HKZ A;  3M3G A;  1N10 A;  1TWG A;  4L48 A;  3TM7 B;  1Y4Z A;  2PI8 A;  2BE5 D;  5FTK A;  1H0H A;  5C18 A;  2KQA A;  3X2L A;  1SMY D;  3O5A A;  2IV2 X;  4FER A;  1KQG A;  4AAY A;  4CRZ A;  2E7Z A;  3HU2 A;  1PT1 A;  1I50 A;  4FG2 A;  4JCW A;  3DMR A;  3HU1 A;  1DMR A;  1OA7 A;  1KQF A;  1FDO A;  3CF2 A;  1E60 A;  3SUK A;  2JIP A;  1Y1V A;  2AE0 X;  3ENG A;  1PQE A;  1QCS A;  4ZM7 A;  4CS0 A;  3GTG A;  1DMS A;  1CZ5 A;  3SUM A;  2NVY A;  2E2I A;  4RV0 A;  2ENG A;  1G8J A;  1S3S A;  2R93 A;  2PJJ A;  3CZB A;  1R7R A;  2V45 A;  2JIM A;  4JJO A;  3X2O A;  4KDL A;  2VPW A;  3GTQ A;  2NVX A;  3QWZ A;  3X2H A;  4KOD A;  1PQH A;  2CW0 D;  3GTO A;  2C45 A;  2VUM A;  1BW3 A;  2NYA A;  2E2H A;  2GAE A;  1FDI A;  1L8F A;  4JP6 A;  4AZD A;  1K83 A;  1WC2 A;  1IW7 D;  4C2M A;  2PMZ A;  3X2K A;  1E5V A;  1WLF A;  1YLE A;  4D7Z B;  1R9T A;  3GTJ A;  5GLY A;  1UHD A;  3PLX B;  4FFT A;  4GA5 A;  1I3Q A;  5GLF A;  2YUJ A;  1VC3 B;  3SUL A;  2NAP A;  2KI8 A;  1PYU B;  1PYQ A;  1Y5I A;  2PIC A;  4KLN A;  5C1B A;  5T5I D;  3IR7 A;  1TMO A;  1Q16 A;  1UHE A;  1TWC A;  5FTN A;  2BH0 A;  2PNW A;  1H5N A;  3GTK A;  3QC8 A;  1PQF A;  2JIO A;  3X2N A;  3X2I A;  2R7Z A;  2HCZ X;  1E61 A;  1TWF A;  3IR5 A;  3H0G A;  5GLX A;  4ENG A;  4GA6 A;  5B6C A;  5FTL A;  1AA6 A;  2R92 A;  1QDN A;  3X2P A;  2A6E D;  1ZC1 A;  2Y0S A;  1Y1W A;  4KDI A;  3GTM A;  1BW4 A;  3QQ7 A;  2V3V A;  2JIR A;  1SFO A;  1YNN D;  2WAQ A;  1EU1 A;  1TWH A;  1SIW A;  1E18 A;  4JP7 A;  4AOK B;  2YU9 A;  2A6H D;  3D30 A;  5FTM A;  4AVR A;  4DMR A;  2A69 D;  3FKI A;  4FG4 A; 
#chains in the Genus database with same CATH homology
 5DYG A;  4QIW A;  2G6G A;  3OUG A;  3HU3 A;  3ML1 A;  1PPY A;  2PJH B;  2JA7 A;  3GTL A;  2VPZ A;  1CZ4 A;  1PT0 A;  2O5J D;  5EPP A;  3GTP A;  5FTJ A;  2VPX A;  1OGY A;  1AW8 B;  2EEO B;  2VPY A;  4CRY G;  3TIW A;  2B63 A;  1ZYR D;  1WCM A;  2JA6 A;  1R27 A;  1YNJ D;  4KO8 A;  4NOH A;  2JIQ A;  5DYI A;  2A68 D;  2DMR A;  3IR6 A;  4AYB A;  3QQ8 A;  2WB1 A;  1TWA A;  1E32 A;  2JA5 A;  4AON B;  2G5D A;  5T5M D;  1G8K A;  1CR5 A;  3CQZ A;  3HKZ A;  1TWG A;  3TM7 B;  1Y4Z A;  2PI8 A;  2BE5 D;  5FTK A;  1H0H A;  5C18 A;  1SMY D;  3O5A A;  2IV2 X;  1KQG A;  4AAY A;  4CRZ A;  2E7Z A;  3HU2 A;  1PT1 A;  1I50 A;  3DMR A;  3HU1 A;  1DMR A;  1KQF A;  1FDO A;  3CF2 A;  1E60 A;  2JIP A;  1Y1V A;  2AE0 X;  1PQE A;  1QCS A;  4CS0 A;  3GTG A;  1DMS A;  1CZ5 A;  2NVY A;  2E2I A;  4RV0 A;  1G8J A;  1S3S A;  2R93 A;  2PJJ A;  3CZB A;  1R7R A;  2V45 A;  2JIM A;  4KDL A;  2VPW A;  3GTQ A;  2NVX A;  3QWZ A;  4KOD A;  1PQH A;  2CW0 D;  3GTO A;  2C45 A;  2VUM A;  2NYA A;  2E2H A;  2GAE A;  1FDI A;  4AZD A;  1K83 A;  1IW7 D;  4C2M A;  2PMZ A;  1E5V A;  1WLF A;  1YLE A;  4D7Z B;  1R9T A;  3GTJ A;  1UHD A;  3PLX B;  4GA5 A;  1I3Q A;  5GLF A;  2YUJ A;  1VC3 B;  2NAP A;  2KI8 A;  1PYU B;  2PIC A;  1PYQ A;  1Y5I A;  4KLN A;  5C1B A;  5T5I D;  3IR7 A;  1TMO A;  1Q16 A;  1UHE A;  1TWC A;  5FTN A;  2PNW A;  1H5N A;  3GTK A;  3QC8 A;  1PQF A;  2JIO A;  2R7Z A;  1E61 A;  1TWF A;  3IR5 A;  3H0G A;  4GA6 A;  5B6C A;  5FTL A;  1AA6 A;  2R92 A;  1QDN A;  2A6E D;  1ZC1 A;  2Y0S A;  1Y1W A;  4KDI A;  3GTM A;  3QQ7 A;  2V3V A;  2JIR A;  1SFO A;  1YNN D;  2WAQ A;  1EU1 A;  1TWH A;  1SIW A;  1E18 A;  4AOK B;  2YU9 A;  2A6H D;  5FTM A;  4DMR A;  2A69 D;  3FKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...