3OUGA

Crystal structure of cleaved l-aspartate-alpha-decarboxylase from francisella tularensis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
107
Chain Sequence
MLISVLKSKISYATVTGKDLFYVSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVDPTRENIKPKLVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase
publication title Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 27
structure length 107
sequence length 108
chains with identical sequence B, C, E, F, G, H, I
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02261 Asp_decarbox Aspartate decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3ougA00
1H5NA 3OUGA 1TMOA 3TIWA 2DMRA 2JIRA 1E61A 5DYGA 5FTJA 2WB1A 3ML1A 1Q16A 5EPPA 1PQFA 1TWCA 3PLXB 1K83A 1CZ4A 1TWHA 2VPWA 5FTLA 1KQFA 2PMZA 4AAYA 2EEOB 4C2MA 1E32A 2WAQA 3GTKA 2VUMA 2E7ZA 1PT1A 2JIPA 1Y5IA 2JA6A 4KDIA 2R7ZA 2C45A 1G8KA 1WLFA 1FDIA 3IR5A 4AZDA 1QDNA 1YLEA 5GLFA 1R27A 3IR7A 3HU2A 1AW8B 2PJHB 1UHDA 4KODA 2IV2X 2R93A 3GTOA 2Y0SA 4CRYG 2JA5A 4QIWA 2E2IA 3GTPA 1R7RA 2V3VA 3QC8A 3HKZA 5FTNA 1QCSA 2R92A 4CS0A 1VC3B 3HU1A 1I3QA 3QQ7A 1PQEA 3GTJA 3QWZA 3FKIA 1I50A 4AYBA 1PYUB 2NAPA 1E60A 2JA7A 1TWGA 1KQGA 2E2HA 4RV0A 1S3SA 3GTGA 3DMRA 3GTQA 1SFOA 5DYIA 2B63A 4KLNA 4GA6A 2VPZA 4DMRA 3HU3A 1UHEA 5FTKA 3O5AA 1IW7D 3GTLA 2NVXA 2V45A 4KDLA 5C1BA 1TWAA 2VPYA 1CZ5A 1DMRA 5T5MD 3IR6A 3CQZA 1PT0A 4KO8A 1PQHA 2YU9A 5T5ID 1PPYA 5C18A 4CRZA 3GTMA 1H0HA 2JIQA 1PYQA 1WCMA 4GA5A 1R9TA 3TM7B 3CF2A 1AA6A 3QQ8A 2NVYA 1E18A 1E5VA 1SIWA 2KI8A 4D7ZB 1FDOA 1OGYA 1TWFA 5FTMA 3H0GA 1Y4ZA 2JIMA 2VPXA 1CR5A 4AONB 1Y1VA 5B6CA 1EU1A 2NYAA 1Y1WA 2JIOA 4AOKB 1DMSA 1G8JA
chains in the Genus database with same CATH superfamily
1H5NA 3OUGA 1TMOA 3TIWA 2GAEA 2DMRA 1SMYD 1E61A 2JIRA 2ENGA 5DYGA 1YNND 2WB1A 3CZBA 5FTJA 5GLXA 4ENGA 3ML1A 1Q16A 4JS7A 5EPPA 1PQFA 1TWCA 3PLXB 1K83A 1CZ4A 1TWHA 2VPWA 5FTLA 1KQFA 3X2NA 2PMZA 1YNJD 4AVRA 4AAYA 2EEOB 3X2GA 4C2MA 2PI8A 1E32A 2WAQA 3GTKA 2VUMA 2E7ZA 1PT1A 2JIPA 1Y5IA 3X2IA 2JA6A 4KDIA 4JP6A 1HD5A 2R7ZA 2C45A 1G8KA 1WLFA 1FDIA 3IR5A 4AZDA 4ZM7A 3SUJA 1QDNA 1YLEA 4JP7A 5GLFA 1R27A 3IR7A 3HU2A 1AW8B 3ENGA 2PJHB 1UHDA 4KODA 2IV2X 3SULA 2R93A 5GLYA 3GTOA 2BE5D 2Y0SA 4CRYG 2JA5A 2A68D 4QIWA 2E2IA 3GTPA 1R7RA 2HCZX 2V3VA 2KQAA 3QC8A 3HKZA 5FTNA 1QCSA 2R92A 4CS0A 1VC3B 3HU1A 1I3QA 5GM9A 3X2OA 3QQ7A 1PQEA 4FERA 3GTJA 3QWZA 3FKIA 1I50A 4AYBA 1PYUB 2NAPA 1OA7A 1E60A 3X2JA 2JA7A 1TWGA 1KQGA 2YUJA 2E2HA 4RV0A 1S3SA 3GTGA 3DMRA 3GTQA 1SFOA 4JCWA 5DYIA 2B63A 4KLNA 3SUMA 4GA6A 2VPZA 4DMRA 3HU3A 1UHEA 5FTKA 3O5AA 1IW7D 3X2LA 3GTLA 2V45A 2NVXA 4KDLA 5C1BA 1TWAA 2VPYA 5H4UA 1CZ5A 1DMRA 1WC2A 5T5MD 3IR6A 3CQZA 3X2PA 1PT0A 4KO8A 2AE0X 1PQHA 2YU9A 5T5ID 1PPYA 2G5DA 2CW0D 5C18A 3X2HA 4CRZA 4JJOA 1H0HA 3GTMA 2JIQA 1PYQA 1WCMA 4GA5A 2PNWA 1R9TA 1BW4A 4L48A 1ZC1A 3TM7B 3CF2A 4FFTA 2A6ED 1OA9A 3QQ8A 2NVYA 1AA6A 1E18A 1E5VA 1SIWA 2A69D 2KI8A 2G6GA 4D7ZB 1FDOA 3D30A 1OGYA 1TWFA 2BH0A 2A6HD 5FTMA 3H0GA 3X2MA 4NOHA 3SUKA 1ZYRD 1Y4ZA 2JIMA 2VPXA 1CR5A 1N10A 2O5JD 2PICA 4AONB 1Y1VA 4FG4A 1BW3A 5B6CA 2PJJA 3X2KA 1EU1A 4FG2A 1L8FA 2NYAA 3M3GA 1Y1WA 2JIOA 4AOKB 1DMSA 1G8JA
chains in the Genus database with same CATH topology
1H5NA 3OUGA 1TMOA 3TIWA 2GAEA 2DMRA 1SMYD 1E61A 2JIRA 5DYGA 1YNND 2WB1A 3CZBA 5FTJA 3ML1A 1Q16A 5EPPA 1PQFA 1TWCA 3PLXB 1K83A 1CZ4A 1TWHA 2VPWA 5FTLA 1KQFA 2PMZA 1YNJD 4AAYA 2EEOB 4C2MA 2PI8A 1E32A 2WAQA 3GTKA 2VUMA 2E7ZA 1PT1A 2JIPA 1Y5IA 2JA6A 4KDIA 2R7ZA 2C45A 1G8KA 1WLFA 1FDIA 3IR5A 4AZDA 1QDNA 1YLEA 5GLFA 1R27A 3IR7A 3HU2A 1AW8B 2PJHB 1UHDA 4KODA 2IV2X 2R93A 3GTOA 2BE5D 2Y0SA 4CRYG 2JA5A 2A68D 4QIWA 2E2IA 3GTPA 1R7RA 2V3VA 3QC8A 3HKZA 5FTNA 1QCSA 2R92A 4CS0A 1VC3B 3HU1A 1I3QA 3QQ7A 1PQEA 3GTJA 3QWZA 3FKIA 1I50A 4AYBA 1PYUB 2NAPA 1E60A 2JA7A 1TWGA 1KQGA 2YUJA 2E2HA 4RV0A 1S3SA 3GTGA 3DMRA 3GTQA 1SFOA 5DYIA 2B63A 4KLNA 4GA6A 2VPZA 4DMRA 3HU3A 1UHEA 5FTKA 3O5AA 1IW7D 3GTLA 2NVXA 2V45A 4KDLA 5C1BA 1TWAA 2VPYA 1CZ5A 1DMRA 5T5MD 3IR6A 3CQZA 1PT0A 4KO8A 2AE0X 1PQHA 2YU9A 5T5ID 1PPYA 2G5DA 2CW0D 5C18A 4CRZA 3GTMA 1H0HA 2JIQA 1PYQA 1WCMA 4GA5A 2PNWA 1R9TA 1ZC1A 3TM7B 3CF2A 2A6ED 3QQ8A 1AA6A 2NVYA 1E18A 1E5VA 1SIWA 2A69D 2KI8A 2G6GA 4D7ZB 1FDOA 1OGYA 1TWFA 2A6HD 5FTMA 3H0GA 4NOHA 1ZYRD 1Y4ZA 2JIMA 2VPXA 1CR5A 2O5JD 2PICA 4AONB 1Y1VA 5B6CA 2PJJA 1EU1A 2NYAA 1Y1WA 2JIOA 4AOKB 1DMSA 1G8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5N A;  3OUG A;  1TMO A;  3TIW A;  2DMR A;  2JIR A;  1E61 A;  5DYG A;  5FTJ A;  2WB1 A;  3ML1 A;  1Q16 A;  5EPP A;  1PQF A;  1TWC A;  3PLX B;  1K83 A;  1CZ4 A;  1TWH A;  2VPW A;  5FTL A;  1KQF A;  2PMZ A;  4AAY A;  2EEO B;  4C2M A;  1E32 A;  2WAQ A;  3GTK A;  2VUM A;  2E7Z A;  1PT1 A;  2JIP A;  1Y5I A;  2JA6 A;  4KDI A;  2R7Z A;  2C45 A;  1G8K A;  1WLF A;  1FDI A;  3IR5 A;  4AZD A;  1QDN A;  1YLE A;  5GLF A;  1R27 A;  3IR7 A;  3HU2 A;  1AW8 B;  2PJH B;  1UHD A;  4KOD A;  2IV2 X;  2R93 A;  3GTO A;  2Y0S A;  4CRY G;  2JA5 A;  4QIW A;  2E2I A;  3GTP A;  1R7R A;  2V3V A;  3QC8 A;  3HKZ A;  5FTN A;  1QCS A;  2R92 A;  4CS0 A;  1VC3 B;  3HU1 A;  1I3Q A;  3QQ7 A;  1PQE A;  3GTJ A;  3QWZ A;  3FKI A;  1I50 A;  4AYB A;  1PYU B;  2NAP A;  1E60 A;  2JA7 A;  1TWG A;  1KQG A;  2E2H A;  4RV0 A;  1S3S A;  3GTG A;  3DMR A;  3GTQ A;  1SFO A;  5DYI A;  2B63 A;  4KLN A;  4GA6 A;  2VPZ A;  4DMR A;  3HU3 A;  1UHE A;  5FTK A;  3O5A A;  1IW7 D;  3GTL A;  2NVX A;  2V45 A;  4KDL A;  5C1B A;  1TWA A;  2VPY A;  1CZ5 A;  1DMR A;  5T5M D;  3IR6 A;  3CQZ A;  1PT0 A;  4KO8 A;  1PQH A;  2YU9 A;  5T5I D;  1PPY A;  5C18 A;  4CRZ A;  3GTM A;  1H0H A;  2JIQ A;  1PYQ A;  1WCM A;  4GA5 A;  1R9T A;  3TM7 B;  3CF2 A;  1AA6 A;  3QQ8 A;  2NVY A;  1E18 A;  1E5V A;  1SIW A;  2KI8 A;  4D7Z B;  1FDO A;  1OGY A;  1TWF A;  5FTM A;  3H0G A;  1Y4Z A;  2JIM A;  2VPX A;  1CR5 A;  4AON B;  1Y1V A;  5B6C A;  1EU1 A;  2NYA A;  1Y1W A;  2JIO A;  4AOK B;  1DMS A;  1G8J A; 
#chains in the Genus database with same CATH topology
 1H5N A;  3OUG A;  1TMO A;  3TIW A;  2GAE A;  2DMR A;  1SMY D;  1E61 A;  2JIR A;  2ENG A;  5DYG A;  1YNN D;  2WB1 A;  3CZB A;  5FTJ A;  5GLX A;  4ENG A;  3ML1 A;  1Q16 A;  4JS7 A;  5EPP A;  1PQF A;  1TWC A;  3PLX B;  1K83 A;  1CZ4 A;  1TWH A;  2VPW A;  5FTL A;  1KQF A;  3X2N A;  2PMZ A;  1YNJ D;  4AVR A;  4AAY A;  2EEO B;  3X2G A;  4C2M A;  2PI8 A;  1E32 A;  2WAQ A;  3GTK A;  2VUM A;  2E7Z A;  1PT1 A;  2JIP A;  1Y5I A;  3X2I A;  2JA6 A;  4KDI A;  4JP6 A;  1HD5 A;  2R7Z A;  2C45 A;  1G8K A;  1WLF A;  1FDI A;  3IR5 A;  4AZD A;  4ZM7 A;  3SUJ A;  1QDN A;  1YLE A;  4JP7 A;  5GLF A;  1R27 A;  3IR7 A;  3HU2 A;  1AW8 B;  3ENG A;  2PJH B;  1UHD A;  4KOD A;  2IV2 X;  3SUL A;  2R93 A;  5GLY A;  3GTO A;  2BE5 D;  2Y0S A;  4CRY G;  2JA5 A;  2A68 D;  4QIW A;  2E2I A;  3GTP A;  1R7R A;  2HCZ X;  2V3V A;  2KQA A;  3QC8 A;  3HKZ A;  5FTN A;  1QCS A;  2R92 A;  4CS0 A;  1VC3 B;  3HU1 A;  1I3Q A;  5GM9 A;  3X2O A;  3QQ7 A;  1PQE A;  4FER A;  3GTJ A;  3QWZ A;  3FKI A;  1I50 A;  4AYB A;  1PYU B;  2NAP A;  1OA7 A;  1E60 A;  3X2J A;  2JA7 A;  1TWG A;  1KQG A;  2YUJ A;  2E2H A;  4RV0 A;  1S3S A;  3GTG A;  3DMR A;  3GTQ A;  1SFO A;  4JCW A;  5DYI A;  2B63 A;  4KLN A;  3SUM A;  4GA6 A;  2VPZ A;  4DMR A;  3HU3 A;  1UHE A;  5FTK A;  3O5A A;  1IW7 D;  3X2L A;  3GTL A;  2V45 A;  2NVX A;  4KDL A;  5C1B A;  1TWA A;  2VPY A;  5H4U A;  1CZ5 A;  1DMR A;  1WC2 A;  5T5M D;  3IR6 A;  3CQZ A;  3X2P A;  1PT0 A;  4KO8 A;  2AE0 X;  1PQH A;  2YU9 A;  5T5I D;  1PPY A;  2G5D A;  2CW0 D;  5C18 A;  3X2H A;  4CRZ A;  4JJO A;  1H0H A;  3GTM A;  2JIQ A;  1PYQ A;  1WCM A;  4GA5 A;  2PNW A;  1R9T A;  1BW4 A;  4L48 A;  1ZC1 A;  3TM7 B;  3CF2 A;  4FFT A;  2A6E D;  1OA9 A;  3QQ8 A;  2NVY A;  1AA6 A;  1E18 A;  1E5V A;  1SIW A;  2A69 D;  2KI8 A;  2G6G A;  4D7Z B;  1FDO A;  3D30 A;  1OGY A;  1TWF A;  2BH0 A;  2A6H D;  5FTM A;  3H0G A;  3X2M A;  4NOH A;  3SUK A;  1ZYR D;  1Y4Z A;  2JIM A;  2VPX A;  1CR5 A;  1N10 A;  2O5J D;  2PIC A;  4AON B;  1Y1V A;  4FG4 A;  1BW3 A;  5B6C A;  2PJJ A;  3X2K A;  1EU1 A;  4FG2 A;  1L8F A;  2NYA A;  3M3G A;  1Y1W A;  2JIO A;  4AOK B;  1DMS A;  1G8J A; 
#chains in the Genus database with same CATH homology
 1H5N A;  3OUG A;  1TMO A;  3TIW A;  2GAE A;  2DMR A;  1SMY D;  1E61 A;  2JIR A;  5DYG A;  1YNN D;  2WB1 A;  3CZB A;  5FTJ A;  3ML1 A;  1Q16 A;  5EPP A;  1PQF A;  1TWC A;  3PLX B;  1K83 A;  1CZ4 A;  1TWH A;  2VPW A;  5FTL A;  1KQF A;  2PMZ A;  1YNJ D;  4AAY A;  2EEO B;  4C2M A;  2PI8 A;  1E32 A;  2WAQ A;  3GTK A;  2VUM A;  2E7Z A;  1PT1 A;  2JIP A;  1Y5I A;  2JA6 A;  4KDI A;  2R7Z A;  2C45 A;  1G8K A;  1WLF A;  1FDI A;  3IR5 A;  4AZD A;  1QDN A;  1YLE A;  5GLF A;  1R27 A;  3IR7 A;  3HU2 A;  1AW8 B;  2PJH B;  1UHD A;  4KOD A;  2IV2 X;  2R93 A;  3GTO A;  2BE5 D;  2Y0S A;  4CRY G;  2JA5 A;  2A68 D;  4QIW A;  2E2I A;  3GTP A;  1R7R A;  2V3V A;  3QC8 A;  3HKZ A;  5FTN A;  1QCS A;  2R92 A;  4CS0 A;  1VC3 B;  3HU1 A;  1I3Q A;  3QQ7 A;  1PQE A;  3GTJ A;  3QWZ A;  3FKI A;  1I50 A;  4AYB A;  1PYU B;  2NAP A;  1E60 A;  2JA7 A;  1TWG A;  1KQG A;  2YUJ A;  2E2H A;  4RV0 A;  1S3S A;  3GTG A;  3DMR A;  3GTQ A;  1SFO A;  5DYI A;  2B63 A;  4KLN A;  4GA6 A;  2VPZ A;  4DMR A;  3HU3 A;  1UHE A;  5FTK A;  3O5A A;  1IW7 D;  3GTL A;  2NVX A;  2V45 A;  4KDL A;  5C1B A;  1TWA A;  2VPY A;  1CZ5 A;  1DMR A;  5T5M D;  3IR6 A;  3CQZ A;  1PT0 A;  4KO8 A;  2AE0 X;  1PQH A;  2YU9 A;  5T5I D;  1PPY A;  2G5D A;  2CW0 D;  5C18 A;  4CRZ A;  3GTM A;  1H0H A;  2JIQ A;  1PYQ A;  1WCM A;  4GA5 A;  2PNW A;  1R9T A;  1ZC1 A;  3TM7 B;  3CF2 A;  2A6E D;  3QQ8 A;  1AA6 A;  2NVY A;  1E18 A;  1E5V A;  1SIW A;  2A69 D;  2KI8 A;  2G6G A;  4D7Z B;  1FDO A;  1OGY A;  1TWF A;  2A6H D;  5FTM A;  3H0G A;  4NOH A;  1ZYR D;  1Y4Z A;  2JIM A;  2VPX A;  1CR5 A;  2O5J D;  2PIC A;  4AON B;  1Y1V A;  5B6C A;  2PJJ A;  1EU1 A;  2NYA A;  1Y1W A;  2JIO A;  4AOK B;  1DMS A;  1G8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...