5T5ID

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, orthorhombic form at 1.9 a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGKVGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 130
sequence length 130
chains with identical sequence L
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5iD00
5EPPA 4GA6A 3IR5A 1E32A 2NAPA 2JA6A 1EU1A 3GTJA 2VPXA 1WCMA 1QCSA 3PLXB 2WB1A 3IR7A 1TWAA 1SFOA 5T5MD 3GTMA 1YLEA 2JIMA 4CRZA 3GTPA 3HKZA 3H0GA 5FTLA 3ML1A 3IR6A 2PMZA 3DMRA 1K83A 2VUMA 2JIPA 3CQZA 1TWGA 2E2IA 1DMRA 5C1BA 3QWZA 3OUGA 4AAYA 1I50A 1PQHA 1E60A 1PT0A 3QQ7A 1CZ4A 3TIWA 2R93A 2JA5A 5C18A 3GTGA 1G8JA 1PQFA 4GA5A 2JA7A 1SIWA 1FDIA 2KI8A 1WLFA 1OGYA 1CZ5A 3HU2A 5GLFA 1TMOA 1PQEA 1TWFA 2V45A 1TWCA 1Y1WA 3GTKA 2E7ZA 4AOKB 2NVXA 2C45A 1KQGA 1DMSA 1I3QA 4CRYG 4KLNA 2E2HA 1AA6A 3HU1A 1H5NA 3GTOA 5FTKA 2WAQA 4AZDA 1E18A 5B6CA 2NVYA 1AW8B 5DYGA 2JIQA 1R7RA 2VPYA 2IV2X 2DMRA 1R27A 4C2MA 5FTNA 2VPWA 1UHDA 1VC3B 1PPYA 4AONB 1R9TA 1Y1VA 3O5AA 5DYIA 2R7ZA 4KO8A 1E61A 1H0HA 2YU9A 1Y5IA 2VPZA 4AYBA 4KDLA 1FDOA 1PT1A 2Y0SA 1IW7D 1PYQA 1KQFA 5FTMA 4KODA 4CS0A 3GTQA 1UHEA 2JIOA 2B63A 1CR5A 4D7ZB 1Q16A 5FTJA 4KDIA 3QC8A 1QDNA 2EEOB 4RV0A 1Y4ZA 4QIWA 2R92A 2V3VA 1TWHA 1S3SA 3FKIA 2PJHB 1E5VA 1PYUB 4DMRA 3CF2A 3TM7B 2JIRA 1G8KA 3HU3A 3QQ8A 2NYAA 3GTLA 5T5ID
chains in the Genus database with same CATH superfamily
5EPPA 4GA6A 3IR5A 1E32A 1YNND 3D30A 2NAPA 2JA6A 1EU1A 3GTJA 2VPXA 4ENGA 1WCMA 1QCSA 3PLXB 2WB1A 2GAEA 1TWAA 1OA7A 3IR7A 4FFTA 5T5MD 1SFOA 3X2GA 3GTMA 1YLEA 2JIMA 2A6HD 4CRZA 3GTPA 2PI8A 3HKZA 2O5JD 3H0GA 5FTLA 1BW4A 2HCZX 3ML1A 3IR6A 2PMZA 3DMRA 1K83A 2VUMA 2JIPA 3CQZA 1TWGA 2E2IA 1DMRA 4FERA 3QWZA 3OUGA 3SULA 3X2IA 4ZM7A 4AAYA 5C1BA 1I50A 1PQHA 4JCWA 1E60A 2G6GA 1PT0A 3QQ7A 1CZ4A 5GM9A 4NOHA 3SUKA 3TIWA 2R93A 2JA5A 5H4UA 4L48A 3X2PA 5C18A 3GTGA 1G8JA 2ENGA 1PQFA 4GA5A 2JA7A 1SIWA 2AE0X 1FDIA 2A69D 2KI8A 4AVRA 1SMYD 1WLFA 4JP6A 1OGYA 1CZ5A 3HU2A 3X2HA 5GLFA 1TMOA 2G5DA 1PQEA 1TWFA 2V45A 1TWCA 1Y1WA 3GTKA 2KQAA 2E7ZA 4AOKB 2NVXA 2C45A 3X2NA 1DMSA 2BH0A 1KQGA 1I3QA 2YUJA 4CRYG 4KLNA 2E2HA 4JJOA 1AA6A 3HU1A 1H5NA 3GTOA 5FTKA 2WAQA 1ZC1A 1E18A 4AZDA 5B6CA 2NVYA 1AW8B 3ENGA 5DYGA 2CW0D 2PNWA 3X2LA 2JIQA 1R7RA 2VPYA 1OA9A 3SUJA 2IV2X 2DMRA 1R27A 4C2MA 2BE5D 5FTNA 2VPWA 1UHDA 1VC3B 4FG4A 3X2KA 1PPYA 3M3GA 4AONB 1R9TA 1Y1VA 3O5AA 1WC2A 5DYIA 1HD5A 3X2OA 2R7ZA 4KO8A 5GLYA 1E61A 1H0HA 2YU9A 1Y5IA 2VPZA 4AYBA 4KDLA 1FDOA 1PT1A 2Y0SA 1ZYRD 1L8FA 1IW7D 1PYQA 2PJJA 1KQFA 5FTMA 4KODA 2A68D 4CS0A 3GTQA 1UHEA 2JIOA 3X2JA 1BW3A 5GLXA 4FG2A 2B63A 2PICA 1CR5A 4D7ZB 1Q16A 5FTJA 4KDIA 3QC8A 3SUMA 1QDNA 2EEOB 4RV0A 1Y4ZA 4QIWA 2R92A 2V3VA 1TWHA 4JS7A 1S3SA 3X2MA 3FKIA 2A6ED 3CZBA 4JP7A 2PJHB 1E5VA 1PYUB 4DMRA 3CF2A 3TM7B 1YNJD 2JIRA 1G8KA 3HU3A 3QQ8A 1N10A 2NYAA 3GTLA 5T5ID
chains in the Genus database with same CATH topology
5EPPA 4GA6A 3IR5A 1E32A 1YNND 2NAPA 2JA6A 1EU1A 3GTJA 2VPXA 1WCMA 1QCSA 3PLXB 2WB1A 2GAEA 1TWAA 3IR7A 1SFOA 5T5MD 3GTMA 1YLEA 2JIMA 2A6HD 4CRZA 3GTPA 2PI8A 3HKZA 2O5JD 3H0GA 5FTLA 3ML1A 3IR6A 2PMZA 3DMRA 1K83A 2VUMA 2JIPA 3CQZA 1TWGA 2E2IA 1DMRA 5C1BA 3QWZA 3OUGA 4AAYA 1I50A 1PQHA 1E60A 2G6GA 1PT0A 3QQ7A 1CZ4A 4NOHA 3TIWA 2R93A 2JA5A 5C18A 3GTGA 1G8JA 1PQFA 4GA5A 2JA7A 1SIWA 2AE0X 1FDIA 2A69D 2KI8A 1SMYD 1WLFA 1OGYA 1CZ5A 3HU2A 5GLFA 1TMOA 2G5DA 1PQEA 1TWFA 2V45A 1TWCA 1Y1WA 3GTKA 2E7ZA 4AOKB 2NVXA 2C45A 1KQGA 1DMSA 1I3QA 2YUJA 4CRYG 4KLNA 2E2HA 1AA6A 3HU1A 1H5NA 3GTOA 5FTKA 2WAQA 1ZC1A 1E18A 4AZDA 5B6CA 2NVYA 1AW8B 5DYGA 2CW0D 2PNWA 2JIQA 1R7RA 2VPYA 2IV2X 2DMRA 1R27A 4C2MA 2BE5D 5FTNA 2VPWA 1UHDA 1VC3B 1PPYA 4AONB 1R9TA 1Y1VA 3O5AA 5DYIA 2R7ZA 4KO8A 1E61A 1H0HA 2YU9A 1Y5IA 2VPZA 4AYBA 4KDLA 1FDOA 1PT1A 2Y0SA 1ZYRD 1IW7D 1PYQA 2PJJA 1KQFA 5FTMA 4KODA 2A68D 4CS0A 3GTQA 1UHEA 2JIOA 2B63A 2PICA 1CR5A 4D7ZB 1Q16A 5FTJA 4KDIA 3QC8A 1QDNA 2EEOB 4RV0A 1Y4ZA 4QIWA 2R92A 2V3VA 1TWHA 1S3SA 3FKIA 2A6ED 3CZBA 2PJHB 1E5VA 1PYUB 4DMRA 3CF2A 3TM7B 1YNJD 2JIRA 1G8KA 3HU3A 3QQ8A 2NYAA 3GTLA 5T5ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPP A;  4GA6 A;  3IR5 A;  1E32 A;  2NAP A;  2JA6 A;  1EU1 A;  3GTJ A;  2VPX A;  1WCM A;  1QCS A;  3PLX B;  2WB1 A;  3IR7 A;  1TWA A;  1SFO A;  5T5M D;  3GTM A;  1YLE A;  2JIM A;  4CRZ A;  3GTP A;  3HKZ A;  3H0G A;  5FTL A;  3ML1 A;  3IR6 A;  2PMZ A;  3DMR A;  1K83 A;  2VUM A;  2JIP A;  3CQZ A;  1TWG A;  2E2I A;  1DMR A;  5C1B A;  3QWZ A;  3OUG A;  4AAY A;  1I50 A;  1PQH A;  1E60 A;  1PT0 A;  3QQ7 A;  1CZ4 A;  3TIW A;  2R93 A;  2JA5 A;  5C18 A;  3GTG A;  1G8J A;  1PQF A;  4GA5 A;  2JA7 A;  1SIW A;  1FDI A;  2KI8 A;  1WLF A;  1OGY A;  1CZ5 A;  3HU2 A;  5GLF A;  1TMO A;  1PQE A;  1TWF A;  2V45 A;  1TWC A;  1Y1W A;  3GTK A;  2E7Z A;  4AOK B;  2NVX A;  2C45 A;  1KQG A;  1DMS A;  1I3Q A;  4CRY G;  4KLN A;  2E2H A;  1AA6 A;  3HU1 A;  1H5N A;  3GTO A;  5FTK A;  2WAQ A;  4AZD A;  1E18 A;  5B6C A;  2NVY A;  1AW8 B;  5DYG A;  2JIQ A;  1R7R A;  2VPY A;  2IV2 X;  2DMR A;  1R27 A;  4C2M A;  5FTN A;  2VPW A;  1UHD A;  1VC3 B;  1PPY A;  4AON B;  1R9T A;  1Y1V A;  3O5A A;  5DYI A;  2R7Z A;  4KO8 A;  1E61 A;  1H0H A;  2YU9 A;  1Y5I A;  2VPZ A;  4AYB A;  4KDL A;  1FDO A;  1PT1 A;  2Y0S A;  1IW7 D;  1PYQ A;  1KQF A;  5FTM A;  4KOD A;  4CS0 A;  3GTQ A;  1UHE A;  2JIO A;  2B63 A;  1CR5 A;  4D7Z B;  1Q16 A;  5FTJ A;  4KDI A;  3QC8 A;  1QDN A;  2EEO B;  4RV0 A;  1Y4Z A;  4QIW A;  2R92 A;  2V3V A;  1TWH A;  1S3S A;  3FKI A;  2PJH B;  1E5V A;  1PYU B;  4DMR A;  3CF2 A;  3TM7 B;  2JIR A;  1G8K A;  3HU3 A;  3QQ8 A;  2NYA A;  3GTL A;  5T5I D; 
#chains in the Genus database with same CATH topology
 5EPP A;  4GA6 A;  3IR5 A;  1E32 A;  1YNN D;  3D30 A;  2NAP A;  2JA6 A;  1EU1 A;  3GTJ A;  2VPX A;  4ENG A;  1WCM A;  1QCS A;  3PLX B;  2WB1 A;  2GAE A;  1TWA A;  1OA7 A;  3IR7 A;  4FFT A;  5T5M D;  1SFO A;  3X2G A;  3GTM A;  1YLE A;  2JIM A;  2A6H D;  4CRZ A;  3GTP A;  2PI8 A;  3HKZ A;  2O5J D;  3H0G A;  5FTL A;  1BW4 A;  2HCZ X;  3ML1 A;  3IR6 A;  2PMZ A;  3DMR A;  1K83 A;  2VUM A;  2JIP A;  3CQZ A;  1TWG A;  2E2I A;  1DMR A;  4FER A;  3QWZ A;  3OUG A;  3SUL A;  3X2I A;  4ZM7 A;  4AAY A;  5C1B A;  1I50 A;  1PQH A;  4JCW A;  1E60 A;  2G6G A;  1PT0 A;  3QQ7 A;  1CZ4 A;  5GM9 A;  4NOH A;  3SUK A;  3TIW A;  2R93 A;  2JA5 A;  5H4U A;  4L48 A;  3X2P A;  5C18 A;  3GTG A;  1G8J A;  2ENG A;  1PQF A;  4GA5 A;  2JA7 A;  1SIW A;  2AE0 X;  1FDI A;  2A69 D;  2KI8 A;  4AVR A;  1SMY D;  1WLF A;  4JP6 A;  1OGY A;  1CZ5 A;  3HU2 A;  3X2H A;  5GLF A;  1TMO A;  2G5D A;  1PQE A;  1TWF A;  2V45 A;  1TWC A;  1Y1W A;  3GTK A;  2KQA A;  2E7Z A;  4AOK B;  2NVX A;  2C45 A;  3X2N A;  1DMS A;  2BH0 A;  1KQG A;  1I3Q A;  2YUJ A;  4CRY G;  4KLN A;  2E2H A;  4JJO A;  1AA6 A;  3HU1 A;  1H5N A;  3GTO A;  5FTK A;  2WAQ A;  1ZC1 A;  1E18 A;  4AZD A;  5B6C A;  2NVY A;  1AW8 B;  3ENG A;  5DYG A;  2CW0 D;  2PNW A;  3X2L A;  2JIQ A;  1R7R A;  2VPY A;  1OA9 A;  3SUJ A;  2IV2 X;  2DMR A;  1R27 A;  4C2M A;  2BE5 D;  5FTN A;  2VPW A;  1UHD A;  1VC3 B;  4FG4 A;  3X2K A;  1PPY A;  3M3G A;  4AON B;  1R9T A;  1Y1V A;  3O5A A;  1WC2 A;  5DYI A;  1HD5 A;  3X2O A;  2R7Z A;  4KO8 A;  5GLY A;  1E61 A;  1H0H A;  2YU9 A;  1Y5I A;  2VPZ A;  4AYB A;  4KDL A;  1FDO A;  1PT1 A;  2Y0S A;  1ZYR D;  1L8F A;  1IW7 D;  1PYQ A;  2PJJ A;  1KQF A;  5FTM A;  4KOD A;  2A68 D;  4CS0 A;  3GTQ A;  1UHE A;  2JIO A;  3X2J A;  1BW3 A;  5GLX A;  4FG2 A;  2B63 A;  2PIC A;  1CR5 A;  4D7Z B;  1Q16 A;  5FTJ A;  4KDI A;  3QC8 A;  3SUM A;  1QDN A;  2EEO B;  4RV0 A;  1Y4Z A;  4QIW A;  2R92 A;  2V3V A;  1TWH A;  4JS7 A;  1S3S A;  3X2M A;  3FKI A;  2A6E D;  3CZB A;  4JP7 A;  2PJH B;  1E5V A;  1PYU B;  4DMR A;  3CF2 A;  3TM7 B;  1YNJ D;  2JIR A;  1G8K A;  3HU3 A;  3QQ8 A;  1N10 A;  2NYA A;  3GTL A;  5T5I D; 
#chains in the Genus database with same CATH homology
 5EPP A;  4GA6 A;  3IR5 A;  1E32 A;  1YNN D;  2NAP A;  2JA6 A;  1EU1 A;  3GTJ A;  2VPX A;  1WCM A;  1QCS A;  3PLX B;  2WB1 A;  2GAE A;  1TWA A;  3IR7 A;  1SFO A;  5T5M D;  3GTM A;  1YLE A;  2JIM A;  2A6H D;  4CRZ A;  3GTP A;  2PI8 A;  3HKZ A;  2O5J D;  3H0G A;  5FTL A;  3ML1 A;  3IR6 A;  2PMZ A;  3DMR A;  1K83 A;  2VUM A;  2JIP A;  3CQZ A;  1TWG A;  2E2I A;  1DMR A;  5C1B A;  3QWZ A;  3OUG A;  4AAY A;  1I50 A;  1PQH A;  1E60 A;  2G6G A;  1PT0 A;  3QQ7 A;  1CZ4 A;  4NOH A;  3TIW A;  2R93 A;  2JA5 A;  5C18 A;  3GTG A;  1G8J A;  1PQF A;  4GA5 A;  2JA7 A;  1SIW A;  2AE0 X;  1FDI A;  2A69 D;  2KI8 A;  1SMY D;  1WLF A;  1OGY A;  1CZ5 A;  3HU2 A;  5GLF A;  1TMO A;  2G5D A;  1PQE A;  1TWF A;  2V45 A;  1TWC A;  1Y1W A;  3GTK A;  2E7Z A;  4AOK B;  2NVX A;  2C45 A;  1KQG A;  1DMS A;  1I3Q A;  2YUJ A;  4CRY G;  4KLN A;  2E2H A;  1AA6 A;  3HU1 A;  1H5N A;  3GTO A;  5FTK A;  2WAQ A;  1ZC1 A;  1E18 A;  4AZD A;  5B6C A;  2NVY A;  1AW8 B;  5DYG A;  2CW0 D;  2PNW A;  2JIQ A;  1R7R A;  2VPY A;  2IV2 X;  2DMR A;  1R27 A;  4C2M A;  2BE5 D;  5FTN A;  2VPW A;  1UHD A;  1VC3 B;  1PPY A;  4AON B;  1R9T A;  1Y1V A;  3O5A A;  5DYI A;  2R7Z A;  4KO8 A;  1E61 A;  1H0H A;  2YU9 A;  1Y5I A;  2VPZ A;  4AYB A;  4KDL A;  1FDO A;  1PT1 A;  2Y0S A;  1ZYR D;  1IW7 D;  1PYQ A;  2PJJ A;  1KQF A;  5FTM A;  4KOD A;  2A68 D;  4CS0 A;  3GTQ A;  1UHE A;  2JIO A;  2B63 A;  2PIC A;  1CR5 A;  4D7Z B;  1Q16 A;  5FTJ A;  4KDI A;  3QC8 A;  1QDN A;  2EEO B;  4RV0 A;  1Y4Z A;  4QIW A;  2R92 A;  2V3V A;  1TWH A;  1S3S A;  3FKI A;  2A6E D;  3CZB A;  2PJH B;  1E5V A;  1PYU B;  4DMR A;  3CF2 A;  3TM7 B;  1YNJ D;  2JIR A;  1G8K A;  3HU3 A;  3QQ8 A;  2NYA A;  3GTL A;  5T5I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...