5T5ID

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, orthorhombic form at 1.9 a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
b'MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGKVGQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
molecule tags Oxidoreductase
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
total genus 32
structure length 130
sequence length 130
chains with identical sequence L
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5iD00
1UHDA 2E2IA 2C45A 5FTKA 2JA5A 3HKZA 5FTNA 5FTLA 2JA7A 1FDOA 2VPZA 4D7ZB 1VC3B 1PYQA 1TWGA 1TWFA 2JIOA 1Q16A 3HU2A 2E7ZA 3FKIA 1KQFA 5DYIA 3HU1A 1PQFA 1DMSA 1PQHA 3DMRA 4KLNA 1E5VA 5FTJA 5GLFA 2NVYA 1CR5A 4KDLA 2WAQA 3GTLA 3GTJA 1AW8B 3GTPA 2DMRA 5FTMA 2PMZA 2JIMA 4CRZA 1TMOA 3OUGA 4CRYG 1R27A 2E2HA 2JA6A 4QIWA 1H0HA 1AA6A 1G8KA 1CZ5A 1Y1VA 1QCSA 3CQZA 1EU1A 3IR5A 2B63A 4CS0A 1H5NA 1TWAA 1Y5IA 2V3VA 1K83A 5T5ID 1QDNA 3TM7B 1G8JA 5B6CA 4KDIA 1CZ4A 3H0GA 1E32A 2VPXA 1TWHA 2VPYA 3ML1A 1PPYA 1R7RA 2KI8A 4GA5A 1Y4ZA 5C1BA 2VPWA 5T5MD 4AZDA 2PJHB 3O5AA 2R93A 2JIRA 1S3SA 2IV2X 3TIWA 1KQGA 4AYBA 1I3QA 3IR6A 1FDIA 1Y1WA 1E18A 2JIPA 4KODA 1PT1A 1I50A 3GTQA 3GTGA 1WLFA 3QQ8A 3QQ7A 3CF2A 4KO8A 1SFOA 1IW7D 1R9TA 3IR7A 4DMRA 1UHEA 2NAPA 1WCMA 2VUMA 2NVXA 3GTMA 1PYUB 1PT0A 1YLEA 2JIQA 4AAYA 1OGYA 2YU9A 4RV0A 3GTOA 2WB1A 2V45A 4AOKB 1PQEA 2NYAA 2R92A 2R7ZA 1E61A 1DMRA 3QC8A 3GTKA 3QWZA 5DYGA 4C2MA 2Y0SA 4GA6A 2EEOB 3HU3A 3PLXB 1SIWA 5EPPA 1TWCA 1E60A 4AONB 5C18A
chains in the Genus database with same CATH superfamily
1UHDA 2E2IA 2C45A 1YNJD 1HD5A 5FTKA 4JJOA 4JS7A 4ENGA 2JA5A 3HKZA 5FTNA 2PJJA 5FTLA 2JA7A 3SUJA 2G6GA 1FDOA 2YUJA 2VPZA 2KQAA 2A69D 4FG4A 4D7ZB 1VC3B 2JIOA 1PYQA 1TWGA 1TWFA 1Q16A 3X2KA 3HU2A 2E7ZA 3D30A 3FKIA 1KQFA 1BW4A 1L8FA 3X2PA 5DYIA 3SUMA 2HCZX 3HU1A 1PQFA 1DMSA 3ENGA 1PQHA 3DMRA 4KLNA 1E5VA 5FTJA 5GLFA 3X2JA 2NVYA 1CR5A 4FFTA 4KDLA 2WAQA 4L48A 3GTLA 3GTJA 1ZC1A 3SULA 1AW8B 4JP6A 3GTPA 2DMRA 5FTMA 1ZYRD 3X2NA 2PMZA 2JIMA 3CZBA 4CRZA 1TMOA 3OUGA 4CRYG 1R27A 2E2HA 2JA6A 4QIWA 1H0HA 1AA6A 1G8KA 1CZ5A 1Y1VA 2A6ED 2ENGA 1QCSA 3CQZA 1EU1A 3IR5A 2B63A 4CS0A 1H5NA 1TWAA 1Y5IA 2V3VA 1K83A 5T5ID 1QDNA 1BW3A 5GLYA 1G8JA 3TM7B 2BE5D 5B6CA 4KDIA 1CZ4A 3H0GA 2GAEA 1E32A 2VPXA 2G5DA 1TWHA 2PNWA 3X2MA 4JP7A 2VPYA 3ML1A 5GM9A 3SUKA 1PPYA 3X2GA 1R7RA 2A6HD 2KI8A 4GA5A 1Y4ZA 5C1BA 2VPWA 5T5MD 4AZDA 2PJHB 3O5AA 3X2HA 2R93A 2JIRA 1S3SA 2IV2X 3TIWA 1KQGA 4JCWA 4AYBA 3IR6A 1SMYD 1I3QA 1FDIA 1OA9A 1Y1WA 1E18A 2JIPA 4KODA 1PT1A 1I50A 3GTQA 3GTGA 1WLFA 2CW0D 2O5JD 3QQ8A 3QQ7A 2BH0A 3CF2A 1N10A 3M3GA 4KO8A 1SFOA 1IW7D 1R9TA 2A68D 3IR7A 4DMRA 1UHEA 2NAPA 4FERA 1WCMA 4AVRA 2VUMA 2NVXA 3GTMA 1PYUB 1PT0A 1YLEA 2JIQA 4AAYA 1OA7A 1OGYA 2YU9A 4RV0A 3GTOA 2AE0X 2WB1A 3X2OA 5GLXA 2V45A 4AOKB 1PQEA 4FG2A 1YNND 2NYAA 3X2IA 2R92A 2R7ZA 1E61A 1DMRA 3QC8A 2PICA 3GTKA 5H4UA 3QWZA 4ZM7A 5DYGA 3X2LA 4NOHA 4C2MA 2Y0SA 4GA6A 2EEOB 2PI8A 3HU3A 1SIWA 3PLXB 5EPPA 1TWCA 1E60A 1WC2A 4AONB 5C18A
chains in the Genus database with same CATH topology
1UHDA 2E2IA 2C45A 1YNJD 5FTKA 2JA5A 3HKZA 5FTNA 2PJJA 5FTLA 2JA7A 2G6GA 1FDOA 2YUJA 2VPZA 2A69D 4D7ZB 1VC3B 1PYQA 1TWGA 1TWFA 2JIOA 1Q16A 3HU2A 2E7ZA 3FKIA 1KQFA 5DYIA 3HU1A 1PQFA 1DMSA 1PQHA 3DMRA 4KLNA 1E5VA 5FTJA 5GLFA 2NVYA 1CR5A 4KDLA 2WAQA 3GTLA 3GTJA 1ZC1A 1AW8B 3GTPA 2DMRA 5FTMA 1ZYRD 2PMZA 2JIMA 3CZBA 4CRZA 1TMOA 3OUGA 4CRYG 1R27A 2E2HA 2JA6A 4QIWA 1H0HA 1AA6A 1G8KA 1CZ5A 1Y1VA 2A6ED 1QCSA 3CQZA 1EU1A 3IR5A 2B63A 4CS0A 1H5NA 1TWAA 1Y5IA 2V3VA 1K83A 5T5ID 1QDNA 3TM7B 1G8JA 2BE5D 5B6CA 4KDIA 1CZ4A 3H0GA 2GAEA 1E32A 2VPXA 2G5DA 1TWHA 2PNWA 2VPYA 3ML1A 1PPYA 1R7RA 2A6HD 2KI8A 4GA5A 1Y4ZA 5C1BA 2VPWA 5T5MD 4AZDA 2PJHB 3O5AA 2R93A 2JIRA 1S3SA 2IV2X 3TIWA 1KQGA 4AYBA 1I3QA 3IR6A 1SMYD 1FDIA 1Y1WA 1E18A 2JIPA 4KODA 1PT1A 1I50A 3GTQA 3GTGA 1WLFA 2CW0D 2O5JD 3QQ8A 3QQ7A 3CF2A 4KO8A 1SFOA 1IW7D 1R9TA 2A68D 3IR7A 4DMRA 1UHEA 2NAPA 1WCMA 2VUMA 2NVXA 3GTMA 1PYUB 1PT0A 1YLEA 2JIQA 4AAYA 1OGYA 2YU9A 4RV0A 3GTOA 2AE0X 2WB1A 2V45A 4AOKB 1PQEA 1YNND 2NYAA 2R92A 2R7ZA 1E61A 1DMRA 3QC8A 2PICA 3GTKA 3QWZA 5DYGA 4NOHA 4C2MA 2Y0SA 4GA6A 2EEOB 2PI8A 3HU3A 1SIWA 3PLXB 5EPPA 1TWCA 1E60A 4AONB 5C18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHD A;  2E2I A;  2C45 A;  5FTK A;  2JA5 A;  3HKZ A;  5FTN A;  5FTL A;  2JA7 A;  1FDO A;  2VPZ A;  4D7Z B;  1VC3 B;  1PYQ A;  1TWG A;  1TWF A;  2JIO A;  1Q16 A;  3HU2 A;  2E7Z A;  3FKI A;  1KQF A;  5DYI A;  3HU1 A;  1PQF A;  1DMS A;  1PQH A;  3DMR A;  4KLN A;  1E5V A;  5FTJ A;  5GLF A;  2NVY A;  1CR5 A;  4KDL A;  2WAQ A;  3GTL A;  3GTJ A;  1AW8 B;  3GTP A;  2DMR A;  5FTM A;  2PMZ A;  2JIM A;  4CRZ A;  1TMO A;  3OUG A;  4CRY G;  1R27 A;  2E2H A;  2JA6 A;  4QIW A;  1H0H A;  1AA6 A;  1G8K A;  1CZ5 A;  1Y1V A;  1QCS A;  3CQZ A;  1EU1 A;  3IR5 A;  2B63 A;  4CS0 A;  1H5N A;  1TWA A;  1Y5I A;  2V3V A;  1K83 A;  5T5I D;  1QDN A;  3TM7 B;  1G8J A;  5B6C A;  4KDI A;  1CZ4 A;  3H0G A;  1E32 A;  2VPX A;  1TWH A;  2VPY A;  3ML1 A;  1PPY A;  1R7R A;  2KI8 A;  4GA5 A;  1Y4Z A;  5C1B A;  2VPW A;  5T5M D;  4AZD A;  2PJH B;  3O5A A;  2R93 A;  2JIR A;  1S3S A;  2IV2 X;  3TIW A;  1KQG A;  4AYB A;  1I3Q A;  3IR6 A;  1FDI A;  1Y1W A;  1E18 A;  2JIP A;  4KOD A;  1PT1 A;  1I50 A;  3GTQ A;  3GTG A;  1WLF A;  3QQ8 A;  3QQ7 A;  3CF2 A;  4KO8 A;  1SFO A;  1IW7 D;  1R9T A;  3IR7 A;  4DMR A;  1UHE A;  2NAP A;  1WCM A;  2VUM A;  2NVX A;  3GTM A;  1PYU B;  1PT0 A;  1YLE A;  2JIQ A;  4AAY A;  1OGY A;  2YU9 A;  4RV0 A;  3GTO A;  2WB1 A;  2V45 A;  4AOK B;  1PQE A;  2NYA A;  2R92 A;  2R7Z A;  1E61 A;  1DMR A;  3QC8 A;  3GTK A;  3QWZ A;  5DYG A;  4C2M A;  2Y0S A;  4GA6 A;  2EEO B;  3HU3 A;  3PLX B;  1SIW A;  5EPP A;  1TWC A;  1E60 A;  4AON B;  5C18 A; 
#chains in the Genus database with same CATH topology
 1UHD A;  2E2I A;  2C45 A;  1YNJ D;  1HD5 A;  5FTK A;  4JJO A;  4JS7 A;  4ENG A;  2JA5 A;  3HKZ A;  5FTN A;  2PJJ A;  5FTL A;  2JA7 A;  3SUJ A;  2G6G A;  1FDO A;  2YUJ A;  2VPZ A;  2KQA A;  2A69 D;  4FG4 A;  4D7Z B;  1VC3 B;  2JIO A;  1PYQ A;  1TWG A;  1TWF A;  1Q16 A;  3X2K A;  3HU2 A;  2E7Z A;  3D30 A;  3FKI A;  1KQF A;  1BW4 A;  1L8F A;  3X2P A;  5DYI A;  3SUM A;  2HCZ X;  3HU1 A;  1PQF A;  1DMS A;  3ENG A;  1PQH A;  3DMR A;  4KLN A;  1E5V A;  5FTJ A;  5GLF A;  3X2J A;  2NVY A;  1CR5 A;  4FFT A;  4KDL A;  2WAQ A;  4L48 A;  3GTL A;  3GTJ A;  1ZC1 A;  3SUL A;  1AW8 B;  4JP6 A;  3GTP A;  2DMR A;  5FTM A;  1ZYR D;  3X2N A;  2PMZ A;  2JIM A;  3CZB A;  4CRZ A;  1TMO A;  3OUG A;  4CRY G;  1R27 A;  2E2H A;  2JA6 A;  4QIW A;  1H0H A;  1AA6 A;  1G8K A;  1CZ5 A;  1Y1V A;  2A6E D;  2ENG A;  1QCS A;  3CQZ A;  1EU1 A;  3IR5 A;  2B63 A;  4CS0 A;  1H5N A;  1TWA A;  1Y5I A;  2V3V A;  1K83 A;  5T5I D;  1QDN A;  1BW3 A;  5GLY A;  1G8J A;  3TM7 B;  2BE5 D;  5B6C A;  4KDI A;  1CZ4 A;  3H0G A;  2GAE A;  1E32 A;  2VPX A;  2G5D A;  1TWH A;  2PNW A;  3X2M A;  4JP7 A;  2VPY A;  3ML1 A;  5GM9 A;  3SUK A;  1PPY A;  3X2G A;  1R7R A;  2A6H D;  2KI8 A;  4GA5 A;  1Y4Z A;  5C1B A;  2VPW A;  5T5M D;  4AZD A;  2PJH B;  3O5A A;  3X2H A;  2R93 A;  2JIR A;  1S3S A;  2IV2 X;  3TIW A;  1KQG A;  4JCW A;  4AYB A;  3IR6 A;  1SMY D;  1I3Q A;  1FDI A;  1OA9 A;  1Y1W A;  1E18 A;  2JIP A;  4KOD A;  1PT1 A;  1I50 A;  3GTQ A;  3GTG A;  1WLF A;  2CW0 D;  2O5J D;  3QQ8 A;  3QQ7 A;  2BH0 A;  3CF2 A;  1N10 A;  3M3G A;  4KO8 A;  1SFO A;  1IW7 D;  1R9T A;  2A68 D;  3IR7 A;  4DMR A;  1UHE A;  2NAP A;  4FER A;  1WCM A;  4AVR A;  2VUM A;  2NVX A;  3GTM A;  1PYU B;  1PT0 A;  1YLE A;  2JIQ A;  4AAY A;  1OA7 A;  1OGY A;  2YU9 A;  4RV0 A;  3GTO A;  2AE0 X;  2WB1 A;  3X2O A;  5GLX A;  2V45 A;  4AOK B;  1PQE A;  4FG2 A;  1YNN D;  2NYA A;  3X2I A;  2R92 A;  2R7Z A;  1E61 A;  1DMR A;  3QC8 A;  2PIC A;  3GTK A;  5H4U A;  3QWZ A;  4ZM7 A;  5DYG A;  3X2L A;  4NOH A;  4C2M A;  2Y0S A;  4GA6 A;  2EEO B;  2PI8 A;  3HU3 A;  1SIW A;  3PLX B;  5EPP A;  1TWC A;  1E60 A;  1WC2 A;  4AON B;  5C18 A; 
#chains in the Genus database with same CATH homology
 1UHD A;  2E2I A;  2C45 A;  1YNJ D;  5FTK A;  2JA5 A;  3HKZ A;  5FTN A;  2PJJ A;  5FTL A;  2JA7 A;  2G6G A;  1FDO A;  2YUJ A;  2VPZ A;  2A69 D;  4D7Z B;  1VC3 B;  1PYQ A;  1TWG A;  1TWF A;  2JIO A;  1Q16 A;  3HU2 A;  2E7Z A;  3FKI A;  1KQF A;  5DYI A;  3HU1 A;  1PQF A;  1DMS A;  1PQH A;  3DMR A;  4KLN A;  1E5V A;  5FTJ A;  5GLF A;  2NVY A;  1CR5 A;  4KDL A;  2WAQ A;  3GTL A;  3GTJ A;  1ZC1 A;  1AW8 B;  3GTP A;  2DMR A;  5FTM A;  1ZYR D;  2PMZ A;  2JIM A;  3CZB A;  4CRZ A;  1TMO A;  3OUG A;  4CRY G;  1R27 A;  2E2H A;  2JA6 A;  4QIW A;  1H0H A;  1AA6 A;  1G8K A;  1CZ5 A;  1Y1V A;  2A6E D;  1QCS A;  3CQZ A;  1EU1 A;  3IR5 A;  2B63 A;  4CS0 A;  1H5N A;  1TWA A;  1Y5I A;  2V3V A;  1K83 A;  5T5I D;  1QDN A;  3TM7 B;  1G8J A;  2BE5 D;  5B6C A;  4KDI A;  1CZ4 A;  3H0G A;  2GAE A;  1E32 A;  2VPX A;  2G5D A;  1TWH A;  2PNW A;  2VPY A;  3ML1 A;  1PPY A;  1R7R A;  2A6H D;  2KI8 A;  4GA5 A;  1Y4Z A;  5C1B A;  2VPW A;  5T5M D;  4AZD A;  2PJH B;  3O5A A;  2R93 A;  2JIR A;  1S3S A;  2IV2 X;  3TIW A;  1KQG A;  4AYB A;  1I3Q A;  3IR6 A;  1SMY D;  1FDI A;  1Y1W A;  1E18 A;  2JIP A;  4KOD A;  1PT1 A;  1I50 A;  3GTQ A;  3GTG A;  1WLF A;  2CW0 D;  2O5J D;  3QQ8 A;  3QQ7 A;  3CF2 A;  4KO8 A;  1SFO A;  1IW7 D;  1R9T A;  2A68 D;  3IR7 A;  4DMR A;  1UHE A;  2NAP A;  1WCM A;  2VUM A;  2NVX A;  3GTM A;  1PYU B;  1PT0 A;  1YLE A;  2JIQ A;  4AAY A;  1OGY A;  2YU9 A;  4RV0 A;  3GTO A;  2AE0 X;  2WB1 A;  2V45 A;  4AOK B;  1PQE A;  1YNN D;  2NYA A;  2R92 A;  2R7Z A;  1E61 A;  1DMR A;  3QC8 A;  2PIC A;  3GTK A;  3QWZ A;  5DYG A;  4NOH A;  4C2M A;  2Y0S A;  4GA6 A;  2EEO B;  2PI8 A;  3HU3 A;  1SIW A;  3PLX B;  5EPP A;  1TWC A;  1E60 A;  4AON B;  5C18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...