5T5ID

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, orthorhombic form at 1.9 a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
b'MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGKVGQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 130
sequence length 130
chains with identical sequence L
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5iD00
4QIWA 2R92A 3GTGA 1FDIA 2KI8A 2VPWA 3QWZA 2YU9A 2PMZA 4AAYA 1TWGA 3HU1A 4AONB 3PLXB 1SIWA 1UHEA 1QDNA 2NYAA 5T5MD 1PT0A 5C1BA 2B63A 2NVYA 1K83A 3FKIA 4KDLA 1DMRA 3GTOA 1R7RA 1Y4ZA 3IR7A 2E2HA 1TMOA 3TIWA 1TWFA 4KO8A 2NVXA 1Y5IA 3HU3A 1CZ5A 1G8KA 1FDOA 1SFOA 4CRYG 2V45A 3GTLA 2V3VA 2R7ZA 2JA7A 1PQEA 5EPPA 1Y1VA 5T5ID 3OUGA 3CQZA 2JIRA 1E18A 1R27A 1E60A 5FTJA 2JA5A 3GTKA 1OGYA 4KLNA 1IW7D 3IR6A 4AYBA 2VPXA 1WLFA 1TWHA 1E32A 1EU1A 2R93A 5DYIA 3O5AA 1H0HA 2WAQA 4KDIA 3GTMA 5FTMA 3QQ8A 1PQHA 1I3QA 2DMRA 2E7ZA 3QC8A 1YLEA 1PQFA 1PPYA 3IR5A 2JIOA 5GLFA 1TWAA 4GA6A 5FTLA 1UHDA 4AZDA 2VPZA 1Y1WA 1PYQA 1TWCA 2VPYA 3GTPA 2WB1A 1PT1A 2NAPA 2E2IA 3GTJA 4GA5A 3DMRA 4C2MA 4RV0A 4DMRA 2JIQA 1WCMA 1Q16A 1H5NA 2PJHB 3TM7B 4CS0A 3ML1A 4KODA 4CRZA 1PYUB 5FTKA 1G8JA 4D7ZB 5C18A 1DMSA 3CF2A 5DYGA 2EEOB 1R9TA 2Y0SA 1E5VA 2JA6A 1CZ4A 2JIMA 1S3SA 1E61A 1I50A 1AA6A 1AW8B 1CR5A 1KQFA 3HKZA 3HU2A 2IV2X 2VUMA 1QCSA 1VC3B 2JIPA 5FTNA 5B6CA 2C45A 3GTQA 3H0GA 1KQGA 3QQ7A 4AOKB
chains in the Genus database with same CATH superfamily
4QIWA 4FG2A 2R92A 3GTGA 1FDIA 2KI8A 2VPWA 3QWZA 2YU9A 2PMZA 4FFTA 3X2HA 4AAYA 5GLYA 2O5JD 1TWGA 3SULA 3HU1A 4AONB 3PLXB 1SIWA 1UHEA 1QDNA 2NYAA 1ZC1A 2KQAA 1PT0A 2PNWA 5T5MD 4JP6A 5C1BA 2PICA 2B63A 2NVYA 1K83A 3FKIA 4KDLA 4JP7A 1DMRA 3GTOA 1R7RA 1Y4ZA 3IR7A 2E2HA 1TMOA 3TIWA 1TWFA 4KO8A 2G6GA 2NVXA 1Y5IA 3HU3A 1CZ5A 1G8KA 1FDOA 1SFOA 4CRYG 4JCWA 4FG4A 3X2IA 2V45A 3GTLA 1L8FA 1OA9A 2V3VA 1WC2A 2R7ZA 2JA7A 3SUMA 1PQEA 1YNND 2BE5D 5EPPA 1Y1VA 2G5DA 5T5ID 3OUGA 3CQZA 2JIRA 1E18A 1R27A 1E60A 2A6ED 5FTJA 1BW4A 2JA5A 4AVRA 2CW0D 3GTKA 1OGYA 4KLNA 1SMYD 1IW7D 4JJOA 2PI8A 3IR6A 4AYBA 2VPXA 1WLFA 1TWHA 1E32A 1EU1A 2R93A 5DYIA 3O5AA 1H0HA 2WAQA 4KDIA 3GTMA 5FTMA 4L48A 3QQ8A 1PQHA 1I3QA 2DMRA 2E7ZA 5GLXA 3QC8A 1YLEA 1PQFA 1PPYA 3IR5A 2JIOA 4NOHA 5GLFA 4ENGA 3CZBA 1TWAA 4GA6A 5FTLA 1UHDA 4AZDA 1BW3A 2VPZA 1Y1WA 3X2OA 3M3GA 1PYQA 1TWCA 1HD5A 2VPYA 3GTPA 2WB1A 1PT1A 2NAPA 2E2IA 2A69D 3ENGA 3GTJA 4GA5A 3DMRA 2GAEA 4RV0A 4C2MA 2A68D 4DMRA 2JIQA 3X2GA 1WCMA 1Q16A 5GM9A 1H5NA 4ZM7A 2PJHB 2PJJA 3TM7B 3ML1A 3X2LA 4KODA 1ZYRD 4CS0A 4CRZA 1PYUB 5FTKA 3X2KA 3SUKA 1G8JA 1OA7A 5H4UA 4D7ZB 3X2JA 2YUJA 2A6HD 5C18A 3X2NA 1N10A 1DMSA 3CF2A 5DYGA 2EEOB 1R9TA 2Y0SA 1E5VA 2JA6A 1CZ4A 2JIMA 1S3SA 1E61A 4JS7A 1AA6A 1I50A 3D30A 1AW8B 1CR5A 1KQFA 1YNJD 3SUJA 3HKZA 3HU2A 2BH0A 2AE0X 2IV2X 2VUMA 2ENGA 4FERA 1QCSA 1VC3B 2HCZX 3X2MA 3X2PA 2JIPA 5FTNA 5B6CA 2C45A 3GTQA 3H0GA 1KQGA 3QQ7A 4AOKB
chains in the Genus database with same CATH topology
4QIWA 2R92A 3GTGA 1FDIA 2KI8A 2VPWA 3QWZA 2YU9A 2PMZA 4AAYA 2O5JD 1TWGA 3HU1A 4AONB 3PLXB 1SIWA 2NYAA 1QDNA 1UHEA 1ZC1A 2PNWA 1PT0A 5T5MD 5C1BA 2PICA 2B63A 2NVYA 1K83A 3FKIA 4KDLA 1DMRA 3GTOA 1R7RA 1Y4ZA 3IR7A 2E2HA 1TMOA 3TIWA 1TWFA 4KO8A 2G6GA 2NVXA 1Y5IA 3HU3A 1CZ5A 1G8KA 1FDOA 1SFOA 4CRYG 2V45A 3GTLA 2V3VA 2R7ZA 2JA7A 1PQEA 1YNND 2BE5D 5EPPA 1Y1VA 2G5DA 5T5ID 3OUGA 3CQZA 2JIRA 1E18A 1R27A 1E60A 2A6ED 5FTJA 2JA5A 3GTKA 2CW0D 1OGYA 4KLNA 1SMYD 1IW7D 2PI8A 3IR6A 4AYBA 2VPXA 1WLFA 1TWHA 1E32A 1EU1A 2R93A 5DYIA 3O5AA 1H0HA 2WAQA 4KDIA 3GTMA 5FTMA 3QQ8A 1PQHA 1I3QA 2DMRA 2E7ZA 3QC8A 1YLEA 1PQFA 1PPYA 3IR5A 2JIOA 4NOHA 5GLFA 3CZBA 1TWAA 4GA6A 5FTLA 1UHDA 4AZDA 2VPZA 1Y1WA 1PYQA 1TWCA 2VPYA 3GTPA 2WB1A 1PT1A 2NAPA 2E2IA 2A69D 3GTJA 4GA5A 3DMRA 2GAEA 4RV0A 4C2MA 2A68D 4DMRA 2JIQA 1WCMA 1Q16A 1H5NA 2PJHB 2PJJA 3TM7B 3ML1A 4CS0A 4KODA 1ZYRD 4CRZA 1PYUB 5FTKA 1G8JA 4D7ZB 2YUJA 2A6HD 5C18A 1DMSA 3CF2A 5DYGA 2EEOB 1R9TA 2Y0SA 1E5VA 2JA6A 1CZ4A 2JIMA 1S3SA 1E61A 1I50A 1AA6A 1AW8B 1CR5A 1KQFA 1YNJD 3HKZA 3HU2A 2AE0X 2IV2X 2VUMA 1QCSA 1VC3B 2JIPA 5FTNA 5B6CA 2C45A 3GTQA 3H0GA 1KQGA 3QQ7A 4AOKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW A;  2R92 A;  3GTG A;  1FDI A;  2KI8 A;  2VPW A;  3QWZ A;  2YU9 A;  2PMZ A;  4AAY A;  1TWG A;  3HU1 A;  4AON B;  3PLX B;  1SIW A;  1UHE A;  1QDN A;  2NYA A;  5T5M D;  1PT0 A;  5C1B A;  2B63 A;  2NVY A;  1K83 A;  3FKI A;  4KDL A;  1DMR A;  3GTO A;  1R7R A;  1Y4Z A;  3IR7 A;  2E2H A;  1TMO A;  3TIW A;  1TWF A;  4KO8 A;  2NVX A;  1Y5I A;  3HU3 A;  1CZ5 A;  1G8K A;  1FDO A;  1SFO A;  4CRY G;  2V45 A;  3GTL A;  2V3V A;  2R7Z A;  2JA7 A;  1PQE A;  5EPP A;  1Y1V A;  5T5I D;  3OUG A;  3CQZ A;  2JIR A;  1E18 A;  1R27 A;  1E60 A;  5FTJ A;  2JA5 A;  3GTK A;  1OGY A;  4KLN A;  1IW7 D;  3IR6 A;  4AYB A;  2VPX A;  1WLF A;  1TWH A;  1E32 A;  1EU1 A;  2R93 A;  5DYI A;  3O5A A;  1H0H A;  2WAQ A;  4KDI A;  3GTM A;  5FTM A;  3QQ8 A;  1PQH A;  1I3Q A;  2DMR A;  2E7Z A;  3QC8 A;  1YLE A;  1PQF A;  1PPY A;  3IR5 A;  2JIO A;  5GLF A;  1TWA A;  4GA6 A;  5FTL A;  1UHD A;  4AZD A;  2VPZ A;  1Y1W A;  1PYQ A;  1TWC A;  2VPY A;  3GTP A;  2WB1 A;  1PT1 A;  2NAP A;  2E2I A;  3GTJ A;  4GA5 A;  3DMR A;  4C2M A;  4RV0 A;  4DMR A;  2JIQ A;  1WCM A;  1Q16 A;  1H5N A;  2PJH B;  3TM7 B;  4CS0 A;  3ML1 A;  4KOD A;  4CRZ A;  1PYU B;  5FTK A;  1G8J A;  4D7Z B;  5C18 A;  1DMS A;  3CF2 A;  5DYG A;  2EEO B;  1R9T A;  2Y0S A;  1E5V A;  2JA6 A;  1CZ4 A;  2JIM A;  1S3S A;  1E61 A;  1I50 A;  1AA6 A;  1AW8 B;  1CR5 A;  1KQF A;  3HKZ A;  3HU2 A;  2IV2 X;  2VUM A;  1QCS A;  1VC3 B;  2JIP A;  5FTN A;  5B6C A;  2C45 A;  3GTQ A;  3H0G A;  1KQG A;  3QQ7 A;  4AOK B; 
#chains in the Genus database with same CATH topology
 4QIW A;  4FG2 A;  2R92 A;  3GTG A;  1FDI A;  2KI8 A;  2VPW A;  3QWZ A;  2YU9 A;  2PMZ A;  4FFT A;  3X2H A;  4AAY A;  5GLY A;  2O5J D;  1TWG A;  3SUL A;  3HU1 A;  4AON B;  3PLX B;  1SIW A;  1UHE A;  1QDN A;  2NYA A;  1ZC1 A;  2KQA A;  1PT0 A;  2PNW A;  5T5M D;  4JP6 A;  5C1B A;  2PIC A;  2B63 A;  2NVY A;  1K83 A;  3FKI A;  4KDL A;  4JP7 A;  1DMR A;  3GTO A;  1R7R A;  1Y4Z A;  3IR7 A;  2E2H A;  1TMO A;  3TIW A;  1TWF A;  4KO8 A;  2G6G A;  2NVX A;  1Y5I A;  3HU3 A;  1CZ5 A;  1G8K A;  1FDO A;  1SFO A;  4CRY G;  4JCW A;  4FG4 A;  3X2I A;  2V45 A;  3GTL A;  1L8F A;  1OA9 A;  2V3V A;  1WC2 A;  2R7Z A;  2JA7 A;  3SUM A;  1PQE A;  1YNN D;  2BE5 D;  5EPP A;  1Y1V A;  2G5D A;  5T5I D;  3OUG A;  3CQZ A;  2JIR A;  1E18 A;  1R27 A;  1E60 A;  2A6E D;  5FTJ A;  1BW4 A;  2JA5 A;  4AVR A;  2CW0 D;  3GTK A;  1OGY A;  4KLN A;  1SMY D;  1IW7 D;  4JJO A;  2PI8 A;  3IR6 A;  4AYB A;  2VPX A;  1WLF A;  1TWH A;  1E32 A;  1EU1 A;  2R93 A;  5DYI A;  3O5A A;  1H0H A;  2WAQ A;  4KDI A;  3GTM A;  5FTM A;  4L48 A;  3QQ8 A;  1PQH A;  1I3Q A;  2DMR A;  2E7Z A;  5GLX A;  3QC8 A;  1YLE A;  1PQF A;  1PPY A;  3IR5 A;  2JIO A;  4NOH A;  5GLF A;  4ENG A;  3CZB A;  1TWA A;  4GA6 A;  5FTL A;  1UHD A;  4AZD A;  1BW3 A;  2VPZ A;  1Y1W A;  3X2O A;  3M3G A;  1PYQ A;  1TWC A;  1HD5 A;  2VPY A;  3GTP A;  2WB1 A;  1PT1 A;  2NAP A;  2E2I A;  2A69 D;  3ENG A;  3GTJ A;  4GA5 A;  3DMR A;  2GAE A;  4RV0 A;  4C2M A;  2A68 D;  4DMR A;  2JIQ A;  3X2G A;  1WCM A;  1Q16 A;  5GM9 A;  1H5N A;  4ZM7 A;  2PJH B;  2PJJ A;  3TM7 B;  3ML1 A;  3X2L A;  4KOD A;  1ZYR D;  4CS0 A;  4CRZ A;  1PYU B;  5FTK A;  3X2K A;  3SUK A;  1G8J A;  1OA7 A;  5H4U A;  4D7Z B;  3X2J A;  2YUJ A;  2A6H D;  5C18 A;  3X2N A;  1N10 A;  1DMS A;  3CF2 A;  5DYG A;  2EEO B;  1R9T A;  2Y0S A;  1E5V A;  2JA6 A;  1CZ4 A;  2JIM A;  1S3S A;  1E61 A;  4JS7 A;  1AA6 A;  1I50 A;  3D30 A;  1AW8 B;  1CR5 A;  1KQF A;  1YNJ D;  3SUJ A;  3HKZ A;  3HU2 A;  2BH0 A;  2AE0 X;  2IV2 X;  2VUM A;  2ENG A;  4FER A;  1QCS A;  1VC3 B;  2HCZ X;  3X2M A;  3X2P A;  2JIP A;  5FTN A;  5B6C A;  2C45 A;  3GTQ A;  3H0G A;  1KQG A;  3QQ7 A;  4AOK B; 
#chains in the Genus database with same CATH homology
 4QIW A;  2R92 A;  3GTG A;  1FDI A;  2KI8 A;  2VPW A;  3QWZ A;  2YU9 A;  2PMZ A;  4AAY A;  2O5J D;  1TWG A;  3HU1 A;  4AON B;  3PLX B;  1SIW A;  2NYA A;  1QDN A;  1UHE A;  1ZC1 A;  2PNW A;  1PT0 A;  5T5M D;  5C1B A;  2PIC A;  2B63 A;  2NVY A;  1K83 A;  3FKI A;  4KDL A;  1DMR A;  3GTO A;  1R7R A;  1Y4Z A;  3IR7 A;  2E2H A;  1TMO A;  3TIW A;  1TWF A;  4KO8 A;  2G6G A;  2NVX A;  1Y5I A;  3HU3 A;  1CZ5 A;  1G8K A;  1FDO A;  1SFO A;  4CRY G;  2V45 A;  3GTL A;  2V3V A;  2R7Z A;  2JA7 A;  1PQE A;  1YNN D;  2BE5 D;  5EPP A;  1Y1V A;  2G5D A;  5T5I D;  3OUG A;  3CQZ A;  2JIR A;  1E18 A;  1R27 A;  1E60 A;  2A6E D;  5FTJ A;  2JA5 A;  3GTK A;  2CW0 D;  1OGY A;  4KLN A;  1SMY D;  1IW7 D;  2PI8 A;  3IR6 A;  4AYB A;  2VPX A;  1WLF A;  1TWH A;  1E32 A;  1EU1 A;  2R93 A;  5DYI A;  3O5A A;  1H0H A;  2WAQ A;  4KDI A;  3GTM A;  5FTM A;  3QQ8 A;  1PQH A;  1I3Q A;  2DMR A;  2E7Z A;  3QC8 A;  1YLE A;  1PQF A;  1PPY A;  3IR5 A;  2JIO A;  4NOH A;  5GLF A;  3CZB A;  1TWA A;  4GA6 A;  5FTL A;  1UHD A;  4AZD A;  2VPZ A;  1Y1W A;  1PYQ A;  1TWC A;  2VPY A;  3GTP A;  2WB1 A;  1PT1 A;  2NAP A;  2E2I A;  2A69 D;  3GTJ A;  4GA5 A;  3DMR A;  2GAE A;  4RV0 A;  4C2M A;  2A68 D;  4DMR A;  2JIQ A;  1WCM A;  1Q16 A;  1H5N A;  2PJH B;  2PJJ A;  3TM7 B;  3ML1 A;  4CS0 A;  4KOD A;  1ZYR D;  4CRZ A;  1PYU B;  5FTK A;  1G8J A;  4D7Z B;  2YUJ A;  2A6H D;  5C18 A;  1DMS A;  3CF2 A;  5DYG A;  2EEO B;  1R9T A;  2Y0S A;  1E5V A;  2JA6 A;  1CZ4 A;  2JIM A;  1S3S A;  1E61 A;  1I50 A;  1AA6 A;  1AW8 B;  1CR5 A;  1KQF A;  1YNJ D;  3HKZ A;  3HU2 A;  2AE0 X;  2IV2 X;  2VUM A;  1QCS A;  1VC3 B;  2JIP A;  5FTN A;  5B6C A;  2C45 A;  3GTQ A;  3H0G A;  1KQG A;  3QQ7 A;  4AOK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...