5T5ID

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, orthorhombic form at 1.9 a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGKVGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
total genus 32
structure length 130
sequence length 130
chains with identical sequence L
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5iD00
3GTJA 2YU9A 1PQEA 1H0HA 1E18A 1E5VA 1TWCA 4CRZA 2R93A 3GTKA 2E2IA 2Y0SA 4RV0A 3HU1A 1OGYA 2JA5A 1PT1A 3O5AA 3PLXB 4KDIA 1CZ5A 1YLEA 5B6CA 3CF2A 1PYUB 2JIQA 2VPWA 1WLFA 1E60A 1WCMA 1Q16A 2E2HA 1TMOA 1PPYA 5T5ID 1Y4ZA 1Y1WA 1PQHA 3OUGA 3GTPA 2NVXA 4AONB 5FTLA 3QC8A 1FDOA 2NYAA 4DMRA 2NVYA 1CZ4A 2JIMA 2VPXA 2EEOB 4AAYA 1G8JA 1DMSA 1QCSA 3QQ7A 4KODA 5FTKA 5C1BA 2V45A 1UHDA 3GTQA 1QDNA 1EU1A 1I3QA 5C18A 1E61A 1I50A 3GTGA 3FKIA 2NAPA 1PT0A 1SFOA 2WAQA 3TM7B 3QWZA 2B63A 5EPPA 2IV2X 5DYIA 3HU2A 2E7ZA 3ML1A 1TWFA 1TWAA 2KI8A 3DMRA 3HU3A 2R7ZA 1KQFA 1UHEA 1PQFA 3QQ8A 1R27A 5GLFA 2JIPA 2VPYA 1S3SA 4GA6A 1Y1VA 2JA6A 1AW8B 1FDIA 2DMRA 3IR5A 3IR7A 4GA5A 1K83A 3GTLA 5T5MD 3TIWA 1PYQA 2R92A 1KQGA 1G8KA 4KO8A 1H5NA 4CRYG 1AA6A 1E32A 2WB1A 5FTNA 1R9TA 2JIRA 5DYGA 3GTOA 1DMRA 3IR6A 5FTMA 4KDLA 4AZDA 4CS0A 5FTJA 3GTMA 4AYBA 1TWGA 2PMZA 1CR5A 3CQZA 3HKZA 2C45A 2VPZA 4KLNA 2JIOA 3H0GA 2PJHB 2V3VA 1SIWA 1R7RA 4C2MA 2JA7A 1VC3B 1IW7D 2VUMA 4D7ZB 4QIWA 1Y5IA 4AOKB 1TWHA
chains in the Genus database with same CATH superfamily
3GTJA 2YU9A 1SMYD 1PQEA 1H0HA 1E18A 1E5VA 1TWCA 2YUJA 4CRZA 2R93A 3GTKA 1OA9A 2Y0SA 2E2IA 4JCWA 4RV0A 4JP6A 3HU1A 1OGYA 4JS7A 2JA5A 1PT1A 3O5AA 2ENGA 2AE0X 3ENGA 4FFTA 3PLXB 2A68D 4KDIA 1YLEA 2O5JD 1CZ5A 2G5DA 5B6CA 3CF2A 3X2JA 1N10A 1YNND 1PYUB 2JIQA 2VPWA 1WLFA 1E60A 3X2GA 1WCMA 1BW4A 1Q16A 4ZM7A 2E2HA 1TMOA 1PPYA 5T5ID 1Y4ZA 1Y1WA 1PQHA 2PI8A 3OUGA 3GTPA 2NVXA 4AONB 5FTLA 4AVRA 3QC8A 3M3GA 4JP7A 1FDOA 1ZC1A 2NYAA 4ENGA 2NVYA 4DMRA 2G6GA 1CZ4A 2HCZX 2JIMA 2VPXA 2EEOB 4AAYA 1G8JA 1DMSA 1YNJD 1QCSA 3QQ7A 1L8FA 4KODA 5FTKA 2A6ED 5C1BA 2V45A 1UHDA 3GTQA 1QDNA 1EU1A 1I3QA 5C18A 3SULA 1E61A 1I50A 3GTGA 3FKIA 2NAPA 1PT0A 2CW0D 1WC2A 1SFOA 2WAQA 3CZBA 3TM7B 3QWZA 2B63A 2A69D 5EPPA 2IV2X 5DYIA 3HU2A 4FG4A 2E7ZA 4L48A 3ML1A 2BH0A 3SUMA 3X2OA 1TWFA 1TWAA 2KI8A 3DMRA 3HU3A 2R7ZA 1KQFA 1UHEA 3X2KA 1PQFA 4FERA 5GLYA 2A6HD 3QQ8A 1R27A 3X2IA 4FG2A 5GLFA 2JIPA 2VPYA 1S3SA 4GA6A 1Y1VA 2JA6A 1AW8B 1FDIA 2DMRA 3IR5A 3IR7A 4GA5A 1K83A 3GTLA 5T5MD 3TIWA 1PYQA 2R92A 1KQGA 1ZYRD 4D7ZB 5GM9A 1G8KA 4KO8A 2BE5D 1H5NA 3X2PA 4JJOA 4CRYG 1AA6A 3X2MA 4NOHA 1HD5A 1E32A 2WB1A 5FTNA 1R9TA 1OA7A 2JIRA 5DYGA 1DMRA 3GTOA 3IR6A 5FTMA 4KDLA 4AZDA 3D30A 5GLXA 5FTJA 5H4UA 4AYBA 4CS0A 3GTMA 1TWGA 2PMZA 3SUJA 1CR5A 3X2NA 3CQZA 3HKZA 3SUKA 2C45A 2VPZA 4KLNA 3X2LA 2JIOA 3H0GA 2PJHB 2PNWA 2PICA 2V3VA 1SIWA 2PJJA 1R7RA 1BW3A 4C2MA 2KQAA 2JA7A 1VC3B 2GAEA 1IW7D 2VUMA 3X2HA 4QIWA 1Y5IA 4AOKB 1TWHA
chains in the Genus database with same CATH topology
3GTJA 2YU9A 1SMYD 1PQEA 1H0HA 1E18A 1E5VA 1TWCA 2YUJA 4CRZA 2R93A 3GTKA 2E2IA 2Y0SA 4RV0A 3HU1A 1OGYA 2JA5A 1PT1A 3O5AA 2AE0X 3PLXB 2A68D 4KDIA 1YLEA 2O5JD 1CZ5A 2G5DA 5B6CA 3CF2A 1YNND 1PYUB 2JIQA 2VPWA 1WLFA 1E60A 1WCMA 1Q16A 2E2HA 1TMOA 1PPYA 5T5ID 1Y4ZA 1Y1WA 1PQHA 2PI8A 3OUGA 3GTPA 2NVXA 4AONB 5FTLA 3QC8A 1FDOA 1ZC1A 2NYAA 4DMRA 2NVYA 2G6GA 1CZ4A 2JIMA 2VPXA 2EEOB 4AAYA 1G8JA 1DMSA 1YNJD 1QCSA 3QQ7A 4KODA 5FTKA 2A6ED 5C1BA 2V45A 1UHDA 3GTQA 1QDNA 1EU1A 1I3QA 5C18A 1E61A 1I50A 3GTGA 3FKIA 2NAPA 1PT0A 2CW0D 1SFOA 2WAQA 3CZBA 3TM7B 3QWZA 2B63A 2A69D 5EPPA 2IV2X 5DYIA 3HU2A 2E7ZA 3ML1A 1TWFA 1TWAA 2KI8A 3DMRA 3HU3A 2R7ZA 1KQFA 1UHEA 1PQFA 2A6HD 3QQ8A 1R27A 5GLFA 2JIPA 2VPYA 1S3SA 4GA6A 1Y1VA 2JA6A 1AW8B 1FDIA 2DMRA 3IR5A 3IR7A 4GA5A 1K83A 3GTLA 5T5MD 3TIWA 1PYQA 2R92A 1KQGA 1ZYRD 1G8KA 4KO8A 2BE5D 1H5NA 4CRYG 1AA6A 4NOHA 1E32A 2WB1A 5FTNA 1R9TA 2JIRA 5DYGA 3GTOA 1DMRA 3IR6A 5FTMA 4KDLA 4AZDA 4CS0A 5FTJA 3GTMA 4AYBA 1TWGA 2PMZA 1CR5A 3CQZA 3HKZA 2VPZA 2C45A 4KLNA 2JIOA 3H0GA 2PJHB 2PNWA 2PICA 2V3VA 1SIWA 2PJJA 1R7RA 4C2MA 2JA7A 1VC3B 2GAEA 1IW7D 2VUMA 4D7ZB 4QIWA 1Y5IA 4AOKB 1TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ A;  2YU9 A;  1PQE A;  1H0H A;  1E18 A;  1E5V A;  1TWC A;  4CRZ A;  2R93 A;  3GTK A;  2E2I A;  2Y0S A;  4RV0 A;  3HU1 A;  1OGY A;  2JA5 A;  1PT1 A;  3O5A A;  3PLX B;  4KDI A;  1CZ5 A;  1YLE A;  5B6C A;  3CF2 A;  1PYU B;  2JIQ A;  2VPW A;  1WLF A;  1E60 A;  1WCM A;  1Q16 A;  2E2H A;  1TMO A;  1PPY A;  5T5I D;  1Y4Z A;  1Y1W A;  1PQH A;  3OUG A;  3GTP A;  2NVX A;  4AON B;  5FTL A;  3QC8 A;  1FDO A;  2NYA A;  4DMR A;  2NVY A;  1CZ4 A;  2JIM A;  2VPX A;  2EEO B;  4AAY A;  1G8J A;  1DMS A;  1QCS A;  3QQ7 A;  4KOD A;  5FTK A;  5C1B A;  2V45 A;  1UHD A;  3GTQ A;  1QDN A;  1EU1 A;  1I3Q A;  5C18 A;  1E61 A;  1I50 A;  3GTG A;  3FKI A;  2NAP A;  1PT0 A;  1SFO A;  2WAQ A;  3TM7 B;  3QWZ A;  2B63 A;  5EPP A;  2IV2 X;  5DYI A;  3HU2 A;  2E7Z A;  3ML1 A;  1TWF A;  1TWA A;  2KI8 A;  3DMR A;  3HU3 A;  2R7Z A;  1KQF A;  1UHE A;  1PQF A;  3QQ8 A;  1R27 A;  5GLF A;  2JIP A;  2VPY A;  1S3S A;  4GA6 A;  1Y1V A;  2JA6 A;  1AW8 B;  1FDI A;  2DMR A;  3IR5 A;  3IR7 A;  4GA5 A;  1K83 A;  3GTL A;  5T5M D;  3TIW A;  1PYQ A;  2R92 A;  1KQG A;  1G8K A;  4KO8 A;  1H5N A;  4CRY G;  1AA6 A;  1E32 A;  2WB1 A;  5FTN A;  1R9T A;  2JIR A;  5DYG A;  3GTO A;  1DMR A;  3IR6 A;  5FTM A;  4KDL A;  4AZD A;  4CS0 A;  5FTJ A;  3GTM A;  4AYB A;  1TWG A;  2PMZ A;  1CR5 A;  3CQZ A;  3HKZ A;  2C45 A;  2VPZ A;  4KLN A;  2JIO A;  3H0G A;  2PJH B;  2V3V A;  1SIW A;  1R7R A;  4C2M A;  2JA7 A;  1VC3 B;  1IW7 D;  2VUM A;  4D7Z B;  4QIW A;  1Y5I A;  4AOK B;  1TWH A; 
#chains in the Genus database with same CATH topology
 3GTJ A;  2YU9 A;  1SMY D;  1PQE A;  1H0H A;  1E18 A;  1E5V A;  1TWC A;  2YUJ A;  4CRZ A;  2R93 A;  3GTK A;  1OA9 A;  2Y0S A;  2E2I A;  4JCW A;  4RV0 A;  4JP6 A;  3HU1 A;  1OGY A;  4JS7 A;  2JA5 A;  1PT1 A;  3O5A A;  2ENG A;  2AE0 X;  3ENG A;  4FFT A;  3PLX B;  2A68 D;  4KDI A;  1YLE A;  2O5J D;  1CZ5 A;  2G5D A;  5B6C A;  3CF2 A;  3X2J A;  1N10 A;  1YNN D;  1PYU B;  2JIQ A;  2VPW A;  1WLF A;  1E60 A;  3X2G A;  1WCM A;  1BW4 A;  1Q16 A;  4ZM7 A;  2E2H A;  1TMO A;  1PPY A;  5T5I D;  1Y4Z A;  1Y1W A;  1PQH A;  2PI8 A;  3OUG A;  3GTP A;  2NVX A;  4AON B;  5FTL A;  4AVR A;  3QC8 A;  3M3G A;  4JP7 A;  1FDO A;  1ZC1 A;  2NYA A;  4ENG A;  2NVY A;  4DMR A;  2G6G A;  1CZ4 A;  2HCZ X;  2JIM A;  2VPX A;  2EEO B;  4AAY A;  1G8J A;  1DMS A;  1YNJ D;  1QCS A;  3QQ7 A;  1L8F A;  4KOD A;  5FTK A;  2A6E D;  5C1B A;  2V45 A;  1UHD A;  3GTQ A;  1QDN A;  1EU1 A;  1I3Q A;  5C18 A;  3SUL A;  1E61 A;  1I50 A;  3GTG A;  3FKI A;  2NAP A;  1PT0 A;  2CW0 D;  1WC2 A;  1SFO A;  2WAQ A;  3CZB A;  3TM7 B;  3QWZ A;  2B63 A;  2A69 D;  5EPP A;  2IV2 X;  5DYI A;  3HU2 A;  4FG4 A;  2E7Z A;  4L48 A;  3ML1 A;  2BH0 A;  3SUM A;  3X2O A;  1TWF A;  1TWA A;  2KI8 A;  3DMR A;  3HU3 A;  2R7Z A;  1KQF A;  1UHE A;  3X2K A;  1PQF A;  4FER A;  5GLY A;  2A6H D;  3QQ8 A;  1R27 A;  3X2I A;  4FG2 A;  5GLF A;  2JIP A;  2VPY A;  1S3S A;  4GA6 A;  1Y1V A;  2JA6 A;  1AW8 B;  1FDI A;  2DMR A;  3IR5 A;  3IR7 A;  4GA5 A;  1K83 A;  3GTL A;  5T5M D;  3TIW A;  1PYQ A;  2R92 A;  1KQG A;  1ZYR D;  4D7Z B;  5GM9 A;  1G8K A;  4KO8 A;  2BE5 D;  1H5N A;  3X2P A;  4JJO A;  4CRY G;  1AA6 A;  3X2M A;  4NOH A;  1HD5 A;  1E32 A;  2WB1 A;  5FTN A;  1R9T A;  1OA7 A;  2JIR A;  5DYG A;  1DMR A;  3GTO A;  3IR6 A;  5FTM A;  4KDL A;  4AZD A;  3D30 A;  5GLX A;  5FTJ A;  5H4U A;  4AYB A;  4CS0 A;  3GTM A;  1TWG A;  2PMZ A;  3SUJ A;  1CR5 A;  3X2N A;  3CQZ A;  3HKZ A;  3SUK A;  2C45 A;  2VPZ A;  4KLN A;  3X2L A;  2JIO A;  3H0G A;  2PJH B;  2PNW A;  2PIC A;  2V3V A;  1SIW A;  2PJJ A;  1R7R A;  1BW3 A;  4C2M A;  2KQA A;  2JA7 A;  1VC3 B;  2GAE A;  1IW7 D;  2VUM A;  3X2H A;  4QIW A;  1Y5I A;  4AOK B;  1TWH A; 
#chains in the Genus database with same CATH homology
 3GTJ A;  2YU9 A;  1SMY D;  1PQE A;  1H0H A;  1E18 A;  1E5V A;  1TWC A;  2YUJ A;  4CRZ A;  2R93 A;  3GTK A;  2E2I A;  2Y0S A;  4RV0 A;  3HU1 A;  1OGY A;  2JA5 A;  1PT1 A;  3O5A A;  2AE0 X;  3PLX B;  2A68 D;  4KDI A;  1YLE A;  2O5J D;  1CZ5 A;  2G5D A;  5B6C A;  3CF2 A;  1YNN D;  1PYU B;  2JIQ A;  2VPW A;  1WLF A;  1E60 A;  1WCM A;  1Q16 A;  2E2H A;  1TMO A;  1PPY A;  5T5I D;  1Y4Z A;  1Y1W A;  1PQH A;  2PI8 A;  3OUG A;  3GTP A;  2NVX A;  4AON B;  5FTL A;  3QC8 A;  1FDO A;  1ZC1 A;  2NYA A;  4DMR A;  2NVY A;  2G6G A;  1CZ4 A;  2JIM A;  2VPX A;  2EEO B;  4AAY A;  1G8J A;  1DMS A;  1YNJ D;  1QCS A;  3QQ7 A;  4KOD A;  5FTK A;  2A6E D;  5C1B A;  2V45 A;  1UHD A;  3GTQ A;  1QDN A;  1EU1 A;  1I3Q A;  5C18 A;  1E61 A;  1I50 A;  3GTG A;  3FKI A;  2NAP A;  1PT0 A;  2CW0 D;  1SFO A;  2WAQ A;  3CZB A;  3TM7 B;  3QWZ A;  2B63 A;  2A69 D;  5EPP A;  2IV2 X;  5DYI A;  3HU2 A;  2E7Z A;  3ML1 A;  1TWF A;  1TWA A;  2KI8 A;  3DMR A;  3HU3 A;  2R7Z A;  1KQF A;  1UHE A;  1PQF A;  2A6H D;  3QQ8 A;  1R27 A;  5GLF A;  2JIP A;  2VPY A;  1S3S A;  4GA6 A;  1Y1V A;  2JA6 A;  1AW8 B;  1FDI A;  2DMR A;  3IR5 A;  3IR7 A;  4GA5 A;  1K83 A;  3GTL A;  5T5M D;  3TIW A;  1PYQ A;  2R92 A;  1KQG A;  1ZYR D;  1G8K A;  4KO8 A;  2BE5 D;  1H5N A;  4CRY G;  1AA6 A;  4NOH A;  1E32 A;  2WB1 A;  5FTN A;  1R9T A;  2JIR A;  5DYG A;  3GTO A;  1DMR A;  3IR6 A;  5FTM A;  4KDL A;  4AZD A;  4CS0 A;  5FTJ A;  3GTM A;  4AYB A;  1TWG A;  2PMZ A;  1CR5 A;  3CQZ A;  3HKZ A;  2VPZ A;  2C45 A;  4KLN A;  2JIO A;  3H0G A;  2PJH B;  2PNW A;  2PIC A;  2V3V A;  1SIW A;  2PJJ A;  1R7R A;  4C2M A;  2JA7 A;  1VC3 B;  2GAE A;  1IW7 D;  2VUM A;  4D7Z B;  4QIW A;  1Y5I A;  4AOK B;  1TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...