5T5ID

Tungsten-containing formylmethanofuran dehydrogenase from methanothermobacter wolfeii, orthorhombic form at 1.9 a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
MRVILNTGRTIWQGQAIESGKDLKMYVDAAAIIQMNPEMMKQLGIAEGDNVKVISEYGDVVVKAVEAKEPLPEGMVYIPMGPWANRVIRPYTDSTATPSFKNIPVEIIPTDEEVLDMPTLMKVYGKVGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Tungsten formylmethanofuran dehydrogenase subunit fwdA
total genus 32
structure length 130
sequence length 130
chains with identical sequence L
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5t5iD00
4AYBA 2VPYA 1Y4ZA 2R7ZA 5DYGA 1AA6A 2JIMA 3O5AA 3HU3A 5GLFA 1PPYA 2NVYA 1VC3B 1YLEA 3QWZA 3GTGA 4KDIA 1UHEA 5B6CA 1OGYA 3H0GA 4AONB 1IW7D 5FTNA 2NVXA 1AW8B 2C45A 1QCSA 4RV0A 1SIWA 1E18A 2PMZA 1Y1VA 3IR6A 1Y1WA 2VPXA 2R92A 2NYAA 2VPWA 3IR7A 1QDNA 3PLXB 3HU1A 4AOKB 1TWCA 1PT1A 2VPZA 5EPPA 5FTLA 3GTKA 2JIQA 4KODA 5FTKA 3GTOA 1FDOA 3OUGA 2E2HA 3GTQA 1TWAA 2JA6A 2PJHB 1R27A 5C18A 1K83A 1WCMA 3TM7B 1TWFA 1PQFA 2DMRA 4GA5A 4KO8A 1G8JA 1PT0A 1DMSA 1TWGA 1EU1A 5FTMA 1H5NA 1I3QA 4KDLA 2JIPA 4AAYA 4D7ZB 2IV2X 4AZDA 4QIWA 1DMRA 3QC8A 1H0HA 3GTLA 3DMRA 5T5MD 2B63A 3IR5A 1CR5A 1Q16A 2JA7A 3FKIA 2WAQA 1PYQA 4CS0A 1FDIA 2V45A 4C2MA 1PQEA 1TMOA 2EEOB 1E5VA 1S3SA 1G8KA 2E7ZA 1E61A 2V3VA 3QQ8A 5C1BA 1WLFA 2JA5A 4CRZA 1KQGA 3HKZA 1CZ5A 2R93A 3CF2A 2KI8A 4KLNA 1KQFA 2JIRA 3QQ7A 3GTJA 1UHDA 3HU2A 5T5ID 3CQZA 4DMRA 1CZ4A 1PYUB 1E32A 2WB1A 1I50A 3GTPA 3TIWA 3GTMA 2Y0SA 3ML1A 1Y5IA 2JIOA 1E60A 4CRYG 1PQHA 1R7RA 1SFOA 2E2IA 1R9TA 5DYIA 2YU9A 1TWHA 4GA6A 2VUMA 2NAPA 5FTJA
chains in the Genus database with same CATH superfamily
5H4UA 4AYBA 2VPYA 2A69D 1Y4ZA 2A6ED 2R7ZA 5DYGA 4FERA 1AA6A 2JIMA 3O5AA 3HU3A 5GLFA 1PPYA 2NVYA 4FFTA 1VC3B 1YLEA 4JS7A 3QWZA 3GTGA 4KDIA 1UHEA 5B6CA 1OGYA 4FG4A 3H0GA 4AONB 1IW7D 3M3GA 5FTNA 3X2KA 2NVXA 1AW8B 2G5DA 2YUJA 3X2LA 4NOHA 2C45A 1QCSA 4RV0A 1SIWA 3X2HA 1E18A 2PMZA 1Y1VA 3IR6A 4JP7A 2VPXA 3D30A 1Y1WA 2R92A 1BW4A 2NYAA 2VPWA 3IR7A 1WC2A 1QDNA 3PLXB 4ZM7A 3X2NA 3HU1A 5GLYA 4AOKB 1TWCA 3X2GA 1PT1A 2BE5D 2VPZA 5EPPA 2PICA 4FG2A 5FTLA 2KQAA 2A6HD 2CW0D 3GTKA 2JIQA 4KODA 5FTKA 3GTOA 4JP6A 1FDOA 2PNWA 3OUGA 2E2HA 3GTQA 1TWAA 2JA6A 2PJHB 1R27A 5C18A 1K83A 1WCMA 4JCWA 3SULA 3X2MA 3SUKA 3SUMA 3TM7B 1TWFA 1PQFA 2DMRA 3CZBA 4GA5A 4KO8A 1G8JA 1PT0A 1DMSA 3SUJA 1TWGA 4AVRA 1EU1A 5FTMA 1H5NA 1I3QA 2G6GA 1SMYD 1HD5A 1YNJD 4KDLA 2JIPA 4AAYA 5GLXA 2IV2X 4D7ZB 1OA9A 2PI8A 4AZDA 4QIWA 1DMRA 2GAEA 3QC8A 2PJJA 1H0HA 2A68D 3GTLA 3DMRA 5T5MD 2AE0X 2B63A 3IR5A 1CR5A 1Q16A 3X2JA 2JA7A 1N10A 2WAQA 3FKIA 1PYQA 4CS0A 1FDIA 2V45A 4C2MA 1PQEA 1TMOA 1BW3A 4JJOA 1YNND 2EEOB 2HCZX 1E5VA 1S3SA 1G8KA 2E7ZA 1E61A 2V3VA 3QQ8A 5C1BA 1WLFA 2JA5A 4CRZA 1OA7A 1KQGA 3HKZA 2BH0A 1CZ5A 2R93A 3CF2A 2KI8A 4KLNA 1KQFA 2JIRA 3QQ7A 3GTJA 1UHDA 3HU2A 5T5ID 3CQZA 4L48A 1CZ4A 4DMRA 1L8FA 4ENGA 1PYUB 3X2OA 1E32A 1ZYRD 2WB1A 1I50A 3GTPA 3TIWA 3X2IA 3GTMA 2Y0SA 3ML1A 1Y5IA 2JIOA 1E60A 4CRYG 1PQHA 1R7RA 5GM9A 1SFOA 3ENGA 1ZC1A 2ENGA 2E2IA 1R9TA 5DYIA 2YU9A 2O5JD 1TWHA 4GA6A 2VUMA 2NAPA 5FTJA 3X2PA
chains in the Genus database with same CATH topology
4AYBA 2VPYA 2A69D 1Y4ZA 2A6ED 2R7ZA 5DYGA 1AA6A 2JIMA 3O5AA 3HU3A 5GLFA 1PPYA 2NVYA 1VC3B 1YLEA 3QWZA 3GTGA 4KDIA 1UHEA 5B6CA 1OGYA 3H0GA 4AONB 1IW7D 5FTNA 2NVXA 1AW8B 2G5DA 2YUJA 4NOHA 2C45A 1QCSA 4RV0A 1SIWA 1E18A 2PMZA 1Y1VA 3IR6A 1Y1WA 2VPXA 2R92A 2NYAA 2VPWA 3IR7A 1QDNA 3PLXB 3HU1A 4AOKB 1TWCA 1PT1A 2BE5D 2VPZA 5EPPA 2PICA 5FTLA 2A6HD 2CW0D 3GTKA 2JIQA 4KODA 5FTKA 3GTOA 1FDOA 2PNWA 3OUGA 2E2HA 3GTQA 1TWAA 2JA6A 2PJHB 1R27A 5C18A 1K83A 1WCMA 3TM7B 1TWFA 1PQFA 2DMRA 3CZBA 4GA5A 4KO8A 1G8JA 1PT0A 1DMSA 1TWGA 1EU1A 5FTMA 1H5NA 1I3QA 2G6GA 1SMYD 1YNJD 4KDLA 2JIPA 4AAYA 4D7ZB 2IV2X 4AZDA 2PI8A 4QIWA 1DMRA 2GAEA 3QC8A 2PJJA 1H0HA 2A68D 3GTLA 3DMRA 5T5MD 2AE0X 2B63A 3IR5A 1CR5A 1Q16A 2JA7A 2WAQA 3FKIA 1PYQA 4CS0A 1FDIA 2V45A 4C2MA 1PQEA 1TMOA 1YNND 2EEOB 1E5VA 1S3SA 1G8KA 2E7ZA 1E61A 2V3VA 3QQ8A 5C1BA 1WLFA 2JA5A 4CRZA 1KQGA 3HKZA 1CZ5A 2R93A 3CF2A 2KI8A 4KLNA 1KQFA 2JIRA 3QQ7A 3GTJA 1UHDA 3HU2A 5T5ID 3CQZA 4DMRA 1CZ4A 1PYUB 1E32A 1ZYRD 2WB1A 1I50A 3GTPA 3TIWA 3GTMA 2Y0SA 3ML1A 1Y5IA 2JIOA 1E60A 4CRYG 1PQHA 1R7RA 1SFOA 1ZC1A 2E2IA 1R9TA 5DYIA 2YU9A 2O5JD 1TWHA 4GA6A 2VUMA 2NAPA 5FTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB A;  2VPY A;  1Y4Z A;  2R7Z A;  5DYG A;  1AA6 A;  2JIM A;  3O5A A;  3HU3 A;  5GLF A;  1PPY A;  2NVY A;  1VC3 B;  1YLE A;  3QWZ A;  3GTG A;  4KDI A;  1UHE A;  5B6C A;  1OGY A;  3H0G A;  4AON B;  1IW7 D;  5FTN A;  2NVX A;  1AW8 B;  2C45 A;  1QCS A;  4RV0 A;  1SIW A;  1E18 A;  2PMZ A;  1Y1V A;  3IR6 A;  1Y1W A;  2VPX A;  2R92 A;  2NYA A;  2VPW A;  3IR7 A;  1QDN A;  3PLX B;  3HU1 A;  4AOK B;  1TWC A;  1PT1 A;  2VPZ A;  5EPP A;  5FTL A;  3GTK A;  2JIQ A;  4KOD A;  5FTK A;  3GTO A;  1FDO A;  3OUG A;  2E2H A;  3GTQ A;  1TWA A;  2JA6 A;  2PJH B;  1R27 A;  5C18 A;  1K83 A;  1WCM A;  3TM7 B;  1TWF A;  1PQF A;  2DMR A;  4GA5 A;  4KO8 A;  1G8J A;  1PT0 A;  1DMS A;  1TWG A;  1EU1 A;  5FTM A;  1H5N A;  1I3Q A;  4KDL A;  2JIP A;  4AAY A;  4D7Z B;  2IV2 X;  4AZD A;  4QIW A;  1DMR A;  3QC8 A;  1H0H A;  3GTL A;  3DMR A;  5T5M D;  2B63 A;  3IR5 A;  1CR5 A;  1Q16 A;  2JA7 A;  3FKI A;  2WAQ A;  1PYQ A;  4CS0 A;  1FDI A;  2V45 A;  4C2M A;  1PQE A;  1TMO A;  2EEO B;  1E5V A;  1S3S A;  1G8K A;  2E7Z A;  1E61 A;  2V3V A;  3QQ8 A;  5C1B A;  1WLF A;  2JA5 A;  4CRZ A;  1KQG A;  3HKZ A;  1CZ5 A;  2R93 A;  3CF2 A;  2KI8 A;  4KLN A;  1KQF A;  2JIR A;  3QQ7 A;  3GTJ A;  1UHD A;  3HU2 A;  5T5I D;  3CQZ A;  4DMR A;  1CZ4 A;  1PYU B;  1E32 A;  2WB1 A;  1I50 A;  3GTP A;  3TIW A;  3GTM A;  2Y0S A;  3ML1 A;  1Y5I A;  2JIO A;  1E60 A;  4CRY G;  1PQH A;  1R7R A;  1SFO A;  2E2I A;  1R9T A;  5DYI A;  2YU9 A;  1TWH A;  4GA6 A;  2VUM A;  2NAP A;  5FTJ A; 
#chains in the Genus database with same CATH topology
 5H4U A;  4AYB A;  2VPY A;  2A69 D;  1Y4Z A;  2A6E D;  2R7Z A;  5DYG A;  4FER A;  1AA6 A;  2JIM A;  3O5A A;  3HU3 A;  5GLF A;  1PPY A;  2NVY A;  4FFT A;  1VC3 B;  1YLE A;  4JS7 A;  3QWZ A;  3GTG A;  4KDI A;  1UHE A;  5B6C A;  1OGY A;  4FG4 A;  3H0G A;  4AON B;  1IW7 D;  3M3G A;  5FTN A;  3X2K A;  2NVX A;  1AW8 B;  2G5D A;  2YUJ A;  3X2L A;  4NOH A;  2C45 A;  1QCS A;  4RV0 A;  1SIW A;  3X2H A;  1E18 A;  2PMZ A;  1Y1V A;  3IR6 A;  4JP7 A;  2VPX A;  3D30 A;  1Y1W A;  2R92 A;  1BW4 A;  2NYA A;  2VPW A;  3IR7 A;  1WC2 A;  1QDN A;  3PLX B;  4ZM7 A;  3X2N A;  3HU1 A;  5GLY A;  4AOK B;  1TWC A;  3X2G A;  1PT1 A;  2BE5 D;  2VPZ A;  5EPP A;  2PIC A;  4FG2 A;  5FTL A;  2KQA A;  2A6H D;  2CW0 D;  3GTK A;  2JIQ A;  4KOD A;  5FTK A;  3GTO A;  4JP6 A;  1FDO A;  2PNW A;  3OUG A;  2E2H A;  3GTQ A;  1TWA A;  2JA6 A;  2PJH B;  1R27 A;  5C18 A;  1K83 A;  1WCM A;  4JCW A;  3SUL A;  3X2M A;  3SUK A;  3SUM A;  3TM7 B;  1TWF A;  1PQF A;  2DMR A;  3CZB A;  4GA5 A;  4KO8 A;  1G8J A;  1PT0 A;  1DMS A;  3SUJ A;  1TWG A;  4AVR A;  1EU1 A;  5FTM A;  1H5N A;  1I3Q A;  2G6G A;  1SMY D;  1HD5 A;  1YNJ D;  4KDL A;  2JIP A;  4AAY A;  5GLX A;  2IV2 X;  4D7Z B;  1OA9 A;  2PI8 A;  4AZD A;  4QIW A;  1DMR A;  2GAE A;  3QC8 A;  2PJJ A;  1H0H A;  2A68 D;  3GTL A;  3DMR A;  5T5M D;  2AE0 X;  2B63 A;  3IR5 A;  1CR5 A;  1Q16 A;  3X2J A;  2JA7 A;  1N10 A;  2WAQ A;  3FKI A;  1PYQ A;  4CS0 A;  1FDI A;  2V45 A;  4C2M A;  1PQE A;  1TMO A;  1BW3 A;  4JJO A;  1YNN D;  2EEO B;  2HCZ X;  1E5V A;  1S3S A;  1G8K A;  2E7Z A;  1E61 A;  2V3V A;  3QQ8 A;  5C1B A;  1WLF A;  2JA5 A;  4CRZ A;  1OA7 A;  1KQG A;  3HKZ A;  2BH0 A;  1CZ5 A;  2R93 A;  3CF2 A;  2KI8 A;  4KLN A;  1KQF A;  2JIR A;  3QQ7 A;  3GTJ A;  1UHD A;  3HU2 A;  5T5I D;  3CQZ A;  4L48 A;  1CZ4 A;  4DMR A;  1L8F A;  4ENG A;  1PYU B;  3X2O A;  1E32 A;  1ZYR D;  2WB1 A;  1I50 A;  3GTP A;  3TIW A;  3X2I A;  3GTM A;  2Y0S A;  3ML1 A;  1Y5I A;  2JIO A;  1E60 A;  4CRY G;  1PQH A;  1R7R A;  5GM9 A;  1SFO A;  3ENG A;  1ZC1 A;  2ENG A;  2E2I A;  1R9T A;  5DYI A;  2YU9 A;  2O5J D;  1TWH A;  4GA6 A;  2VUM A;  2NAP A;  5FTJ A;  3X2P A; 
#chains in the Genus database with same CATH homology
 4AYB A;  2VPY A;  2A69 D;  1Y4Z A;  2A6E D;  2R7Z A;  5DYG A;  1AA6 A;  2JIM A;  3O5A A;  3HU3 A;  5GLF A;  1PPY A;  2NVY A;  1VC3 B;  1YLE A;  3QWZ A;  3GTG A;  4KDI A;  1UHE A;  5B6C A;  1OGY A;  3H0G A;  4AON B;  1IW7 D;  5FTN A;  2NVX A;  1AW8 B;  2G5D A;  2YUJ A;  4NOH A;  2C45 A;  1QCS A;  4RV0 A;  1SIW A;  1E18 A;  2PMZ A;  1Y1V A;  3IR6 A;  1Y1W A;  2VPX A;  2R92 A;  2NYA A;  2VPW A;  3IR7 A;  1QDN A;  3PLX B;  3HU1 A;  4AOK B;  1TWC A;  1PT1 A;  2BE5 D;  2VPZ A;  5EPP A;  2PIC A;  5FTL A;  2A6H D;  2CW0 D;  3GTK A;  2JIQ A;  4KOD A;  5FTK A;  3GTO A;  1FDO A;  2PNW A;  3OUG A;  2E2H A;  3GTQ A;  1TWA A;  2JA6 A;  2PJH B;  1R27 A;  5C18 A;  1K83 A;  1WCM A;  3TM7 B;  1TWF A;  1PQF A;  2DMR A;  3CZB A;  4GA5 A;  4KO8 A;  1G8J A;  1PT0 A;  1DMS A;  1TWG A;  1EU1 A;  5FTM A;  1H5N A;  1I3Q A;  2G6G A;  1SMY D;  1YNJ D;  4KDL A;  2JIP A;  4AAY A;  4D7Z B;  2IV2 X;  4AZD A;  2PI8 A;  4QIW A;  1DMR A;  2GAE A;  3QC8 A;  2PJJ A;  1H0H A;  2A68 D;  3GTL A;  3DMR A;  5T5M D;  2AE0 X;  2B63 A;  3IR5 A;  1CR5 A;  1Q16 A;  2JA7 A;  2WAQ A;  3FKI A;  1PYQ A;  4CS0 A;  1FDI A;  2V45 A;  4C2M A;  1PQE A;  1TMO A;  1YNN D;  2EEO B;  1E5V A;  1S3S A;  1G8K A;  2E7Z A;  1E61 A;  2V3V A;  3QQ8 A;  5C1B A;  1WLF A;  2JA5 A;  4CRZ A;  1KQG A;  3HKZ A;  1CZ5 A;  2R93 A;  3CF2 A;  2KI8 A;  4KLN A;  1KQF A;  2JIR A;  3QQ7 A;  3GTJ A;  1UHD A;  3HU2 A;  5T5I D;  3CQZ A;  4DMR A;  1CZ4 A;  1PYU B;  1E32 A;  1ZYR D;  2WB1 A;  1I50 A;  3GTP A;  3TIW A;  3GTM A;  2Y0S A;  3ML1 A;  1Y5I A;  2JIO A;  1E60 A;  4CRY G;  1PQH A;  1R7R A;  1SFO A;  1ZC1 A;  2E2I A;  1R9T A;  5DYI A;  2YU9 A;  2O5J D;  1TWH A;  4GA6 A;  2VUM A;  2NAP A;  5FTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...