4FG4A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with hemithiocellodextrin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg4A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg4A02
3M3GA 1BW4A 3SUKA 2VXQA 1BMWA 3X2IA 4JCWA 1OA9A 3X2PA 1WHPA 1WC2A 2HCZX 1BW3A 2KQAA 2GAEA 4FFTA 1WHOA 1OA7A 5GLXA 4FG4A 2ENGA 1HD5A 3X2KA 3X2MA 3SUMA 3FT1A 3D30A 1L8FA 4FG2A 3X2NA 4JS7A 4AVRA 4ZM7A 5GLYA 2BH0A 3CZBA 5GM9A 2PI8A 1N10A 2G5DA 4FERA 4JJOA 3X2GA 3FT9A 4JP7A 2JNZA 4JP6A 3ENGA 2PJJA 3X2LA 4L48A 3X2HA 2AE0X 2G6GA 3SULA 4ENGA 3X2JA 2PNWA 3SUJA 5H4UA 2PICA 3X2OA
chains in the Genus database with same CATH superfamily
1VGEL 5B38B 3S5ZA 2EADA 4FG6D 2GCYB 3K4ZA 2ITCB 4RRPA 5T5FA 5LNGA 4GG6F 5JW5B 5F2FA 1OCRB 4KUCD 1KWKA 3NRFA 5E1QA 1RZIA 3FK3A 4JDVB 5DMKA 2Q7YB 3WTTA 4AE1A 1DQIA 5KJRH 2FLBT 3MX0A 3QQ8A 5DLML 3KVPA 3SCMB 3STLA 1XWVA 2BVPA 3UBXB 3WE6A 5AALA 1F0LA 4XB8A 5EIIG 4IBVA 3QDAA 5KYUB 5FTJA 1K6QH 2VPYA 3GJFB 1EEZA 3AB0B 4C4BA 2OXHB 2VLME 3MRDB 1L9SA 4I87A 2OLDA 2WXRA 5EB9A 3FONA 1ESOA 2CLZA 2JIOA 1IGTB 4L3FA 3LHAA 5J11C 3BPNC 1BDYA 3FUIA 2W9LA 3GMRB 4KKBD 1QPKA 4JL1A 2GY5A 1NIDA 1Q8MA 4HKXB 1SRDA 2E7BA 4FP8H 4QRSB 2KLTA 1A0QH 5IW6A 4HU2A 4BSWB 5HYQB 3ECWA 1M6OB 3CFIC 2BSTA 4NDMA 3D34A 5DRZA 3ZUNC 2AEIT 4HZ1A 2VPXA 4JZJC 4LLAA 5JQHC 1H15A 4HBCL 3WOVA 1A9EA 3E6HA 5D5ME 4XWOC 5T3ZD 2AEOA 2CBPA 1OGAB 3MV9B 5EZOH 2V5YA 2FECL 2H9GB 2WO3B 3ASNB 3L6FB 4RGND 2DW5A 3GIZH 1OTUC 2IALB 3L48A 4Y19A 1WE5A 4KOCA 4OM1L 1ACCA 2R0WL 5A2IH 3DI3B 2JVUA 1UWXH 1E5YA 5DVNA 3B1UA 4X50A 3FO1B 2O5XL 3GBEA 3G3LA 3LZNA 3OD3A 4PY8J 5GIRA 2EIKB 3KNBA 2ZG2A 3MYJA 1WAAF 2OTPA 4Y7MA 4G6ML 3QA3B 4XNYL 3O4LD 1HSBB 5GJTL 3A6BH 1TJHL 2OJZH 4KQ3H 1RVFH 5FGSA 3GLZA 4NZUH 1KTLA 4HUXA 2FT7A 2R7EA 2Y6SD 4ZMVA 1J9QA 1QKZH 1QBLL 1EANA 3I9GH 2BS9A 3WYRA 5HSFA 4DP8X 5KSBA 4BKTC 4U1LB 4NC1E 2FYVA 4ZFOB 1AR1D 1AXSA 1QLFB 2PCFA 1PY9A 2Z35A 2X0VA 3PL6C 1DBBH 1S7VA 2EXTA 2DAVA 4MB5A 1S2EA 5H94A 1IARB 2WNGA 5CEZH 3CLEL 5JW3L 5D7IF 1E9QB 1KLUB 1U0QA 3IMVA 1KLGB 4O2CA 2Z91A 3P0VL 3BT2H 4S0HA 1A7NH 4WO4A 4IK6A 4TNFA 2RIKA 4FQXC 2IDFA 2PXYD 3GXDA 4IGBC 4FE9A 4TNVF 4XNXH 4FABH 3ULVD 3NA9L 5GS1A 3HZMB 1OPGH 1YJDH 4Y16A 2XN0A 1M71A 1FC2D 2ADFH 5LCVH 1DVZA 3FZUC 3SO3C 2CUIA 4JR9L 2XBDA 4AYFA 1NGZA 3UAEA 1MREL 2YHGA 2AQRA 1A1NB 4MGXA 1WF5A 3PWVB 2K3TA 3O2WH 4RMTA 3DUSA 1DQJA 4MNGA 4LSRL 3TL5A 3P3TA 5AOJA 5GS2H 3TEUA 2ZXGA 5KSAD 1QHPA 4ERSH 1H3UA 2EDHA 4Y5VA 3HUJB 5C0EB 2X9XA 1HN1A 4O02B 2AABH 1AO7A 3VNZA 1YECH 5AW6B 4PJCA 3HB3C 1NC4D 3MA7A 2CO6A 3VRLF 1XH3B 3GKWL 2JIXD 3CDCA 4IBSA 2XQ0A 1G4RA 3BQUB 4TTGA 2P8LA 3BAKA 1R9TA 2JCCA 1OARH 4Z7UA 1QSEB 3U36B 1XGTA 3KJ4C 4PJIA 2DQEL 1JPEA 5I1DA 1I7TB 2E59A 1JZ3A 2X9YA 3NQKA 5EC1A 3PV7A 3FFCB 1KACB 4RZCB 4YHKL 4BK8A 1OGTA 2QQQA 3V0IA 2R56H 5JW4M 3O8XD 4XZUB 2YPVL 4IIZA 3ZT7A 4R7NA 4B5ZA 2YOAA 3AT0A 4H88L 4M6NL 3U9PL 3DETC 4X42A 1ERNA 5HYJE 3AADB 4GMTL 2K9FB 3DXAB 5EBGA 4MJ6A 4UAOC 4YJZL 3VG0L 4U6TA 5ILTH 1VPOL 5L9DH 5C2BH 2XG4A 4XHQA 2GEQA 2EDDA 2TAAA 4ZQKB 1RP9A 1JSYA 1UB6B 3WAKA 4L05A 1EHLH 1FH5H 5AKVA 1CLZH 5GSRB 3WL9A 5LKNA 4APQB 3VX1A 3SPVA 3QCTL 2DQ6A 3RU8H 2QQLH 1SOXA 1H0DA 1IV8A 3X3GH 2CO7B 4M7KL 5J5EA 4JVPA 2KZ1B 1CCZA 3C09C 2PNWA 2JV6A 3ESNA 3P30H 4OGAD 1NBZA 3RUGF 4XWGL 2AXJA 2VDQH 3V0GA 3MOAH 2EO1A 5I82A 5E6IB 3S8GB 1U41A 3UX9B 2CK0H 3UYRL 1GR7A 3KYMA 3G5XB 3VU1A 1DMRA 3MV7B 4JZNA 4KJQD 3DUUA 1PT0A 3FB8B 2YKKA 4Q4EA 1C12A 4IKIA 4R5VA 1IGYA 1NUNB 4GS7C 5BRQA 4WWPA 5FC9A 3TBCA 3WFZA 2GTZB 3R19A 3BGMB 4ORGA 4LSDA 4X4MA 5T1DL 1IGCH 3ALWA 2BOBA 3QEGL 1JZ6A 4KLNA 3GJFK 3UADA 1BIIB 5D1QA 2K6YA 3NYKA 2OR8A 4B0MM 3KLQA 3KPMA 5IW1B 5HYSB 3IDXL 3U0PA 5E6YA 3C60D 1UB5B 2F1EA 5BRZB 4X6BB 3BIAX 2GABA 3N1QC 2VITA 5KVFH 1I1FA 5HJDA 1EO7A 3WS6C 2KC0A 4NYLA 4AQ1B 5CGBA 4YHYC 1ZLSH 3UGEA 2FBJH 1N12A 5HI4D 1QW9A 3IDGA 1E27B 3F65A 3DO3A 3WY1A 3X1NA 1URIA 1UM4L 4LDCA 3ESPA 4NZFA 2C7UB 1HDMB 2OXGB 3EGDB 5B21A 4U4BA 4Y19E 3PJLA 4NERA 4WZ9A 4FQQB 4KKQA 2VOTA 2KS0A 2W95A 4ZTEA 1OWWA 1ODAA 3OHMB 3IJ7A 2BIOA 4MD4A 4AJWA 5C8JB 3SCMD 3MV8B 1DL7H 4JO1L 3MXVH 4H1LB 1R0AL 3L4VA 3P4MB 3HG1A 4MMYA 4TQEL 5I8OL 5CO1A 5GHWL 2C4FU 3MCKB 4UQBA 4DQOH 1JL8A 4E42B 3FRUA 1KJ3H 4UUJA 3ZKSD 2N56A 4Q0XH 4BKSC 3CZBA 4N2EA 4GQRA 3FT2B 2IQAA 3EJSA 2NW3A 1UD2A 4Y5YA 2P26A 1KBKA 3TFKC 3HAEG 4YDJA 3WGVB 5KSBE 2F18A 2R93A 1WAEA 3BMVA 5IFAL 4L3EA 3AGVA 2WXPA 4LPYA 1CFTB 1DFXA 2J8UF 4NRXB 2R2EA 2AJ3A 2VCOA 3VTMA 1RFDL 5DJ2A 3OKEB 4FLHA 4GAGH 3VFPB 2Z4QB 4L3AA 4HS8L 3UTZA 2A4CA 3BDXA 1GAFL 3FQXB 5JPMC 2EIJB 2R1WB 1LP9B 4PJ7F 3RJDA 2VW4A 3ASWA 3MRBB 4F92B 4JFFA 5DUJA 3FCSA 3ECVA 3KYAA 4R90H 1OGAD 3HG2A 3MV9D 4UQ2A 1CG9B 1SDYA 4QKXB 2R15A 3B2VL 3G6JA 4LEBA 3UACA 1EAPB 3TIEA 3VGFA 1LO3H 4FQIL 3ZYZA 1XF2A 3L3IB 4KY1H 1QFWL 3S3PA 2YMXH 2EUWA 3WO4C 1RSFA 2ENQA 5FDWB 2X4OB 5IMKB 2VZ3A 3QZOA 4OLZL 4NJAH 1XH0A 2B3IA 4M8VA 2VO8A 4FLQA 5BZXA 2D4FA 1AGDA 4CW1B 4LIQL 1JZGA 3TONA 3FT9A 4M7JH 4PJCE 5CJOH 1RURL 5B7MA 3S4SA 3RFZC 4WHYG 1Z9OA 3BSZH 4N85A 2K3HA 2WBJA 3N43B 1LEIA 1VFUA 3SOTA 5EU6A 1CZ8H 2F74A 2WWMC 3RWFA 2XTSA 1BF5A 2FQEA 2JCCE 4WW2B 4Z7UE 2X70A 4PJIE 1N19A 3CZNA 4G82A 2WMPA 4JFTA 3S36L 4Y9CA 1ADWA 4CBPA 3IDIB 4EVNB 1BXAA 2I69A 3FL7A 3HMXH 2OBGA 2G5UA 4X6DE 1XGPA 3PP3K 3S37X 2FIRT 4YSTA 4ZM7A 1MH5B 4NQDB 4QT5B 1ZLDA 3T3PE 1FZOB 3ZW3A 3QRFM 4GB9A 3TEXA 4YHZH 1GGBH 2V8MA 5T1LB 3BUTA 3WEMA 1A14H 3BCFA 2NYAA 2ESVA 4YPJA 2GKIA 1P7KA 2R0ZL 1I1YB 2CM5A 4WEBL 3DK2A 1BMWA 1RJCA 4NGHL 3ULVL 1D2PA 5I74C 5C0JB 1QA9B 2OL3L 4LF3A 3MFFB 1NCHA 5DO2D 3TNMA 1N64L 5AZEH 2ZTBA 4WUUB 1GOGA 2HLFD 5K1NA 2Z31B 4AUUA 3ZDZE 3EXLA 3GWJA 3QQDB 1JOIA 5ECGA 3GK8H 2B20A 4JQVA 5T5NG 5KW9H 1U8JA 1SM3H 1IM9B 3CVDA 2IAMC 3O6LH 3LAFA 4OZFB 5EEYA 4CMMA 3KW7A 3DOHA 4UV7H 2VQTA 3TM7B 3SULA 2J71A 2YXWA 4CC4A 1K5WA 5LVEA 4WU5B 1S9XB 4Z9KB 1E4XH 3U48A 2Q10A 4HIEA 3ZO9A 2ZOWA 1T7VA 3BQUD 2J72A 3F7LA 4PJ6A 3JWNE 2Y9RT 1QSED 5EWIH 2A7BA 4E36A 4OV5B 3G04B 4PLJC 1DSWA 5LAPA 1W16A 2NNXA 3FFCD 4X4ME 3WXVH 1YNTF 5E1HB 3GYRA 4UB0L 4F8NA 4A7GA 2OMYA 3QEQE 3DHMA 4QOKD 4L48A 3FXIC 3A5VA 5FR3A 1WDAA 3DXAD 1TQVA 2LVCA 2ALAA 3T4AA 5ECJE 4J2QA 2NNFA 3T1FA 5I8EA 5FCUH 4R5XA 4PGBA 3VFWB 4WFEE 2EEOB 2P80A 2PTVA 4I3RL 3GRWA 4GUPA 4APQD 4PAZA 4NO0B 4MMZB 4GNKB 3NABL 2WXNA 2CKBH 4PS3A 3U2SB 4XP6H 3U1QA 3WFDL 3LKOA 5DURB 3V8OA 3GXUB 2X42A 3C5ZB 4Z7QE 4K3DH 3O4OC 4BH7A 1NBVL 1VB9A 4NC0B 1U30A 5CAYB 5AZUA 3AAZB 1PSKL 3FB7A 5E6ID 1E42A 3HG1E 2P42B 5ITBH 4TLTA 3ETBJ 3FT4B 4AZDA 1XR8A 4R7DA 3VD5A 4JRXB 3UJTL 1PYWA 4GKNA 4DMRA 1CC3A 1MFBL 3HW7A 4QWWD 4QRPA 4OFDA 2EAEA 4XPBL 2EH8H 4Z7NE 2LTQB 5IJVB 3L2NA 3CIAA 4MXVE 3ATFA 3EJJX 4XN5A 2FZ3A 2JKSA 2IGFL 3UOAB 3FTVA 3L9RB 4L3EE 3VQ2C 2QLYA 2Q6WB 3SDXF 4FNLL 3U25A 2N3JA 3CVHA 4RA3A 3A23A 3EGXA 5E56A 2NY5H 5BRZD 3SUJA 4WWKB 1RUPH 4RAVA 5DGQA 2O26U 2VLRA 4PJBB 3ZKXB 1PLCA 4D0BB 3RGVA 5KUMA 4U0RC 3LS4L 4YGVA 1DZBA 3P11H 3CFJA 4FCAA 5DK0A 5HI5D 3OXRB 1S8DA 2H2PC 4G1EB 2J6EL 3OX8A 1AC0A 1QFUH 1QP1A 4ILDA 3MJ8B 4TQIA 1L0YA 2NTFA 3G6JE 3KLAB 1K8DB 2H8PA 2RTTA 5D72L 1DLHB 1IBYA 4PJEB 2VQ1A 1KCRH 4C56B 3CMOL 5IQ7L 3B9KC 3MV8D 3WEBA 1CWVA 4C83A 1G4MA 2DWEB 3G6AB 4K23H 2IIJA 5SX4I 3VGHA 1JYNA 2ZD0A 5ESVA 5EPMB 1EJFA 1NMCB 1HESA 2VXQH 3SQBB 3DSFL 1MOEA 1CTMA 2XTJE 1CK0L 2HXAA 4OCYH 2MHAB 4YN3A 1MCOH 1BBJA 4ZJ9A 1CUOA 3RX9A 1JRHH 4HIQA 5DS8B 4KRLB 3IR6A 4FQ1L 4H8HA 1W72H 1KB5B 4PJXB 3VXUA 3GUTB 1RIVL 1H5BB 3VXQB 3AU1B 5H2BA 1SFHA 3CDZA 3Q1EA 5AB0A 1KGWA 3I2CL 4OH2A 5GGSB 1OP5H 3MBEC 3LTVA 3FQTB 2DQCH 1GW0A 4L37A 3IFLH 1WC2A 2EDRA 3WMSA 3QEUB 4BFIB 3VE0A 1WC7B 1F4AA 3OJDA 4ABVA 4O4YH 4A6YH 1MFAL 4HKZB 2BWQA 3IR7A 2ESVE 4U2ZA 4WI9A 1F4WL 5DJ0B 1QSVA 4L8BA 5C0AA 1M7IB 4JFZH 1MQKL 1MW0A 3GEFA 4AV0A 2YAPA 4M03A 1T5WB 1M05B 1X5XA 4D7BA 1Z9SB 2RAMA 3V5HA 3GHEL 3V0JA 4XHJD 1Q4NX 1C9SA 3LD8B 1GRWA 5CIPA 3NCBB 2NNCA 5I16A 5E5RB 3FF7A 4TLUA 3VWJA 2XKSA 3WFEL 1UWEL 2W1NA 1U8LA 1YEHH 4UQIM 3DROA 3Q6FA 4N0FB 3BKCL 4PJBF 2GIMA 1FG2B 2ZG1A 2MH4A 1EGJA 3U6XA 1X7QA 1FDLH 2BLFA 4ETQA 3WLBA 2WUBL 4ZK8A 4OI7A 1N5AB 5IF0B 1NLDH 1XCWA 5A6IA 3G7TA 2CCWA 1OD7A 3M3GA 1T21A 3KBEA 1GYUA 3FUEA 4U1MA 4HKBB 4GFTB 4TN9A 3BLBA 3ARFB 2PR4H 2CO1A 2OMZB 4Y4KC 1R27A 1P4LA 4Y9GA 5E6RB 3SBPA 4FXGA 1FORL 4NQDD 3H0TB 5D9SA 1G9MC 5B1BB 1HT6A 5HDOA 3JTTB 3RDTA 3KWXA 4DHLA 2TRYA 5FUOL 3MLPA 4LLVA 1U3HA 1RHHA 3NG5A 2WV3A 2V3FA 5T1LD 2Y7OA 1E6JL 3C5JB 2BH0A 1QLRB 3AW5A 2ZX9A 4ICWA 5IW3A 4HJGA 2AF2A 2D3LA 4OD2A 1XCQA 4KJWC 1GGTA 3K2KA 5E0QA 4EE2A 4WUUD 1QQDB 3WNLA 1E8XA 3IGAA 3I02A 4PJXF 2Z31D 1TZGH 3FO2B 3CFTA 4FTVA 2BCMA 4NBZB 3OR7A 1CFVH 2ZYSA 3BGFC 4LMQE 3P4NB 2H6OA 1IM9D 1QD0A 2ZG3A 2VUMA 1PZSA 5CGYD 5DUML 3EXJA 1E5CA 3PNRB 4J3OD 4PJDB 4MFHA 4X98A 1QNZH 4AZ8B 2RACA 3CZFB 3AY4C 4Q9BA 5K33A 3BD4A 1NLBL 4JFOA 3V5KA 2Q1EA 3HE7B 2WTPA 1OSPL 3KGUA 4PBVC 4K7PX 2WLZA 2G3ZA 4ZOAA 3QYCA 2CDEA 4IBUA 1GKEA 3FO9A 2EO7A 4QRPE 5EZJB 4KKLC 3WEAA 1RZFL 2Q3AA 3CK0H 3LKRA 4B53A 5CLYA 3CU1A 5TE7L 4YAQA 2UY6B 2R29H 3FMGH 3F58L 4N3TA 1MAJA 4N25A 2EYRA 5TJWK 1PVHA 3H9ZA 4PS4L 2K8MA 1QFOA 3DSNB 4HUWB 3GXMA 4U6VL 4QHKI 4U6XB 5TGBA 5GLYA 1ZXKA 1IGMH 6CGTA 1YYLH 4KX7A 3EO9H 5TF1H 3QO1A 5D1XB 3KZ8A 5EDSA 1MLBA 4JO2H 1ZCRA 1VZGA 2OTWA 4GA6A 4NO0D 1P2CB 4IJ3B 4OBRA 4F8PA 3EBHA 2WLMA 3TT3L 4NQXB 3NRPA 1E18A 4MA7H 5DURD 3ULUE 3C5ZD 4WEEA 4KROC 3A67H 1PTZA 1ID2A 1I8KB 1DLFL 3CFEA 3TYGL 3CF2A 4CSTA 4OSUH 5CR1A 5JZ7D 4Q9CA 3RPBA 4AC4A 4AYGA 4OCSL 3QUMA 2OX5A 1ZE3C 4CMHC 1CN4A 4XC3L 4PGEB 3UZQA 1DJGA 1TO4A 4XT1C 3HC0B 3H0GA 4JRXD 3IMWA 3SGJC 2AQTA 1FVCA 4WI5A 1G7JB 2JJWA 4J4PA 2A9CA 3BESR 5DMIH 1V3JA 1G84A 3D25B 2OZNA 4R96A 5EUKA 5L2KA 1N5YH 3X2IA 1JGVL 2X89A 2VTFA 2C3VA 4EDXB 4LHUG 2E7DA 4DESA 2A69D 2CMRH 4OZGF 2IH9A 5FK9A 5A3IC 3KH3A 1QRNA 2F53B 3QS2A 4NZRL 5F7LB 1P9MC 3VXME 1NAMB 3H85A 4QLWA 1GHFH 1CGSH 2ERJB 1CVSC 4PBXA 1S7XB 4YHOH 4YDIL 2XA8L 4WWKD 1U3JA 2VMJA 3RKDD 1E9PA 1U58B 4D3CL 2JLPA 4KH2A 5EU5B 2Z1KA 5D55A 1S9KC 5LNDA 1CF8H 2VC2B 4PRAA 4PB0L 2VQ4A 3K71A 4FFZL 3ETSA 4XOCA 1FNLA 3GMPA 1J1PL 1FL3A 2C1PB 2WGNB 3RVUD 1BFVL 1FV1B 1UACL 2IGLA 5C0AE 4GAYA 5T3XE 4PLKD 1M6UA 3MMEA 5F7MC 4GSRA 4C56D 1DSFH 4XCNA 3ZBMA 1NDMA 3GSNH 5G55A 1CICC 5L4MA 2Z8VC 1AZCA 2YD0A 3FQWA 3KAAA 4NZTL 2CE6A 4I77H 4PJFB 2M1KA 4U4IA 4CRPA 5I0VA 4LPWA 2R1YA 2YBRA 2QGBA 3GS4A 4AEHL 1MJ8L 1I7ZA 2H3XC 2IFFL 4W9FC 4KMTH 1CYXA 5FA3A 1DE4B 5I6PA 4BFBD 4H26B 3I75B 1RU9H 2PPFA 2CJUH 2WKOF 3LKQB 4MNQA 3ZL2A 4XMUA 3X2MA 3HVNA 4UTBL 4LSQL 4AENA 4MA1B 3OMIB 2WLKA 4G8IA 2E7ZA 1UM6H 3EJYD 4UTCA 5I26A 5ICYA 1KIRB 1X5YA 1QASA 4XE5B 1V3MA 2P24A 3QHZL 4K5MA 2EYTB 4IK7A 5EUOB 2NNRA 2O6CA 3QHTC 4GSDH 3OSVA 2DH3A 4OTXL 2OW6A 4ODSL 3GJEA 1ZV2A 2QQKL 4NHUB 1P5VA 3CDFA 4APXB 3Q1SL 2P8PA 1IO4C 4DF9A 3VYOA 1KGJA 3VQLA 1N8ZB 4B95C 1OQXA 3C6SA 3WENA 2VABB 2CIKA 4XCYA 2VUKA 4M4PA 1JHTB 3I74A 4OU3A 2GBVA 1Y4ZA 1KDIA 1VFAB 2B14A 3O45B 4JM2B 3JT0A 4NQEA 5DZAA 1AGFB 1F6AB 5HPMA 2HVJA 1R7RA 3EYOB 4WTQA 3E0GA 1OVZA 3WSQH 2E74C 4PWJA 1A5FL 3FB5B 3BZEB 3MODH 5C0CE 1BVKB 1G1KA 4JANB 3GIVB 4UT9L 3SO5A 5JHDB 2H47C 2EH7H 3QDGA 1QATA 1TNMA 5FM4A 5K9QI 3FTXA 1WHPA 1MRFL 4PV9B 2X6UA 1MW1A 3UTTA 3PU7A 4JFVA 4XP1L 3OB0K 4HFWA 1TTBA 3BVVA 3NFPA 1RIUH 3A21A 5B7FA 2JCWA 4EI5C 4OCRH 4HIHB 4N8VB 4IHOA 4BUQA 1FA4A 5E1IA 2P43B 1BWMA 2Z93B 3HRZB 1PZBA 3U4EB 1Z66A 1C16B 4NKDA 3ARFD 1WG3A 1Q0XH 5IVXB 3LY6A 5TE4L 3RWJA 2HT4D 3LEXA 3ZOAA 3DDFA 3ARVA 1GPOL 4PV8B 3QORC 4C2MA 1K6QL 4QJ5B 3FU8A 3QAZB 2JFCA 4D0CB 3TESA 4MDIB 3GMQB 1KPUB 2HP4A 4YFDB 3L3DA 5CFHA 1SMAA 2FJFB 2A6JA 5DMGD 3FTGB 3MDJA 2CR6A 4XAKD 1DQQA 3H42H 3L95B 1ZGLA 3X13B 3T6XA 2N7BA 3SYOA 3GSVA 3HU1A 1MXGA 3HS8A 5C1BA 3SZ6A 5CCHE 1FJ1A 4QRTB 1A0QL 3RNQA 2Y2WA 4FA6A 4HXBH 2Z7YA 3JTBA 3V9CA 1SUJA 1S7TA 3P77B 4NWUL 3LHPH 2DYRB 3PRZA 4AIOA 1WBZA 2FEDD 3JUZA 3T65A 3BAIA 1IC4L 4M8RA 5IQ9A 2AK1L 3OG4B 4LDOB 3UZVA 4FOMA 2OZ4L 1M4KA 3KXFD 2AJXL 3HE7D 5EZOL 4Y2DC 2A6KB 5I23A 3MGTB 4EBQL 5EUOF 4DKDC 3LIZH 1A3LL 4PRHA 4FFWD 1YEFH 1DQMH 1DUYA 1T83C 3WS3A 1FNEB 5DJCA 2CR0A 3EOBA 1W0WB 1MN4A 2Q86B 5EIIB 1OP3H 1A7QL 3FU7A 4P2OB 5SX5H 1F42A 3QFJE 5HVHB 3CXHK 2E46A 1RK1A 1QRNE 2H6PB 5GXBB 3VM7A 3RVVD 2I9TA 2D31A 3A6BL 1IC7L 3KGSA 4GMSL 5E9DA 3B6SA 4X9FA 3QG6B 1U8OA 4DN4L 1H6EA 1JS4A 4HGWA 3S88L 3WN5B 2XWBB 4JFDB 4NQCA 1UXWA 4W9KC 1IAIH 3QXAB 4RMBA 1QKZL 3I9GL 3ARTA 3MROA 2BWIA 3KPSB 3HI1A 3CFDA 1HZHH 4DVBA 4F9PC 3VACA 1OP4A 3VRIA 3IJHB 1IBGL 2FBOJ 4I2XA 4EF3A 2FR4A 5CEZL 1BXUA 4AIZA 4Q56A 4K4KA 3CGTA 4Z7WF 3CFCL 3MRIB 4HS6B 5I17B 1WJ3A 2LHAA 4WK2B 1UATA 5J4MA 3CQPA 1YA5A 2NMSA 5IVXF 2EZ0C 2NAPA 2P5PA 1MCWW 4WHTA 3KLSA 2G5RA 2H32A 2GJJA 5F1IA 3EHBB 4U3HA 1GJUA 5SWZA 4RDQF 4N1EA 3QW9A 1KNOA 3K80A 5ESAA 2PW2B 2ZONA 3V4UL 2BCKB 4KODA 2Y06H 1FAIH 3N41F 3ZT5A 4WFHD 4G8GA 1OF2A 2CDGA 4D0DA 1QI5A 5DHDA 3U6XS 1KYAA 1MJ7H 3PDOA 5EOTB 3GB7A 2F53D 2IDSA 4MNQE 5ID0B 3C2SA 5E2TL 5IQLA 1B4TA 3QQ4A 5FM8A 4BYHA 1YECL 4HWBL 2BVQB 4P3CL 4Q6IA 2FH8A 1VA9A 2ED7A 1ZHKA 3REWB 1IW7D 1LL1A 3RWCB 1MCHA 3ML1A 2ADGA 4QRQA 5K59E 1KIUB 2CXKA 4GUQA 2BHYA 4N0UA 3G5VA 1DSYA 1OARL 1LYQA 3IFNH 3NFNB 4P4RA 3V0VB 3AG1B 2W9DH 4KK5D 4EN3C 1EDHA 2F8VA 1IAKB 3ZIYA 1FWXA 2XNAB 5DC2A 1H3GA 1MFMA 1PG7L 2WXFA 1AQMA 2R56L 5I5IA 4NQEE 2HJKB 3FQYA 5AKRA 5FLUA 9PCYA 4N2BA 3QZBA 3PE9A 1RLWA 5FM5O 2B63A 2B39A 3NFSL 3QIBA 4KKAC 4PSRA 1B9KA 4DP0X 3QUXB 2MKWA 4FJYA 1D7CA 2X4RB 1S9YB 5F93C 1DVUA 1OY3B 4H20H 5L9DL 1UHDA 1KB3A 1DFBH 3EBIA 5IB5B 2YN5A 5KTEL 4BUGA 2XICA 4X9YA 2BP5M 3R0MA 3NJMA 3UTTE 3WN6A 3ECBA 4FNUA 1RUQL 3RU8L 4XNBA 1J1XH 1U8PA 4LCIH 3OL2A 4ENEC 1NINA 1IAII 5F7DB 1SLUA 1I3QA 5DFWH 2VDQL 1MAKA 5E70A 3UP6A 1USQA 3ME0B 1KB5L 2YEZB 2ICWI 1FFNB 3Q6GH 1XGRA 3H3BC 5CSBA 1XMWA 3WJMA 1EZUA 3OZ9L 1RK0B 2MNUA 2ZCKL 1XL6A 4AQOA 3OKLB 1GH7A 1NAKL 1FGNL 2AEPH 2Z8RA 1X5JA 2G4EA 5JDSA 1ZHLA 4CBZA 1I4FA 3KYNB 2KMWA 4HW6A 4MA3A 2CLVA 4OF7A 5E1AB 4YHIA 2X4UB 1SQMA 3LKSA 3LZQA 2R2HB 4XNDA 4AAYA 2NR6D 2Q76B 4UU9A 4TULL 4JM2D 5KVGL 1I8UA 3MFGB 3CUPA 2CD0A 3G5YB 3DC0A 1TVBA 3E2HC 4NCC2 5GLXA 5KVFL 4RQQA 3TO4B 5JHDD 1WCQA 4KVPA 1AQ8A 3GMMA 2FBJL 2DQTH 3RRQA 3L4TA 4FNTA 2O6DA 3NGBC 3Q2LA 4YDLB 4C55A 2I07B 5MENB 4HCRL 4GRMA 4PRHE 2BC4A 1XHHA 4RFEA 3STZB 4YX2L 1T4WA 4QHNA 1S7RB 2MMXA 3D3VE 1HL8A 3NIDE 2MCMA 5GRUH 4M5YH 1EAOA 2W65A 4TTDD 3TO2B 1HYSD 3MRCB 5IMLA 1OTSD 2O6EA 2PTTA 3IAPA 2OK0H 1QWHA 2D2OA 4DQOL 1D9KD 4MX7A 1KJ3L 3RA7L 1OW0A 2HFEB 4Q0XL 3E6FB 4JRWA 5E9DE 1PZ5B 2YXVA 1M3IA 1UA6H 3QAQA 1ZY9A 2DEWX 2D7MA 3JWOC 2WQ8A 3CXDH 1WBXA 4A38A 2ID5A 4ZZKA 5FB8A 1MHPL 1ML0A 2B4CL 4IYKA 4UIMA 4X0KB 4OF5A 2YPKB 2KLRA 4JVWA 3NQIA 5AVYB 3OKDA 3MOBH 3KWWB 4I2XE 2PETA 4GAGL 2UWEA 3QJFA 1MF2H 1X4YA 1K3IA 5IMOA 3VDCA 4HUUB 1X5FA 3HPJB 1SHMA 2WOBA 4G9DB 4PP2A 4E41A 1KZYA 2PO6C 4IRZH 2XVLA 3MRMA 4MAYC 1N7MH 4MXQD 1MJUH 2IOMA 2FWOB 4K5NA 5EA0L 2ICEA 4LCVA 3GNMH 2R2CA 4DAGH 1SJMA 3UTSB 1F41A 1CFBA 3NPSB 4Q8BA 3TCTA 4P4KC 2CBQA 4IS6A 5C6PB 5SWZE 4KV5F 2DM7A 3KPPB 2V7NB 3QG7H 1LO3L 1XGQA 3EFOB 5B3JF 1WFJA 3JWDC 3ARDC 3S37H 3PNWB 1CT8A 4L5FE 4P2OD 4XNAA 4F3FB 5G4OA 1NCCL 4WJG3 3V55A 1ZKAA 2APWA 2X28A 3BKJH 1V5JA 2O61B 2JK5B 4ZXBC 5IT2L 3F2LA 2AW2A 3VD9A 1AHKA 3B8SA 3HAEB 2XZCH 4TUKL 1OSEA 5CJOL 3FUMA 1MVYA 2HA1A 4JFDD 5FO7A 3UTPD 4Z5RB 3DJ9A 5FYKE 3KPSD 1HKLH 3WIAA 4KDIA 4PWGA 4YC2C 5I19L 2JELL 2VL5B 4H0HB 5DFVD 2EDBA 1P5UA 1CD9B 2ORBL 2A6ED 1XEUA 5I76B 4CADB 2WZAA 1E8ZA 3FQRB 1WEJL 2DD8H 5GRWA 1NDTA 3BWSA 2VN6A 2ARJA 2QMKA 4RMSA 2Z1PA 5C3IA 1WUZA 4OLUL 4YHZL 4W4OA 3SPCA 3FN0H 4R7XA 1UWFA 2Z65C 3OKKB 4QHKJ 1QLEB 5LBSH 4I18A 4NUGL 1JD9A 3EHBD 2R69L 4QHPA 5DQ9B 1P0SE 4JPVH 1UVQA 5CHNA 1UA7A 2NZIA 2PP8A 4R26L 1DBKH 1JFQH 3PWPA 2A9NL 1KYDA 3NUKA 4B9ZA 5CD5D 1JWUA 1GGUA 4EDWH 5B8CB 1NKGA 1HSAA 2QADC 5IHHA 1LJMA 5H35B 1E65A 4JGNA 4GXUN 4JHZA 3V6OC 3VRJA 1MCKA 5JXAL 1XQ4A 1X4XA 5JR1H 1A8ZA 2NYZA 1BA9A 1FN4A 1QO3B 1SM3L 3S8WA 3OHXB 4LQFH 4UQ3A 5T1KA 4LOUD 3TPKA 4X7CC 3BZDA 3O9WA 4N2LA 1CQKA 2E6QA 2HT3D 4UV7L 5HGHA 6TAAA 1TENA 2FD6H 2R4RH 3DV4B 3MRJA 4PP1C 4PRIB 1N6UA 2ZUXA 4P2QA 1NAML 2UX6A 1YAZA 1F90H 2FK9A 3D18A 5ISZA 1U8MA 4OLWH 1SVCP 1H5NA 4XNQB 1MUJB 3W37A 4OZHB 2WXKA 4LARH 5E5MB 1D2OA 2CKNA 5AW5B 3QXTA 1L0XA 2DMHA 4N2CA 1S5IL 5IB3A 4X5XA 4LSUH 3APDA 3RNKB 2ZSWB 3L9BA 2VC2L 3EDDA 3L13A 4FTDA 4G71B 4ZFGL 3D9AL 2WQUA 3NCXA 1TEGA 3AU0A 3UABA 3QVAA 1A6PA 3QUXD 2W5PA 2VKWA 4WCYL 3LEYH 4WI2A 3D39E 3IDYC 3MKKA 4KGLA 4PRBA 3ZKND 1CPUA 3D0LA 3NSXA 4ZO8A 5B6CA 1FUNA 4ODHL 2L3BA 5M94B 4B41A 2AJZB 3U4AA 1X5AA 4OZFH 4AL8C 3K74B 1WLFA 3PJSA 3MNVB 3IDJA 1G9NC 3CH1A 2C3WA 3SEPA 4LL4A 4OFYD 3K6OA 3WTWA 1HAUA 1H8OA 1OGSA 4B9PA 1OLZA 1RL1A 4LCWA 2G0LA 3EYUH 1A7OH 4N86A 5EU3A 2Q8BH 3B1TA 5F88A 5JIDA 1WCBA 3LZOA 4XNZC 1CS6A 1ORQA 1UJ3A 3NTCL 4LU5H 4NQSB 4M7LL 2D9QB 4QHMA 1A3ZA 2AP2A 1MG2C 4KI5C 5F71A 3ZDYE 4U1IA 5D5MF 1GGCH 2CKBA 1GYAA 1KULA 1PQZA 4ZMNA 2FYYB 4JCMA 5J9PA 1JGUL 1FYTB 2NZ9D 3NDZE 4M1GH 4HG4K 5KN5B 3HPLB 1N9PA 2DJUA 4CS0A 1SOSA 1UFUA 4JQXA 3V4PB 3EYSH 1KIPA 1KBVA 1VFBA 2J8HA 2FQFA 1BEYH 3CQQA 1OV8A 5FIEA 3ZKMC 1BBDH 3IDNA 4N26A 1L6ZA 5DXWA 2FX9H 3L1OL 4Z7AA 1R46A 4ZO9A 1KXQA 4BDVA 2UWEE 3BPNB 3VI3B 5J11B 1M7DB 3T2NH 4IM8A 4WNSA 4FHKA 5AENA 3TO4D 3MRGA 4CNIA 3LVTA 3CSYA 4K94C 3E1ZA 4ZTPL 1AC6A 3BKMH 3FB6A 2AGJH 4NFCA 4H8WH 1JHLH 4LDEB 4ODXB 3SKOB 1SMDA 5A2BA 5CMAA 5IVNA 1TZAA 3O6FA 3VXTB 5AD0A 1BYOA 3QQXA 4JZJB 2AJYH 5MEND 2VLLB 3F5WA 2R23A 4M5SA 3QUZC 4OJDH 5JPNA 3FSVA 5IBTH 2CRYA 3ZHKA 3TT1H 3RWDA 5KYYB 2XCMC 3MNZB 2EIDA 1UD6A 3JBG7 3LNIA 4N0CC 3ZGHA 3QIWA 1I3VA 2YFNA 4I0PC 5DUBB 1FLRH 4GUCA 3ES6B 5EN3A 3RPIA 3J07A 2FRGP 4FQPA 5F0LB 2XFXB 1EFXA 5A6MA 1WFIA 2KUTA 3BRGC 1MCNA 1PKQE 4R8WL 4ZPTB 3L1GA 1BM3L 3US0A 4KMQA 2BOCA 3QI9B 1C8QA 2E76C 4G8EB 4WO4C 4F5CA 5J6HA 4MRCA 1H3TA 5KS9A 3DV6B 4HQQL 4ZX4A 5MHSE 12E8H 2EUXA 1HNYA 3VFTB 2R4SH 3CV5A 2XZZA 4F7TA 5INDB 4XBPA 1Q9KA 1H3PH 1SFOA 1MDAA 5E8PB 3AZUA 1FQ9C 4Y2NA 5GZNA 1YN6B 3T0WA 3PL6B 3L4YA 3QC5X 4N4YB 4R9HA 4PU2A 4YEFA 3M8OL 1W72A 2DKMA 4X6CB 4BK4A 5F1SA 4FXLA 2FO4B 3E8UL 3M88A 5I0DA 1EIBA 1AQKL 3UTSD 1H9VA 3LOWA 1HIMH 3QZLA 5GRVL 4A6YL 2XY1A 4Y5VC 2KLSA 1Q9OB 3I85A 5HHQB 4UCFA 1TZ8A 2YPVA 2DH2A 2IQ9H 5F21B 5E2VH 3MLXL 1QR1B 3MJ9H 3PWPE 1DBML 4WDIA 1I8AA 4J3VA 5LG6A 2LFGA 4HD5A 1KY6A 3Q5TA 4NN6C 4PS7A 3TYFB 5EIQA 5BQ7A 3GI9H 5TDOB 3SO3B 4A55A 3FOLB 3B8YA 3KGRA 5J6GB 3IJSB 4LOVA 1EXHA 1AS7A 1MSPA 3SN6N 1MCIA 2GIYA 4JFXA 2Z92B 4P9MH 3RWHB 3WTYA 5L7XL 1UZ6E 3QJXA 5H4YA 1OWRM 2WJ7A 1F4XH 2AI0H 2FX7H 2NY6B 4IQHA 1YEHL 4OLVH 1V05A 4PYGA 4G42B 3VFGH 3L7FB 4P2QE 1U36A 4GO9A 4JHWH 5CBAA 4ANXA 1PQHA 2XKNA 4DJMA 4M8QB 2JTYA 5AVSB 5ISZE 3B83A 3MR9A 4IIQA 3MAWA 4E68A 2QKIC 4HAKA 5FCSH 2XT1B 1TYRA 5E8OB 3ARYA 2EKJA 1PNDA 5FTLA 3ALPA 4JRYE 3E80A 4DPAX 4E0RB 3LN9A 4FFTA 4P5TA 4TSCL 3KJ4B 1B6UA 4L29B 4TQ8A 4UQEA 2LAAA 4QRRA 5CLXA 3TX4A 3DOSA 2XQYG 3II2A 4CILA 1S7WB 4HCIA 2WCSA 3Q2CA 3QDME 4K7PH 1J5OL 4PN6A 7CGTA 3RWEB 1VLXA 4NNYA 3ZHLA 4ELKB 1UD5A 5DHYB 2VAAA 5I1LB 3FJTA 1U91B 2FEJA 3FHQA 4OBSA 3QJHB 2FVNA 1SYSA 2CBMA 4DW2L 3BC9A 5I1GL 4UAOB 4H8UA 3EO0B 3QO0B 1DJHA 4BFNA 3LRKA 1I7RB 4JL2A 3PABA 4OW6A 1MI5E 2LV4A 2VRQA 5KBKA 3TC9A 1VZIA 3MHZA 1CFVL 2E3VA 5CBEA 1Q90A 2DRUA 4YSSA 2CHNA 3C9NA 5FX3A 2B59A 4TUJA 4LCWE 2W80C 4XRCA 1A25A 1G7LB 3QUKB 3C09B 4UINL 5D1QC 4HPHA 3NJXA 4DP5X 3QISA 2IPKA 4PRID 1VF5C 4GSQA 4FCHA 4XI5D 4IU3B 1JVLA 4X7SH 3HNTH 3UCQA 1PZUB 4X4XA 1O7DE 4KVNL 4AVKA 4QHUB 1HJBC 4RMWA 3DRTB 1WLHA 4HX1B 4BHUI 5I1KH 1FL5A 5BZZA 2FIKB 5F3BA 3AREC 4MAUH 4UM9D 2A4EA 5GJSH 4YHNA 2VJXA 4Z77B 1XF3B 4W9EC 1N0LA 1DQLL 1Y6NR 2AVFA 3DTDA 1WK0A 4GS7B 4LLYA 3H53A 3BVNB 4ABWA 4LBEB 1KXQE 1XGUA 3MXWL 2F8XC 4LFHG 2KZWA 1ZANH 5AAWC 1IGML 1U4EA 5EBWB 1XH2A 3ARUA 4NO5A 4QI3A 3ZE2B 3PWJB 3EO9L 1UXSB 5TF1L 1JD7A 4NKIL 2R29A 1NFDA 1A8JH 1OAKL 2ICES 2WSKA 4FL4C 3K7UA 3UROR 3OWRA 4UYQA 4OGZA 5KSBF 2JIRA 4Z3EA 4YHYB 3SDYH 1T5XB 2Q5BA 2BNRE 4NSKA 3U0WH 3VFMB 5IKCB 4PMEA 3EKCA 3GGWA 4OZ4A 2EE3A 3QQ9C 4GT0A 4Y5YC 3V52H 3IMBA 1JV2A 3WIHH 2BP8A 2UXVA 3E9UA 1BQLL 5DYOA 4D7ZB 1UWGH 3L5XH 4FZ8H 4PJHE 4AEFA 1JDCA 4J3XA 3UJIL 1H6FA 3JVGC 2JIMA 4CVUA 1YC8A 3SDCA 4EZJA 1W0VA 5F9JB 4OLXL 4YZWA 3U1SH 1FYTD 3FN9A 4RH4A 3PPSA 2H0EA 2R1XA 5KS9E 1V10A 2DQGH 1T22B 4L1LA 3IJ9A 4UT7H 1YEEL 2I32A 5EBMA 4Q9QL 3GS0A 1BECA 4GA5A 3CFNA 2EDWA 3KPLA 4JB9H 4GFXA 1GHFL 1Q9LB 4WVRA 4YHOL 3II1A 5EOCH 2BIMA 2JJTA 2ICWJ 3B9EA 1UH4A 3ABZA 1ZLVK 4ZNEA 1RZKL 1MAMH 3O4LA 1X9LA 5F3HB 4XGZA 5FYLD 1F00I 1ZK5A 2YN3A 4PJCF 5ERWB 4TNGA 3BZFB 3NZ8A 4GP8B 4LOEA 3R06A 3K6NA 5DT1L 3MREA 5E9AA 5JPMB 3T2OA 4NFDA 3V4VH 4OT1L 2JCCF 2F2HA 3WKYA 3D50A 4Z7UF 4PJIF 5TDNA 3UPAA 4XWOD 2Z64C 3BAEL 1NUGA 1ZS8A 3QDJB 3P9LB 1OLLA 4IW4C 4B60A 1J1OH 1CLYH 1OTUD 5DLLA 4X6DF 4ADJA 1Q1JH 4CVZB 5GGRA 3LQAH 3T3PF 1BREA 4L4JA 3WO4B 5GSVA 5DVPA 5HHPA 1D5MA 4KUZH 4M4RA 1UCBL 4I77L 4IMKA 4P06A 4FNSA 4IBZA 5BJTB 5KG9A 4YXKL 1GC1H 2KZKA 4LSVL 3SE4A 1W2KT 4GW4B 4LHUB 4ZBJA 4KMTL 4ANWA 1OA7A 4MCYB 3ZE2F 1NPJA 4E9RA 4B3EA 4ANVA 3ABLB 3DURB 4JO3H 5L2JA 5I30L 4PJ8A 3RFZB 2VSMB 3ZDZF 4K0OA 4M1DH 2Y7QB 1K5NA 2VZ1A 2F9BT 2IF7A 5D7HA 1TF4A 1F58L 1I50A 1YN7B 1UM6L 5DD0H 1X5IA 5KSAA 5C6TH 3PL6D 1KCVL 5G5DB 3BVXA 2CA4A 3UO8B 2F19H 1KUMA 1OPOA 1ZWIB 1U92A 2G60H 2UY7A 4QRRE 4WWOA 5DUPH 5I1CH 1S7UB 5GRZA 3RIAK 4GSDL 3OR6A 4CU6A 5DJXB 4JQVC 1AE6H 3DX9B 1ZV5A 1ODUA 4Q89A 3AG3B 3D5OF 4FQXD 5F0MB 3X12A 1R5WB 4IGBD 2WWNA 3CX5K 2GC7C 1HXYA 2HJLB 4RRPG 1PX8A 2ITDB 4CC4C 2GYSA 3TBYA 3H55A 2PWGA 4AEIH 1MWAA 2AJUH 4H25B 3ORJA 3FZUD 4ZFFA 2I7SA 5FECB 3BOVA 3O8XA 4IOIA 4EI6B 5I74B 4CVWA 2VMFA 1MWOA 2P45B 3NJHA 2AK4A 1TQSA 5GLFA 3B7YA 3MRPB 1Z6JT 5BVJB 3FOMB 3KLDA 4TKWA 3GXPA 1MQ8A 3MCLH 3TF4A 4P2YA 2UX7A 4WW1B 3M1OA 3EO1A 4AZUA 1BX2B 1T2QL 2IAMB 1YEJL 3LRSA 4G6JL 3KPNA 4KJYA 3T77A 3HB3D 1GS8A 3A4DA 1R5IA 2TSAA 3T4AC 5F6HI 1T0PB 3FQNA 3KVQA 3OPUA 4OZIE 3GM8A 4HD9A 1J18A 3QFGA 4H7VA 5DYIA 1BQSA 3GMLB 5DJ6A 4F7EB 5B39A 1DDHA 3SD5A 3ZDXE 1JF1B 4M6ML 4Q9RH 5GGUB 1IBHA 1CXLA 1IE5A 1AD0A 1PBYA 4XMPH 3DGDA 2R0KH 4CDGC 4KKZA 2DL2A 3FQ4A 5HGBA 1BZOA 1YLEA 3CVBA 2E7MA 3H7BB 2UZYB 3HLKA 4OKVA 3L9EA 1ZYRD 1MVUA 3H6AA 5AAMA 4Z8FH 3DETD 2WXMA 1RUMH 3EBAA 4K7FA 3H42L 4Z7NF 1NFDE 5MERB 3FDWA 4HDIB 4MXVF 3P73B 2NNAA 2Z7ZA 3M86A 4W68A 3SYAA 2Y5QA 3EJCA 1QLEL 4OD3L 3T0VA 5KSVB 5AVUB 4TOYL 4N9GB 4S1RH 3OGOE 3ZTJH 5LBVA 3EYQC 2BNUB 2EE6A 4LXFA 3M07A 3QWRD 3M17A 2PW1A 4NKOA 4KDTA 4BZ2H 3PFQA 1F45A 3O4OB 4JM4H 5C9JA 2HX8A 4X7TB 3GZOA 4Y7OC 5ESQB 2B2XL 3MTXA 3WUWA 4FEIA 3H4HA 1JNNL 3NP3A 3OQ3B 4MTMA 1R3HB 5T3ZE 5B38A 1YEFL 1UGKA 2ZCLL 3ARXA 3FTZA 5J1AB 2GCYA 2ITCA 1DQML 5KBLA 3G6JF 4RGNE 4U05A 5JW5A 1IAIM 3RGVC 1XIWC 1S9WB 1BJMA 3SKUD 2QKSA 2QTEA 1ZHNB 3SCMA 4LIQE 4I4WB 3W9EA 1DR9A 2N4IA 3RE0A 4F58L 2ZAHA 3TZVC 3ZHFA 5BS0E 5AW2B 4ZS7H 2O5NA 4UDTB 5KYUA 2PUQT 4PRDA 3O4LE 2A1WL 5CZXD 4ZRGA 3RFRA 5IY5B 4JHVA 5D7EA 3RZWA 1U8NB 2ZPKH 2C8NA 3NCJL 2OXHA 2PP7A 3MRDA 1BYPA 5E99H 4EQ2A 3HNVH 1HZHL 3U9WA 1ED3A 1IGTA 3VFRB 1QABA 3D4YA 5K1VA 4U0RB 5ANMA 1ZEAL 1SXAA 1A6VH 1MCLA 3FQUB 5F96L 1CIUA 4KRMB 4YL9A 2WIIB 3F84A 4QRSA 3VMNA 4YSAA 2PWEA 4JW3A 2KERA 4G83A 1NOAA 3D52A 1AS8A 2QVFB 2XUWA 1R47A 1M6OA 2X12A 4GY4A 1LO4H 1YY8B 1FI8C 1N8OE 1G7QB 4XVJL 2VDOH 3B9KB 2CRMA 2GTWB 2X2UA 2YPLB 1B88A 3WUZA 1EAJA 3TIDA 1D6VL 2BSED 3T2PA 3R1GL 5J0BA 3MV9A 1UYWL 2H9GA 3L6FA 3GRGA 2HKFH 4ENGA 2V17H 2IALA 1FAIL 5T8IA 1VADB 3S7GA 3UP1A 3MJWA 4GAJH 1E4WL 3F3HA 4WNQA 3RJQB 1RAMA 3BVTA 1FPTH 3NK3A 3TFKD 1WIPA 2FJGA 2KQMA 4K15A 5F9OL 4WJ5B 3FO1A 1I3GH 3OG6B 1NPUA 4JKNA 4NHCL 3Q43A 4LSPH 3PG2A 4X9BA 3QA3A 1HSBA 5D2NA 2F8OA 4OD1L 3U46B 2AQQA 4AYID 1Z9NA 3FU5A 3MBEB 1IFRA 2NX5D 5BO1L 2YR3A 3I3BA 3Q13A 5E1GA 3IFNL 3IJEB 5ELIA 5IWLA 3OKMB 3JUYA 1YEDB 4ZFOA 2VLJB 3BHBB 1QLFA 4P5SA 4AXWB 1A6WH 3RUGA 4U3XA 3SIKA 1DUZB 4HETA 4RWHA 4YDNA 4FZEH 4NX0A 3QWNA 4MXWH 1AD9B 3QDJD 5FUCE 1S5HB 2VISB 4AX3A 1E9QA 2I9LB 1KLUA 3LX9A 4XNUH 1QEXA 1KLGA 2XN2A 1U2YA 4Q2ZB 5FF6B 2AJSH 2YXMA 1S3KH 4HEPA 4ZFZB 4ZOBA 4UNTA 2IPUG 1JGLH 4Z3FA 5DQDH 3VW3L 2L0DA 4H20L 1XT5A 2AVGA 2WK2A 2YBGA 2NY7L 1DVXA 1NGXB 1QTSA 1SDDB 4LHUD 5C70A 2DLHA 3LV3A 1DBAL 4JCWA 1A1NA 2PF6A 4HLZH 1HCFX 3PWVA 4QF1A 3SGKA 3TVMA 4FGMA 4GW1B 4NP4H 2P5EB 4PFEA 3GI8H 3CU7A 5IMMB 3C5XA 5HYEA 5EU6B 4I88A 1I1RA 1GZQB 1NKRA 5A40E 3HUJA 4K3JH 3Q48A 5L88H 5C0EA 1OOAA 4O02A 4NWTL 4I5BB 4A7VA 4NRYB 1AVAA 5GRXG 4W70A 3L7EB 4Y4KB 2AEPL 4KX9A 1HOCB 2L04A 1C7SA 4IMLB 1QSEA 1JPGB 1O7VA 4N8CH 1I7TA 4DEUA 3FFCA 4HMCA 1JDDA 3I9PA 5FHBL 4RZCA 4NQVB 1URLA 1VEOA 3NSJA 3F7VB 4TVPH 2MIZA 1GKOA 2F58L 3CXFA 1AFVL 4KNUA 3ARZA 3VI4B 1JTPA 3VFUB 1WGVA 1H8LA 2Z0BA 1CJYA 3P1VA 2V4LA 3DXAA 1LWRA 1AGEA 2VDLH 1I8LA 2ZSVB 3O81A 4LSSL 4MASA 2VNCA 1NJ9B 3BGFB 1FBIH 4JAMB 4ONHA 4LCYB 2IAMD 2EKSA 5MEQB 4JK0D 3KG5A 4X99B 4ZQKA 3ZYIA 2J8UA 1UB6A 5BW7C 3B2XA 1YLBB 3C87A 5GSRA 3BPCB 5TE6H 1RZ8B 2A99A 4OM0H 1M1XB 3ULUF 2CO7A 5IHLB 1J0KA 5GRUL 3UC2A 1NGWB 4M5YL 1FNSL 2Y6TE 2XXFA 2BHZA 5EO0A 4CA4A 4LP8A 2QPFA 4PJ7A 3OXSB 3U7YL 5EHFA 3TCXA 3TNNB 3MLSL 2OK0L 3C8DA 4PLJD 3N40P 5E6IA 2ZKHL 3JTSB 3IRCA 1X3DA 4BWUA 1F8TH 1L9QA 3G5XA 2YMOA 1UA6L 1RUAH 1HCZA 3N5AA 3MV7A 1GCYA 4JPQA 4IU2B 3QCVH 3FB8A 4MRBA 1TJMA 5A6LA 1UM5H 4P2RB 2B1HL 4XO3A 3LRLA 2CU9A 3JV0A 1EJOL 2YAQA 4JY5H 4R83A 5DD1L 4DEWA 1MW2A 2BY0A 2GTZA 1ZTXL 4W9IC 2X87A 5K9OB 3PGCB 3MV01 1WVZA 1MXDA 4ZUTB 2YJQA 5AYTA 4PWKA 5CILH 1BIIA 4X8CA 1U8QB 5HYSA 3GQFA 1S9VB 2WPGA 1IT9L 1U4FA 3R8QA 5IW1A 3AQYA 5KVEH 5F9WC 4GXFA 5DHVH 3LRMA 1UB5A 5D6DA 5BRZA 1ZHBA 1T1WB 2YGQA 4X6BA 3THMH 5E00B 4KROB 1WTGT 5F89B 2XLLA 1B4RA 4AQ1A 2PCPB 5GGTL 4I1NB 5E8EA 4YFLF 2MQ3A 1E27A 3FCGA 3S4SG 1S4IA 2HG0A 3IVKB 4IRSA 1OGAE 3MV9E 3BP6B 1TVDA 4CMHB 1I3UA 3EGDA 1LE5B 3EFDH 2M83A 1E5VA 2VUOA 1ZTMA 4LCUB 5EBLB 1KJ2H 4IRZA 4D9RD 2MTAA 1QNIA 1XGYH 5C8JA 2AQNA 5K69A 3MV8A 3AXLB 4B6ZA 2EACA 2CALA 3HC3L 2X2IA 4H1LA 2BHFA 1U93B 5DQJB 5IESL 3MCKA 3K5SA 4E42A 1TCRB 3K2IA 1QHOA 3EYVB 2GITA 3HBPA 3WKMH 2B15A 3VI4F 3T71A 1NWOA 1NC2A 3AS0A 3FT2A 3BFWA 2A68D 1HKLL 1PCSA 3ABGA 1JGIA 2GUOB 4J7RA 4LEOA 5FW6A 2UUDH 5C0IB 3VGGA 1U95A 1CGWA 1MCPH 2ZP0T 4WK4B 2AS5M 2VDPB 1CFTA 4P23A 4NRXA 2IWFA 2H2PD 2FWUA 4KZ0A 4JKMA 2FHFA 2PP9A 4AMXA 2O6FA 3OKEA 3VFPA 4ACTA 2E8YA 2UYLB 5FGBA 5IQMA 7PAZA 2YLHA 3ILPB 3FQXA 3OAZK 1LP9A 1WFMA 3TBVB 3B9KD 3FN0L 4G6KH 4W9HC 5HYIA 3DPDA 2YPLD 3MRBA 2A6DB 4F7MB 1B2WH 2X1OA 3BIBX 3T3MB 3VXRB 4EZMA 1CICB 4F57H 4GOSA 1GVIA 4XXDA 3ERXA 1PEZA 3WD5H 3IBOA 4A39A 1YO4A 2F1BA 2DYPB 4EDWL 1EAPA 3WY3A 3IT8D 4XCEB 4BQCA 3P0YL 5T33H 4JQIH 5F72S 3L3IA 3MUY1 3PDDA 4UT9A 1IAMA 3B2UC 4J1UB 2PABA 3VSUA 2O72A 3IPFA 3ZTNH 1X9RA 4FFYH 5FDWA 3GSQB 4ZW5A 4AM0Q 4GKZB 4YDVB 4LP4A 5CWSB 1XL4A 5FWQA 2YD6A 5BV7C 4KGJA 4KQ4L 3HUJE 4CW1A 5DK2B 1F3DH 1Z9MA 1HNGA 3V0HA 4CUCA 1CD1B 1BFTA 3MBED 4HISA 3DVFA 1F90L 1G7HB 1YMMA 4HSQA 4OLWL 2JB5L 2ZXBA 5CJQL 3S35X 4B97A 3LMJH 5IK3B 1ZLWK 4FDWA 3GMOB 1ZDSA 5FXCH 2VLJD 1A7RL 3JV4A 4M7LT 4PEEA 1QSEE 5DWUH 4MQ7B 3FFCE 3IDIA 4FQHB 4EVNA 1KN4L 3TPUB 1BMGA 2IADB 3CN2A 5E51A 2C9PA 1AGCB 1YUHB 1MH5A 2DPKA 2IWEA 4NQDA 1EXUB 4QT5A 1FZOA 2X1PA 3FT3A 4QOKE 3UMTA 1ROWA 4JHBA 1ID5I 3D07A 3R7QA 3DXAE 5T1LA 2DQMA 3CLWA 1IAOA 4JFEB 2X9ZA 2Y5TA 1I1YA 5AOZA 4NCC1 3IMSA 5CCJA 5C0JA 1WZ1L 1QA9A 5DJAB 3SDXA 2W0FB 3DJRA 2VSKB 2WNKA 1ZT7B 4A37A 4LRIC 4WUUA 1SEQL 3EZ8A 4JEGB 3KHQA 2D8KA 2NLJA 3L4ZA 4TSAL 1C5CL 2P5ED 5L0QC 2W07B 2BDNL 4YSPA 5FYKU 3DX8B 3QQDA 1J9RA 3EYUL 4Q6YA 1VCBC 2OZ4A 4JUSA 4F8TA 4L4TB 4DZBB 4PBDA 4EI5B 4M6OH 1IM9A 4PJGB 2G75B 4Z0BH 2E7LA 2V9TA 2YD9A 4OZFA 4QXGL 3W0WB 5SWQB 3LS5H 2C3GA 4OGXH 3K46A 1S9XA 4Y4KD 3MLRH 3MV7E 4GLRH 4LKXB 4LVOC 4NQUA 4ONOA 1BQ5A 3QORB 1NZRA 1BG1A 5AOMA 4OV5A 3EYSL 3T3MF 2IDUA 4LPTA 1A7PL 1PZAA 2BNQB 3G04A 3IDMB 3CLFL 2H45A 3JQOB 2D7TH 1SVBA 5EEZA 1R1CA 2VDRH 2Y1VA 1LXMA 1G9HA 4K2UH 4KJWD 5DD6B 3T8VA 2BMKB 1Q9WA 1WSST 4V1DB 5BRZE 2VXSH 1MRCH 1P1ZA 3VXSA 3X14B 5FHAH 4F93B 4AYSA 1IKNC 1T1XA 3FU6A 1F56A 1VEPA 1UKQA 2XG5B 1BZQK 4GI8A 3MA9H 1GGIH 2O1AA 2X7LB 4MBRA 4OAWB 3VFWA 4D8PA 2YLKA 4XP9H 1IU1A 1BGXL 3L3KB 4NO0A 4ZMLA 5BS0A 4AV4A 3TT1L 3K8LA 3FFDB 4Y2DB 5SWSB 2EVGA 3C5ZA 4XXCA 2LU3A 4ODTL 4EO5A 4OGQC 2WZPD 1INQA 4KKLD 3MV8E 1FLRL 3T6VA 4OLYL 2X53A 3AAZA 1O6SA 3WHXB 4Y9FA 1LILA 2HLEB 3FT4A 3S3BB 4JRXA 3IM1A 2ZX5A 2DQDH 3KE0A 3TOPA 1HL5A 2GSIB 3MO1B 4S1QH 4M3JA 12E8L 1WWWX 5LO7A 3RL1A 3FCBA 3O6MH 1EA9C 4HOZA 5J3HC 4U0QB 4XVUC 1J7VR 2FGWL 4ONFL 5T5FH 1D5IH 1GY1A 5EC2B 3L9RA 1HZKA 1X5ZA 2XSKA 3ULAB 2CDFA 4RGMC 3IU4L 2LW3A 4U33A 4ONGH 2Q6WA 4F8LA 4M7ZC 3LNHA 5IZ7A 3CFUA 5JHMA 1JZ5A 5TH2B 4IOSD 1BVNP 2E86A 4WWKA 2A74A 5JUEL 5TQ0L 4KROD 4MJIB 2C9RA 5CJXA 4PJBA 1LP9E 4D0BA 1RJYB 1YJDC 1HIML 4Z18A 2VR9A 2WLLB 4X6EB 3CXHJ 1HHJB 4QTHB 5HHNB 2WXLA 1ORSB 2GTQA 2WY3B 3MBXL 3TXAA 3NCMA 4Z6AT 1IGJA 5JOFA 2H3NB 3MJ8A 4Q6IC 2GIXA 3HZKA 3MJ9L 3KLAA 1X7SA 4AQEB 1DLHA 1NFKA 1SXNA 1WZLA 4PJEA 1ADQL 1YEKH 5CP7B 1CI3M 4C56A 1DVFC 3K1DA 4HPYL 4WSJA 3H9SB 4NO2B 1LMIA 2I60L 4I13B 2ZX6A 3G6AA 2DWEA 5EPMA 4DWHA 1AXTL 1A6TB 3SQBA 4M00A 5A3ID 3S96B 1F4XL 2QT6A 4PG2C 1KYUA 4LPVA 2IBZY 3AQDA 4PRPB 2MHAA 2AXFA 1SBSH 3AM8A 3IGUA 2WVVA 4NCDA 4F15B 1NGYB 3VFGL 2AITA 5LWYH 1JZIA 5EZLA 3BN9C 4O51B 5DS8A 4AM0B 5IQOA 2G0KA 3HZVB 2DTMH 1KB5A 4PJXA 5MP6L 3NAAH 1RULH 1CFMA 1FF5A 3BVWA 3GUTA 5D6CB 2APFA 3VXQA 1VKXB 4Z7VB 4G3YH 1WHOA 4QO1B 4R4FH 5I15L 4AW7A 2DBLL 3B2DC 1D3CA 2EIZB 4TLSA 4C58B 1QBBA 2XWTB 4EN3B 4FRWA 2R2BB 3FQTA 4A2GA 5I75C 1CBVL 1OAZL 3OLGA 3OGCB 4AE0A 3ZQWA 1FVEB 5AL8A 4FMFA 1B0RB 2LVEA 4OFVA 4K7PL 4NQDE 5D70H 3QWZA 1N0XH 3QEUA 2GAZA 3VSTA 3ZZLA 4BFIA 1RUKH 3V7AG 3VTAA 1TMQA 3VXRD 5JQIB 1CICD 1WC7A 5HHOD 3ASOB 3UC0L 1E9OB 3FO0L 1UADC 2DYPD 3FU3A 4JREC 4UOQA 5EU7C 2IG2H 2CJ3A 5DJ0A 4R5TA 1PAMA 4J6RH 1M7IA 5FFOA 4PJ9C 4YZFE 2D0HA 5KYXB 3SE8H 3TBWB 1DQTA 4WUUE 5EF2A 4ORZC 1Z9SA 1QHQA 5TK2A 3HNSH 3ATBA 2P8MB 1EUUA 5HDQH 3MLUH 4AGNA 1CF1A 3WIFA 3UPRA 1GZPB 5FO8B 3EFFB 4WTXA 3FQ1A 1K4CA 4YDKL 5CINL 3SE3C 2I5YL 3HNTL 3N0AA 1FFPB 4FF9A 5BVPL 2C9AA 1WRFA 1SYVB 1QYGH 4XCFL 1N5AA 1L5GB 1I8MB 5IF0A 1E28B 2Y72A 5FUZL 1ZMYA 3NIDF 2GQHA 1JE6A 4QXWA 4G43B 4HKBA 4OF8A 2DS4A 2JQZA 1W8NA 2GJZA 1TCMA 2Z7WA 3ARFA 2BFGA 3BW9B 4AYBA 2G9HA 3JT2A 3BZ4B 3FSZA 3ZZSA 1NBYB 1BAWA 3H0TA 4LLWB 1ZANL 3JTTA 1MW3A 3BI9X 1FZMB 3E2HB 2FB4L 4LAQH 3T0EC 2J88H 2EDQA 1P53A 3X3FH 4JFED 1OAQL 3CZEA 1QLRA 1F11B 3MZGB 4M43L 5TQ2H 4ZTOH 1YQ2A 2NQCA 3OJMB 5DD5H 3SQRA 3VG9B 4GAFB 3MU3A 4FYRA 5TTRA 2WWOA 3L1EA 4G6AC 3NGBB 1U2CA 1KTCA 2ADJB 3OUGA 1I1AC 4LKCB 3QNYB 3D1MC 1V7NH 3X2LA 3NSCA 4L4TD 4EI5D 5AWNH 3P4NA 1NCOA 3PWNB 3QR0A 2IDTA 4XCCL 2X3CA 3AMKA 3W0WD 1B90A 4OI9A 4J28A 3B56A 4UIKH 1WA1X 4X4YB 3GHBL 3DVNB 4UTAL 3HE7A 2QSCH 1QFPA 1UUNA 4JRXE 2X38A 1AQHA 3QORD 3CWGA 3I6LD 4JHAH 2CIIB 4P04A 1RZ7H 2YD1A 3WIHA 2DQGL 3QWOB 1NM4A 4KO6A 3D2UB 5EZJA 2ICEC 2BNQD 1YVLA 4KTEH 4J23A 1ZT1B 2UY6A 4NN5C 1T4KB 1G9ML 1JCKA 1N6VA 4F20A 4GRWB 5EOCL 3QK0A 5I8KH 3P9MB 3SDDA 3RGBA 5LN8A 3DSNA 4HUWA 2JXMB 4U1SB 2OR9L 2D3JA 1ET5A 4V1DD 3GO1L 4WUKH 3U1PA 3GBDA 3RPKA 2OMTB 1G0XA 2EINB 2ALWA 3LEVH 4PJBE 4BKLA 3S5LA 1U6AH 5D1XA 2BVUA 1ZVNA 4PVMA 4G5AA 5I9QC 4MAYB 2B77A 3I3DA 5HHMB 3V4VL 3CMGA 3JWNH 1P2CA 4APQA 3SOBH 1SLXA 3N91A 4NQXA 4Y2DD 3DPBB 5SWSD 2V33A 3ET9F 4YVNA 1Z2KA 2J1YA 4P4KB 4PJEE 1P6WA 5DR5L 5IFJB 3NH7L 4OQTH 4C56E 1I8KA 5I1JH 2R69A 2P46B 1CXKA 1I7UB 3E3QE 9CGTA 3C08L 5I1HH 3ARDB 3NRQA 1MKFA 5HHVH 1P5UC 4KUZL 1EBAA 2CBOA 2ILLA 5I1EH 4PGEA 5L8LB 1AKPA 3ZKQD 3IAQA 4TQHA 3HC0A 1GC1L 1DVTA 1MCRA 4I1PA 4ZXBB 1KCKA 1G7JA 2QVIA 3HCVA 1A4JB 1P69B 3D25A 3K72B 5E23A 5FPIA 4PJXE 1CFQB 2MWCA 2EVJA 3AC0A 3SPIA 1BZ7B 1LMKA 4EDXA 4M1DL 3T6WA 4BE5A 4OF6A 5BOJA 2JLLA 4PJ5B 4YC2B 5JMOC 3F8UB 1S7XA 2WIMA 2F19L 4O9HL 2WVUA 4FQJH 2G60L 4DP4X 4RLDA 4MJID 2VH5L 3LPWA 4XPFL 1TUPA 1IGFL 3BD3A 5EU5A 5BS0B 2VYRE 5E8DL 1QSFB 3VFNB 2XWXA 3FYIB 1YDPA 3VJ6B 1FIGL 3BEVA 2VDMH 2HKHL 2XQBL 1E3XA 1WZKA 2YA0A 1KCWA 4S10A 2EZ0D 2C1PA 3BWZA 4JN1L 4XPAL 1S7QB 5DZJA 2XYBA 1JJUA 1FV1A 1IEAB 3MLWH 4QXVA 2YD2A 4G8FA 4YHLL 1J0YA 2YRLA 3H4FA 3PAYA 1FE8L 3H9SD 1MFCH 3PWUB 3HJ0A 3TA3C 3HFML 5MEPA 5B1JA 1PKQB 1N67A 43CAB 5CP3A 5DRWA 2QADB 3GTLA 1SOQA 3E38A 5IJKC 5I0ZA 4PJAB 1FNGB 5EF1A 2X6VA 4LLQB 3MCLL 1QTYT 4JPKH 4PRPD 4PJFA 5F1KC 1G1CA 3WDIA 1YUKB 3ZYJA 1ZD6A 3O11B 1KTDB 4H5SA 5GGVY 1HTYA 4HUCA 2EE0A 5DRNA 1DE4A 3UYPB 1D5ZB 4BFOA 2YARA 3I75A 4ZPVB 5KAQF 1J9CT 2FSDA 3LKQA 1XFPA 5JQ6L 1I9RH 4P49A 4WWNA 1MPAL 3BWUF 4EN3D 2B1AL 5H37A 1KIRA 2X5PA 3TJHC 2R0KL 1KFAL 4DCQA 2KI6A 3X2KA 3S8FB 5EUOA 1TQCC 5I5JA 1UD8A 2F54A 5DVLA 2XQYK 2AV1B 2Y07H 4I9WD 1ET7A 5D7SL 3ZDYF 3B9DA 4HWEL 3C6LC 4Z8FL 1HHIB 1YQVH 3ARWA 4NHUA 5JW4Q 4APXA 4KKAD 1RZIB 1UJ3C 5DMKB 1T7WA 3G9AB 4PD4K 1YEIH 1N8ZA 4XAKE 3STLB 2VABA 3IDYB 2BVPB 2Y36L 2ZUUA 3TN0C 1JHTA 1M53A 2NR6A 5CD3B 1VFAA 3O45A 2CA3A 3WE6B 1AGFA 1F6AA 3F7QA 4S1RL 7FABH 1B2YA 3EYOA 1A21A 2O5ZL 4NS0A 4H4NA 4JQXC 4DERA 2OCFD 4HP5A 4J3TA 3UZEC 3FB5A 4IBTA 4ENED 1JGDA 4M9OA 1CXIA 3TA4D 4JANA 5JHDA 3GIVA 5KOMC 2J55A 1T1YB 3FONB 1HS6A 3GSUB 4PJDE 4YWGH 2Q2EB 2PYEB 1G5AA 4XNZB 1LEKA 5IIEB 5A2KH 3MUHL 4DK5A 1TETH 5D93C 3BPLB 2VDNH 1YPZB 4DO5A 5JYLA 3WXWH 4HIHA 4N8VA 1UEYA 2HH0H 4UMSA 3MCYA 4Z7OB 4BZ2A 3O6FC 5EORH 2RGSA 2Z93A 4D2NA 3U4EA 1H15B 1LK2B 1C16A 5IVXA 4ZS7L 1RXLA 2W94A 1A9EB 2NY5C 3CN1A 3E6HB 3N85L 4PV8A 5JHAA 1JERA 3IWVA 4ODBD 5C0BB 4D0CA 4RBPH 1E90A 2BIIA 3GMQA 2ZPKL 3QIWC 5C7XL 3HNVL 4Y9BA 2WXQA 2VXUL 3K8MA 2FJFA 4QMEA 4R4NC 4ENZA 3SBRA 5D1XE 3H3PL 3L95A 3HHSA 5LNEA 1HE7A 3X13A 4EIGB 2DDQL 1KZQA 4PY8I 4Y0GA 2FEEI 4QRTA 4Z23A 3NP4A 2OFQA 2Y24A 4U49A 3QUZB 3AFLA 2DMGA 1KTLB 1NCDL 4XVSH 1OM3H 3P77A 4AW4A 3SE9H 3IXTA 3FTSA 5KEZA 3O2DA 1DCEA 3ZRFC 3TJEL 5GZNC 4I0PB 2Y7LA 2PCFB 3L3OB 2A6KA 2I24N 2OMUB 2XJKA 3MGTA 3NPZB 2X05A 3VGEA 2G5BB 2V17L 4X9HA 2XWEA 3D2UD 3QNXA 2XN1A 1AAJA 5I71C 1FNEA 2KL6A 2Z91B 5CZVL 3QJVB 4K8RH 3GRWH 4WO4B 4LFHD 1I3GL 1UXMA 3DA0A 2F53E 4LSPL 2H6PA 3KYKH 2FNBA 1FVDA 3O3EB 4MA8H 1M71B 5JA9A 3QG6A 5EULV 1HL9A 5AOKA 2G6GA 2GK0B 1KELH 2XWBA 4JFDA 3WN5A 3QXAA 2D2CC 2X4SB 1J87A 5HXMA 4M48H 2MOVA 4HFUH 4OUUB 3DX4A 1E61A 4MAYD 5HHMD 4MNGB 5LAXA 4YXLL 4B9GA 3IJHA 1OE1A 1QG3A 2VMDA 4FZEL 1OSZB 1GYVA 3MQIA 4P4KD 15C8L 2SODB 1U2HA 3H1ZA 4XNUL 4IIQC 2PMZA 5KYWA 3MRIA 1PL3A 2BW5A 2AJSL 3UO1L 3L5JA 4Z3JA 1IBBA 4PWEA 2C9VA 3ARDD 1ZV9A 4NN6B 2Y1ZA 35C8L 4R7VA 3FUKA 1IFHH 1JK8B 2DJSA 4OY9A 4PJFE 4ZXBD 4Y5XC 4GJTB 5EC1B 1LK3H 2HAZA 3QPXH 2PW2A 5G4MA 2BCKA 1OGTB 3P2BA 3QJQB 4P9HH 2BSSB 4WEMB 4RESB 3GI8L 3QZWG 3VFVB 3MNMA 3ULUH 3WDJA 1E5UI 5DA0B 5LHDA 2MKLC 4MJHA 2CO3A 3V4LA 4PJ5D 4GKLA 3W9DB 1L3NA 4IRJC 5ACLA 2QKIB 3OAZH 1HOEA 1EZVY 5ALBL 4DGIL 4KHXH 4JG9A 4YK4C 2BVQA 2PICA 1T3FA 1F3JB 3T0XA 1HINH 5BRPA 3L17A 1V7ML 5EUOE 4KDVA 3RWCA 2VR8A 3ZJAA 5BS0D 1QSFD 1KIUA 2IH3A 1HCVA 3NFNA 1F5WA 5BQDA 5DEZA 3LXAA 1R3LB 3U7AA 2DLFH 2XNAA 2KQNA 4JFYB 1UOVA 4X5LA 4QIRA 2Q8AL 4TVPL 2N0MA 3EG9A 2O30A 3KYMB 3MRKA 3GZKA 5CSZB 4AVIA 2DZEA 1AY1H 2QADD 4PREB 2RMNA 1NCAL 3WFCH 2CGRL 4Q58C 2HT2C 3QUXA 3EJQA 2X4RA 2ADIB 1S9YA 1HQ4A 2ZKYA 1DCLA 4XBMA 5JHDE 1QAWA 1FBIL 5IB5A 4YXHL 3HN3A 2GAEA 5FOBB 2BOBB 1TKWB 2YMTA 2ZOTA 4TPRH 4LMQI 5D7JC 5HDLA 1PX4A 2CPCA 4F2MA 5TE6L 5D1QB 3U0TA 4PP1D 2BSDA 1IQDB 4TL4A 4G9FA 2C9QA 1J8SA 2BJMH 2K7PA 3VSVA 3OC8A 3TIWA 5F7DA 5T3XH 6FABH 5IR1B 3BE1H 3ME0A 2YEZA 3HZYB 1CTNA 4TSBH 4WTZA 5AEAA 2CHXA 4A7QA 1JXDA 1G1OA 3AREB 3PQYA 4PJHF 4XP5H 2VW7A 2JA6A 5GZOA 3KEDA 3JYBA 2BM3A 1I85A 4HZLA 1E5ZA 2EP6A 4L1SA 3C8HA 3OKLA 4X2UA 3QCVL 4F33B 3O6KL 1MNUL 4MJJA 2NY3C 3PP4H 4WFFD 3DK0A 2VDKH 2VM9A 4M93C 1R24B 4JFPA 3DIDA 3NJFA 4XC1L 5KS9F 5E1AA 2BRRL 2K8QA 4TRPL 2R2HA 3SDCC 2LU5A 3G08B 2Q76A 1EGJH 3NCYP 5SV3A 5CCKH 2CZNA 4FL4B 3G5YA 4B0MB 5AW1B 3BWAB 2AANA 1JXGA 1IC1A 3ARSA 1W6LA 3TO4A 3SBWA 1COBA 4KVCH 5FYJD 2FE0A 5K93A 5AG9A 4MWFB 4YDJB 3ZL4L 2VRAA 1OHZA 3OKOB 2PYED 1AJ7H 1BM7A 2ZOKB 5MENA 4HBQA 3NCFB 3EFDL 1HHHA 2JB6B 3Q8BA 3Q7JA 4KI5D 4YHPB 3STZA 4DT2A 5CKGA 1AR2A 1S7RA 3D85A 1XGYL 3SKMB 1CGTA 3OAYH 1BLNB 4L0ZA 4WWID 1EWHA 4QNPE 4N6RB 5A7BA 2AFNA 3KW8A 5IEHB 1SLVA 3NIFB 5C0GB 3FCSB 5EU4B 3ZKMD 4A2EA 5ACMA 2HFEA 4UQ2B 3E6FA 5C0BD 4A04A 4Y19D 3LRHA 1A9VA 4LEXH 4KDLA 4JFDE 4B3VA 2A6IB 3UTPE 1XF2B 1PQEA 2E4FA 4DUWA 4XAWH 3U4BL 4EN2A 1BVZA 2LOEA 3KPSE 1SMOA 4A2DA 4O58L 4LCCC 1KPRB 3IFPB 3VGAC 5E6ZA 1KC5L 4X0KA 2YPKA 4QRAA 3CQZA 3SE4C 1DN2A 2CWRA 4YFLI 1N2RB 3QUZD 3HPJA 3VXPB 5K9JL 5C07B 4JN2B 3HI5H 4PJ8C 3S4SB 5D7LB 2FWOA 3S35H 5I6NA 2VJ8A 32C2B 3H9HA 1PPYA 1B2WL 2J2ZB 3PIQA 3QCUL 4N0CD 4I0PD 1BAGA 4XXWC 3UTSA 4UDUA 1X9UA 1RMFH 3GMNB 1I31A 3RY6A 1OD9A 3CE1A 5DGRA 4XMTA 5H8DA 1GIGH 2OYMA 3W1ZA 3VWKC 3D33A 4FA7B 2IDQA 4WO4D 5AZ2H 2WZ5A 4RSYA 2YZ8A 1A64A 4F3FA 4ODWA 2QR0B 4TVSa 1ONQA 4ZUWB 1OAYL 3DHJA 5KANI 4N3UA 2O61A 4BZ1H 2VDPH 2E9IA 4P5MB 4WKZB 3JWOL 2WC7A 3KYOB 4MDJB 5HI3C 3WCYA 2Q7NA 4JQIA 1Y1DA 3L3JB 1HWHB 3OPZH 1BCIA 3QUMH 4LF3B 4CVXB 3TNMB 1HJCA 3B37A 3LMJL 3GPEA 4W81A 4FFYA 2C5DC 1SZNA 3PGDB 4OJFH 3LH9A 1P6FA 4OZIF 3UYOD 5DS1A 5E2WH 4N2OA 4KUCF 4F7KA 3HU2A 3F01A 3RI5K 2XZQH 1AO7D 3TH2T 3ZDXF 1S7SA 2VM3A 4CADA 4DN3H 1AOZA 1D6EB 1U8IB 5HJBA 3FPXA 1HXMB 3FQRA 1QBML 1NKOA 3MRNB 1PNCA 2DWXA 2ZNXA 4HIEB 2QL1A 1EXGA 1RIHL 2DN7A 4YSOA 2I7OA 1J12A 2ZXAA 5FTKA 1SLWA 1ZLUK 1A3RH 3OKNA 3OKKA 3ZE0B 2IPUK 2A9ML 3PHSA 5DQ9A 5I18H 1F1AA 1MEXL 2V5MA 1E3FA 4J39A 1NFDF 4PCSA 4XMKH 5B8CA 1V55B 5H35A 3ARGB 3WKQA 1N6QH 3FW6A 2HRPH 5D71L 1EEYA 3N06B 4HXAH 1OSYA 2PWDA 3CX5J 4ATTA 1QO3A 2OSLB 3QHFH 1C5BH 3HC4H 2OTUA 3BGAA 2BSBA 4RSVA 4KHTL 1TZOA 3LS5L 4UI2A 3DV4A 1HH6B 4PRIA 4GUPB 3RGHA 1Z3RA 1B4JL 4N22A 3W2DH 4XNQA 1MUJA 3V8CA 3LKOB 4NKMB 4OZHA 1LTXA 1U42A 4HH8A 5E5MA 4ZYKA 3ZY7A 4BH7B 1OB1A 4NN7C 2WO4A 2HCZX 2WAQA 3RNKA 1YNKL 3S36X 4BWWA 1INDL 2ZSWA 1X5KA 2BINA 1S78C 3EDEA 1SHXA 4AUJA 5MI0C 1PYWB 1FNHA 2R0LL 1MIEH 2VXSL 3RYMA 5FHAL 3C75A 3SCMC 5ITFB 1KG0A 1IRAY 1SHSA 3MACL 3DJTA 4DNLA 3FT0A 2AJZA 3HN8A 4JO4H 1BW4A 3NEEA 3OJ2C 2HJFB 2K0RA 5D1QD 4NPYA 4FXKA 3X1GA 5MENE 1NANH 2WYHA 5KVEE 3AB0C 5E08L 2R7ZA 2Q2LA 4OGYH 3ZIMA 4RAVB 4ZD3H 2VLRB 1JVKA 2XZAH 4N9OB 3RGVB 1OIOA 3EOYG 3ARED 3MPCA 4ZZFA 1XIWB 5DK0B 4NQSA 1ZVSA 1O6VA 1BJ1H 3OMNB 3ULVF 5FDYA 4Z3IA 2H6UA 3SDAA 1DQKA 4BM7A 3TZVB 1VACB 2FYYA 1FYTA 5HGDB 2NOYA 2XV2A 1NMBH 1FFTB 2VQ1B 2Z7UA 3HPLA 4G7VH 1L9MA 3SKNB 3V4PA 4L3CB 2QGEA 2JE8A 1OGPA 1CIDA 4PGCB 4R2GC 3HE6C 1AS6A 3C60B 3L4WA 1A4AA 5DHEA 1TJGL 2MCG1 3RX5A 4E9XA 3BO8A 5HYJA 4R3SA 3WEXB 2QZQA 1N26A 3GBNH 3DTXA 3BRDA 4XTRC 4DZ8B 4ZDHA 3IMRA 4IKLA 3VI3A 3NCWA 1M7DA 2E27H 4P46C 3WY4A 2OYPA 1IE4A 1PEWA 1A6AA 4MCZB 3QQ9D 4HLJA 5F7UA 4EZKA 2F15A 4ODXA 1NUDA 3SKOA 2G2NA 3VXUB 4AL8L 4B9YA 3CSFA 3VXTA 1PZ2A 3UTSE 4PW4A 4W6WB 4JZJA 5D2NC 4K9EH 4P2AA 1G9NL 2VLLA 3CDZB 4ZOCA 1AHWA 1T89C 2IVFC 2AEQH 4HIXH 4NKQB 5I0XA 5FYJL 3D06A 2WKGA 4OB5L 1A2YA 4BRJA 5CLWA 4RMRA 5IWLC 4I85A 2X88A 3MNZA 4WKXA 2APTA 43C9A 4ODVH 2AXWA 4M56A 4F9LA 3T0BA 3SGEH 1OB0A 4JFFD 4M61B 3ES6A 4KPHH 2XFXA 1INEH 3AXIA 4RFOH 1T20A 5EPPA 2YGNA 3IEAA 4KAQL 4ZPTA 2V45A 5GISL 3GTJA 4L8BB 3QI9A 4HK3J 5LWYL 1TYEB 4G8EA 5DZ9A 1R17A 3B5TA 4I1RA 3ZSTA 2OP4L 5AL0A 1DBJL 3VFTA 1KY7A 3UBHA 1KBWA 4R4FL 3NN8B 1ECZA 5INDA 5B4MC 3MGOB 5E6SB 3HS9A 2BSCA 4EUPH 1G7MB 2PPEA 5E8PA 5F8RC 3IE4A 5BMFH 3MLVL 5CIPB 5F70A 1ETA1 4K94L 1YN6A 2V9UA 3FU0A 3TVMC 3SGKC 4MCMA 5C07D 1NANI 4X8JA 5D7LD 1K4DB 3KR3L 4A67A 5EU6D 3N50A 4K5LA 5ID1B 4XX5A 3IDUA 4FQCH 1RJZA 4WY7L 4F7CB 2NT1A 4Z76B 5HHQA 1AG0A 3HHMA 1CL7H 3MNWA 2IFGA 1E43A 3WNOA 1L7TL 1DHKA 3BAXA 1P4IH 3BP5B 1PZDA 3D4ZA 1QR1A 1N4XH 1U3YA 3KPQB 2OI9C 1J05B 4MYPA 1CTOA 5D9SB 5TDOA 5IOPA 1ZIAA 3HG5A 3FOLA 3IJSA 4PV1C 4BA0A 5HYFA 4ODUB 4M62H 5CU9A 2VWEC 2DWSA 4FA8A 3Q05A 2Z92A 2ESVD 4U31A 3GTGA 3P4LA 4RGOH 5IHWA 4KXAA 3MRFB 4OD2B 4G42A 4PRIE 5AW9B 5BZDA 3L7FA 2DKUA 3IGAB 1A4CA 2H0FA 1OHQA 4FTVB 4M8QA 1ZRUA 1I8LC 2H32H 3OR7B 1X5MA 4OZHE 3TV3H 1QYGL 2FSEB 4PR5B 2ENYA 5TPWH 2WB7A 5DVKA 1AANA 1HEJC 4WF7A 4E0RA 3W39B 3L3HB 2B08A 4L5FH 1UURA 3ZDWA 1RZJH 2DQIH 2ROXA 4L29A 5DC4B 3TWCH 1S7WA 4I3SL 4UQAA 5IEKA 3R4DA 1G7PB 2COVD 4J8RA 1ZS2A 2CDEB 3BP4B 1IBDA 5F9AC 3RWEA 2EVHA 2J88L 4ELKA 2DMRA 5DHYA 5I1LA 1ZA3A 2QVKA 4HIPA 3C2AH 5E6IC 5FYKH 3QJHA 5TQ2L 2OMBA 4YAQB 1NM9A 3SGEI 4E9YA 3LN4A 2ZOLB 4JDZB 5DD5L 1BF2A 2EYRB 3EO0A 3QO0A 3TH4T 1OAXH 3ARGD 3TEYA 3TP4A 4QXUL 5ICZA 2IPTH