4FG4A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with hemithiocellodextrin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
b'AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
molecule tags Cellulose-binding protein
source organism Bacillus subtilis subsp. subtilis
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg4A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg4A02
1BMWA 3FT1A 1WC2A 1HD5A 2AE0X 2GAEA 5GLXA 3X2JA 1WHOA 3D30A 2G6GA 5H4UA 3X2NA 3X2KA 1BW3A 2JNZA 2ENGA 2PI8A 3X2HA 2HCZX 2BH0A 2PNWA 5GM9A 1WHPA 4JP6A 3M3GA 4JS7A 4L48A 3SUMA 3SUJA 4JJOA 4ENGA 2G5DA 4FERA 4ZM7A 4JP7A 3X2LA 1OA9A 3X2PA 1L8FA 5GLYA 3X2OA 3ENGA 4AVRA 2VXQA 1N10A 4FG2A 3X2GA 3SULA 2PICA 3X2MA 3FT9A 1OA7A 4JCWA 3SUKA 3X2IA 4FG4A 4FFTA 2KQAA 1BW4A 3CZBA 2PJJA
chains in the Genus database with same CATH superfamily
5IVXF 4YIQA 4P46B 5CWSA 1KJ2H 4GFXA 3W9DB 3WFEL 4WHYG 5DYFA 1TQBB 5CEXA 2H26B 4N1HB 2WB7A 5AVUB 1H5NA 1OKEA 4G6AC 5IV2B 5AZEL 3LH2H 5ITBL 2NXZD 2A38A 3MRHB 1KJ3L 5FV2A 2Q2LA 2NY2C 1KCUH 3BIAX 3ARSA 3UBFA 3RWHB 2FHCA 1XGYH 2XLLA 4MKTA 1CDUA 2FWUA 4PH8A 3BAXA 4JHZA 3M1BB 1U8NA 3B4NA 4L23A 2YQBA 3N1FC 4R8WH 5DVPA 1JZ3A 2WW8A 4RMSA 3OB8A 4NKDA 4XPFL 5FA4B 1J9SA 5FTKA 1T21B 3VJ6A 2X89A 5CEYB 4PS3A 2XWRA 3QDJA 3QIWC 3BPCB 4ZYKA 5LXGH 4QXWA 4OLEA 3B2PA 3IJ8A 2AKRB 1DP0A 4PW4A 3T3PE 4O58H 4YSOA 1M6OA 1RHHA 5E9AA 1AHWA 3KHOA 2FLMA 4AQAA 1SM3L 1SYSA 1VESA 4JQIH 1N0XH 5HI5C 5B1JC 3OMZA 2H9GA 4G5ZL 1XCQA 3KVDD 4DZ8A 1A22B 4A67A 2Y72A 3US1A 2YZ8A 1Q0EA 4JY5L 5JOEA 5KZCB 4Q9QL 2HJFA 4XH2B 3U2SA 4FQJH 4HAKA 3SDXB 3RAJH 2IMMA 1R5VA 4TMPA 1M57B 5HJDA 5MEQA 4LARL 5LAXB 4PJFF 4FC3E 4CVZB 5T3ZD 4GKZA 2Z35B 4OCYH 4YHIA 3F84A 5C09E 1WFIA 1YPZB 4L3EB 5H37A 2H2PD 4ODHL 3WTSA 3O9WB 4NPKA 4OZGF 2PWFA 5CBAB 1F45A 4FFTA 1XCTA 4UUJA 5JPNC 3BKJH 1PVHA 4GBXB 4XCNB 1U8OA 2HVJB 1E4XL 1MCCA 4NYLB 3RFRA 1S7QB 4ZO8A 4Y88A 2KMWA 1KB5A 1N0XL 4R4FH 2DWDB 3MJ8B 5I73C 4WQOA 5FGSA 3TBVA 4LLWA 3IDXH 3QDAA 4XVTH 1JHLL 3S6CA 4NQDD 4KRPC 2ZWYA 1EVUA 2BP8A 4EOWL 1T3FB 3L17A 4JFQB 1G7PB 4AZ8B 4OFQA 3THML 3K2UH 3OAZH 3EXLA 1MFDL 5AOKA 1J0JA 1UACL 4P59H 1C5BH 3KNBB 1TVDA 5F9OH 3AACA 5HYSG 1BQRA 4EIZC 1I9JH 2E8ZA 2P5EE 5HDQH 2WQ8A 1YEDB 4HJIA 2EKJA 2MCPH 4ES8A 4KUCD 1AOHA 2GB2A 4X9YA 1MHPH 1S9XB 3BKJL 1D5XB 3SDDB 2YD1A 4JFDE 4DGUA 4XMZA 1A6VH 2R1XB 3SYCA 1UZ8B 2WN2A 4F33A 4HMEA 5EWIL 2E4FA 3CZGA 5K9KB 3JTBA 4JKPL 4F8PA 3D06A 2W8CA 4LCWE 4UMGA 4UQ9A 3NFPB 2WUBL 5ILTH 4EOWH 2NTSP 3BOVA 1OLLA 2LV4A 2ZAHA 3X2NA 3O11B 4S11A 1ZT1A 4AM0A 1S7TB 4P2RE 5D7IE 4ADJA 2NW2B 3LRKA 1R46A 1KDIA 2YBRA 2NPLX 3BPOB 3LXCA 2PW2B 1SOSA 2QKIB 4FTVB 5AAWC 4DOHB 1F5WA 3F7RA 4FHBD 2F0CA 4G6MH 4JDTL 1PD1A 2XXCB 2GI7A 2FEJA 5L2KE 1EVTC 3T04D 3GTNA 4UB0L 1S46A 3CAFA 3IAQA 2H1LM 2JELL 1F6FB 1EA9C 3U4BH 5H94A 1NGXA 1Z5LB 4GQZA 2NY4B 4O2FB 4OIBA 1UKQA 1I1FB 4QAWA 4GIPD 2GT9B 3T0EE 3MZGB 1V3KA 5CCGE 3BYYA 3KD4A 1C16A 5F7AA 3FQRA 2BFVH 5I1DB 1KT2B 1QW9A 1AC0A 4JQXA 2FR4B 1NDGB 3DUUA 2J1WA 5KTEL 3HZYA 5EUOA 3QSKB 4PJCF 4QHLB 5EG6C 1N8ZB 4WW1B 2OMUA 3RVVD 3T4AA 1JYNA 4HFUL 1EHLH 2O6EA 1T6VN 3TWCH 5C0FA 2AJSL 4MDJA 5E2WH 3BH9B 1YY8B 3O4OB 1MELA 1FO0H 4G6ML 5JPMA 2HB0A 3TZVA 1BVNT 5IEKB 2BH0A 5HI5D 4E41E 2JCCF 3NTCH 4WFEE 4X6FA 3LZFL 1AW8B 2EILB 3HB3B 3O4OC 3PP4L 4UQ2B 4Y1AD 1DEEB 2DWYA 1OTSD 4ANUA 1YECL 4X6EB 5D4HA 3Q05A 5DUML 1ACCA 5GIRA 2ERJC 3OX8A 5DC0A 1A9EA 1XT5A 4J8RA 3HMXA 2NZIA 3JV4A 3RE0A 3TN0A 4CSTA 4JFWA 4ZMQA 4Z3HA 4P5TB 4QHMB 1HVXA 5F97E 3T6WA 3B3IA 4AQOA 1U8CB 4U1IA 4IIZA 4K9EH 3WNNA 2IPTH 4M5YH 1CXLA 4LOVA 4DKFH 4A6YB 4YSTA 1HHGB 2N0KA 1Q72H 2UWEB 4NERA 3KJ4B 3K4DA 3SN6N 5F7BA 4YFLF 1EHKB 5KOMC 4HFUH 3MLVH 1H19A 4FQ2L 4WJKB 2EVFA 1OE3A 4WUUD 4IRJA 1H8LA 3U36B 2CHWA 4Y2NA 3ME0B 1HIML 4LSSL 2VDNB 5HHOD 4YUEL 4QHUB 4URTB 3V0WH 1FVCB 3HOGA 4DK6A 3DUSA 4TSCL 3V0GA 4CILA 3MC0A 5GS0L 1J5OH 2D7NA 5ALCH 3AS2A 4YDVA 3X17A 3EBHA 3NIFF 1MIMH 2Q7AA 5HVHB 2IDSA 3SE8H 4WKZB 3P4MA 2A73B 5DUMH 1XIWC 3CLFL 3QJTB 1GYWA 3WDJA 2RTTA 5HHPB 3BE1L 5DO2D 5IFHL 5J11C 2X09A 4DNLA 5G4OA 2XPYA 2R29L 3NCJH 3IFPB 4XN9A 3VI4E 3LX9A 2PJHB 4I77L 3VSQA 4YAQB 4LMQE 2Q8BH 3WS3B 3WTYA 5JNYA 3BZ4A 2HX7A 4WI0B 3MLVL 5F7YC 5FDWB 1Z2KA 2D31B 2YGNA 2CKNA 3LNFA 3DOHA 4PWIA 3LVTA 4ONHA 4PYGA 3X1EA 4XNMB 5ITFB 4HCIA 2JIOA 1XGQB 3QQ9C 3HAEG 4A68A 3BGFB 1JZ6A 3VG9B 1QCSA 1KTCA 3FUMA 4R4BA 3MRNB 5F0LB 1RZFH 3IGUA 3ABGA 3K8MA 4JHBA 4L4TA 3BUYB 3SKNA 4DTGL 3IMSA 1NFAA 1HEZB 1UD2A 2IAAC 4Y1AA 2OCFD 1L9PA 1CFNB 4QEGA 4E2OA 1E5BA 4PRPE 3ATBA 1N2RA 2EADA 1FJ1A 4DP1X 1DJZA 5B8CC 4YLQT 4L1TA 1UHDA 2YGPA 2D7MA 4N8PA 4APQC 2NR6A 2A9NH 4RZCB 1WBXB 3PWPA 1D5MA 4BGLA 3CIAA 1OM9A 3SYAA 2F5BH 1YEFH 5FGCB 3O6MH 5F1SA 1T7XA 3UPCA 4MQXD 1UJ3A 4ATWA 3SGJA 3P0VH 1YMHB 4LQFH 2KQNA 3DX6A 4JP7A 4KJQD 1ETZA 5IHZA 4CSZA 3NZUA 3KJ6H 3VNYA 4HIIB 1P7QD 3NABH 3IJSB 4IEFB 3CSTA 4KNTA 1E67A 4QRPE 1DLFL 3A67H 1OOWA 3ULUF 2F74B 3WS6C 1YEDA 4OJDH 5BO1H 2NLJB 1OK0A 4I0PA 2XYCA 3OHMB 4HUXB 4YEEA 1SBSH 1GKOA 2CGRL 3LNEA 3L9RB 3SDYH 4M1CC 3CFTA 1EJOH 4LLDA 4MWFB 3RX8A 2Z92B 3F5WB 2VERA 1YRKA 3BAEL 3QZWA 3RP1A 4IBZA 5EFIB 4OLUH 3JVFC 3RVWD 3EFOB 1NCAH 3TT1L 4LIQL 4NZDA 5EU7C 2AABH 2NAPA 1M7DA 5CEZE 3FPYA 4TSAL 3CV5A 3CDCA 2IPUK 3JWNE 1AQHA 2KZKA 1YLBB 1IAKB 4EN3D 1RUAL 3O6LL 5CD5C 2SODB 1IGCH 5I23A 2P8PB 4DKAA 3LIZL 1B9ZA 1JPGB 1WZ1L 1MJJB 1YC8A 3GWJA 3UEZA 4HU8A 1P7HL 5HYQA 5CEZH 1E2WA 2RA1A 4QXGH 4KKAD 2LLNA 5DJAA 4R6UA 4HSAC 5EDSA 2UZIH 4YHLL 1W0WA 4LT7A 2DQCH 5EPMA 5TDPA 4U1JA 2JFCA 4RNRA 3ARFB 2WAHA 3NJHA 3U25A 4KODA 2BRRH 4UTBA 3IGAB 4LAQL 1NCNA 3GBDA 2EKSB 2WOBA 1CE6A 3DI2B 4OF0A 1JSYA 5KYXB 3D07A 3MRBB 3QNFA 4AC4A 3TBYB 1NCIA 3ZDXE 2J57A 1MVFA 1YPZF 1ZLWK 3ORJA 5K9OB 1W16A 3CMGA 2AV1A 2QQQA 3G6DH 4NI6A 2PWGA 2F6AA 4CSSA 4UT6L 5GRZA 5ACMA 1XIWD 1CWVA 3VI3E 4AXWB 4QDGA 3HS0C 3N43F 3VWKB 5MHSE 3M17B 5FXCH 5LGHL 2G3XA 5DO2C 1NGQL 2FLRT 5LBSA 3OAZK 4Y2DA 4ZUSA 2VXVL 1O5PA 4HKJA 5J7CC 3VE0A 3RWFB 4H2CA 2YUZA 4YHLH 3HU3A 1ADQL 1GYUA 3BVUA 5E9NA 2DQDL 1IBGL 2O5YL 5CJ5A 5I16B 4TUKL 1WQVT 3DJ9A 5BVPH 1SHSA 2G9HB 5HYJD 5I17B 1MF2L 2ZXAA 1EWHA 3GEFA 4P5TA 1MRFL 3NOIA 3D39A 4LLVA 2FT8A 4XBMA 1N5YH 1DSFL 2X05A 2OL3H 5FUCC 2CALA 3HUJF 2R9HD 1DBBH 2E5EA 3ESPA 3U4KA 2P5WD 4HIQA 2B1OA 3BLBA 4NBYB 2IOOA 3MYJB 2B2XL 3O41A 3V6OC 1RIVH 3CXHK 5IP4A 2RCSL 4QWWD 2W65B 4M8RA 1CBJA 1SMAA 2XSKA 3MODH 5LGHH 1SDDB 1VF5C 4PLOB 3WG7B 3HJ0A 5C0EA 2X2YA 3HG5A 2GUYA 1C1EL 5E0QA 3WEXA 4D3CL 1MNUL 2JB6A 1ADQH 2P26A 3MCG1 2LE9A 3HMWH 4HWBA 3MTXA 4P2AA 5EZJB 4KMTH 3U7AA 4JRYA 4XCYB 4P2QD 1H3PH 1AQKH 4DP0X 1QFWL 1ZJAA 5DK0B 5C7XL 5F1KC 3UAFA 5T33L 1AS8A 4DQOH 2JV6A 5BVPL 1W8OA 4AYSA 3BYTA 3KYAA 3SGDH 4WV1A 3GMRA 1J05A 3DGGA 1GZPB 5LBSL 1FIGH 1HINH 2FBOJ 2C9UA 3D51A 3IFPA 2FT7A 3WELA 4O9HH 5EOCH 5FW6A 4MCYB 1VENA 3T3ME 1PYWA 3I6LD 2LAAA 1SUJA 1MJ7H 3R18A 2PR9A 3PJNA 2GY7B 4NKMB 2BSTB 1L3NA 3GUTA 1FFNB 4MB3A 1R5WA 4XZ4A 4KV5E 3QQDB 1JRHL 1B0RB 2VQ1B 3M7FB 3EOBA 1YNKL 2G4GA 3MOBL 4N22A 1RFDH 3GSUA 1ASPA 1TKWB 4WSJA 3VFUA 1SY6H 3LB6D 2VMFA 4ZUUB 1UM5H 4G6JL 4G7QB 5D7JC 4AGPA 2OI9C 5CUSH 3QUZC 4NRZB 1KPRA 4XCEA 1Z5YD 2B1HH 2KKQA 2OMNA 4IQHA 2B77A 4AYEC 1HWWA 1PFOA 1R24B 2CM5A 3NN8B 5AW1B 3OB0H 1DQJA 4L0YA 2YPVH 2IBZX 4DUXA 4D9QD 1J8RA 1E8XA 1H8SA 4YK4C 5EO9A 1I53A 1F8TH 4PVNA 3R1GL 5EOCL 1NGPH 3VXRA 1WWWX 4L5FL 5E8NB 4Z7UE 4R26H 5DUBB 3N6YA 3CC5B 4H5SA 4ZUWA 4K94H 1BZQK 2YHGA 2F54D 5C0AB 3BUQA 4OCRH 2ZAIA 4M8UA 4B0MM 4WWKC 3VYOA 1ZMYA 5J13C 2Y7LA 3VJ6B 2R29A 1ZS8B 1BF2A 2RBLA 3RGVD 3BSZH 1SOQA 4HQQH 4PQXA 4H8WC 4W9JC 2DEYX 5C07E 3TNNB 1GCYA 3SO3B 4P04A 4XP4L 3FTGB 2XWCA 2QSTA 4LLAA 4PJXA 1U36A 2X70B 1QSVA 3R8QA 3RVXD 3V2AR 4KOCA 1G9ML 4LLWB 2GAZB 3QQ3A 4I5BB 4ZX5A 3KLAB 3JQOB 1MH5A 3JWNG 2C4FU 4LLDB 4MWFA 1L9RA 2EYRA 1S3KL 2QGBA 5HGHA 3MLSL 4Y16D 3VFMA 1F8TL 3QNZA 2N7SA 1SF3A 4HZLA 1RZ8B 3WN5C 3DX1A 4AQZA 4DEPB 1PSKH 3CH1A 1FFOB 4G8GD 4GXUM 5DEFB 1OCRB 4OBRA 5DJ6A 2P46B 3S88L 1EJFA 4J3UA 5CINH 1KIQA 2VZTA 4ZUTA 1PLGL 1SVBA 3SKOA 1RMFL 2NYAA 2X4QB 2MTPA 3BQUC 4PMFA 5BPPA 1PLBA 1WV7T 3UIZA 2WKOA 1A4AA 2ADJB 2VN5A 1FA4A 2ZKXA 2DZEA 1CYXA 5GS0C 1WISA 2VLLA 4GS7C 3GM0A 4F24A 2N01B 4O2EB 2X41A 4P4KD 3MMEB 1BWWA 4HPYH 4P5TD 1JV2B 4L8SC 3T1FA 2YAPA 1UWGL 4JRYD 3QNYB 3FQNA 2VPWA 5ALBL 2WLMA 4EI0A 4CADA 5I73B 5I26A 5IMOA 1S9WB 3LQZA 2EZ0C 4MXQC 3WJLC 3MLTA 3DO7A 4XPHL 5IF0A 4EQ2A 2VLRE 1GS6X 1P5VA 3P73A 4RMVA 2FQEA 1CPUA 1LILA 4GAJL 4AZ8A 1ZVHA 4JRXA 4JQIA 1JVOA 4OB5L 3EH3B 5KSBF 1CFQB 1PSKL 5KSBA 1PG7W 3C5JB 4N6RA 3WJJC 2J1YA 4HF5L 1MCNA 3DK0A 5JHDD 2Z31B 3T65B 1YEGL 4XAKD 4UV7L 2I25N 3S3CB 2ZKMX 4GSQA 5CM1A 2H2PC 4N0CD 1T6WA 1A7RL 4QRBA 3U4EB 1JWSA 5E95B 1Y1UA 3S7GA 3SPIA 3QH3A 5KYUB 1G6RL 3PXLA 5IREA 4IJTA 4LGPB 5K9KA 4LGSB 1U8KA 3B7YA 1JDDA 1NLDH 2B0SL 3D2UB 1NC2D 4ISVB 5KG9B 1XMWA 4CVWA 4ZMOA 3O2WH 5KJRL 4PGJA 3IMBA 4P4RB 4BJLA 4QTHA 1HSAB 4AIXA 4WTZA 1FLRL 2CJSA 1KXTB 5DDHA 1K6QH 4X6DF 5DD5L 4B41A 3WKMH 3BIBX 2Q0ZX 5M7QA 2NYKA 2VDMB 3CN0A 5I6OA 1BOYA 4LVHC 4YBHA 5JUEL 4OZHB 3V95A 5BV7H 5J89A 2W92A 5EZOH 1FFQA 4WFFD 4XTRC 4LMQI 4YXKH 3MYJA 4QRRD 3WY2A 3VW3H 3EYUH 2GAEA 4Y4FA 2XIBA 1HYSC 2X4UA 5CSBA 3ZDYB 1FNGB 1MCDA 2V5RA 4FD0A 5H4YA 4ALAC 2B20A 1NFIA 4GIAA 2ATAA 4PJCA 2C3HA 2I5YL 1OSYA 3I6GB 4ZS7L 2CDGA 4R4NC 1MOEA 2WNGA 5FYJH 2OTUB 3CH8A 3FB7A 3HMXL 4OLZL 2XPZA 2QSCL 2CE6A 4G9FB 1FGVL 1PLAA 4QOKE 1OSEA 4Z7QB 4HOMA 3HZYB 5HD8D 2UWEA 1QTYT 2WP3O 3RILA 4F2ME 4Z7OE 4JJ5A 1KIUB 4OFPA 1V7MH 4KGJA 3CN1A 1OD7A 3X3FH 5DEJA 1WUNT 4K5PA 2Z35A 3QEGH 4QYAA 3P30H 4AEHL 4YSSA 1WZKA 4GT7A 4OZHF 4G43B 1U41A 1QR4A 1UT2A 4PJ8B 1A3RL 5T1JA 4PLKD 3ETSA 3TURA 2CJUL 1XGRA 3F00A 1E4KA 3KPSE 5AVQB 4GRLC 1YHPA 3DTXA 3BP5A 1GGIL 5AW2B 5FKAA 4XAKE 4BZ2L 1RURH 2P5ED 1JYXA 1Y18A 1GL4B 4H26A 2PWHA 1HSBA 4YL9A 2JIQA 3DWTA 4YMPA 2CW0D 3OAYK 2JE8A 5KW9L 4C57C 2VDLB 1JDCA 1T89C 1DJHA 4AQ1B 2OMTA 4ZXBC 1NMAL 1TO4A 3L5WA 5FGBA 5GSVA 4RESB 3CVDA 4KTEL 2KI8A 2E3VA 4U4IA 2KBGA 4NQDE 4NSKB 2VR6A 1CI5A 3PGFL 1V27A 2XZQH 2YUVA 3C60B 4AIZA 4WENB 5KBKA 2W0KA 3RL2A 3C5ZA 1T04B 2O6PA 3AADB 2XN9A 2NY7L 2C34A 5GGTH 5H37G 1WS8A 4LCIL 3GM8A 1CXIA 2E46A 4NJ9H 3K4ZA 3D3VE 2DMRA 1PCXA 1JZDC 4XNBA 3CSYB 1RK0A 5I1HH 4LBEA 5D1QD 3EJYC 4OGXL 5BZZA 1ODUA 4J3OG 2JNZA 1EXUA 1RZ7H 3UTSA 1MCWW 2WO3B 3MJ9A 2CKBB 2VZSA 3GBLA 5GS1B 2YMXH 3ZU8A 4R7NB 5GZND 4BCYA 3SD2A 4O5LL 4JY6A 4RZCA 5HGAA 3JXAA 3PWPB 1LWHA 4JM2A 5EC1B 3VYNA 3TESA 3ZIMA 3QUKA 3VFSA 3DJSA 3RAJL 2GAZA 3QQ3B 4I5BA 1IGMH 5LNGA 3SDAA 3O11A 4LKXA 5B1AB 3NIDB 1A6PA 2GBAA 2R4RH 3ASNB 3TCTA 1P4IL 2ZTBA 1ZT4B 4OW6A 1NGWB 3HZMB 3OLGA 5IB3A 3U6RB 3ULUL 1HI6B 2YD6A 1NCBH 1EUUA 1AIFB 3M8OH 3W2DH 1N5AA 4A2EA 5CKGA 1XGQA 2DWSA 2J8OA 3VWJA 4U6XA 4XB7A 2J2ZB 1CLCA 3QUHA 3W9EA 2C1OA 3DURB 4NNYB 4ANVA 4LPTA 4HC1L 4I0PB 3BDYL 2AQSA 5JYMA 4GFTB 2OAAA 4Z3TA 1AR1B 1KFAL 4FI6A 2BDNH 5I5IA 5D71L 1JF1A 4XT1C 3K8LA 5H2BB 4N5ED 3ECQA 4ERSL 3FOLB 3K91A 5IY5B 2DQIL 2YEVB 3PL6B 1Z66A 3L81A 4HCGA 4UM9A 1WBXA 3SGEH 3GMPB 3O3BA 2ZWNA 3S2AA 2YA2A 1BIIB 2H3NA 3BHBB 3L45A 5BS0B 1R3KB 4IS6A 1UXWB 3QDHA 4XNUL 5C6TL 1K4DA 3P73B 2QPSA 5B39A 1A02N 2Q5BA 1EAQA 4FLSA 1H8OA 2QHRH 2SEBA 3ULUH 3BDBA 4JR9L 4FA7B 2ZNWA 4R2GD 5FGBC 5JIIA 3SQBA 3D48R 5AD0B 2OJEB 4X7DC 4JMXA 2CCLA 2CK2A 3BZ5A 1IBYA 5FYJU 3A6CL 3IS0X 1AGCA 1DFBL 1ZT7B 4U1NB 1E30A 3AWEA 1II4E 4KZEH 1QUNA 1WZLA 2IEPA 4ZXBA 2QKSA 2VXQL 4Y2OB 2YPLD 4O02A 2O5ZL 5TDPB 5LLIC 5JO5B 1B2WL 3O0RL 4HGWB 2XKNA 2G60L 1WCQA 3S97C 1QYGL 2PYFB 4X9IA 5EFIA 2GEEA 5HI3D 5HHNB 2YGQA 3HJEA 5DWPA 5ICYA 3ARTA 3B3IB 2XXGA 2VDQH 1UYWH 2V0AA 4I87A 3WL9B 5DFAA 1MW3A 1Q1PA 4YQXH 4TLTA 1A6TB 2J43A 1HHGA 4LSTH 2LGNA 4PJEB 2AFNA 4QXVA 1I9RL 1F1DA 4GRWE 4HISA 1IAKA 4JR9H 5CJQL 3JWOL 2VE6A 2YD0A 1DQVA 1AD9B 1J1XL 3ARGC 4UB0H 2P3YA 2Y2WA 2XKUA 4E42B 1RY7B 3QJHA 1UWEL 1NBZB 5F3HB 1FZMB 4H2AA 4FNPA 3I6LE 4TLKA 4NNXB 2XZZA 4HLZH 4OLWL 3J27A 3QS2A 2Z7UA 4B9YA 3MV8B 4I9XA 4R96B 4ZXBD 1CDBA 4PWHA 1I1AA 3D09A 5DU7A 4OV5A 2RR3A 4BQ9A 4IK6A 3MRHA 1A6AA 1YC7A 2HT4C 2WINA 3DPBA 3LSOA 4XO4A 2YEZA 1CUOA 1F58H 1BD2A 1YEKH 2OMZA 4IKIA 4NM8L 4NZUH 3ZGHA 1TJHH 1WFJA 3D39B 4R2GC 4X6BA 2ITFA 4PLNC 3SGDI 4LSTL 4OKVA 1W0VB 1YUHA 3TWCL 2FWOB 3GMQA 2MQCA 2JF1A 4KI5D 5T1LD 4FQ1H 5K59E 1TTAA 5FYLL 2A6IB 2Q6WB 3SCMD 3NP3A 4GA6A 1NCCL 1ES0B 1XMEB 1OF2A 4R0LB 4ZFOB 3GBNH 1P0SE 2VJ0A 3INUL 5TGBA 4ETYA 1U8QB 4OIAA 1TDQA 2OP4H 5IQNA 4KK9C 3IAPA 1Z7JA 4R4BB 3QR0A 3TWYA 1D6VL 2VWEE 3IDGA 4HOZA 1KLFA 1KTRL 5D1ZC 3TA3C 4MB5A 3R8BB 4JB9H 4FMVA 5DZAA 1JWMB 3MVSA 1G7LA 4G9FE 4JFPB 3RJDA 3ZY7A 4MBRA 3QUMB 3R7RA 1GYAA 2ADIB 1JOIA 2VLKB 4I0CC 4NN7B 5EMYA 5D7LB 2JTYA 4WV1B 5I76A 4PJIE 2CO6B 3HC0A 4PJAA 4C54A 1QWNA 2HWZL 5CZRA 1XH1A 1LQSR 5JQ6H 4C55A 5D7JB 3KCPB 1AKJB 3MJ9H 4ZOCA 2DRUA 1A7OH 5BQDA 5L4MA 2VWEC 3RY6C 3QRGH 4HD5A 1N12A 1JI2A 5D2NB 5ALCL 1G7QB 4GQRA 3MBWA 5EEZA 5D5MF 2XN9B 2IV9A 1OGAE 1S7VB 5KBNC 3QIUB 5E9DD 1EFXD 5GSRA 4DK3A 4F7KA 2FJHB 2F74A 2JI1A 1Z3GH 3V5HA 2ZF9A 4KDTA 4RAUB 1NPJA 4EI5B 2OQJB 1PZ5B 2XFGB 1L9QA 2Q3ZA 2VOTA 4M1CD 2E0PA 4J3BA 4MCZA 1E5CA 2ODHA 3IYLW 4XC1L 4FFZH 2BP8B 2OMBA 2EE3A 3NDYE 1BQLL 3UL4A 3HZKB 3D25A 1I8KA 4I77H 3U9UB 5JXEA 1EANA 3BP6B 3DSFL 4AT6B 3ZDZB 1J05B 3EKCA 3TJHD 5KSAD 4LP5A 4BZ1H 2PP9A 4FXLA 5LQBL 2XV2A 3QUKB 3NCEB 4NT6A 2D7TL 2K4AA 4PJFE 3TIDB 1WG3A 3BP4B 4JDZA 4JFDA 1DUZB 5DVLA 4KTDH 1C5DB 5BW7A 1FPTL 3X2MA 4RDQG 3KPOB 4K71C 3O4LD 1TSRA 3MNZA 5I66A 4CRZA 2L7EA 1KDJA 4JGUA 2ZUTA 3DYMA 2AQ1A 4GSDH 1IM3D 4JZNB 2X1XR 2R1XA 5DJ8B 2XJLA 2C3WA 4FP8H 1XBDA 1OE2A 3L1GA 4BFIB 4N2GA 5E6IA 3C09B 3H9SB 2DOCA 2L3BA 4OIIL 1QDNA 2X87A 3C8HA 4V1DB 4ZM7A 1Q9KA 5FECB 2DJ4A 1AIZA 4X80H 3T2OA 2R7EB 3B9AA 3D85D 3RGVB 4GG8A 3CQQA 3NEOA 3ZQ9A 2QQKL 1KCRH 3LS5H 4QPEA 3NJKA 1IZJA 5LQBH 2FATL 1M42A 3ARGD 1I1YA 3F7PC 3KXFD 1TPXC 1UM4H 2ZG3A 4N3TA 5D7HA 4XNDA 1UXWA 3TP4A 4WU5B 3JTSB 4EQ3A 3S4SA 3BH8A 2BOCA 4PRAB 3SOBH 2WWMC 4NQTA 4M48H 1P4LA 2EDHA 2MTAA 4RRPG 2GHZA 2Q7YA 1ZA3A 3FONB 4JO3L 5LO7A 4LPVA 4XP1H 2D3NA 4NKOB 5EBWB 4FNTA 3HE6C 4R84A 4Q89A 4BE5A 4ZAKC 1QUPA 3DX0A 1PPYA 2QL1A 1CXEA 1TR7A 4MS8D 3W57A 4K7PL 4E41A 3IJYA 3GI9H 2X70A 3HG1D 3TEYA 1C16B 4I2XA 1JN6B 2UZPA 4WU7A 4Q6YA 2QFPA 1ZT7A 2RQ8A 3P40A 4OIIH 4U1NA 3DIFA 2BP0B 4UI2A 4UQAA 4FEMA 3KR3L 3UTOA 1LDSA 4YSDA 5IF0B 5BOPA 5HP5A 1RJZB 1XDTT 4WEEA 3BIKA 2CGZA 5DFWH 4I3SL 3LKOB 4KAQL 4Z7VB 4NN5B 1ZE3H 4HC1A 4CMHB 3T2QA 1FORL 2NCEA 3Q9PA 3BZFB 3IBOA 1T20A 2Y36H 3F12B 3L7EB 3C5JA 2Y69B 4MVBD 4PP1C 4YNYB 1S7XA 5KYYA 2EO9A 3ELQA 1BMGA 4BGDA 5IJBC 1JK9A 5T1DL 5I1JL 1NDMB 1OAQL 2X4QA 4P2OB 3AG1B 4OD1H 1T2XA 3GIVA 3KPQB 3VD2A 1JBJA 2QADC 5JW5A 1GR7A 1G8KA 4EPSA 4JPIB 1XSOA 1GIGL 1AXTL 1HH6A 1RKRA 3BWSA 3P1VA 4ACPA 1NMBL 5AB9A 3VXUD 1SJMA 4L8SB 5DQ9A 3O6FB 4PV9B 4X4YB 2UZXB 1D2PA 4F9PC 3TC9A 5K1NA 2IOIA 3T71A 5HTSA 5F7WC 4JFZL 5J9PA 2DLHA 4MQTB 1A4JA 3RVTC 2OX5A 2XWEA 2IH1B 4UBDD 1MEXL 1YEJH 4I3SH 4WEMB 1PKOA 4NFDA 3TEUA 3LTVA 4OCWL 3VXOB 3RWIA 3OJ2C 1MFEH 3DV6A 3MROB 2XQBL 4KDTC 4U3SB 3VFTA 1WFMA 4UINH 2DPKA 4MNQB 4MTMA 3O3EA 3BVWA 4MAYD 1JMXA 5E6IC 4GW1A 1KTBA 1UEMA 3PUCA 5I0YA 1ZV2A 1NGQH 2Y3AA 5JOPD 1OSPH 3CDZA 1OW0A 2VDKB 1BLIA 4S1DC 2APXA 1JZJA 2H32H 3GTMA 2VDML 5B7MA 4JZJC 1FFNA 1NMBH 2DLFL 4G5AA 4YX2H 4DGVH 1KXVC 4WUUE 2CHZA 5D9SB 3O6FD 4MSWA 4BH7B 2OCCB 2ZXBA 4KI1A 2K7QA 3WFEH 2UWEF 5TDNA 1AZBA 5C08E 1QSEA 3W56A 4GQQA 4JG9A 3D3VD 3K5RA 2NXYB 2X40A 4L8DB 5I1AA 4XCFL 2WLLB 1MEXH 1YEJL 2Y22A 4NRZA 4PP1D 3E8UL 4KTGA 3EFDL 3QFJE 4G8IB 4ZTOH 4L2YA 2YLKA 1TTUA 1E2ZA 3GMOB 4PRHB 4WGVB 1MWAH 3BO8A 3OVUB 2BJMH 3EF4A 2OXGB 3ZN6A 2XQBH 3E7JA 4L18A 3QUZA 3SJVE 3BUBA 2WVTA 4DUVA 5IR1A 4DUWA 1QNZL 1Q0YH 2XRAH 3LNGA 4LSDA 1EMTL 5DYGA 5D6DC 1RERA 3QIBA 4LNRB 3DO4A 3FCSB 4H0LC 4P5SA 4R0LC 4TVPL 4WTXA 4Y16A 4ZPVB 1BVLB 5FM8A 5I6LA 2VLJE 3TTYA 5E8OA 1MPAL 3LKNB 4ZSOA 5I74B 2JQMA 1QBAA 3GSRB 5A3ID 5AVXB 3SDXE 2JH2A 3FHAA 4RQQB 4DGVL 2FUTA 4O58L 3JTTB 2XWJA 5B39G 1TVHB 5GGSY 2ROYA 3DTDA 2DM7A 2LFEA 5C07D 3FT0A 4MNHB 1OA9A 1TEGA 1FG2B 5E5LA 3MGOA 3UZQB 2C4XA 2BHYA 2XT1B 3V6FA 1BFVL 3WFHB 2NYYD 1ZTXH 5F1IA 5AW4B 1OZUA 2EJ1A 3TH2T 4JY5H 3EDJA 5EU6D 4X4XB 5GGRY 2HTKD 2WUCH 3ZL4H 1WIOA 4O2CA 1PLCA 2PR4L 1ZIBA 4XZUB 5LG1A 4K5NA 3T1WA 1CC3A 2DQUL 3ARGB 4FJ6A 1CGSH 1E9OA 5MERB 4TVPH 3G6AA 4M7ZB 2VLME 1INQA 1OWWA 1TQVA 4AZDA 1MPAH 3JWNH 4GW4A 1C7TA 3FRPB 2E7LA 4HS3B 4FXKB 2VUOA 4OJEH 3FU6A 1E5ZA 1RUKL 3U1SL 4AH2B 1DBJH 1T4KA 3QDME 1G7JB 4N2KA 4Y5YC 2HPTA 5B8CA 1HWHB 4A2DA 2DS4A 4Z7UB 2GIMA 4QXUH 2EINB 1GC1H 2EECA 2M26A 2ZCZA 3FU7B 5GGRB 1NZRA 3SDDC 2VC2L 4Q97A 2VXUH 1DQQB 5KVFH 4HLZG 3MLTB 4YWGL 2A9MH 4P9HH 5KYWB 2GJ6B 2Z1KA 1AMYA 5E03A 3Q43A 5GSVB 5F71A 3R1GH 4AENB 3FQXB 2AS5M 4U6YA 3SGJC 2VR5A 1PG7X 4GG8B 3QUMH 2ZOUA 1OV8A 1KZYA 3C60A 3T0VA 1IGTA 3IPFA 5DS8B 5ECGA 2A4EA 3ENGA 1CFTB 2DQUH 4HIJB 4OZIF 2VR4A 3FSVA 4OCRL 2VCOA 1ZHKB 3DX4A 4Y7MA 1RZJL 4PRDB 5EUOF 1VFUA 4B9FA 4K7FA 2XWZA 1BZEA 4KO6A 3HA0A 1JZEA 4XMVA 5F89B 2IMNA 2IGFL 4JFEE 3TFBA 1QFOA 1XWVA 2L7UA 3H0GA 2DYSB 4P23D 4XP4H 3L2LA 4PV8A 5HHMD 1SXBA 3C08H 1DSYA 4NZRH 2K6ZA 2FYYB 4Z7IA 3TXAA 3L1OH 3QIWB 3BFOA 4QXUL 2FZ3A 3HG2A 4KQ3L 3TA3A 1SJHA 1ZDSA 4BQ8A 5ISZE 1OGPA 3FQTB 1G7MA 3IFLL 4A7UA 2J71A 5MENA 5C0GA 5JLZA 1JN6A 4YWGH 1MFBL 4XVJL 2MPAH 1V3JA 3M07A 4ZFFB 1F97A 1I7ZB 1L7TL 4L8BA 3KPMA 2YUWA 2YK1H 5CAYB 1A1OB 1OTSC 3N1MC 4TNWF 3BIKB 1RZPA 1IVTA 2R8SH 1LP9E 3NAAL 5FYKL 2B9AA 4RSVA 5D93C 1F4YL 1KJMA 4S2SB 4U3CA 4L5FE 4M61A 1BBJB 2I32A 1NBYA 2VLKD 2BFGA 1BHGA 1O6TA 5JIMA 4PVBA 4R97B 1UB5B 2YSSB 3DURA 5IROC 2ZAGA 3VE0B 1EHNA 4UTAA 2PYEB 3WFDL 2YPKB 4GKOA 3C08L 1TCMA 4L37B 4NS0A 1QUNB 4XNQB 1OAKL 2VC2B 4D9RE 1MCSA 4N90D 1SFDA 1YMME 4HJ0D 4KH9A 5L9DH 3K4AA 1V05A 2F8IA 1VKXA 5J6HA 4UTAH 1IEAA 4Q6IA 5IUCA 4H13C 2UZXA 1SYVA 4WFHD 2WO4A 3WY1A 4XPAH 2K0RA 4XR8C 1WFTA 2FAUA 1SMYD 3BUIA 4XN7A 5D1ZB 3RDTA 3UTQB 3BCDA 4N2EA 2V17H 3SZKC 1XAUA 1HHJB 2FBJH 4G71B 1SPDA 4JJ5B 3DDGA 4MA7H 4YSPA 1L9SA 3QCVH 2XU9A 4TULL 3KPRD 5DEGA 4PS7A 4AJWA 5B38A 3APNA 4PU2A 3VXQB 2RD0A 3R7QA 2AMUA 4JRYE 1A7RH 3GXMA 1CF1A 1HAUA 2AW2A 5EN2B 4FABL 1TG8A 3RFZA 1NBZA 4PJAE 4ZMAT 3J7HA 1A7PL 1VACA 4XCYA 3LN4A 3QG6B 1NLDL 2B0SH 2ZOLB 1TQBC 4WHDA 1XF3A 3QHTC 3C87A 4EN3C 3L5XH 4Q9RL 2ZUVA 1KQGA 3C5ZC 3EGXA 4IHOA 3T4YB 3RTQC 5CFAA 4JHAH 4HAFA 3TVMB 5EO0A 2IPTL 1QHOA 3X11A 1UH2A 3TEZA 2XWBB 4AQ1A 5E99L 2M83A 4U1SA 1AO7D 4PGDB 2Q86B 1L0XA 4YE4H 5FLVA 4KNSA 2UXVA 4GI9A 1EPFA 5BXFA 3I2CH 3I6KA 3L4XA 3MV7A 1IFHL 5IQOA 2NNAB 2PABA 1RJYA 4MYPA 5T5FA 1U4FA 1WLFA 3TM7B 2J6EH 2EC8A 1RUQL 1S7WB 1D5ZA 4RGMC 4IMKA 3VFUB 5AG8A 3DMMD 3J8F7 2JLPA 32C2B 3QS3A 5CJ8A 1OSZB 2DBJA 1ZIAA 2VDRH 2AEIT 5IQLA 1G7LB 3W1ZA 2XFXA 1YDPB 4I18B 4PY8I 3ZGIA 1IC5L 2XTJB 5DHYA 1FGVH 4CJ0A 3OM3B 4JHAL 4LBAA 4PD4J 3HVDA 2HJKB 3AJ7A 1P2CB 5ANMA 1MHEB 4WWPA 1BOGB 4R2GB 1DVFB 5H4ZA 1JIBA 2AXWA 2NY6D 4KVCL 1V7NH 1KBGH 1UZ6E 1ZRUA 3BEVA 3QEGL 2CR0A 4AEHH 4E9XA 2DYPB 2CLVA 4PJ5B 3QWZA 2WBWB 4IW4C 3ZJAA 3NJNA 4NOBA 3QI9C 3VFPB 3SDAC 4X6CB 2PO6A 2YAOA 1AZNA 3GSNB 4OZFG 3TO4D 5T3XL 3EADA 3VXNB 4EJ1C 1CBVL 5MEND 2NVYA 4H25A 4LDOB 1S7VA 2DEXX 3HN3A 3VXTB 1HDMA 3W9EB 1GGIH 1CLZL 3SEPA 2Q8AL 3JT0A 4WZ9A 2W91A 3RDTC 5L0QB 4N2HA 3FB5B 5EIIB 2GHWB 5FGCE 1PY4A 3STZB 4N2DA 5ACZA 4AUYA 1M4KA 2GTZB 3K80A 4BXSV 1U3HB 2AJUL 2GG1A 4UNUA 1JGEB 3TBSA 3G08A 4QRAA 5EBMB 4Y5VB 1HTYA 2CRZA 1AOZA 4HIEB 2H3NB 3BHBA 2J8HA 1FFOA 2F5BL 1MCOH 4Y8AA 5DK3A 1YEFL 4RLDA 5J1AA 3WNKA 3TIDA 4G8GA 1AI1H 1QSEE 2JKJA 2JQZA 3E3QE 4GRWF 3CVBA 1DO5A 2HYMA 3HUJB 2NY7H 4Q6IC 4AY0A 2DTML 2VM4A 1X9UA 4KY2A 1HN1A 3C6LB 4MJ5A 1H6UA 1GW0A 1IEBA 1GAFH 1O6SA 5E7FA 5CBEB 25C8H 1SN0A 3D18B 1XB3A 2JIXB 3MR9B 5E6ZA 3ZTNL 2CJ3A 4DGIL 1OZTG 1EZLA 2BM3A 2YGVA 5E2VL 4EKJA 4F3FB 4BH8A 4X5WA 4N25A 1QBBA 1K5WA 2COQA 4Z77A 2X6CA 2B63A 4LCUA 4JE4B 3FQNB 4J39A 1KGIA 1EHXA 1PX3A 3NYKA 4RAUA 1URIA 3SB3A 4MDRA 1U8IA 4AQEA 4DW2L 5I71B 2AVFA 5DJXB 1LO0L 2C9QA 4V1DA 2F8OA 3DJZA 4GRLB 2G4EA 3B9KD 2ZX9A 2A6HD 3IMUA 3WJJA 4LEOB 2M8XA 2ZUXA 1EDQA 4JRXB 3N43B 1VA9A 3SKMB 1ZK5A 2W9EH 4P57B 1ID2A 2F7QA 2IAMD 1RQ5A 4BWTA 1YEHL 3AM8A 4NC2B 3VFVB 1KJ2B 1MCOL 5T3XE 3QA3A 4DZBB 4DO6A 2FNBA 3EIFA 2ZE0A 3FFCD 3ZDWA 3WY4A 3S3JA 3MLWH 3JTSA 5CMAA 2QV2A 3FUIA 1OB1A 2JKIS 4PJAF 2F53A 4I3RH 1QA9A 4PGCB 2DIEA 4LNVA 3RDTD 5L2KA 1E6OH 1BZ9B 4X99A 1I9IL 2WANA 2LABA 4EUPG 4F5CA 5KZCD 4NDMB 1MY5A 1UQSB 1U58A 1KFAH 1URLA 2WWKT 3E3QC 2WZ6A 4BFIA 4EN2A 5E6IB 2DM4A 5BV7B 4F2FA 2ZCKH 5MHSD 5HXMA 3B2VH 2DQIH 1LD9A 3ULVD 1OQOA 4L37A 1DJSA 1KXVA 4WFED 3LPFA 2L0DA 3KYMB 1IL1B 1HHKB 1X5AA 2ZKYA 3CFMA 3QEQD 2ICES 2J1XA 4NHUB 4YOKA 1NEUA 3D1MC 4LAQH 2R7ZA 1UM6H 2DI8A 5GXBB 4U1HA 1EAPA 4LHUD 5MENE 3FT3B 1GZQA 4RAVB 3DIVA 5D96C 4K9JA 5I8OH 1IBHA 1GGTA 3F12A 3FQ1A 5JOFA 1AO7B 5DD6B 1W0VA 1YUHB 2IPUG 3WUWA 5I30L 2RFXA 1A14H 5IKCB 1BPVA 3BN9C 3EOTL 5JW4R 2Z4QB 5IJDC 2D7PA 1TMOA 1E6OL 1J9QA 4PB9L 3QJXA 2EDYA 4FGMA 2IJ0C 4G1EA 5HGBB 1EGJA 3KPSB 5AVWB 4B6ZA 4IBYA 2VXVH 3CHQA 1T5KA 4NUMA 1NUGA 3TA3D 4BXVA 3TCLB 2NY5L 1AA6A 2ZOWA 4KKCD 3U6XA 2BP0A 4D9LH 1PW3A 5L8KB 4GQPH 1KNOB 2BP5M 4YDZA 3VU1A 2EC9T 3NQIA 2A5UA 2VO8A 5DWUH 4HH9A 1QVOA 3S0PA 4Q58C 4Q8BA 4XE0A 1SFOA 4NN5C 2ZXDA 2FD6H 2Z3FA 1CU4H 2YZ1A 3RWHA 2GC7C 3RA7H 1PFCA 4U49A 3TO4C 3O3EB 4Y5VC 2QPUA 4NO5B 3X13B 4YC2B 2VISB 3MBEB 3NRFA 4ODXA 5D7JA 15C8H 1CFMA 3KS0J 1RZJC 3GS0A 4U7SA 5I82A 1Y6NR 3KWTA 3OPZL 5ESQA 1D9KC 5E8DH 1NIEA 1LNUA 1MREL 1A0QL 3JWDL 1C1EH 5DRNB 4BH7A 5DT1L 3GHEH 5E4IA 1N64H 3MX0A 3UOAB 1M2VA 2OKMA 2ED7A 1SFHA 2HTLD 1YNTB 2DH3A 1IKFH 1KLGA 2R2HB 1AQKL 2ZF8A 2ICEA 3MNVA 4MCZB 4GUPB 3TBCA 4CW1A 1F1AA 5ADPH 3GJEB 5E8PB 1G1OA 4ZFZA 3RGVC 2YWZA 1AAJA 3QJOA 5I1LB 3HR5B 1M71A 5CIPH 2YMOA 5DD3H 3OAUH 3QUZB 5F7UA 4XP6L 1NCCH 1CT8B 2EYTB 5CSGA 4BCXA 3LIUA 2GSGA 3N04A 4TVSa 4RWYL 5F6HJ 3EG9B 4JFDB 1KB5H 1ASQA 1NGZA 4ZFGH 4PRHE 3QWRD 2E47A 2CO3A 3OPZH 1JZIA 3QPXH 4N0RA 3CSYA 3FF7A 2ZCHL 1NFDB 4FKKA 1MREH 3RURA 2IQ9H 4Y16C 2ZP9A 1DVFD 2AKRA 3ABZA 3FZUD 2ADGA 1KYFA 2IIJA 5DRWA 2CNYA 3QULB 4EUPH 1TQWA 5EB9A 4R7VA 1ZWIB 1YEEL 4P4KB 5IG7B 4FJYA 3G6JB 4YFLI 2NUTA 2BVYA 3TFKC 4X5PA 1E4WH 2R69H 4MNHA 5CN1A 4HKZB 4OZFA 4JAMA 4KV5F 1GGCH 3ZKXB 5IW6B 1RIUL 3ESNA 5EIIA 3BVNB 1F3RB 2HG5A 3MV9E 4ABWA 4LEXH 1T0PB 2L8AA 1UXSB 3MLUL 5I0VA 4NUJA 3V0AC 4GAAA 2HWZH 3KPRE 4U0QB 4TVPD 5GISH 3AXHA 1N68A 1NGWA 3HZMA 3IRZA 1WITA 2QQNL 1ZJBA 4AMKL 5IR1B 4YDLC 4F7PB 5FPIA 1ONQA 4HIEA 2GSIA 1S5IL 1R27A 4PJ8D 4NJAL 4XXDA 3RPKA 2XQYG 5H35B 5G55A 1SVCP 1R19A 2KYIA 4O4YH 1KY7A 5J6GB 3FT4A 4MA3B 4FYQA 5DRXA 3AT8A 4ETQB 4ABQA 4WJ5B 4TM9A 4FFWD 3F7YB 4XO5A 3VG0H 2OW6A 4NZJA 3BRDA 2XWJB 1B88A 1A7NL 4KROD 1KTLA 4P46C 4O51A 1E9QA 1XBRA 2PF6A 1G9MH 1KJVB 3FNKA 1LO3H 1ZLVK 3V55A 4A55A 5I5JA 4EZLA 3DX7B 1U3NA 1YQ2A 4JGMA 2OS7A 1PJ9A 3WEOA 3ZQXA 4KRPB 5FYJE 4KXCA 3L3HB 1ZT1B 5IBLC 1ZPLA 1KV3A 1JVKA 2W80C 2XZAL 4AMKH 1IGTB 3MCKB 3LH8A 1FH2A 3UJIH 2TSBA 3SQBB 3OSVA 2D9CA 1JD7A 2WXOA 3DVNB 3D50A 3HUJE 2EEAA 2XY1A 1Z5HA 3I02A 1INDL 1MVUB 2OMXA 4OF8A 2V2XB 3RBSA 4KKCC 3EBIA 4GEIA 3D9AL 3EH5B 4TS6A 3IU4L 5C07B 4KXBA 1H9VA 1LEKB 4UQ3B 2FQFA 1GOHA 2G75B 4NLHA 3LPPA 1KCKA 5EH1A 1FF5A 5HHVL 1G7MB 2PYFA 4QIWA 1ZK9A 4HV8A 2P24A 1VGKA 3TPUA 3D2UD 1Q8MA 4A39A 3WLWD 1FE8H 2E74C 3MV7E 2ZX6A 4PVLA 4UTBL 4FFYA 1J8HE 3K7UA 3KPMB 1S7RA 2JKLA 5LGJB 2FJUB 1MAML 1BZOA 3PPEA 3C6SA 5I2IB 1RJCA 3RKPA 2PCFA 3DV6B 3GHBH 3O8XC 4KJWD 1YO4A 2Y7NA 3BRGC 2WCPA 5SWSE 3OJMB 3I3BA 5I5MA 1FBIH 2GW5A 4PGBB 4JHUA 2NYZA 1AO7E 4NP4L 2PO6C 3J2PA 3M1CA 4W4OA 4XMLH 3H3PL 3IU4H 4Q0XL 3DYPA 4S1DD 3M7OA 5E1AB 4ZTPL 3EXJA 4JG1L 3IFOB 4OD3L 4NQXB 3BPCA 1FCGA 4JP6A 4HS8H 5DJ0B 5FHAL 3MLRL 5D9SA 1M1XA 4A2MA 1IAII 1RHHB 2AEQL 3KVQA 3OL2A 3PCYA 4AW7A 5J6HB 4J1UA 2VPYA 5ADOH 5IB1B 1ZLWH 1FE8L 4M7JL 2V3FA 3BD4A 5IOPA 3I3DA 3MJWA 4DEWA 4DZ8B 2WLLA 3D0LB 3MNDA 1GMEA 1MAMH 5FO7A 4GRWB 3ZL2A 4IIQC 1EZVY 1L7IL 1UD5A 3MN8A 4KZ0A 4YLCA 1LK2A 2YUJA 1H6EA 4EN3A 3KVPA 5F9DC 5DEGB 4S2SA 1Q9WA 1BGXL 4NQVB 4X5XB 1S2EA 1RZIB 5BV7L 5TQ0L 3NCCB 4XPBL 4WNQB 2HAZA 1BQUA 4JFOB 3C8KB 3BP7B 2Y24A 1XZWA 3MXWL 3WEMA 1F2QA 1WA0X 4IDJL 4WKZA 2Y07L 5GRYA 1X9LA 4XCNA 1VKXB 1Z9PA 1XF3B 1IEAB 3RUGE 2AJYL 3B5HA 2CNZA 4M7JH 5C3IA 2CO4A 3RWCB 2HUEA 1I7TA 5AZEH 5J13B 4OLZH 4OZGB 5D2NE 1C12B 3W11D 3FUKA 5DA0B 3UZQA 4TQEH 5L0QC 3V6OE 2ZXWB 4A6YA 4QNPF 5LGYA 3ISYA 4J3XA 3TM6A 3BZ4B 4WI0A 1K4CA 4ENZA 4PS8A 4GW5B 3FYIB 2ZUQB 3MRRB 2AQTA 4UQEA 4YSRA 4YC2C 5BXFB 4XPFH 3I6KB 3ML1A 3ESOA 3MRCA 3HS0B 4UAOC 3DX2A 3KNBA 4RISL 3BJ91 1S5HA 3E6FA 3GLDA 3H9HB 1T5WA 1HQ4B 5SWZA 4OAWB 5C71A 3RY6A 5LXGL 1MIEH 4GKNB 3UBHA 3VTAA 4YX2L 5IROD 1DDTA 1N6UA 5IB4A 1PZ5A 2I7SA 3QG6A 1CLYH 2IH9A 4D7BA 4L4TB 2WZ0A 3C6LC 2A73A 4AGOA 3HC3H 4DKEH 2ZOLA 3EDKA 4AI7A 4E9RA 3L5IA 3SBPA 4J2XA 1VPOH 1UZ6F 3UYRL 4P23A 1QR1A 4YDJA 4Q9QH 3ILQD 5BRZA 3ZTCC 2DD8L 3F05A 3RZCB 1KFGA 2AMGA 4LLUB 5A16B 4Z1PA 4Z0BH 4NO2B 3LRLA 5L8JB 3PIQA 2XRAL 2ITCA 3B5TA 3FCBA 4W9KC 4KRPD 4MRCA 5FDWA 3CVIL 4BDVA 1HQRA 3X2HA 3MREB 1QHPA 4TOYH 1CFTA 4KRNA 1WWAX 5C0IA 3D39E 4XN4A 5LXVA 1Z9SB 4UM9D 1JHTA 4S0TD 4YE0A 4UCFA 3AW5A 1OAXH 2Y3NA 3S5LB 3VM7A 3H9SA 3IETB 1RP8A 5F96H 3FB5A 3S35X 3VXUE 3WLBB 5A2LH 1NGXB 1VFBA 1Z5LA 2MHAB 2CPUA 4L4VD 4PR5A 1NAMH 3D3VB 1FDLH 2AANA 2XFXB 4S1SL 3C60C 3NIFE 1JXJA 1ZTXL 2B4CL 5FWQA 3VVVA 1JPSL 1XH0A 4O5LH 4J6RL 1FGNL 1P7QB 2PR4H 2ZPKH 3HS8A 4OD2A 4DAGL 4GO9A 3LYRA 1KTJA 2FEDD 2OZNA 1I3QA 2VW6A 2ZIDA 3K2UL 3QJUB 3L4TA 5HGDB 5CFHA 2K8MA 4HH8A 4C8XA 3IU3B 3SCMA 1XGTB 3O2DH 1C5BL 3PWNA 3L3HA 3MRQA 4PIBA 5K9JH 3ES6B 3N91A 2DYPA 4PJ5A 5JIDA 3B3BA 1AE6H 3L3GB 1PG7H 4ODWB 2CQVA 3AQYA 3V0DA 2P5WB 4H0HB 1U8OB 1MHPL 3OR6A 4MAUL 2HKAA 3VGGA 4HG4K 5EU6E 2CA4A 3Q2LA 1PYQA 4DMRA 2KDGA 3REVB 1GY1A 4HYTB 1GC1L 3UACA 5A6IA 4UQ2A 4HA1A 3CE1A 4FKEA 3IPBA 4GRLA 4MZ2A 2B4CH 4U33A 1U9KA 3V0IA 3HBQA 4JL2A 5HYSA 3MRFB 1HOCA 3LKPB 1Z0NA 3QDMB 4XN8A 2FWSA 1J11A 2JKWA 3Q8BA 2ZPKL 1F1GA 1KBPA 3EYQC 4MLIA 5IGXL 2J6EA 1AHMA 3PQYB 3HZ3A 5HHXL 4ZK8A 5K9JL 4L4TE 4MQSB 3C6LA 5DD0H 3FTVA 1IEBB 1O6SB 1QTPA 2ZWSA 3K81A 4IGBC 4UQDA 4ELMF 2ID5A 1BZ9A 2IBZY 3PG2A 4X99B 3TL5A 1H3VA 1ND0B 1V54B 4LF3B 1QAWA 3NFNB 4KKNA 4HUVA 3LEXA 3TJHC 1NIDA 3SPHA 4WO4B 2P5PA 3EGDA 3IRPX 2GCYB 3OKLA 1LQBC 2ALWA 1QFUH 4L8CA 1HILA 5I9QC 1V8HA 5GLXA 2VM3A 3VFRB 5EPMB 2V5YA 5DJ0A 5DMGC 5CN3A 2XX0A 1I4FB 2XPGB 5DVKA 2NW2A 5DXWA 1BJMA 1DDHA 3KWWA 2F8XC 1D6EA 4WW2F 1CE6B 2YBRB 2FNWA 2DQEH 2GK0B 2PTUA 2QKIA 5HHXH 4U1SB 4KXAA 4HCFA 3CX5K 4PGDA 4GW1B 5B7EA 3Q2NA 4KJYA 1WD9A 4NKQB 4UZUA 5GS3A 1ZC1A 4FQCH 5J3HD 3LKRB 2KQAA 1ZOXA 1BEYH 2BSRB 1KZQA 2F9BT 5DVNA 3QQ7A 3Q5YA 4EN3B 4NOFA 5DJZB 2XBDA 5AENA 2BNUB 3FH5A 3OWRA 3MV8D 5D7SL 5EZLB 1YECH 4KUCF 3VI4A 4AQAB 1CFVH 3D85B 5PCYA 1KN2H 3GKWH 4BRVA 2AXFA 5FEBA 5M95B 3TGXA 4DEUA 3O2VH 1BREA 2UV3A 5DK0A 4DERA 1IQDB 4JPKH 5DEZA 3QIBC 4KVNH 3ECBA 3DV4B 3BWUF 3TZVC 2CBPA 2DJUA 4QHLA 1MW2A 4XH2A 1OK8A 3L3KA 3QNXB 1KQFA 4M5ZH 5FUOL 2GJJA 4Z8FL 3PWLB 2XOTA 3VCLB 1U8NB 5LAXA 5D4JA 5FFLA 5EOCJ 3IGKA 2OK0H 5HYFA 2WVSA 5JHBA 3N1QC 4A38A 5FA3A 1AD0A 4B95C 1ITBB 4NQUA 3HKZA 3KEHA 1Y0LB 1W72A 1YMHA 3GXNA 3WIHH 4XPGL 2DQFB 4PJ9B 2WSKA 4N5UA 4ZRGA 4XNYH 1I75A 2OV0A 4X6EA 3VFPA 1I8LA 1LDPH 2APBA 3A6BH 4P05A 4I2XE 4WY7H 4EI5C 5HPMA 2E6JA 2OP4L 5KSAB 3P77A 4XP9L 3ZE1B 1EDHA 3UYPA 2RACA 1CFVL 1T0MB 3S3DB 1OW0C 3VXMA 4MX7B 1AMXA 1JXKA 4KKAC 1L6PA 5IFHH 3I85A 2UUDH 2G30A 4HXAH 5TE7L 4X98A 2MKWA 2R29H 3OLDA 4IU2B 1UH4A 1EH9A 1HESA 6FABL 2P7TA 5FUOH 3ABMB 3KGRA 3MRPB 2Q8BL 3ZO9A 4YE4L 5MEQB 1DVZA 3VNZA 3AROA 5DMKB 2AK4D 3CU7A 1INQB 1AGEA 4BRJA 2APVA 5BS0D 1WC7B 2ZOTA 3NT0A 1U3HC 4FX5A 4DVRH 2EIBA 4U7MA 5D4IA 1R17A 1CQKA 4QD2E 3SDDA 4E9TA 5DMYA 2ICWJ 4QHPA 4OSUH 1LJMA 4ENEC 5HYQB 1FFPA 2ZXQA 4MMXC 5DZPA 5KVEL 3WE6A 4AL8H 3BT2H 1H8NA 4K07A 4N0UA 4NFCA 3GB7A 1CCZA 4ZUUA 2J8UB 3QFDB 3CFIC 4FTVE 2FECI 4HXAL 5TE7H 3H4HA 2HPOA 4FQIL 4QNPE 1IUZA 4DPRA 2VXTL 5ISZA 1R34A 1BQLH 3HI6H 4ZMTA 3WS3A 4PEEA 3L3OC 4LEOA 4ZZFA 4RRPA 1X5HA 4IGBD 3H2WA 2DN7A 2BS8A 3O6ML 5D2NC 3SYPA 1G7HA 1DN0B 3L3JA 3QJQB 4JN1L 4KJPC 3QXWA 2QGEA 3EZJB 4RMBA 8PAZA 4W9LC 3LQMA 2HCZX 4XXDB 1K83A 2GSGB 2OZ4H 4HWZB 4KKBC 1UJTA 1OALA 4PW9A 4JQVA 3IU3A 3SCMB 3ZHDA 4PCYA 2F53B 2X4PA 3BUYA 3R0NA 4PGCA 3WUZA 2NRDA 1P6FA 1CLZH 1W0YT 2X4RA 1QABA 1SXSA 4FS0A 4OSUL 4EI6A 3SUKA 3VRIA 2V45A 2FZ3B 3QPQD 4ZO9A 2XI9A 3QUYA 1ADQA 1I1FA 3Q8FA 3MMEA 1SZNA 3T1FB 3W3BA 5MENB 4HT1L 1KJVA 4FNQA 4JAMB 3VXMD 1U8HB 4DP6X 2GSMB 3ISRA 5HI4D 4OI8A 5I1CL 4M8QB 2AITA 3F01A 3OQRA 3KYMA 4QYOB 3I9GH 4YGAB 4IRSB 3WMSA 1IFGA 1KCRL 3LS5L 2UYLA 1AI1L 2M1KA 5DJDB 2ZSWB 4LLVB 1BBJA 3L4ZA 3ZTNH 5D7IF 4NWUH 3OF6D 1UB5A 3QJRB 3AFLA 4HJ1A 3N9GH 1ZD6A 3GI8H 1PQEA 1UFGA 3WIHA 3PE9A 2OR8A 4AK2A 3ZDZE 5EOQH 3QWQB 1AJ7H 3V5KB 1E7UA 4LOUD 4F15C 4RX4D 4HMCA 5KYUA 1LO0H 3QYMA 2Z91A 4BV1A 2PWEA 4L3EE 5J12B 4KDIA 3RYMA 2J4WL 3K2MC 5I1CH 1CR5A 3GSWB 4XWGL 4W70A 2ADFH 5DJCB 2OSXA 3SY6A 2YSTA 1XSKA 3SUMA 3NIGF 4YXHL 2FYVA 3OXRB 1OD9A 2C3XA 5H4UA 4QJ3B 4PV1C 4S10A 1HSAA 4FF9A 1TTCA 3GMRB 4YGVB 2EDDA 2P8PA 5FYLD 4TNEA 2C5DC 4NO5A 1MDTA 3CVHA 5I15L 1SDYA 4AVKA 3QPQC 2MOGA 4IKLA 5EN2A 5ACLA 3TNMA 1UD3A 4G9DB 4F7MB 4AYFB 1KXQE 3IT8D 1I8LC 3OC5A 4URKA 5J0BA 1EZUA 1E6JH 3LKRA 5EOQL 1J5CA 5CO1A 4YDVB 2PICA 2PXYC 1BD2D 4TTGA 3EYSL 1RK7A 3DJRA 1LO2H 3D87B 5TF1L 4Y1TA 1PQZB 2NXZC 3FS9A 4P46D 1Y07A 4A7VA 3MQIA 4J1UB 1VGKB 4TUUA 4KHTL 3TPUB 2DLEA 1UD8A 4KX9A 1YNTA 4Z3GA 2CR6A 2K6WA 1A6WL 2WUBH 4PWGA 3N44F 5ILTL 3LN5A 1BF8A 1IJ9A 4ORGA 3HE6A 3ROOB 1AR1D 2C1PA 4KO8A 2V3VA 5AUMB 1IBZA 4PVMA 1XEDA 2PCFB 4JO1L 3US9A 2D31A 2OCJA 3S5YA 3ZHFA 2IFFL 3WEAA 5EO9B 1EBPA 3HBGA 2E9GA 3SHSA 4QHUA 3IR6A 1IC0A 1CT8A 1VFOA 2EYTA 5AW9B 3T0ED 1KMGA 3CX2A 5FCUH 3OJVC 3AZUA 4HKXA 5HYJA 3FN0L 2OYPA 5BUPA 1JTTA 4TQPA 1W72B 4E0RA 3D05A 2MOVA 5JXAH 4HK3J 2ZD0A 3KPLA 3P4MB 4BCZA 1D9KA 3NRQA 3IKCB 2BVQB 1H3PL 4I18A 5F6HI 3TNNA 5IFAH 2BK8A 2HKFL 1AZZC 1T0MA 2A1WL 3GBMH 4HMDA 2VPZA 5CD3B 2E7DA 3UJTL 2W0FB 3MJ7A 3HPLA 1CU4L 3BVNA 4I0PC 4QRUB 1P6WA 2AXHA 5DS1A 2QGCA 3BZEB 1UVQB 4XHQA 2UVFA 1ZSDA 1KGXA 1KIUA 1TJIL 3RY5A 1LE5B 4D0DB 1U30A 4LCWD 2OR7A 4ZTEA 3HZVB 3KS0H 4LSVL 4XNMA 2GEQA 3V8CA 3H2PA 4LEBA 4F58H 2R0ZL 3WTWA 2WZ5A 3VXNA 2VO5A 1EV2E 1DBAH 1S5HB 3E6FB 5KVDH 5EPPA 3FTXA 3FT4B 2XA3A 3OMIB 1WC7A 3OWEA 5C1BA 5AVRB 1U3JA 5BRZE 5FB8B 1F2XK 5CR8A 3GZOA 4GG6A 1UFUA 3PWJA 2Z65C 5MP6L 3OGCB 2XY2A 1IKFL 4YDKL 5ACZB 2VLLB 3NCYP 3QEHB 3IVKB 4XC3H 5FYKE 3RTLA 1E9QB 5ABZA 1W91A 1VB9A 5FK9B 1WEJH 3VD9A 1NCOA 1TZIB 3ARRA 4TLUA 1URZA 1XGUB 2ISDA 3QEUA 3VX1A 2WTPA 3JSSA 4LLUA 1P84K 4UIMA 2LU4A 5FM5M 4ELME 3OSKA 3QT2A 4XP6H 4LSRL 3RIFK 2QVFB 1TJIH 5MI0B 4MMZC 4WI7A 4K94L 2OYMA 3GXUB 2CO7B 3IN0A 1X7SA 5AG9A 1SLWA 2EO1A 1LP9F 2EDXA 4LQ1A 3CQPA 3H9HA 4FYRA 4TSCH 3CQFA 3RTQD 5I28A 2ZCHH 1QSZA 3UC0L 1MVUA 4MHHG 4Y2DC 3ZTJG 3NJLA 4XVUD 5DC2A 5AEAA 5I6PA 4WEUD 2B8OT 1ESOA 3BQUD 4LBEB 1BQHB 5F0JB 4M3KB 5GS0D 3QC6X 2MRYA 1E3FA 1JI1A 1FCCA 4GIOA 2QHLA 2WQWA 4LKCB 3B34A 4WSKA 4FMKA 4RCAA 1BQSA 1CDGA 2R2BA 3OKMB 1T1WB 2EDEA 3ZKQD 1IV8A 5HHQA 2FO8A 4GA5A 5B3JF 4PJEF 1S7RB 1ZLSH 1QI4A 3WI9A 5LGJA 4NO0D 2IPKA 1UADC 4JHWL 1OB1B 4Q9CA 3OHXA 1FV1A 5ESVA 3KPTA 1NAKH 3GK8L 5DDHB 2ZSWA 3GLZA 5C9KA 1YEWA 5GRJH 4BKLB 1IM9D 5FIEA 4UNTA 4K23L 4HG4J 5CF3A 4NXSA 2YOAA 2VH5L 4EVNB 1FNEA 4LCCB 5AYUH 1J88A 4HJEA 3ECWA 1GSKA 3QR2A 1J0ZA 4N0CC 2GTQA 3NFSL 3PHOA 2A74A 3KYOB 2MCMA 5L2JA 1AR1C 4PY7B 1RVFL 1TZAA 3BI9X 5IJVB 5JO5A 2AJXL 2IG2H 5L8LB 1N8OE 2YPLA 4XAWH 3I6GA 3MRFA 4U1HB 5KYNA 3KGTA 3QDMA 1IT9L 5BMFH 3KJ4C 1UUSA 1WSST 1BAWA 1LL1A 1PIFA 3HI1B 1Q9LA 4H88H 5DK2A 4U0RB 1GZHC 3II3A 4XGZB 1CDIA 4L4JA 1TNMA 1A6TA 3AABA 4MD5B 3V0VB 4JDVB 2VMJA 2W0LA 2ZCLH 1MVYA 4PRHD 1NAKL 3GK8H 3CIQA 1INDH 4HS6A 1DBKH 2VE6B 4LDLB 3OG6B 3GTPA 1FZJB 1BFSA 4RH4A 5KANG 1AR2A 3CX5J 4U4BA 3CVHB 3EHBC 4PJDE 3I84A 4K5OA 4ZUSB 1JNLH 3V0JA 1J0YA 4NOHA 2FJSA 5AYUL 1J7VR 3ZRSA 4S1QH 3WGVB 1NOLA 2QBWA 3EJUA 5EZJA 5BZDA 1OAKH 4OGZA 5DHMC 2EEFA 2X4NA 2D0HA 5TH2A 3MDJA 3I3EA 1Z9NA 4XAWL 3L9YA 2OLDA 2DICA 2XPGA 4FTDA 5A2AA 3I9AA 4GUOA 3RWCA 4YHNA 1KEGH 5SWSA 1P69B 2GK0A 2KERA 5FGRA 1AQDA 2W88A 4YZFE 1MQKH 4OKVB 1LEGB 2E7BA 2Y6SD 3WKML 1MCFA 1KBVA 5GJSH 4XNZB 5FO8A 3RPBA 3POHA 1MCHA 1SDDA 2XQYA 4Q0XH 4ZTPH 1VADA 1TWHA 4JPWH 2V5SA 1J1OL 1PZCA 3VXSA 4Z7OB 5DRNA 4LB8A 1C8QA 4OD3H 4Y19A 3FQUB 4HK0B 4QOKB 4K3EH 3Q13A 1YNND 4UANA 2NY6C 2VITB 2CA3A 3CFDB 4YHKL 3SBWA 3SKJL 2IANB 5EUKA 3MZTA 4AGMA 1AFVH 4OLYL 4ZS7H 1E8YA 4KITB 3MNVB 4XN2A 4MZRA 4B53A 2YRLA 3NBNA 4JL1A 2J6WA 3UTSD 1CL7L 1ZHBB 4O02H 4RSYA 2GC4C 1KENL 1DQJB 2G3ZA 1KEGL 3ILQC 4OCSH 1E28B 4CBPA 1JCKA 4APQA 2XNAB 2GI0A 4H1LB 5MEPA 3EO0A 1ZA6B 2I9TB 3RZCA 3OXSB 3KYNB 1FO0B 1XF2B 2WWKO 1NIAA 3FBKA 3SDAB 3HRZC 5JMOC 1U8JA 3G6DL 4IJ3B 3CF2A 2FSEB 3HAEH 5FA3B 3VD5A 2EO7A 5TD4A 2A74C 5HDBF 4IM8A 5C8JA 1WC2A 1CD1B 1QI3A 1TQCB 2BSTA 1A3RH 2WLIA 4GO8A 4FZ8L 4M7KL 1U95A 4L0PB 1VC3B 2J6EL 4G8EB 3ZE1F 1KCVH 3CSGA 2FQDA 4PJCB 3WUWG 4WLCA 4NRYA 3AGVA 1TQCC 1UD6A 5EHFA 1BWMA 2DQDH 2AJYH 2R92A 2JB5H 4LCCC 4FXTA 4AMWA 2EE2A 4AUUA 1ZVNA 4L9LB 3NZ8B 1KULA 1A6UH 1JF1B 1X5IA 3AG3B 5E8EA 3S9DB 2NSQA 3ZE0B 1U91A 4KTEH 5C08B 2KQMA 1BXXA 4MMXB 3QZNA 3CFKA 1F56A 1TZIA 3FU0A 1QKZH 1ZE3C 3T2NH 1RCYA 1TCRB 1KBGL 2TSAA 3LD8B 3RNKA 3B1TA 4IS6B 4G43A 4PJ8A 1IGIL 5I1IL 1OGAD 4XWOC 4ETQA 1RIVL 5DURD 3FQ4A 1XO8A 2J3SA 4LCIH 5I8EB 2WLJA 2ORBH 3MJ6A 4ODWA 4JLRB 5F1NA 4TVPE 5LDUA 4KK6C 1N4XH 4JE0A 4LEEA 2JIMA 2MPVA 5IBTH 3VDAA 4MNQE 3FTGA 1EERB 3CSBA 2CCVA 3ZDYF 2AQPA 3V0FA 4KMTL 1MCIA 4TTDC 1AGCB 2QQLL 4IOIB 1S9WA 3U1QA 5JA8B 1RZGA 5MEOA 3P0YH 3VI4F 4F37K 3SOTA 3WMPA 5IUSA 3WSQH 2DD8H 3K1DA 2R7EA 1KTKE 3O3DB 5KS9B 4AVHA 1MRCH 1JGUH 1PL3A 2X6AA 2VXQA 1OPGH 2E4TA 3EYFA 1CFQA 5HHQB 2F54A 3REWB 2OTWA 4HUUB 5AB1A 4PTTA 3MA7B 3Q5TA 1JHKH 3QCUH 1CGTA 4N2AA 3BFQG 2F5AH 3LMJH 3T65A 1I3GH 2OM5A 5GGUA 35C8L 3GDBA 3VD7A 1XTMA 1GAFL 4NHCH 5I0WA 2PPFA 5I66B 2BNQB 3L4VA 2H2SC 3ZZ1A 3EO1B 4N68A 3DVGB 2DJSA 5FOBA 5DJYB 3TX4A 3F62A 5AZ2H 4ZMNA 4PREA 2NX5E 4HUVB 1VHPA 3EBAA 4ZG1A 5C2BL 1YG9A 3T0XA 5FF6A 3HHSA 4IBSA 1QO3A 1U8KB 5CIPA 2WZPD 3VWKC 3D2UA 3GUFA 5CD5D 2Q3XA 4LP8A 3QUYC 1BZ7B 4H44C 2D7QA 1O7DC 3KE0A 1RJZA 4PRIE 3UTSE 3IDNB 3QDGE 4W93A 5CGMA 4OR1A 3ZE0E 5IIEB 2BNQE 1ACYH 3H7BB 5F72S 3QQNA 5GRVL 3FU9A 2QZ5A 3O2DL 4N8VB 4KNQA 4RMRA 5DD1H 2CIKB 3VVWA 3BVTA 1JS4A 5I8CB 4XRCA 2QHRL 4KK6D 3KPPB 3O3AB 2B08A 3LMJL 2EH8H 4C83B 5LCVH 4KJYB 4FFYL 4Z7AA 1CQYA 1DN2A 3RJOA 1P4LB 3GIVB 3KPQA 4NO0A 1ZA3B 3FONA 4JW3A 1B4TA 1P7KA 4HS6B 5C70A 1ZANH 3LB6C 4JM2F 3A6CH 1FYHB 5FM5O 3VSUA 1F86A 1TTRA 5EEWA 4JFFB 3P11H 4P3DA 4LZKA 3ARQA 4HIPA 1HNYA 1JWUB 5C0DB 5LCVA 3BD5A 2Z9TA 1QYGH 5FFOA 5LG6A 5LHDA 4KDLA 3QDJD 5DJCA 3RU8H 2D4DA 3CCHA 3SE6A 2YMTA 2VL4A 4P3CL 4YBQD 3V6ZB 1L6XA 3LS4H 1N19A 2GIYA 4FFWC 43C9B 4DN3L 4YQXL 5LN8A 1PNDA 5JPNB 1BW8A 4JFTA 4Y4KD 2SEBB 4QWWC 4YHNB 1OAUH 5CXPA 1KXTA 1TYJA 5C0BA 4RWHA 5I76B 1A1MA 3B8YA 3VXPA 2GIXA 2WQRA 4K94C 4M6OL 4BK8A 1BMWA 1ZGLP 2DF3A 1RMFH 2YAEA 1WVZA 3EOTH 3H9ZA 2NNRA 1LVEA 2GPZA 1O5DT 2BW5A 1Y0LA 3EJQA 3H42H 4K7PY 3FO1A 4WKXA 5SX5H 3SSGA 4DEPC 3ULVH 2YKLH 2F7PA 1FC2D 1JTOA 4JREC 1AY1L 2VMDA 3B8SA 1KC5H 1HZHL 3L1EA 3MO1A 4GP5B 4YIQB 1RHFA 3V4VL 4PS4L 3QJVB 4GAGL 2WZPA 3ZZQA 4X4KA 4Y9FA 4GNKB 1OQXA 3ZIYA 4N9GB 2JI3A 5CILH 1OHZA 2XN1A 1FL5B 3G5VB 4LU5L 1BM3H 3CMOL 4GAJH 2AJZA 4JFFE 1TENA 4E36A 2X5PA 3LCYA 4NC1C 4OM0L 4BSWB 3U9PH 1IKNA 4GAFB 5BNXD 3UG3A 1MFAL 3TONA 5HHOE 4M6OH 2AEPH 1TPXB 3V52H 3JWOC 4UV7H 4YXLL 4NQQA 2YA0A 4YHOL 1OGSA 1SMOA 1UKTA 5JDSB 2EICA 3PWVB 2CKBH 3KPOA 5T3XD 1QMUA 2HRPH 4LLMA 4R96A 2VKXA 2R0LH 3VI3A 3GKWL 5FKAB 4OKDA 1EXUB 2YIHA 2ZNXA 1G6RH 4LPXA 4WEBL 1RJLA 4PJIB 4PRIB 1M6OB 2EIKB 2Y06L 2JJTA 1BG1A 4Z7NF 1P9MA 3KEDA 4GAGH 2QSQA 4FKHA 3T77A 1QSEB 1CYWA 4AKOA 4JVUA 4JM2B 3DBXB 2BOBA 4DO4A 1LM8V 1LYQA 2LVCA 4NN6C 4OM0H 3IFNL 1FLRH 1VLXA 3MRGB 2DQHL 3CDFA 5F3BA 1K6QL 2X2HA 4PJ7E 3QJFB 4BIKA 5FTMA 4HLEA 3UDWC 4ZO6A 1JV5A 4XPGH 1U8QA 2Y2TA 3QUZD 1C8PA 4YFDB 2A4ZA 2Q76B 1FWXA 3WFZA 3RVXC 4MNGB 4FQLH 3X2KA 3DYOA 3FN3A 4AITA 1WBZA 3CG8A 5FB8A 2X4PB 3KPLB 1KJ2L 2R0LL 3FUDA 3QUYD 2X4RB 4MAZA 4DN4H 1PZ3A 2HVJA 3POCA 3QR1A 1L8FA 3PF2A 4NYLA 4XBPB 3RIFF 3KDMB 1BDYA 1ORQB 4IRZA 3KL5A 5D72H 5AFAA 4I2XB 4WU7B 3GMPA 2D9QB 4ZW7A 1H15A 3WFHA 4EZKA 4M8QA 5E6YA 4GMTL 4E9LA 3EJCA 1X9QA 3NK3A 4QYOA 2VIRB 5B39B 3MRQB 3IJEB 1F11B 4YVNA 4NCC1 5T1KB 1LE5A 5IQ7H 2XJKA 2NY4C 5F9WC 4Z78B 5C0RL 1HYSD 5MERA 1G7QA 1ZHKA 2HUHA 3L7EA 4GJTB 1BAFL 4KI5F 5T1LB 5F7FA 3T0EC 1S7XB 2J2ZA 1R3IL 3IDJA 3S37L 3SULA 3W11C 1NDMA 2B5IC 4CUCA 3GMMA 3S5LG 3O6KH 5CJOL 5AW0B 5CLYA 1CDCA 4AL8L 4ZS6D 4IRSC 3WAKA 2VDOH 3MRKB 1A7NH 1HXMA 3I6SA 3U6XS 1JF6A 1GGBH 4HGWA 1WDAA 5E5MA 3CFNA 1UC6A 3FU7A 5GGRA 4QXTB 3ZX1A 4WK2B 1SMDA 3VXUA 3O9WD 5HJ3B 4AT6A 3FRPG 3QORC 1T1WA 3Q2WA 5JLZB 3LQAL 1DQQA 2AI0L 4HALA 1THCA 3GSWA 4JN2A 1F3JB 3QYCA 2R1WB 4LCVA 1J8HD 3SKUD 5ESAB 3CDGA 5DQDH 2Y1YA 1BBDH 2BINA 1VFAB 3SPJA 3PGDA 3PGFH 3MV7D 2XZAH 1WA2X 2VDKL 1NCDL 5B22A 3MNZB 2YARA 3MRMB 4WUKL 1N59B 1UURA 4KBPA 4R3SB 3V4PA 2AAVA 4K55A 1ND0A 5E1QA 5DJ8A 2OJEA 1AQ8A 1R3IH 4YSUA 5GGSB 2F18A 4UYPA 4F8TA 3NSCA 5SWSD 3QO0A 1EO8H 3BVVA 1X3DA 4KPHL 2UXGA 3KYOA 1KN4L 1X5LA 2A9BA 1SJEB 2B59A 3MOAH 1P5UA 3AB0C 4PMEA 4PRPB 5E2UH 3B9KA 3RHWF 5TDNB 2R2BB 3OKMA 4OQTH 4HWBH 4ADIA 5C0GB 3LQAH 5ICYB 5JHAA 2NY4D 3L6FA 1YZZA 1LXMA 1I85A 3THMH 4L0ZA 4L8BB 2OR9L 2Q20A 4F8LA 3V6ZA 4MD5A 3QCTH 5DHDA 3V0VA 5I75C 5KUKA 5F9OL 2QT6A 4BSJA 3FN9A 1F3DJ 4N2MA 2Y9RT 1HKLH 2C3VB 1ZHNB 4W81A 4WHTA 1WAPA 1TQTA 2ZX8A 4MDJB 3E9UA 3PNWA 4B9KC 5KS9F 3CNKA 3QJHB 3SQOL 3WHE1 1UWYA 1Y1WA 3V4VB 1WFOA 4PRBA 3TVMC 5I18H 2X7LB 2DM2A 1A6VL 3VI4B 5JHDE 2Z6FA 2F7OA 4LP4A 5AVYB 3TJEL 3K72B 1G1KA 1DLHA 3PHOB 2VN3A 5EWIH 3DOSB 4HS8L 3PL6D 4U6VL 2E8YA 1OY3B 4AMXA 2I60L 4P9ML 1X5YA 1N6VA 3NK4A 5E6SB 4F27A 2JKRM 3OX8B 2XVGA 3ROLA 2X44D 1A64A 5KWYC 4IHOB 2ADIA 3EUUA 4FG6D 5CD3A 5CCJA 3UZEC 1CZ5A 1XV8A 3M46A 3K2KA 3ZKNC 3RJQB 5KN5A 4ZUVA 2FX7L 4Y4KA 1FL5A 4XVOA 3QZLA 4ANKA 4J28A 2HLAA 3NZHL 2XZCL 1E0OB 3VWJC 3CZFA 4X8JA 1ES0A 3ZZSA 1OF2B 5D4QA 2ZSVB 2FHBA 5BVJB 3NA9L 2XWTB 4NIYE 4Z7WA 3U36A 1E6JL 4WIQA 4MDIA 3SE4A 3TO2A 1BYNA 4ZPTB 1TETL 1WD8A 4KXZH 3ZE0F 1RJYB 2ATKB 2NTFA 4XN1A 3TJPA 3NSFA 2JELH 5TQ0H 3A4AA 3FQUA 3QARA 4HK0A 3VM5A 3ULUE 4LVNC 1MRDL 3C2AL 2VZ3A 4OFIA 4HUCA 3PWPD 3ECUA 4DP4X 4NQDB 2ED8A 5IJKA 1SEBA 1GS8A 1W72L 2A2QT 2OX5B 4G7SB 1XGPB 5JQIB 4GG6B 4JFPA 2X1WL 5AL0A 4QT5A 4G8FB 3AXLA 4IRJC 2W81C 4U3SA 4PUBH 3VFTB 2VUKA 3QBTB 5CZVH 5CHNA 5CGYC 4A66A 1XGUA 1INEL 2FX7H 4Z9KB 2XQYK 1OHQA 2DB8A 1UA6H 1XXFC 2DI7A 2GJ6A 1HFUA 1XCXA 3E38A 3EH4B 1DQMH 1K8DA 2DYPD 4PJ5D 2O6DA 4Y19D 5D93B 5E2WL 3SGKC 3MRJA 5DSCB 1ICTA 2BWQA 2WM0A 3DGDA 3IWUA 3KCPA 4KUZL 1OP9A 3L2NA 4TNVK 1YMMA 3C60D 3FN0H 3OKNB 4IRSD 1YNTF 4ZYKB 5DMGD 2VRAA 4WFGE 4HWEH 4JO4L 3GSNA 3OMAB 2PNDA 4GP8B 4M43H 4OCMC 4ZMPA 3C2AH 4OT1L 1DE4B 3ZW3A 2YAHA 4LPWA 3PV6B 2BERA 1Q1JL 1T89A 3ENEA 1BJ1J 3GBML 2LQRA 3S36H 2VLRA 4HP5A 4HHAB 1IU1A 3GMOA 3BMWA 1NH6A 2C9SA 4NM4L 4XBPA 4U2YA 4K3JH 5F0PB 1AS7A 3ZTJH 1ORQA 5KVEE 2A6KB 4APQB 1U91B 3GRBA 5C08A 5HYEA 4H1LA 1KELH 4BQ6A 1N26A 3T6QC 2HLEB 3W39A 2WIIA 4HSQA 1K5NA 2BVEA 1HEHC 2ICWB 4WU5A 5TPWH 3BH8B 2LFGA 2BMKA 4FQXD 1JGVH 1G4MA 1R75A 1KYAA 2BVPB 4JO4H 1CO1A 3D18A 3GRWH 3MR9A 4RA3A 4X6CA 3H2QA 1ITCA 4PY8J 12E8H 1N3NB 1NBYB 4EBQL 3WTVA 1F4XL 2AQ2A 4N6QA 5KVGH 1JZGA 3AREA 4HSCX 2NMSA 3GSQA 5T1MA 2AJ3B 3TBVB 4JB9L 1BXAA 3NH7L 4KQ4H 1A8JH 2UXFA 4RIRB 1RZGB 5F1IB 2VC2H 4LK4A 2VXUL 3ZVVA 1X7QA 1VJSA 3TS8A 2W9DH 5GRXG 4AEIL 4XO8A 4XZUA 4WI3A 3RVWC 2UYLB 1TWCA 4J6RH 4Y0GA 1CLOH 2AGJL 3GKZA 3M6DA 4PYHA 2EYSB 2O4EA 4M6NH 4XI5C 3QDGD 2A6DB 4J4PA 2V7NA 1OP5K 3B37A 1HHIB 3KPRB 4KU1A 2AK4B 2O30A 2XA8H 3FTZA 4M3HA 3APMA 2IQAA 5ESAA 3S4SB 1Q9OA 1UCBH 2BP3A 3ILPA 3N42F 1NKRA 5JW5B 2BXZA 5D1ZD 3GSOA 4JM4H 2IGFH 2LR4A 4NKIH 2Q9OA 4LPCA 3DVGA 1F4XH 5FOBB 3P9WB 4ZZKA 4ILDA 5I1KL 3S35H 4Z18A 4H8WH 3K6DA 2Z91B 4FZEL 4PJ7A 1GTFA 5D70H 1OGYA 4WTZG 1IGFL 4U0RC 4F7CB 2F19H 4J8QA 3NH7H 4JZOA 1H9DA 3DIFB 3LY6A 3QO0B 1GS7A 3VMOA 1FHNA 3LZNA 2GJZB 4EXKA 4J3WA 5HYJE 5I0DA 1L7TH 3ETBF 4TUOB 1KV7A 1QLFA 5SWSB 4YGVA 4ENED 5JOPE 4CDGC 3M1BA 5FYKH 3V9FA 3CZKA 3P3SA 4JFXA 2QV4A 1SLVA 4PGZA 4K3GA 3W37A 3ZLQC 1LEGA 1FNAA 3IF1B 4XMKL 2PKDA 4GUQA 2PLTA 3SY0B 4NNPL 3WHE0 4KKLD 1JGLL 4KKZA 2BIOA 2XWXA 3Q8AA 5G5DA 5J8OA 2JJVA 2CU9A 1IGJB 5EA0H 4E5XG 4P2QB 3MV7B 3KHQA 4WHYH 5DJYA 2E7ZA 2EEBA 3HFFA 2R1YA 3BKCL 5CWSB 2K45A 5FF6B 1JUFB 3TYGL 3X2PA 3DROA 3STLA