4FG4A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with hemithiocellodextrin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg4A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg4A02
2PICA 3X2LA 2BH0A 2PI8A 3SUKA 1WHOA 2KQAA 3X2HA 5GLXA 3FT9A 4JCWA 2PJJA 3X2KA 4FG2A 3X2PA 1OA9A 3ENGA 1WHPA 2HCZX 3M3GA 4FG4A 4L48A 5H4UA 3SULA 3X2OA 2PNWA 1L8FA 3X2MA 2G6GA 1WC2A 4JP6A 3SUMA 3X2IA 2VXQA 4JP7A 1BMWA 3CZBA 4JJOA 3FT1A 4ZM7A 3X2GA 1OA7A 5GLYA 1BW4A 4FERA 2ENGA 3SUJA 5GM9A 4FFTA 2GAEA 2JNZA 2AE0X 3D30A 1BW3A 1N10A 4AVRA 4ENGA 3X2NA 2G5DA 3X2JA 1HD5A 4JS7A
chains in the Genus database with same CATH superfamily
5I1HH 5J7CC 4AQ8A 1Z2KA 4NOFA 1IC5L 2BVOA 2BXYA 5IB5A 5CHNA 2EDBA 3GHPA 4M9OA 3T0WA 1T7VA 4E2OA 1HQRA 1F3RB 4FYTA 4L1BA 4OZIA 4AH2B 3SE3A 2NTSP 2WD0A 4WUKL 5I17A 1MCWW 1A6ZB 2QVMA 1Z5LB 4N2IA 3U0WH 1V7ML 2DJ4A 4N8UA 4YL4A 3IWVA 3LRLA 2OYLA 4BXSV 4JFYA 4P2QB 5DUBA 2QZQA 3TPKA 1P6FA 4G8GB 5FFGA 3IR6A 1KN2L 1IT9L 4TPRH 3W9EA 4QRTB 3FS9A 3MRRB 4AW4A 1WD8A 1QTYT 2IDUA 5D7IA 4APQB 3B56A 4CKVX 4TSCH 3T65B 2VIRA 3H1ZA 5D1ZD 4NX0A 5A43C 3NJMA 5IVOA 4X6EA 1TITA 1NC2D 3LOWA 3M6DA 1A7PL 4LVOB 4R5VA 1KDIA 2FJFB 2Z92B 3QYMA 2ETWA 1V5JA 2ZCKL 3ILEA 4KJPC 2ITEA 4HIHA 3RURA 4CSSA 1TJGH 1XR8B 3NIGF 3M46A 2E4TA 1S7WB 4FKHA 1MJUH 2JIXD 1ZLUK 4GMTL 3Q6GH 5ITBH 3IK2A 3PWNA 4TL5A 1BXVA 2BC4A 2G30A 3MA9H 3P11L 2VSKB 5FF6B 5D2LB 4L37B 2WVVA 5AYUH 4IK6A 1M42A 5IOPB 4Q9RL 4UQBA 2CQVA 4GQ9L 2VTFA 1UH4A 4Z7UF 4CVZA 3BSZL 1YEGH 4LSPL 2HRPH 5LGHL 4W9FC 3KYMA 4GO8A 5FTMA 4KDWA 4N0YH 4A2GA 4CVXA 5BOJA 3H55A 5IVXA 1F13A 3MLPA 3MBWA 4UQIM 4UUJA 1UJ3B 2KLSA 3ILQD 4TNVK 4G11A 3IDIB 2VPZA 4K94L 1M05B 3O2VH 3KYNA 1JNHA 1I7TB 5JMOC 3E9TA 2CUHA 2JIQA 5CLYA 4ZJ9A 4Z7VE 1WEJH 3B9DA 3K2IA 3QEGL 5AFAA 1ZYRD 1U8NA 2Y25A 5KSUA 4N1EA 2WNKA 1F58H 3O6FD 3OXSA 3QUKB 4QRQB 2VISB 4LCWA 1XAKA 2G9HB 2E7ZA 5GSRA 3IAGC 1CXLA 1UWEH 3CLEL 3GMOA 5LDUA 5ICXA 3VFUB 1HN1A 3MRBA 2J5LC 4PD4K 2H45A 4K9JA 1HI6B 3RB7A 3WDJA 4HOWA 4KZDL 1QA9B 4CRPA 5EPMA 4PGDA 2J1KA 4ZFGL 2NXZC 4JFZH 3BZFB 2B2XH 3P4LA 5DT1L 4BHUI 2E2IA 2F53E 1ED3A 1NSNH 5FV2A 2I5YH 5CJ8A 4KOBA 3QHZL 3ZYIA 3BGMA 4X4XA 2WKGA 4EDWL 3VD0A 4NRXA 4NOBA 3K6OA 4KMQA 3U36B 3HFMH 1DVYA 1RURL 3I74A 3ZIYA 3V4UL 3N85L 5DQDH 3OKOA 1LP9F 2R9HD 4LL4A 2YR3A 1ZGLB 1Y18A 5GZNC 4OTXL 4XVTL 5EU3B 2B1AH 3IFLL 4TSAL 3MBEB 3SGDH 5AW8B 1XMEB 1NOLA 4MNGE 5JZ7C 2QQQA 2WYZA 5L9DH 1I9IH 3TVMD 1Q9OB 1IKOP 3DPBA 5DEFB 4JREC 3BYTA 1SJVA 2YQBA 2PXYB 1FRGH 4KKNA 3WSQH 4X50A 4OUUB 4NKIH 5J6GB 1PGRB 4L1DA 2WTPA 4AM0B 1ITCA 4LASH 4QRAA 5I6PA 1JWMA 1A0QH 1RH8A 1ZVNA 2AZUA 2CO1A 4FYRA 4NN5C 5F71A 1CD1A 5T1MB 4YDKL 4EN3D 1YAIA 1BAGA 1JWSA 1XX9C 4TQEH 4UM9D 1NBZB 1AE6L 2NNAB 4JFED 2VJ8A 4LLMB 4NGHH 5EDXA 4I18C 2YA2A 4V11A 5TDOA 3TIEA 3ZY7A 4V1DE 3ZKXC 1MIEH 5EF2A 5ALBL 3QNZB 4DIXA 1Q9KB 5GLFA 5EZJA 5KJ4A 2FWUA 3K91A 2ZXDA 5TGBB 5D1XD 4W9DC 3NVQA 3GLEA 3C6SB 3FB7A 3ZDWA 2DQDH 1A7QL 4ZMVA 1XSKA 3N50A 5C09E 4OJAA 3BPNC 3VW3L 1AHWA 4DKEL 5KJ7E 4W4OC 3LX9A 3US0A 4LSVL 4RMTA 4OY9A 4PGBB 1D6VL 3QO0A 4HEPA 4JHAH 1OCOB 5F21B 2DYPA 5I1HL 3CZEA 3AMKA 1ZE3H 2K6YA 4G3YH 4KVPA 1PG7H 3CMOH 4OGYH 3ULUE 4LQ1A 2KI6A 3KLQA 1QLEB 3CN2A 2K8MA 4BFIA 5EN3A 5D8JL 1QEWA 5DCCA 1KC5L 5DEFA 2C1OB 4GQZA 1QWNA 2VR9A 4EI5D 2EXYC 4M3HA 5HI5C 1MHHA 3ECUA 4WUKH 2X6BA 5F7NC 3EFDH 4K3EH 3KL0A 3H8NA 1MRFL 4OAWB 1BVLB 5I71B 4OI8A 1JD7A 4IRSD 1A9EB 4XP9H 3CE1A 4TUJA 4GQPH 3HAEB 4FQXC 1R5VB 3U36A 3EFFB 3BOVA 5FW6A 4P23A 4K8RL 1I3GH 4GKOA 4ZOAA 2NDFA 2WUCL 4P2RD 3VUAA 3ENGA 4X99B 3EZJB 5LAXA 3VRIA 5B7FA 1F11A 4KHTH 3WN5B 1RUML 5ESAB 5IROD 1ZANL 4BK8A 2VNCA 3G3LA 1K83A 3MYZA 1C5DB 1ZIAA 4Z18A 3CJJA 2PCXA 2GBTA 2UZXA 4LRIC 2NY7L 2AMUA 1KB5A 1MIMH 2ENSA 4MBRA 2PICA 4U4BA 4GMTH 1BBJA 2XRAH 2EYRA 5F7HA 1XGZA 3E6HA 3A67L 3R19A 4TUKH 4DGVL 1WSST 4WO0A 3QFJD 1J8RA 2CRZA 4WSJA 3ZTEA 4QO1B 2YAEA 5J11B 4IKLA 1MCRA 2IWEA 1S7VB 3G5VB 3H9SE 3KYNB 3EOTH 5C92A 1GYUA 3L9YA 3UTPD 3QXDB 4FQPA 1F4WL 2VKWA 2R39A 1L3WA 2WXLA 1NMBH 2VLRA 1O9WA 1E4XH 3NN8A 4W9EC 3MRQA 4NO3A 4MQ7A 5IMLA 4WU7B 2OSLB 1YNTA 4PH8A 4DKFL 1II4E 3BHBB 5SWSB 5DSCA 3OAUH 5C6TH 1BV8A 5FDYA 4M1CD 1ITBB 5ESAA 1WZAA 1S7XB 2ZCLL 1DO5A 1YC8A 4JAMA 2ADIA 3BKJL 4ODHL 3AC0A 2ZOLA 5L2KD 3SDDD 3B37A 4N3UA 2H6PA 5JA8B 1EFXB 2FX7H 1T0PB 3VTAA 2PP8A 2DQIH 4ZS7L 4ETYA 4KZDH 1LO4H 2O5YH 2YD9A 4AEHL 1KEML 1N70A 2R27A 2Y6SC 1VZIA 2ZWYA 1JZ2A 4HEPG 2NYAA 4X5WA 4G80B 4OLVL 1JNLH 1G4MA 1ZVSA 4NOHA 2C3XA 2Y4SA 3CGTA 4Y19B 5LG1A 3QHZH 3PAYA 2G2RA 1ADQA 2EDEA 4EDWH 1L9QA 3HFFA 4JY4A 3OKDA 1MDTA 4NUJB 4OBRA 1IL1A 4IRJA 3AABA 3KPNA 1S9WA 2E9GA 5ANME 1I3RA 2LAGB 1BQKA 5CU9A 3O2WH 2EYSA 3NRFA 3GM8A 3LPWA 5F1IA 3W2DL 1HJCA 2DLTA 4XWOD 3KZ8A 4MCNA 3L3KA 1FZOA 3BRDA 2AQSA 3SDAD 3KPRE 1A6ZA 4BFJA 4DQOH 4K8RC 2MOGA 4K7PH 4KKLD 4U1HB 1P5VA 1SUHA 3VE0A 4PGBA 4JQVA 3ZHKA 5HTSA 3QVAA 5JQIB 2PW1A 2XY1A 1KY7A 3FO9B 4AK1A 4HMDA 3HBZA 3ES6A 5KBLA 2QQLL 1VKXA 3AXHA 3FU9A 2G2NA 5CIPA 3LIUA 2L0DA 1KCBA 3BGFC 1QLRA 2BVOB 4HUNB 5KYYA 4J3BA 3Q06A 1HILA 4IMLA 2OTUB 2PN5A 5DEGB 5EOQH 4Q9CA 2N7AA 1IBGH 3MFFA 1DQLL 1UC6A 3IDYB 1JERA 2ESVB 4I3SH 5LN4A 2VN7A 2FD6L 3ZE1E 4KKPA 3GTKA 1YMME 5I23A 4L5FE 4XAKD 5KVEL 4WHCA 5B3JF 2E4FA 2GIYA 4XVJH 3UAJC 1S7TA 1XD1A 2ZKYA 2PTVA 2Y3AA 3EGSB 4F9LC 4N1HB 5FB8A 1G7MA 1MCPH 3N43F 1QW9A 4M6OH 5F7LB 1VC3B 2P49B 4K3JH 2B4CL 3WO4C 3HNTH 3VXNB 3SGDI 5E0QA 5AVQB 5BQ7B 3KYKL 1ONQA 4LBEB 1Y5IA 1FO0L 2X70A 2PUQT 1M1XA 3DLQR 1PG7X 3HUJE 4PRHD 5HI5D 1UEMA 2DKMA 3OKKA 4D7ZB 2DQJH 4PG9A 2P8MA 2BP8A 4ZXBD 1NAKH 5J13C 2IOMA 2ICWB 4YXKH 5TTRA 4A7UA 5HY9B 2FZ3A 4QTHA 1HSAA 1K4CA 2VQ1A 1HL4A 1QLEL 5TDPB 2PABA 3KD4A 2XPZA 3Q8AA 5D8JH 4TMPA 1KXVA 3AQDA 3HG3A 4ZXBA 1FYTE 3ZKMD 1QI5A 4FA6A 1U41A 4AQZA 2Y7QB 2MCPH 1DSFH 3IFPB 2ODIA 1SFOA 1HK6A 4MJ6B 4PP1D 3T2NL 1TCRA 1BMGA 3B7SA 4DP0X 5LCVL 4TKWA 1B2YA 5MP6H 1AC6A 5EU6A 4F58H 1AKJA 1S7UA 3WHXB 3D0LA 1A6TA 3PL6B 3FQWA 2VXUL 5KBDA 1KBGL 2FCBA 2Z9TA 3FCGA 1JMXA 1IEHA 3H42H 1SPDA 3T71A 2XXFA 1KV7A 1Q9LA 5GJTL 2NZ1A 3HHMA 5KVEE 3TA3B 1RUMH 3EJCA 1A8JH 3ABLB 5ENWB 4X6BA 4HWBA 4WFED 1XMWA 2BE5D 3TJHC 3WI9A 1LO0H 2VXVL 5J5EA 4EQ3A 5IVNA 1M9WA 3HPJB 4UM8A 4PVBA 4C56E 5JHBA 4UNVA 1MCHA 1RZJL 1MIML 2QVTA 5J06A 3GSRB 5DUPH 3L54A 3QULA 5E8OA 5DD1H 4AIZB 3CK0H 1C16B 5B1CA 2BY1A 5B3NA 5I1AB 2GY7B 4CVZB 2WIIA 5EULV 5EZPA 4Z23A 3SBQA 4L48A 4RNRA 3VDBA 1BQSA 1JBJA 5TJWK 1NCTA 3IVKB 3J27A 5E5LA 4GW1A 1DJZA 4FRWA 5MERA 2JJTA 5CP3A 3INUH 5D70L 4XPFL 4L0ZA 1R3HA 4YHOL 3LB6D 5AB2A 3D39A 3DX2A 2PP9A 1XH0A 2W38A 4P3WA 4NN7C 4HMEA 3VA6A 4K5LA 4P0DA 5C2BL 5T33L 3C8KA 3CZFB 5C0AD 4U6VH 5AVZB 5EBLB 3QUMB 1GGBH 3OR7B 5AOJA 5ERWB 2ZZUT 3BVUA 1PPIA 1QI3A 3ZZQA 3CHSA 1ES0A 3RZCD 1USZA 3MRNB 1GCYA 2EE9A 2AHIA 1X7QA 2FR4B 5FW7A 3LKPA 4AYMC 1I1FB 1UADC 2CRIA 4J23A 5BV7C 3DBXA 4AZUA 3CHPA 2SEBA 2NQ3A 1M6OB 1FH2A 1YY9D 1DDHA 5FTLA 5FEBA 5D1QB 4WFFD 4KPHL 3MRLA 3P77B 1G7HA 2IVFC 4QHNB 3NRQA 5HVGB 4PRHB 4NEHB 5L88L 1NGXA 3CIAA 3DV6A 3FQ1A 4M03A 1I1AC 3ZR6A 5H35A 1S9XA 5D6DC 3AQZA 2R1WB 3D4YA 4ZDHB 4PRIA 2NPLX 3PGDA 3ZTJG 3CCHA 4JGNA 5GIRB 2Z65C 3JSSA 2IV9A 2JELH 3FULA 4GAGL 1OGPA 4GYBA 1RZIA 4QXVA 4AG4L 5FYKH 4AV4A 3X1EA 4CJ0A 1MRCH 3DIVA 1N10A 4PV9A 2VDRB 2H32A 1SY6H 1PF3A 3UAAA 3HBGA 4I13B 2X4RA 4ERSL 1T1YB 4KJWD 4JFHE 4MNQA 4Y2DB 4CMMB 4HH8A 3EDEA 3R0NA 1MEXH 1NGWA 4JRYA 4J3SA 4X7EC 1TQWA 1CGTA 1F1GA 1I3UA 4QOKD 3S8FB 3IDYC 3EYQD 4FNQA 3LVEA 3VACA 4WTZG 4KRLB 2X4PA 2XXMB 4HUVA 3FO0L 3T9WA 1CGUA 2FD6H 5TE7H 1AJ7H 2RA1A 3MRDA 3X1BA 5CFHA 5KYWA 1MHCB 1I8AA 5CEXA 1NCOA 2BFGA 4JCMA 4EN3A 4JE4B 1OAXH 3BAXA 1LK2A 3CV5A 5CILL 4HHAB 5E23A 5D1ZI 4KNSA 4Z1PA 5KAQG 4K5MA 4HPYH 1ZVYA 3QUXD 2ARJA 2BS8A 2XNAA 5D1XA 3RWGA 1KJ2H 4G6ML 3A6BL 2CKBL 4QCIA 4MJHA 5D4JA 1EO7A 3ZYJA 1D5ZB 4QF1A 2AF2A 5F96H 2ZCKH 5F93C 3UJIL 3HEIB 4FJ6A 4QRUB 3ARBB 5MHSE 2RALA 5FUOH 4HLJA 2YZ8A 2H3NA 2BSDA 5E2VL 4PJBB 3MLVH 3IRZA 2D31A 2ZXQA 4YGAB 5I1KH 3UPRB 3RZCC 1PYWA 3HZKB 4ORGB 1YEEL 4UOZA 3SDDB 5DS2A 5L2KB 3LJ3A 2HFTA 2VDRH 5GSVB 1FO0B 5C09A 3I75A 3UXFA 2YRLA 4V2CB 3DURB 3ME0B 4MZIA 2FIKA 3BAEH 5KSVB 1E90A 4GAJL 1FO0A 2O5NA 4U1GB 2EP6A 3CQPA 3H9HA 3KPMA 2JJWA 4NJ9H 3OPUA 3F7KA 4U6XA 4NLAA 1EGJL 3V9CA 2MOVA 3GSOB 3L4UA 3LRKA 1QX1A 4K94H 1WZLA 3AGWA 3VG0H 2WO3B 4U33A 1WFUA 3CZJA 3OJDA 4QHLB 2DEXX 2ZUVA 4ZUUB 4FQ2H 4GP8B 3G5WA 4BH7B 4W9ZA 1SJHA 2MEJB 5GHWL 1JYVA 1CLCA 1DVQA 4P2OD 4O9HL 2R7ZA 1E9QA 2I9LA 4UV4L 1MVUA 4DH2A 4ZFOL 4Z77A 2P24A 4NRYB 1FN4B 4KMTH 4J3TA 1JVLA 4B60A 2BMKB 2R0ZH 3JV6B 3PDGA 3C8HA 1K72A 5DJAA 4RRPG 1OM3L 5I16B 1REIA 1HE7A 1W16A 1G43A 1I7ZA 5CSBA 4YNYB 4ZNCD 5C0DB 5KSVA 3QUML 4HJ1A 2IH1A 1OSZA 3HZYA 3PGFH 4F8QA 1XR9A 3RPBA 3CBKB 1FI8C 4JFZL 4EPSA 3RZCA 2B2XL 3HTLX 5DT1H 3KPOA 2BP0A 5DUPL 3B8SA 3II2A 1NDTA 5DD1L 3ZTJH 3DARA 1QTSA 5BS0D 5I66B 2VSMB 1BCIA 4A39A 5IEKB 4AEEA 5DD3H 3Q6FA 2ZKHL 1NEPA 1UASA 3C08H 5E7FA 4PJ5D 3M3GA 2WTRB 1GL4B 2QKIC 3CUPA 3D4ZA 4MZRA 3ISYA 1MJJB 4WTZA 1IAIM 1QNZL 1FFPA 5ABZA 1K8IB 2PWDA 3GHBL 1AI1H 3LZNA 4O58H 4KDTA 3WFDL 3WIFB 4NN7B 4R3SB 4WF7A 2Z34A 1AR1C 4IRSB 2VLJB 2R4SL 4HHAA 1BJ1H 4JDZB 1F4AA 4OV5A 3N04A 2ZYHA 3FTVA 1XO8A 3N41B 3VNZA 4ZFFB 5ILTL 3AQYA 3PUUA 4AVHA 4BFOA 4HJJH 4R4BB 4M5SA 4E42A 4OZFH 2IADA 1OPGL 1UATA 3NCCB 2DIBA 3PNWB 4H7VA 3GZPA 3JQOB 1PQZA 3U7WH 4LASL 1AXSA 4ES8A 2BIOA 3SGEH 3MU3A 4R26L 5BO1L 1DBML 1LEIB 4P5TC 3O0LA 2A6DB 1HOEA 2DB8A 2ZNXA 4JRLA 1XH1A 1K9TA 5A2CA 3GPSA 3VWKB 2DWDA 3SE3C 2CBOA 3UTTA 1MQKL 1YNLL 1TNNA 2HTKC 2XICA 4OKVA 4PV9B 5HHVH 5I5MA 5INCB 1JGDA 3DSNB 5FA3A 1A4CA 1EAOA 2OCJA 2VR4A 4JZJC 1KIPA 2J1ZA 2HLEB 3L3DB 2CU9A 3QC5X 2J72A 4XBGB 3DSFH 3CCHB 1JD9A 3Q2LA 2B39A 4RGND 3KDPB 1NCCH 5K59F 5EEUA 3H56A 1SLWA 2BIMA 2WXOA 4Q8BA 1UD8A 4NO5B 2JIOA 2DM4A 4NB7A 4PLNC 4HJ0D 5K1NA 5JQ6H 1B2WH 1D9KA 1B0WA 1KB3A 3OMZA 3QJFB 1PG7L 4F93B 3NYKA 1QFUL 2P8LA 1FJ1A 4AJ0A 3HLKA 3DVFA 4OLYL 1KF9B 4IYKA 4HQQL 3DYOA 4XBPB 3IVKA 1NDGB 1ACXA 3NZHH 5JPMB 4XN8A 1T83C 1RU9H 8FABB 5I5IA 2YARA 3TLRA 3LKPB 4Y2OB 2P26A 4XP5L 2ZP9A 4WHTB 3R8QA 5CGMA 4OCRH 3TVMB 5JR1L 1ETJA 4HV8A 4OZFB 3TN0B 4U1NB 2Y5TA 3BP6B 3O41A 2BIQA 1BQLL 5BRPA 4MDRA 2R83A 2XKUA 4M7LH 4RA0C 3SCMD 3CZFA 4CJ1A 4M4RB 2EABA 3N1GC 5E6IA 2GCYA 4B27A 1P1ZA 3B5TA 5DSCB 4R0LC 2QPUA 3S6CA 3OLEA 3DO4A 4YK4B 3BE1H 4BBWA 3BD4A 1PCXA 2VDLB 5GRXG 4P2RA 2HWZH 1NM9A 5GXBB 5ICZB 4D94A 2A2QT 4WTWA 2BIIA 2A3TA 2V7NB 5KN5A 3UZVB 4NZRH 3OTTA 1MFEH 4W93A 3LS5H 2ITDA 5HHOE 4LRNL 4WQOA 1NANI 4YHKH 2A73B 4JQXC 3T2OA 3ZDXE 2WBJC 3QJOA 2RCSL 5C0CB 2KPNA 1JZ5A 3H6AA 5H94A 1GA2A 4B50A 1QI4A 4OF0A 5B3JE 3CD4A 5C97A 5DGQA 2AQ1A 2QVIA 1NC4A 4F2EA 1N0LA 4JHVA 1ZCRA 3UG5A 2IGFL 2EUZA 5AB1A 1KLGB 4RGNB 3B2XA 1Q94A 5MHSD 2VH5L 4JDTH 4UINH 3QIBA 5ICYA 3QFJA 4M1DH 2X12A 1OGAD 3PP4H 1XQ4A 1H0DA 3VXOA 3FT1A 1KGWA 5CCKH 5IIEB 1A1NB 3TYGL 1E2WA 3D85B 2WNGA 1J9TA 4H20L 1WIOA 4L23A 3TCLA 4JRWA 1V7NL 2R0LH 3VG0L 1EAPA 1A64A 1FCGA 3C9NA 2CIKB 2FO8A 4EAEA 4J4PC 1T89C 1QD0A 2VITB 1YY8B 3VWKD 1ZGLP 4B9ZA 4Y8AA 1JV2B 2VRAA 2ZOOA 3FT4B 2I07A 4UV4H 4I9XA 3DX8B 3DRQB 4PJFE 3BXNB 4PRDA 1QATA 2Y69B 2CD0A 3O81A 3P3SA 4KTEH 2G3MA 4TYUA 4ZW6A 4U1SB 3V4PA 5ADPL 1LWRA 2VLKB 1MFDH 2BNRE 4OCLC 2PPDA 4HS3B 4RMVA 3MLXH 5HVWA 1FFPB 1NANH 4OSUH 4RA3A 2WZPA 3KGTA 3ESVF 3ZX1A 1KGXA 5DK2A 2Y1AA 5TQ0L 2VQ1B 4J8QA 2YQ2A 5AW3B 4KKBC 5GGSB 5BNXD 4ZFOB 1W9XA 1JIBA 2VLJD 1HAWA 3DGDA 3MKGA 1PZSA 4DN4L 2UWEB 3I2CL 4YBQD 1YJDL 4MD0A 5DVKA 3UTQA 2UUDK 4GBXA 2E9JA 3QNXB 4NI6A 1W72H 3EH5B 4X2UA 1KJ2B 4HEME 1ONQB 2PP7A 4NQDE 3S98A 5KYUB 1BEXA 2HKHH 5AL0A 4LIQE 1JZ8A 1G7MB 4ZX4A 4LEOA 1A2YA 1J8HB 2DMHA 2UX7A 4H1LG 2AZAA 1X5XA 3LV3A 3L3KB 5KEZA 2F8XC 2EEDA 1YEWA 3SQBA 1E9OA 2F58L 3W38A 2WQVA 1WO2A 3FYIB 3U7WL 2AV7B 4KI5F 4U49A 4AJYV 3WD5L 4JFDB 2J5LB 2K6WA 1EZSA 1EX0A 1ZV2A 5PCYA 1RJZB 4JPVH 4ABVA 5EOTB 3FQYA 4FNUA 4U3XA 2AXGA 3RWJB 1KBKA 3B9EA 3V6OE 4V33A 4HFWA 4A7GF 3OX8B 3GI8H 4K3JL 1N5YL 3RIFK 4NZJA 1HHKA 4LU5L 3EOAB 3LIZL 4MLSA 3KPTA 1Z66A 2COQA 4LK4A 3V0AC 1NCCL 1MRDH 2CJSA 1OARH 3WNLA 3GTJA 4GW5A 5KVGH 1SZNA 4NNXA 3C60B 2HUHA 2XPYA 1UXWB 4WEMB 1NAKL 2GK2A 2IOIA 2X9WA 3BZEB 1QSFE 4HVBA 1INDL 1DQVA 2VDPH 3MRQB 2I60H 3LRSA 4M3KB 4OD2B 2MCMA 2XPGB 5JW3H 1NC4B 2W0FB 4GSDH 1EUTA 4YDNA 1J0KA 2YEQA 4DUVA 4PYGA 3ULVD 4HQQH 3DK2A 3UIZA 4O5LH 12E8H 3RX7A 5F70A 4PJ5A 2IDTA 1RU9L 4L0YA 4MAZA 3QUXA 5LBSL 3TVMC 1DSFL 4XP5H 2FSDA 3Q8EA 1QA9A 4OCRL 5JR1H 3CHRA 4LHQB 2EDMA 3BQUD 1KXHA 2PO6A 3QDMA 1Z0MA 1QSFB 4YSOA 1A4BA 2CDGA 5TE6L 5FR3A 1ZT1A 2AS5M 5FFOA 5B8CB 4JNXA 1KQFA 1A4JB 1FGVH 4ZTEA 3B2VL 5A2FA 3O8XD 4NJAH 2IJ0C 3JTTB 5J6HB 4UT6H 1DQDL 4Y5XB 2WMPA 1XDTT 1MFAH 5GRUL 1BAFH 5I2IA 2PI8A 3QC8A 1BX2A 1KT2A 2VW6A 2VDML 3QXDA 4GO9A 1LDPL 1TENA 3VI4A 1ZMYA 2CKNA 3O6LL 2WWKO 3LNGA 3LKNB 4LCCC 4LSUH 4XVSH 1XF3B 2CR6A 3ZZLA 3O2DH 3MBXH 1OSPL 2BVQB 4K9EL 2HPOA 1GW6A 1FIGH 1HFUA 2FEJA 3E6HB 4S1SL 5DVMA 3FUKA 2ITDB 2YFOA 4X4KA 3DRTB 2OZ4H 1BHGA 3SDCC 1BJ1J 4FLHA 5GS1B 2P52A 2UV3A 3S5LG 4WTQA 3CLFH 2EVFA 5A40E 4OAWA 1BIIA 1FNEB 3FH7A 1LL1A 4LP5A 4YPGB 4P46C 2AKRB 3C8DA 3MBEC 4DN3L 4F92B 2NNRA 2OL3L 3T3MF 3V4VH 3QJVB 1XXDC 4P2CG 1XAUA 1S78C 1XSJA 1UXWA 2NY3B 3UADA 1E5AA 4NUGH 2VDLL 3HG4A 3KM2A 4JREB 2Z92A 4XXDB 1G9NL 3PQYE 5DFVD 5IFJA 2BZCA 3GC3A 4IJ3C 5D70H 5C7XL 5HPMA 4L8CA 1ASPA 2E7DA 1HHKB 4AE1A 2KL6A 1I8IA 1LVEA 2DQGL 3TCTA 5DF0A 4MCYB 1X5IA 2WXRA 4R7LA 4GS7B 2VDNH 5F3FA 3ISWA 2NY5L 1T0MB 3S3SA 1UD4A 1E60A 3NJIA 3A5VA 2OX5B 1H6TA 1UWFA 5T5FH 4KGJA 4DP2X 2J8OA 4N87A 1INQB 3NCWA 5E5RB 3W39B 1H8SA 2ED9A 2RR3A 4RSVA 1HDMA 1PY4A 4MDIA 5EO9A 1U30A 2CK0L 1SQ2N 4UT6A 1MFUA 3M07A 2XN9B 4KJPD 3NK3A 4ZNEA 5BVJA 1T2JA 1RP9A 1YQVH 3H2WA 3ALPA 3DMMA 5F97E 1U8PB 5C0AB 4K71B 2NNAA 4OIAA 4X9FA 3PNWA 1HZHH 4N1CA 1RPKA 5KS9F 1RK0B 3NACL 1GZPB 2KZBA 3LN9A 4ONGH 4JY5H 3ZHNA 4I0KA 4FXGA 1OV8A 2C45A 1C1EH 5B21A 3WIHH 2ICWJ 4FFWD 4FQCL 3X2PA 4QWWD 2HUEA 2RIKA 5FYLH 3V4PL 1QYGH 7PAZA 1XTMA 3RY4A 1KJ2A 2WLIA 4WEBL 2AI0H 2O6EA 3QEUB 2XWEA 3SKMB 1BOGA 1FORL 4HOXA 3RWHA 3I02B 4N86A 4XR8C 3LN5B 3SCMA 4NQEB 4PJIF 1P4LB 4PAZA 1NBZA 3NIDE 4FF9A 1DQQA 3D25A 4ONFL 2IPUG 3EH1A 5GZOC 2YMTA 1ZOXA 5J1AA 4P4KA 4L4VB 1TTCA 3MV7D 2VDOB 1J1XL 3DTDA 1CVRA 4P23C 2VLKA 4Z3EA 3O3UN 2X2UA 5J6GA 5E2TH 1HZKA 1KMGA 1PX3A 2ZD0A 3Q5YA 4X9BA 3X3GH 4HFUH 2A1WH 5SV3A 4CSTA 4KHXL 3PL6D 1YYLL 4M5TA 5EA0L 3PWVB 6PAZA 3TEZA 4G1EA 1GH7A 1YHPA 2MNWA 1O0VA 1WA2X 2ZWSA 5DMIL 1FVDB 2XZCL 3F2LA 5BRZB 2DQTL 5IMMB 1KFGA 2VUKA 2CR0A 4NPKA 4J4PA 3RVUD 3L3GA 3UG3A 4ZUVA 4F7EA 2NXYB 4BH7A 1EA9C 3QUYA 4PUBL 3GMOB 5IBUB 3VFGH 1D5BA 4HPYL 5GSRB 2BVUA 2QSQA 3ATDA 2X2JA 4IRZA 3ZK0A 2DYRB 1Z1WA 2CKBH 1MRDL 1A4KB 2YPLD 4JO5A 1DQML 1U3YA 1L9NA 1SM3L 5AENA 2X6VA 4XMXA 5FUCE 3BGMB 1VF5C 1VSCA 2NY5C 4DP4X 4RBPK 2YIHA 2YMXH 2JCWA 3PDDA 4LCYB 2I60L 1ZPUA 2ZAIA 4DVRH 1XF4A 3I75B 4U6HB 5T1LD 2H2PC 3IMVA 1D7FA 3L6FA 3F7RA 4N2DA 4ZUWB 2WXJA 1RUKL 3BAWA 3TT3L 2X4UB 3NJLA 4Y8DC 3JV0A 4KXDA 5D96B 3FOMB 4ZUUA 1A21A 3EGXA 2AJUH 1KCLA 5HYJE 3EIFA 5ISZB 1BVNT 3HR5B 4Z8FL 4GKLA 3UCQA 4H8VA 5HSFA 3PHOB 4HZLA 1NGPL 2XQBL 5HGBB 3ZKND 3UMTA 2H2SC 5DEGA 1OHZA 4OQ1A 1A2YB 2C9XA 2HFFB 5EWIL 1BMZA 3C5ZA 4NKDB 2GCYB 5JXAH 1CD8A 4HIHB 4D9RE 1UWGL 3SY0B 5D7LE 2Q2LA 4PTTB 3SDXF 5GSVA 3V0VB 3WO4B 5I8OL 2ESVD 1E67A 3QR2A 4PRAA 3W57A 5LBSA 2YBRA 4JM0A 3T8XB 2LU3A 4BYHA 1J5OL 5T5MD 4KK5C 3RU8L 2R69H 4H26B 5IOPA 4K9EH 3W9EB 2Y5EA 1JF1A 3QFDA 4PM1A 5IQOA 2X4PB 5CBAB 2Z31D 4GAYB 4JM2F 4X98A 2APVA 3RILA 1FJ1B 1Y6KR 4PW4A 5FECB 1KOAA 2BSTB 3KEDA 5FAAA 2RJMA 4M8UA 5EC1A 2ED7A 3WS3A 1X5JA 3RBGA 1FAKT 3ELAT 1T4KA 4YDJA 4NUGL 4OZIB 3MHZA 4XPBH 4OD1H 1DMRA 1GOFA 3ZMEA 4N6RA 4NO0A 2VIRB 5DD6A 2VM4A 4KX8A 3RIFF 1V3LA 5E6YA 3VTMA 1AMXA 2HJFA 4KAQH 3C5ZC 4U7KA 3IJ8A 1P5UB 2FJHB 4RMUA 3P30L 4Z7AA 3DSNA 1ET5A 1HEJC 1THCA 1UOVA 3PAZA 1PNCA 1WAPA 2O26U 2IAAC 2A6DA 5EO1A 4Z95H 4H8HA 3VFOA 5C0BD 3ZT7A 2OYKA 3HIZA 5ICYB 1J05B 3O4LA 2MQ3A 4FTDA 1NBCA 3HW7A 1ZRUA 1KN4L 1SFDA 1FE8H 3V7AG 1E8XA 1KLUA 3B34A 4AUUA 1DBMH 2D7NA 4QGTA 3CC5B 4BV1A 2CJUL 2OQJB 1UB5A 3OD3A 4NRZB 4ZSOA 5DJXB 1OTTC 4M02A 1UKTA 4IGBD 5GS0D 1QFPA 4OZGB 4Z7WF 4JPIB 4YXLH 3SHSA 4AQAA 2EVIA 3HB3D 3MV9E 1ND0A 1L7IH 5BOPA 1NDMB 2DTSA 3QUMA 2VZSA 4PREB 3HU3A 1TQVA 1PTZA 1ETZA 1NMAH 4PVNA 1H8LA 4R8WL 4KXZI 4WIQA 4FCHA 3RNQB 2EC9T 5DDHA 2F53A 3AB0B 1BZQK 5HI4C 1KEGH 1ID2A 4L3CB 1U3HC 3WNJA 3QWNA 3N1PC 2DOCA 5TQ2H 3HI1B 2X1QA 5D1ZA 1IC7H 1ZSDB 5BXFA 5MERB 4HUXA 1AZRA 3RA7L 4J3OG 3CZSA 1VEMA 4FNRA 3NIGB 4BKLA 3CVDA 1W0VB 2L3BA 3KWWB 2NY1B 1A9VA 4G5AA 4WCYL 2W88A 3BEWA 5F7BA 3M7OA 3BP6A 3O41B 2AJZB 4OB5H 3E38A 1ZDQA 2YBRB 3LH2L 5I8EA 4S1QH 4HV8B 4FFVD 1RZ7L 1SN5A 4X42A 5ANMA 2QEJA 3C8KB 5DHYA 2VZVA 3F7YA 3HPJA 3VMOA 4JUTA 5E1AB 2E27H 2AXGB 2MNUA 3RWJA 1RLWA 1UKSA 4H0IA 2H26B 3IDMB 3H4FA 3QEQB 4JFQB 4H8UA 2X05A 4XMLH 1CK0H 5IQ7H 1IIKA 1T4WA 2WOYA 4KQ3H 4KQ4L 4HKXB 5D5MB 3KW7A 4PS4H 2A69D 1KGCD 3MJ6A 3NK4A 3IAQA 5E08H 5GJSH 2CBQA 3O3DA 2WBKA 2B5IC 3KHOA 4YOKA 2X4UA 5TDNB 1J0HA 3WAJA 3GBML 3QIBD 5E8OB 3BI9X 3GTTA 5C86A 1EJ6A 1BZ9B 4CILA 3BDXA 2O93L 3ZRSA 1SMYD 2AK1L 3LDBC 4F8PA 1UA6H 2VM3A 2MFNA 3GSXA 2EUXA 1X5ZA 4NM8H 5F8QC 4MMZB 2RCSH 3ROOB 1ZK9A 2JKRM 1G8JA 1WQVT 3MKKA 3QDME 3W9DB 3QRFM 5DC2A 1A6UL 1QMUA 1C5BL 5D96C 3HUJF 1R3JB 4XZUB 1MJ7L 2W9LA 4Y7MA 3ATEA 2AJUL 5E2UL 2JKNA 2Q7NA 1JHKL 3VI4F 3EJZD 4NQSA 1FLRH 4QCIB 4NUQA 2X0UA 4Z8FH 4G82A 2FEDC 2E56A 3TYGH 1M7UA 1TJIH 4FNTA 1CD1B 4H20H 1CBVL 3HLAB 2D9QB 1D7BA 5FK9A 1M1XB 1GKEA 3BQUA 4JM2B 3NSYA 1JPTL 4GRLB 3SKJL 2IPTH 1HEHC 3D50A 2GUOA 3V4PB 3HMWL 4N2KA 1PQEA 2GY5A 2JI2A 4YFEA 4XNYL 4E9QA 2XX0A 2J21A 4NM4L 4EN3B 4IBVA 1MREH 1IBHA 1MHCA 2XG4B 3MOAL 1I9EA 1AZUA 4KTEL 5TDPA 1CFQB 1U92A 1Z3RA 2DMCA 2ZJSH 3ARFB 1ANUA 2Z4QA 4MJJA 1SXBA 5C70A 5KS9E 2CIKA 1V3JA 3K4DA 1T21B 4EBQL 4UT9L 3MLXL 1T03H 1NGWB 3DDFA 2OJZL 4OLZH 1BXUA 4E9LA 3IPBA 5L6YH 4ZMLA 4P3DA 4P05A 5LNEA 2PXYC 1ACZA 4GQQA 1KXQA 3P0YH 4J3OF 2HFGL 5DUML 2CGRL 3UO1H 3UZEC 3K8KA 4A2EA 4A6YA 3BUYB 4FTVD 1Z3GL 5AAWA 3MV8E 4HMCA 5FO9A 1UQSB 4MA8H 3SDXB 4PJIA 3RY5A 3DXAD 4AGOA 1QO3B 2EYTB 2NAPA 3VXUB 4JFSA 4W70A 3BO8A 3GLZA 5DYOA 4FI6A 4JN2B 5DA4A 2AJ3B 4PJXA 4R7DA 5E95B 3TONA 4BD4A 3FBQA 2IAND 2RH0A 4A7GA 2A6KB 3IXTA 2CO3A 1KYFA 4GKSA 4WK2B 4AENB 1SYVA 1T0OA 4BZYA 4JMNA 1SDDA 3DHUA 3IKCB 1BF2A 5FO7A 4GG6E 1XL6A 4AVJA 3TEUA 1YEJL 3T6QC 1UZ8B 4AE0A 1R46A 2BS9A 5IJVA 3WBDA 4P5SA 2XC8A 4G71B 4P2YA 4WSKA 3QUHA 2OK0H 2FH6A 1E4KA 3UL4A 3VE0B 1FQ9C 3MUY1 5FFLA 5JIIA 4O02L 3AXLB 1M7DB 1NBVL 4ELKB 5IJDC 2XWXA 5I30L 1BQ5A 2YOCA 2F9BT 3F6JA 2ZOLB 5I6MA 3QAZC 3FU5A 5JOEA 1Q0EA 2B16A 2BW5A 3O45B 2CBTA 3F7LA 2J44A 4KKRA 2VLMD 3RIKA 4C58B 5DMGC 5IHBA 1EDYA 2MOQA 2VSDA 32C2A 4MS6A 1CU4H 4OLUH 4WI5A 3S0PA 3TIDA 3AAZB 4ANXA 3FT9A 3VCLB 5IJKA 1SOKA 5IF0A 1B3IA 1FDLL 2NYYC 4RGOL 3OZKA 4IHOA 5IGXL 3MRIB 1KLFB 1T5XA 3QFGA 3QJTB 4AMWA 2GSGA 3UYOD 3KEHA 8PAZA 3DGGA 3G5YB 3QARA 3NRPA 1IAIL 2NY1C 2ZF8A 4H44C 3PP3H 4HIPA 3CWGA 4PBVC 1C5CH 3RVWC 3CBRA 2JJVA 2VDPL 4MXVF 4E9WA 2UXTA 3O0RL 4F9LA 2J88L 2HH0L 3EYSH 2CNZA 4I2XA 4YSUA 5EIIG 5EUKB 3U7AA 1TXKA 4U1LA 3DJTA 3VH8G 1MCJA 2VUOA 1UOKA 4KBPA 1WHPA 3QCUL 3TCXA 2WMPB 3LSOB 3OPZL 1FGNH 3MV7A 2FAUA 3GJFK 4APQD 4XC1L 4I85A 1G9MC 1YDPA 3UX9B 1YYCA 5ETUB 3TBVA 5C9KA 2VQUA 2GKIA 4PS3A 1GGIH 2K1MA 3ULVH 1DANT 2XWZA 5IMKB 4Y4HA 4P2QD 3L9EA 1CGVA 2B8OT 1QFWI 1JGLH 1N59A 3DX4A 4U6YB 3QUGA 5KVMC 3TZVB 1MFAL 4JS7A 2WWMD 5HI4D 4N2EA 4MFHA 5E08L 3SYCA 2Q5BA 2P1YA 2YSSB 4L29A 1X5FA 3BAKA 2N3JA 4OZHE 4I48A 1SLXA 1W15A 3O6LH 4W9JC 5GZND 1GTFA 3CXDL 2DQHL 2X2IA 4LCWE 2OMYA 1ZK5A 3SD2A 3L2LA 3NZ8A 3DX9B 3ULUF 2VLJA 1HXMB 1QCSA 3PFUA 1IFGA 5FDWB 1K8DB 3BZEA 3MLWL 5IBTH 3OJMB 3CZGA 5KVFH 4LPVA 2RQEA 4F9PC 4A04A 2HB0A 1A6UH 5B7MA 1F11B 1HSBB 2A9BA 3R8BB 1GC1H 2JJTC 4XODA 2FJGB 3B2MA 3UERA 3W0WD 1KENH 1RJYB 1PZ2A 5I1EH 2L7UA 4K5PA 3W56A 3LXAA 3AMLA 3L8QA 4BQCA 4F7KA 3F01A 4N0FA 4PG9B 4ODSL 3A3YB 4FMVA 1EK3A 2OSYA 4UTAA 2J5WA 1YQ2A 3VD7A 4IHBA 5DJDA 3MRNA 1TJIL 4JM2C 1HE8A 2BSBA 2X4OA 3OG6B 1SDYA 5HYFA 3MOBL 1JPTH 5IFHL 1Z0NA 5EOTA 2AK4E 1OP4A 2X3CA 2F15A 5EU7C 2ENPA 5GRJH 4GG6F 3VDCA 4O02A 1FBIH 5IVXF 1O6SA 2HLFD 2YQGA 3HPLA 3P02A 4TTGA 4V1DB 1XCXA 4Z7WA 1QEWB 2P45B 3BZ5A 1XSOA 4NBYB 4U1MA 3TJEL 5GGVY 4BH8B 2ZSWB 1FVCA 1PSKH 4U1KB 1AR1D 3L3IA 4GXVL 2BSED 1NUGA 1HILB 4IMLB 4N0UE 5HDBE 3CVIL 3D87B 1JHTA 1PKQE 2GITB 2VMEA 2VMFA 1MJ8L 3CHOA 4JX0A 4LIQL 4N9GB 4NI3A 3EDJA 2YN5A 2CPCA 3VVWA 1PD1A 5C0EB 1T03L 1BF8A 4N0CC 1OT1A 3F83A 4BDVA 2W9EH 1MHPH 3JWDC 2CGYA 5LQBL 3U0WL 3DJZA 1V7MH 3EYFB 1CMOA 3P0YL 4LCYA 5DUMH 4K5OA 2PYFB 3TH3T 1ZJBA 1G9ML 1WBZA 2DZEA 3VD9A 1JOIA 2NY2B 3CFJB 4N5ED 1CZ4A 1MDAA 4X4MA 4BE6A 5DJ2A 1RULH 1JYNA 3JYCA 5IHWA 2EDNA 4JGUA 1R1CA 4KTDH 5TDOB 1QYGL 4IRZH 5HHPA 3VSQA 2VOTA 4N8PA 4YS4A 1ZGLA 3LRMA 4HXAL 1WLFA 3TS8A 3ZE1F 2JV6A 1QPPA 3KXFD 5CJOH 3JUYA 3WLBA 2XFGB 4A63A 2WQXA 5T3ZH 4B97A 3ZMNA 4FI7A 3FQ2A 1E4KC 2PXYA 4CUCA 3EDFA 2C8NA 3HS0A 3P73A 4WY7L 4R84A 2XTJC 3BW9B 2DF3A 1J1XH 4UDTA 4KUCF 3IFPA 2VT0A 2E7MA 2AEWA 2Z4TA 3VFTB 4KK9D 5B38A 1EUUA 3CFMA 2HRPL 3ATBA 4FXKC 2V8LA 1SEBB 1PZDA 2BW4A 4GW4B 3I9GL 3VFSB 3H3KA 3GS4A 4OQTA 4M1GL 6PCYA 2XZCH 1WPCA 2D03L 1TZIA 3GBLA 2ZQKA 4UF7C 3DNKA 2G4EA 4ZO9A 4IOSA 2OP4H 4PRPD 5CUSL 3SE4A 2JTDA 3V7AE 5D7IF 2XI9A 3MBWB 1SYSB 1U91B 1NZRA 4UUJB 3WE6A 4OZHA 4NSKA 1CZ5A 1T89A 3S2AA 1AY1L 4NP9A 4WI2A 1YCSA 2BC4B 3HOGA 4PRIB 4PCTA 5HHQB 3N9GL 4L8BB 4YFDB 3NQKA 4NWUL 5DR5L 4A2MA 5C08A 4OJEH 3MRGA 1XCTB 5EIIA 4Z3HA 4GA6A 3T0EE 2PTUA 1P1ZB 1E9PB 2NOYA 1XR8A 2CMRL 1G7HB 2FWSA 1LWJA 2ILLA 2WUBH 2WV3A 4CADB 3GHEH 1ZA6B 4IOIA 1M6OA 2QFPA 1PLBA 2IANA 4IW4C 3V0WL 1J12A 4OLEA 5DJ0B 3LN4B 4PJFF 4RISH 4AYGA 5K59E 3EFFA 4ZUTA 1C08A 1Q9WB 3LEVH 1ML0A 2JJSC 2DTML 1UWGH 5C7ZA 1O6TA 3T08A 3F64A 4JB9H 4M48L 1KCUH 4YE0A 4BSWA 2P9RA 5DZVA 1ACYH 4FS0A 3OMAB 5EPPA 2KQAA 1ZSHA 1OAQL 1JMZA 2IMMA 1SXZA 5EBLA 3LRHA 4NZTH 1UT2A 4O2CA 1AD9A 1IL1B 4IRJB 3PLXB 2ZXBA 1TTBA 1B4LA 3CFQA 4RIRB 2DV6A 1A0QL 3KE0A 4LLWB 3TM6A 5AW2B 2WLJA 4AH2A 4RCAA 4KH9A 4J3VA 3H85A 2V2WB 1AACA 1DQIA 4S1RH 4XBGA 2DQFA 2H5UA 3DOIA 4OM1H 1NQBA 2Q8AH 3MNZB 4KKAC 1WGVA 2OTPA 2IWFA 5E8DL 4BFBD 2NY4C 3CN0A 3VVVA 3QJZA 5CR8A 2JA6A 5IWLA 4Y4HD 1WFMA 1ZHBB 4MYWB 4P2QA 3FQNB 4G43B 4AGNA 3S88L 4CW1B 3VI4B 3BH4A 1MCFA 1ZLDA 3FJTA 2XN9E 4LOFA 5CLZA 3AS2A 5IK3B 5TGBA 2GSIA 3EF7A 4AOKB 1S7RB 3MRFA 2GJPA 2OSLA 4TTDD 3W3BA 5ENWA 1VADA 1FBIL 4JFXB 3LNEA 3CF2A 1ZT1B 1O6VA 1AO7D 5AVRB 3TWCH 3WGVB 1I53A 5F7MC 2ENQA 4M8RA 3TURA 2LU7A 4BWTA 4BCYA 4BELD 2DBLL 2AXFA 3CVIH 4C4KT 5LCVA 5HYQA 2WP3O 4M43L 2QSCL 4JLRA 3OC8A 3CFEB 3L7EB 1FNSL 4R4NC 4OUOA 3EJQA 1UM5L 2EINB 3MXVH 4OZ4A 5F7AA 5DD0H 5D1ZC 2FYYB 2G4GA 1WA0X 5JHLL 3HC2A 1AANA 1BXAA 4LHJB 2JK5A 2VWEE 4X9IA 2FHCA 4PD4J 3TNMB 1S8DB 1NMAL 1U8OB 3JTSA 4PJGE 1DJSA 3Q5TA 4DOHB 1CL7H 3SY6A 5ITFA 4E9YA 3Q6GL 4IS6A 4P99A 5CU5A 5SX4H 5ITBL 4MZ3A 5I66A 3F12A 2JIMA 3ZRCC 4JRXD 5DUJA 4ZTOH 3IR7A 2YAPA 3C5SB 4R83A 4UOQA 1RVFH 4YLCA 1TETL 5B3SB 8CGTA 2ORBH 4ODWA 4A2FA 1SHMA 4M62L 2PYEB 3CFDB 3CFNA 1XGTA 2AV1A 3PDOB 1G1OA 3WDIA 1BGXH 4L9LB 3KBEA 1FL3B 4KK8D 4M61B 4PGDB 3TFBA 1KIRA 5EZLA 1S9VA 1U8HA 4GA5A 2BOBA 2QQNH 1UHDA 2OMYB 3K74B 1WRFA 2VXQA 4NAQA 3S3CB 4P2RE 4I18A 4XPGH 4PWFA 3FB6B 4HWZB 1F4WH 3VI3A 5BJTB 1MCQA 1ASQA 5HYQB 2EC9U 4KITB 1U33A 3FFCE 1FUNA 3DETC 4XMLL 4YGVB 2CM6A 1VFBB 2XN2A 2K7QA 3BKCH 1WFIA 2X4QB 4DKFH 3BLPX 1Y6NR 2OP4L 1B6DA 2JLPA 5IMKA 3MGOB 3ARBD 2OL3B 3ES6B 2ZCLH 1NSNL 1NFDE 2JKSA 3B9KB 4MQSB 5C0ND 2GTZA 4IDJL 5IKCA 1S7RA 3X2MA 1C12B 5IK3A 2QHRL 2DQIL 4ZS7H 4GKZA 4N0RA 2H1XA 2O5YL 1WG3A 2UWEA 2VO8A 2HT2D 5D7LD 3JXAA 3SN6N 4ODVH 1UXMA 3UTZB 1IGTB 3HG1D 2EUVA 3OKMA 1L5GB 3VFMA 3WN6A 5IUCA 3D9AH 4BKTC 5J3HD 1YJDC 5F7EL 1SRDA 3N9GH 5DR5H 4W9GC 2IXQB 1YYML 3RHWK 4PY8I 1B9ZA 4WUUE 2C9AA 4NCDA 1U95B 4QIWA 4GS7C 4PB9L 5TF1H 2G2RB 2QPDB 5E2UH 3VQ2C 4EDXB 4LDCA 2P5EA 2HFEA 5C6PB 4ABQA 3U46A 3GHEL 2W0PA 1QASA 1CFVL 4JO2H 3WAKA 3FKIA 4XCNA 3V0WH 2YWZA 1NICA 3UBHA 4DEUA 4EUPG 4Y2DD 5KYWB 1ICTA 1GGCH 2IPTL 2O6DA 3G08B 3MROB 2AITA 3L3HA 3HMWH 4K7PL 1IGIL 3TH4T 4JB9L 3KBHE 1WCBB 4FQQB 2ADIB 2EAEA 3QQDB 2CDEB 1ZHKA 3ZTCC 3QUZC 2P7TB 3HAEH 1FAIH 1UEYA 1A1NA 2Y7MA 1HXKA 4OT1L 1DVFC 3AREB 4FABL 3D12B 1P4UA 3FUMA 3HZMB 1SXAA 4J27A 2D7TH 2YPKB 3ARDD 4YSCA 5IMLB 3GTNA 4U0RC 3ZQWA 1NAMB 3JWNE 4OGXH 4JDEB 4LKXA 5FXCH 3L95A 3TFKC 5JXED 3GSVB 2Y72A 3QWOA 4JO1H 3K2MC 3QYNA 4G9FD 1OAZL 1TZHA 2YA1A 1I4FB 1T2QL 4MRBA 4CDGC 3QQ3B 4N4YB 4U1IA 5IFAL 4ACTA 2XVGA 3MV8A 4N85A 3GLAA 4DTGL 1WYJA 5I9QC 1QDNA 1XGQB 4JHAL 4GO6B 3L5WA 3FC8A 3MRGB 1MCPL 1E4JA 2HT3D 4IKJA 2EYRB 1IM9A 2E86A 3CAFA 2GC7C 1BBJB 1BSIA 4L2YA 2HKFL 2WINA 4MJ4A 3EBAA 3LIZA 3RI5K 3VG9C 2A6IA 3DDGA 3MUUA 1CXKA 2ADGB 3SBRA 2LLNA 4QRRD 3IDGB 5J3HC 3NA9L 3ZUCA 3X2QB 2Q10A 3GSVA 1SLVA 5I1IL 4YFLF 1E3XA 3C87A 1Y1WA 5T8IA 5F1NA 1CF8H 4PRNA 3H54A 2YGPA 1HAUA 1X7QB 1FNLA 4N26A 2FR4A 5LAXB 3VRIB 1UJ3A 3AT9A 1TT6A 1SHWA 3A4FA 4CVXB 5IVXB 2KPWA 1HESA 5BQDA 2EKSB 2WCPA 3ZYZA 3QQDA 4AEFA 1FZKB 2QLVB 4B9YA 1RHFA 4FQQA 3RL2A 1I3GL 5ALCH 1Q0XL 3ARFA 8FABA 1W0YT 3UTOA 2G5BA 1BVKB 5A16A 3T2NH 2QV2A 4FXTA 1TQCB 4NXSA 4QXWA 4WWKB 4HPHA 4UILL 3CDGA 3GSWA 1IKNA 1DCLA 2CLVA 4HUUB 1S7WA 5E9DE 5EC2B 5CWSB 4M7JL 4HHGA 4RMBA 1YPZA 2YD5A 3K1KC 1RV6X 5H37H 3CU1A 1SHSA 2NDGA 4CC0A 2R56H 5CAYB 1CXIA 4OCXL 4G83A 4HU2A 3QG6A 4XP1H 4HIIA 5GJTH 1C16A 4C56D 4WLCA 3IS1X 4APQA 1KJMA 2HAZA 1KB5H 3M8OL 4LHUA 4NN5B 4FFZA 4QUOA 3IU3A 1RJCA 2LQRA 4WI8A 5BVPL 2APFA 1TZ8A 1T6WA 4YDZA 5J12B 3DTUB 4JM4H 1YUKB 4OKVB 3ARTA 4W6YB 5LHDA 5BOZG 1XB6A 3UTTB 3G6DL 2OTWA 3O0RH 1E5VA 4DFHA 4DW2L 3VGEA 4OIIL 2R29L 1BGXL 1WBZB 3GSXB 3QRBA 2BSRB 5ADOL 1G9NC 1U8KA 2QZ5A 2ATPA 2QVFB 2WN3A 4I0PB 1PQZB 3D2UB 1UWXH 3FRUA 1N3NA 4YHIA 2V2XA 4E41B 2OMUB 2QTEA 5JIPA 4ZMWA 3NCJH 2BXZA 3NT0A 5FGBA 1RKRA 3FUJA 4HKXA 4ZFFA 1A1OA 1D5XB 1ORQA 2V9UA 4O2FA 5EC2A 1HIML 4JFDE 1WFTA 1VDGA 4ELMA 1RPQA 4ZXBB 3FTYA 2JTYA 5I8CB 4GKNA 4LMQE 1FRGL 5IQ9B 4BCZA 3GSQA 5K1JA 1U3HB 1JI1A 3BYYA 3N44F 5ANMB 2WTRA 3TM7B 1NL0H 4P46A 1ZHLB 2FLBT 4Q2ZA 4D0BB 2EUWA 4HT1H 3U30C 5BUPA 1CD9B 3W2DH 1F18A 3WO3B 1F00I 1YUHA 3O6KH 4WI0B 5F7EH 4WFGD 5KSBF 5MEOA 4YLQT 3VD1A 3UG4A 2NX5E 3NTCL 4DQOL 1ZT4A 5GGTA 1NKRA 4W6XB 5DVLA 4BKLB 3V95A 4FQHB 3WJMB 1XR9B 5I1EL 3UH8A 4YSQA 2PMZA 2UXVA 4A7VA 4ENEC 1M2VB 5FB8B 5F7KC 2IEPA 3IDNB 1PT1A 1T5KA 5DK3A 3CMGA 4OVVA 1HHJB 2ATKA 4JJ5A 4LLDA 3F04A 4OF8A 5B4MD 3SPHA 4BSVB 3REWA 3VW3H 3OR6B 5I74C 4PREA 1E9QB 4O2FB 3L7EA 1H3TA 4GI9A 3UBGA 1NDMA 2NUTB 1D6VH 4HC1L 2EDXA 3QUZB 2IF7A 1BA9A 1GS6X 1IGFH 4MHHG 5IJBC 1I4FA 3FT3A 1X9LA 4DKTA 1EGJA 5DJXA 1FAIL 3TJEH 1EBAA 1W6WA 3WFBH 4K7FB 3RDTD 2B4CH 2FIKB 5I24A 1Z9NA 4L3EA 4OGXL 2F7OA 2YPKA 4HZ1A 3KJ6L 3L4VA 3UGEA 1K5NA 3T3PB 2W60B 1YDPB 3BP7A 1W6LA 1HCYA 1ZHKB 3TZVD 2R8SL 2ZUYA 3AZUA 4QRSA 5BZXA 2HG5A 4LE8A 1MCSA 1TTRA 2NY6D 2YO3A 2CCVA 4WW1A 2YGVA 4DK3A 4BM7A 4L37A 2X09A 4QXTB 4XI5C 5BMFL 1G9MH 3AFLA 4KRMB 4Z7OB 3KG5A 3S7GA 1UCBL 2J1YA 2Q0ZX 4I2XB 4RFOH 4JQIA 3FK3A 1K3IA 1F90H 3EJYC 3NG5A 2CA3A 4JFHD 4HIIB 3ARYA 3UEQA 1KJ2L 4G6MH 1BECA 1OSEA 3F6LA 1A7RL 1TQTA 1L0PA 2OPCA 5CJOL 4JVWA 2MNJB 1HH9A 4JQVC 2PO6D 1HWHB 4MJ5A 1YEGL 4LSPH 2FHFA 2X1XR 1IAMA 3D3VB 4P4KD 2GTWB 4G8IB 1LO2L 4WEEA 3X12A 2V5RA 5MP6L 4LCVA 1CGSL 4PTUA 2J6WA 1S9KC 2ZX5A 1CGXA 1GYWA 4JAMB 4G1MB 3WKNA 4X9HA 3X2HA 5EHFA 5DUBB 1IRAY 2KKQA 5EF3A 3C60C 2E47A 3O3EB 4FG0A 4GSRA 2LR4A 4F3FA 3AG3B 3WKQA 4L05A 1S5HB 1K2DA 1VB9A 3KYAA 2JI1A 4G6KL 2XTJE 1E4XL 3GT6A 1UA3A 4XP4H 5ID0A 2DM3A 4PJDF 3VMPA 4MQTB 1C8PA 1CDCA 4AIEA 1DN2A 4YGVA 5GHWH 5CGYC 3QB7C 1Z9SB 3BH9A 5FGRA 1E5UI 1ZXQA 4LT7A 4AUJA 5HHQA 1CICB 4XN1A 3M8OH 3N42B 1LD9B 4ISVB 4L8DB 3FOMA 2DPKA 4WW1B 3VRJB 2FIRT 2DD8L 1UZ6F 1OKEA 4RWYL 1AY1H 3F8UB 4JN2A 3ULVE 1DL7L 2AV1B 3G6DH 3PDOA 3ZE1B 5KSAA 3V79C 4PJIB 3P3UA 4EI0A 3IFLH 3BKMH 4F7PA 3T1WA 4EIUA 3STLB 1OK0A 4FQHA 5I75B 2NYYD 2KUTA 4G2AA 5D2NA 4KU1A 3OM3B 4P49A 4NBZB 1R5VA 4N2FA 4YHMH 3VXUD 3O3BB 3HZMA 5I6KA 5MEQB 3DXAB 3G5ZA 1BZ7B 3D39D 2PNWA 1MAML 3MLZL 4GT7A 4D2NA 2J8UB 4HIEB 4O58L 1EEQA 2YGQA 4P46B 2QADD 1EHNA 5DC0A 3ZE2B 4ZG1A 5C0FA 2ROXA 4DGUA 5IQ9A 1OO2A 2F7RA 3VFVA 2BINA 1KCUL 1NWOA 4UMGA 3S5LA 4DZ8A 5HVHC 5KS9B 5DRXB 4KNTA 1SFHA 4FQIH 5BRQA 3QJRB 5JHAA 4LLVB 2E8YA 5FYJU 4HETA 4B9KC 3HNVL 5AG8A 3QT2A 2MJWA 4OQTL 1XEDA 3K5RA 3WTUA 1E28A 4LVHB 3IGLA 4KWUA 3AW5A 2YRZA 2BNQA 3ARFD 3TO2A 3FU7B 3SPVA 5IP4A 1FP5A 1G1CA 3T77B 4B3EA 4IIZA 4R26H 5BO1H 4JG1L 1AQKH 4P5RA 1FSKB 3MACL 2X0VA 4YE4H 4MX7A 43C9A 3NTCH 2YUVA 4DKEH 4JHBA 4ESKA 3PREA 2DWXA 4JFEB 4XGZB 1IFHL 4GUPA 3FFCD 1SMDA 4UM8B 3GSQB 1SF3A 3MLSH 4OZHF 3K71B 2B9AA 1HQ4B 1VGKB 3G5XA 3HNTL 3QRGH 1D3CA 1IILE 3LQMA 1ASOA 4RZCA 3WU1A 1A1MB 1U4EA 3FCSA 4H2CA 5HD8C 4NIKB 1DBKH 5I1JL 4PVMA 5F1OB 4HJTA 5E6IC 1ZS8A 1UXSB 1WUZA 2CUIA 3FQRA 4OJCA 3ZU8A 1JDDA 3VFPA 3WHE1 1BZ9A 1CZ8L 3U83A 2FX9L 1T80A 2B1HH 1KCVL 1ZKAA 1IGFL 4LZKA 1Q8MA 3EFDL 2WSDA 5FWQA 3C75A 1L7TL 1AHWC 2V2XB 3LKSA 2QSTA 3QDJD 3BWAA 3MBED 1XTLA 5AYQA 2ZP8A 5BVJB 2ATPB 3CDZA 3ZZSA 5LKNA 2XN9A 7FABL 5EBWA 5F3HB 4TUOB 1QKZH 4NQDA 1I8KA 3SPGA 3TBTB 2YA0A 1MLCA 1U8CB 5B1JC 5L0QC 1DJHA 4M5ZL 2V2TB 3QEQA 4JFQA 1AD9B 4JG5A 5AW7B 2JIPA 1AGCB 1YVLA 3FSAA 3S5ZA 4PJAE 2A6JB 5DFVC 3ECVA 1YNJD 4OV6F 5CSGA 4UQ3A 5JW4M 1IAOB 1UB6B 3WE1A 3G5ZB 3TXAA 4AV0A 1I1CA 5CM1A 9PCYA 4YBHA 3QEQD 2IDSA 5I8EB 2XV2A 4QKXB 2P3YA 3MUHL 3IF1A 1U2HA 2VLRE 3V52H 5I1KL 3NAAH 3PABB 4KI1A 5GISL 1KJ3L 2CIIB 1ED3B 2ZAHA 1CICD 3RWFB 1BG1A 2JI3A 2FX8H 5G5DA 3UO8B 1DDTA 3BCDA 2G3XA 3RJDA 2GB2A 4UBDD 4EI6B 4YL9A 4D0CA 4LRNH 2ORBL 1RZ8B 5FCSH 2BHYA 5C08B 3ROLB 4TULH 1RZJH 3U79A 3WGUB 5E6SB 4HX1A 1T1XA 3DGCR 1VFAB 1F86A 1MCCA 2ZYRA 4A1RA 3MCYA 2WBWB 4I48B 4G8AC 4IJTA 2AJSH 4L29B 4PJ7F 5T1LA 2B3IA 3L3OC 3D34A 4LSDA 2N1KA 4IMKA 2OA9A 1DBAH 3N3EA 4LLQB 3WKYA 2WWNA 2C9RA 2OMZB 3JV5A 3GIZH 3VSVA 1YMMA 1S5HA 4M6MH 1KPUA 3ZL1A 2FO1A 3KYMB 5M95B 4UBDC 1IX2A 3T0ED 3QNFA 5C2BH 1FFNB 3DVGB 4JKWA 4NHUB 4BFNA 1U3ZA 2NY2C 1T7XA 2O6FA 4U1LB 5D2LA 2PO6B 1JNLL 2VRKA 3VWJD 2WLMA 4XMVA 1S3SA 3EJUA 3TBWA 4XTRD 3BVVA 5EO0A 5DD3L 2CHWA 4JO3H 1R24A 2CM5A 4HBCL 1KGYE 4EZKA 4FZ8H 5JA9A 2NW3B 3LKQA 2YD3A 1P9MA 1G7PA 4TQPA 4LVEA 3WTSA 3OWRA 1NIFA 4NKMB 3V4LA 2Y3NA 2ENJA 4XHJD 2XPGA 3GHBH 3WFDH 4B95C 1FF5A 4E9SA 1WWBX 2NY6B 1NJ9A 3B7UX 3U4BL 1FZJA 4J1UA 2R4SH 2AVFA 4OZGF 1IKFH 3AG4B 4PB9H 3EYUL 4R5TA 2OJEB 2F54B 2ZX9A 4Q58C 1EANA 1R47A 2R0WL 1THAA 1EXGA 4UMSA 4XMPL 4GH7B 3OKMB 4JO2L 3SEPA 4D9RD 4L3ED 2XU9A 4ZTPL 3K0YA 4F91B 1NLDL 2OJ1A 2P5WE 1JPGB 5EEYA 3D6GA 3KBPA 1BZEA 3KL3A 2ESVE 4KO9A 5AOKA 3JVFC 2X89A 4UAOC 4IGBC 5GS0C 5EU4A 2Q1EA 3ML1A 5D7IE 3HG2A 2H6UA 2Z91B 2VR5A 1XD0A 2M83A 3SDDC 5D71H 2EC8A 1I8LC 3FUEA 3PG2A 4F33B 1K5WA 1OCCB 5T3XD 4BDVB 4ZOEA 2HVKB 2IH3A 3MREB 3PGCA 4FABH 3D09A 3ZE0E 3BVTA 2X89D 3C5ZB 4G70B 3FN3A 4HHWA 4HF5H 4P8QA 3RFZC 3KHQA 3KYKH 3MRMA 3NIDF 5LN8A 1E6JH 1KUMA 3FPYA 1TIUA 3OAZK 1GPOL 3RGHA 2CLRB 1IGTA 5C0JB 2BIHA 4QI3A 3VXTA 4JG0L 2JF1A 4NQDD 4P48A 4K3HA 4A67A 1UENA 1AMYA 2BOBB 4UZGA 3X11B 2W65A 2R0KL 2FEDD 3T4YB 3ZMRA 3ZSSA 5HYJB 1E3ZA 1A7NL 2NYZA 2PCFB 3L7FB 3NFPA 3OGCA 4MJIA 5E0FA 3TTSA 4YVUA 4W9HC 1OGYA 1XGTB 3IDXL 2GHZA 1UH3A 4QRPB 4QYAA 3MGOA 2CIIA 3SE6A 2AJVL 4Q6YA 3REVB 2ZWLT 3PABA 3SE4C 3H53A 4XNQB 3JZYA 2B0SH 2X4QA 3GFUA 3GJFB 4LGSB 4RMQA 4FLSA 4QHPA 5EDSA 2IBZY 2NX5A 3LQAC 3V55A 4DFIA 1DHKA 4PR5B 5I6XC 3BUPA 3BZ4B 5MENB 1T1ZA 2BS71 4HWZA 1TZIB 3VI3B 4DETA 3F12B 1EZVY 1OTSD 2Q7YB 1VAHA 3MLVL 4MNGB 5DC4B 1T1XB 2FRGP 1SEBA 5ABAA 3GTQA 2F18A 4F58L 3GRBA 5I8CA 1T20A 4JPKL 1QLFA 4PJAB 5IW6B 1YEEH 4QNPE 2LTQB 3H3PL 3DKHA 4FQJH 4IBSA 4PBDA 1SNRA 3PCYA 4APXB 4PJAA 2C9PA 5B1JA 5ALCL 1OP3K 1S7SA 4XH2A 1QAWA 3TBTA 1JCVA 2R69A 3U1QA 4X80L 1BM3H 1JFHA 1IGML 3PWVA 1A4AA 4PFEA 1WUNT 1WAAE 2VLKE 2XQYG 4PLKC 4ZO8A 3CZBA 1CXFA 1MFCH 2FTAA 2W9DL 3QZWA 4QY8A 4KKZA 3X2GA 4RLDA 3GXTA 4UT7L 3TEYA 1CYWA 4GAAA 3BZ4A 3SBWA 2LLGA 4M93B 2EADA 3A4EA 3OHXC 3DTXB 5LXGL 1EAPB 2R56L 3A0OA 3BJ91 4HGWA 2I25N 3HC0B 4UQ3B 4ZMAT 2VDMH 1U2CA 5ECGA 5HHOD 1JVKA 4KMTL 4TNGA 3W1ZA 4RZCB 3I02A 1AQ8A 1M7IA 4HCIA 2IGFH 3NFPB 3MV7B 4MJIB 5DLMH 5GS0L 1MHEA 5CZXD 1PJWA 1EXUA 1X4ZA 4X5PA 4ZX3A 3PGFL 4S0TD 1QWUA 5JNYA 4CW1A 2V7HB 2AGJL 2D7PA 3KLLA 5E7BA 4MAUH 3L3OB 1JG9A 1H6UA 4PJDA 1ZHBA 2NNCA 4Y1TA 3GD1C 5EORL 3RIAF 3ZL4H 4OIIH 1MXDA 1TVDA 3APDA 4Y16B 1NCBH 2X4NB 2YXWA 3FO1B 3V6OC 1JHTB 2GITA 2DICA 3GBNL 3GF8A 2DKUA 3ZTNH 2H3XC 1GGBL 3LDBB 2FGZA 3B7TA 4N2BA 5AYTA 4XNMA 1E28B 2I9TA 1CDHA 5C0RH 1IEAB 3I3BA 4JP6A 1GMEA 3LXBA 2YXVA 3C2SA 4V1DA 5BZWA 3VM7A 5DRNA 3QI9D 4LOVA 4O02B 5A16B 4MDIB 3UEZA 5ISZD 2EIZA 4PLOB 1RXLA 4U3HA 3DETD 1OP5K 5DI8B 1GS8A 3BIAX 4GUPB 4W6WB 1EVUA 2VDNL 1OM9A 4HLZG 1JF6A 3PWPE 4JFFB 4G43A 1TWGA 4I77H 4PJAF 3K4AA 1ZY9A 2BNRD 1CT8A 2NUPA 2X1OA 3LQAL 3K1DA 1HXYA 4HS6A 5IB2A 3FAWA 3QI9B 2XZZA 5ICUA 1MCWM 4KV5E 2Z1PA 4N0FB 3JWDL 4G5ZH 5IESL 4NRXB 4XI5D 1BFTA 1NJ9B 1MCDA 1TYRA 1YPZF 3O6ML 1PQHA 5I2IB 1UZ8A 5IBLC 4GIPD 2YFNA 3IDGA 3MNMA 3VXQA 2J1XA 2P8LB 5GRYA 4P2AA 4G42B 3UBXI 5DJZB 5IM7B 1MQ8A 6FABH 1MQKH 1YNLH 2WINB 2XTJD 4JY5L 5TD4A 4ZPVB 4X0NA 4FP8L 1BFSA 5D55A 4NO5A 4WEUD 5BPPA 1HXMA 1GIGL 3HJ0A 1KCSH 2OLDA 2A74A 4FHBD 4XMUA 3NEEA 2AEIT 3UJTH 5JORA 5EU6E 3S3JA 1A7OL 4XMPH 4ABUA 2NVYA 2Y22A 2F58H 4M7KL 2UY7B 5AW6B 5FGCB 4EIBA 5HXMA 2EYTA 5F7WC 4WEBH 1AA6A 4D9QE 4DO5A 3MI6A 1RIHL 3TZVA 3QG7H 5HHOB 5MI0B 3FO0H 1XT5A 2V5YA 3DUUA 4WHYG 2KBGA 1T22A 3FT2B 2FQFA 5AOZA 4PJ8B 2DQCH 4KRPC 3MMEA 4YVNA 4ONFH 3HE7C 4E5XB 1Y6MR 4Y5XA 5GGUB 5DO2D 3Q05A 4AKQA 3AUWB 1Z5YD 1GYAA 4R7NA 4L8BA 4POUB 5PAZA 3BMVA 1BFOB 1E6JL 4KTGA 2LVCA 3KLKA 5D93C 2A1WL 4YC2C 5LXVA 1EHLH 2EDLA 2DLHA 1J9CT 2IH9A 1S9YA 4ZW7A 3NJNA 1ZAGA 2GJ6B 3UZEA 2DQTH 1CYXA 1SYSA 1U91A 2Z35A 2ZYSA 3P2DA 3Q3GA 5KANG 4AQEA 3BQUB 4JM2A 1QSEA 4JFOB 3O3AB 4FQLL 3ILPA 3U4EA 2DEYX 2ICCA 5MEND 5L2KE 3AWEA 1GJUA 2HVBA 4L9LC 3NJXA 4BK5C 1PMYA 2ZOKA 2J6EL 3Q5OA 5D4IA 1LILA 3QFDB 3VXME 3JV4A 4E68A 4UYPA 3GI9H 1HCZA 1ILSA 4XN9A 4P07A 3EBHA 2FEEI 3QCTL 1F8TH 4KMLB 1AGDB 3JWOL 5HYJD 1JS4A 3AXLA 4JPKH 1DUZA 3TT3H 4NQDB 4HCFA 4F7CB 4N2GA 4L0PB 3N44B 4O9HH 4K94C 3M17B 3GWJA 3Q1SH 2Y2YA 4UINL 3OZ9L 1HQRB 2UZYB 2HFFA 3B9KC 5C0BE 1AG6A 2DWSA 2FECI 1MFCL 3PP4L 4MDJB 2HJLA 4AKPA 5I6OA 1NGPH 2V9RA 4XVSL 1E8WA 5BJTA 4G6KH 3MX0B 4HG4J 1OGSA 3EJPA 4AQ1A 4YSAA 1JGUH 3ARXA 4KO7A 1UFUA 3IFNH 3NFSH 4XX5A 4V2BA 1KGIA 1ID5I 2Q3ZA 2R23A 3QIUD 3RRQA 3GZKA 2WYTA 3ARZA 3EHBB 1JYWA 2J8UE 2K8QA 4LPCA 5JOFB 5AVWB 1QUPA 3V4VL 1U58B 3H0TB 3OV6A 2Q86B 4URKA 5JLZA 4UI2A 1I31A 3E2HB 5K69A 3PNRB 5DGRA 5FYLD 5AAWC 1MFDL 3TV8A 4TUUA 2VDLH 1BJ8A 1G94A 3GSUB 3C09C 4ACPA 1YMMD 3EO9L 3MTXA 4KXAA 2YUXA 4ZO7A 4A7QA 4FN0A 1R9TA 2MKLC 1KCWA 3PJSA 1FC1A 1A25A 3HHSB 2DQGH 2X28A 4MB1A 2BNQB 2JJUA 2AQTA 3TNNA 2BH0A 1BYNA 1FHNA 1J0JA 1ZHLA 3ABZA 3V0IA 3WY3A 3MGTB 3EDKA 4FL4C 4QF1B 5DHVH 4HOZA 5I1LA 5AZ2H 1XZ0A 1N6QH 4JZOB 4WHYH 4W9LC 4UOJA 3UGUA 4JFEE 4KJYA 3VFVB 1KJVB 1XZ0B 4YDMA 4DSYA 4KAQL 5D7EA 1QHPA 3DX9A 1X3DA 3QHFH 1TEFA 3P30H 4J28A 4J3XA 4LNRB 1TU2A 3LS4L 2JLLA 1UKQA 4ANWA 1KZYA 2EEBA 4ZFZA 5DQ9A 1ODUA 2WLKA 4MMYA 4NAMA 4RAUA 5FKPB 4PJCE 4OZGA 4KVCH 4EN2A 1MWAA 1N4XL 3O3BA 4Z7VA 2HYMA 3HNVH 4ECNA 1IBDA 4QHUB 4Z95L 3BD5A 1QTPA 3EO1B 4ONGL 2F0CA 5AAMA 4MRCA 3FQTA 4ADIA 2E9BA 4DPAX 2E75C 3WKPA 2XXCB 4Y4HB 2MIZA 4FE9A 3FTXA 1U58A 2Q86A 3H0TA 1WWCA 2WZ5A 3NJFA 2V17L 1X5LA 4Q6IC 4Y9BA 1CUOA 4X4YA 2AMGA 4YH6A 2XZAL 5A6IA 1AZCA 2JCCE 1ORQB 1VHPA 4X7DC 4YWGL 4GXFA 4NHCL 1DZ0A 1CBJA 2D3NA 3D85D 5L8LB 1IO4C 4NZUH 4YHNB 3GIVA 2QQKH 5SV4A 3LQZB 4C8XA 3MNZA 4LCCB 2FUQA 3CFCL 1Z9SA 1RK0A 3SBWC 4N6RB 4NO0B 3NZSA 3U9UB 4X7FC 1KIUA 2R1WA 1YSOA 5HI3C 5KVGL 3VXPA 3FTZA 1RUPL 4UYQA 2VC2B 3CNKA 5E2TL 2B1HL 4LLWA 1D7CA 4KRPB 4YO0A 4FHKA 5EEWA 2CKBB 2IG2L 2BSTA 2JCCB 3Q43A 3U9PL 4FKEA 2Z3FA 2ZOUA 1HCVA 2BZ7A 2NMSA 3N1QC 4GSDL 2DBJA 1WAAF 3L1OH 4O5LL 4WKZB 5IY5B 1RCYA 5EUKA 3RVXC 5J0BA 5EEVA 4G9FA 3RUGB 3IU3B 4IJ3B 1GZHA 5GS2H 1DFBH 3LB6C 3ZDXF 2XFXA 4ZUTB 3KM1A 4FOMA 3GXPA 5DJYB 3X12B 4I9WD 1M53A 1EHLL 2NZIA 4HJEA 4BCXA 2AJZA 2XFXB 1L4IA 1CIDA 1CJYA 4KKCC 4LAJH 5HPMB 3DGGB 3DX6A 5J12C 2ALWA 3ARSA 3MJ9L 4KQ4H 2AE0X 3A22A 1ZHNA 4QTIL 1DQDH 1CO1A 3MLRH 1BAFL 4NKOB 4Y1AE 4L3CA 4ZAKD 4AM0Q 4X83A 1PAZA 2F74A 4IK7A 1KJ3H 32C2B 4KUZH 3RNQA 3U0TB 2G2PA 4YIQB 2WLLB 3S4SA 5AKTA 3SO5A 2F8VA 3B6SA 3RL2B 4XN4A 1XIWD 2I7SA 2X4SB 2WNWA 3CZNA 2XQBH 4HDIA 4DP9X 4RDQG 4PGCB 2AJSL 2A0LD 3ZDZF 3RVVD 4J5VA 1R5WA 1WJ3A 5DU7A 5JPNB 3QEHA 1TYJA 5IJVB 5D7JA 2LFEA 3FSVA 3DUHA 1XZWA 1VZHA 1J9SA 2UUDH 2ZX8A 4JQXA 1PZ5B 1FLRL 4UNTA 3NJKA 5KUMA 3CFUA 3GIZL 3TEXA 3G9VA 3VRLE 2J2ZB 3F65A 1S2EA 4NNYB 4OD3H 1J5CA 4X6DE 5MEPB 3VD2A 1HEZB 3QISA 5JUEL 1TKWA 3OC5A 3MJGX 2LVEA 3GDCA 4U2ZA 1O7DE 5DJZA 4ANVA 2BRRH 3WXVL 1WTLA 3BW9A 1RP8A 1M2VA 2OR9H 2YLKA 3MOAH 5KOMC 4DWHA 3KPRD 1A5FH 2AC0A 4DN4H 5HGDA 2EICA 2K78A 3TBYA 1WWAX 1HJBC 1WICA 2Y7QA 1G6VK 3FONA 1DJGA 1YNKL 5IB4A 1Y7VA 1HXYB 1ZLSH 4DAGH 2AQQA 1RIVL 3DV4A 4NQSB 1R3KA 2WLYA 4AYEC 2ZPKH 5L4FA 2XWBA 5HY9A 1ADWA 2IAMB 3J7HA 1ZLVK 4PJBE 1JF1B 1BOGB 1EJOL 2CRYA 3L13A 1KCKA 4CN6A 4N9OB 2EIZB 3A23A 5DRNB 4JE0A 3W9DA 1AR1B 2RFXB 1F2QA 2K70A 5DMGD 4WI9A 2X9YA 1KN4H 1PU0A 2W07A 1UYWL 4KX7A 5FWRA 2P47B 2N59A 1UG9A 4NKDA 2V0AA 2IO5A 4BWUA 4E5XG 4PN6A 1FVCB 4U1KA 4DP5X 3SQBB 5A3ID 5B22A 4XZUA 1CICC 1WZMA 3HPLB 3PP3K 2O5XL 2BSRA 1N5YH 1MHEB 2FT7A 2QPEB 1AOHA 3U4AA 4YDVA 5DWUL 3GSOA 3V8OA 5JO5A 3MV8D 3VWKC 1GPOH 4LSSH 2A83A 2J1WA 3B9KA 4ETQB 2B4CC 2XZAH 5KYUA 2Y7NA 1OARL 3BUTA 5TQ2L 4OR1A 4PPTA 2V33A 2NCEA 5DJDB 2BOCA 4YWGH 5CBEA 4LEEA 3HA0A 4RFEA 4D8PB 4XAKE 4X8JB 1JPSL 4BIKA 1G1YA 1PYWB 2FJUB 2ITCA 3IDXH 4FMFA 4Z0XB 4F1SA 3EOYG 2D31B 3K2UH 2GT9B 3VFGL 4IEFA 4ZFOA 5FPIA 3DA0A 2XBTA 3LPPA 4QY8B 2BVEA 4TLUA 5D6DA 4JEGB 3RWCA 4C55A 1I3RB 1NGZA 3FF7A 4YBLB 5T5NF 4CKQA 5HDLA 1NCGA 3UC2A 4XH2B 1ZSDA 5A2AA 3L16A 4H1LA 4ZUVB 4APXA 2IWKA 3GSWB 2QKIA 3OF6A 2B77A 3SGEI 3DROB 3I6KB 2N0KA 2R2EB 1DP0A 2DQ6A 3QS2A 3QAQA 4MQXD 1MUJB 2N7SA 3HS0C 3ZT6A 5I19L 4PJEB 5ANHA 4OM0H 3CHQA 4RX4A 5DVPA 3KPPA 5TPWL 1YG9A 5GRUH 3RX9A 3FOLA 3LHPL 3RGVC 1YY8A 4PSRA 5GJSL 2EVGA 3BEWB 3ZL2A 1IGCH 2EXWC 2PW2A 3MRDB 4XRCA 2ARJQ 5EZIL 1LQSR 1FSKC 3IJHA 4KH2A 3VYNA 4YAQB 4EE2A 1G7QA 3D85A 3QZNA 1BX2B 1KT2B 4ODXB 1G7LB 2ZIDA 5FYJL 4WI7A 2XWTA 1UGKA 4ODUB 5J9PB 2LABA 3MTRA 5EWIH 4J8RA 1BF5A 1AIZA 5CJXA 3GTMA 1X7TA 3MGAA 3UBFA 5ACZA 3J07A 3VXRA 3SKMA 1R6VA 3B9AA 3X11A 5EG6C 5J1SC 5HBBA 1R0AH 1MWOA 3PPEA 3KH4A 4KUZL 4J2QA 3GEFA 4OVUA 2WVTA 4LSRL 5CN2A 2BFVH 1RZJC 4BE5A 4QLRA 5TFSH 4G7QB 1LK3H 2J12B 3TBSB 4YUEH 4PWIA 2VDQB 2WJ5A 3EO0B 2CPUA 4W68A 3K81A 3MLUH 4WW2F 3HAEG 5T1JA 3OLGA 2HVKA 2Y1ZA 3NMEA 4PY8J 3KPQA 1TPXB 3WY2A 4M6NL 1KGUA 4HKBA 1NCBL 2EDDA 2C4FU 4KK9C 3ZQ9A 4UTBA 3PYCA 3ZT5A 3GBNH 1O7SA 3OAWA 1U8QB 4GW5B 2NY5H 4M5YH 2HRLA 3AB0C 5H4YA 5DURD 2XX1A 4NERA 4H5SA 4OD1L 4YN3A 1MELA 4WFFE 2VQ4A 4YSEA 4XPHH 1NCAL 3U7YH 4B9PA 4XZ4A 1MH5A 3JTBA 2C34A 4GAYA 4N2AA 1QACA 3HVNA 2A4EA 3FMGL 5E5MA 2E7LA 2F54A 2Y06H 3V9FA 4ELKA 1J1OL 3BEVB 2V45A 1MFBL 1AS7A 5FKAB 4O00A 4HFWB 4MKTA 3IU4L 1JGEB 4J1UB 1R3IH 5DD6B 1T5WB 1FYHB 4XBPA 1OIOA 2IANB 4ONHA 2E74C 5IOKA 4JMXA 3V0VA 3BKYL 5DTFA 3UCRA 1MAJA 1RUAL 3LQAH 2AQRA 2HFGH 5CF3A 2QR0B 1PBYA 2ZYIA 1U8QA 2X88A 2J7LA 2PTTA 1M71B 2AK4A 3BIKB 1AZZC 4GKSB 1FE8L 3I9PA 3II1A 5AL8A 1YECH 4TVUA 2E2HA 3B1TA 4TSCL 2JA5A 4I0PD 3HNSL 3V4PH 1SJEA 4L8SC 5DZOA 4JO4H 3EO0A 4AUYA 1TCMA 2OYMA 2VERN 3TGXA 2LOEA 2DEWX 3T4AC 2G9KA 4NLHA 2DJSA 2GTZB 1AHWB 1UZ6E 1XF3A 4XMKL 5A1AA 4BWWA 5K93A 1OPOA 4W4NA 4FCAA 4ZQKA 1WBYB 4M7KH 3ZKSD 2FK9A 3RTLA 2OYPA 3FNKA 1KEGL 1LO3H 3SJVB 2DIJA 1ZIBA 2OK0L 5L0QB 1E8ZA 3VXRB 2QELA 3SE9L 1OCZB 4QRRA 1AXSB 3KGRA 3NP4A 2YD2A 2OULB 3BSZH 2IQAB 4Q74A 1A4JA 3X3GL 1YY9C 3MLTA 5K9JL 3MV11 4N0YL 1F3DH 1YYLH 4S0HA 3MSPA 4PWHA 4HISA 2DQCL 5T5NG 2PO6C 5HPOA 1TO4A 4JM2D 5ACMA 4OB5L 1KY6A 4TM9A 2ADJA 1U8HB 3BVXA 2E7BA 3TPUB 2ZONA 4BK5A 1OAYH 1U8JA 2GABA 1CU4L 2Z8WC 3FH5A 1XEUA 2KZWA 3Q9PA 2BP3A 3ATFA 1OVZA 3PAUA 1OHQA 1H3PL 1AGFA 1FPTH 5DHMC 2BDNH 4BUHA 5L7XL 1B4RA 2FQEA 4N3TA 1ZLUH 5AVUB 4DK6A 2HX9A 4RFNC 4Y4KA 2D3VA 3DJRA 2H0FA 2X42A 2F19H 5IT2H 3HU1A 3DRQA 1NCIA 1NMCC 4PVLA 3FT4A 2PNDA 5DZLA 3RKDC 3Q8CA 1XGYL 1DQTA 1XL4A 3UAJA 2B15A 1ZVHA 3GS7A 3UP6