4FG4A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with hemithiocellodextrin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg4A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg4A02
2KQAA 3X2LA 5GM9A 4FG2A 2AE0X 3X2MA 5GLYA 1OA9A 1OA7A 1HD5A 4JP7A 2BH0A 5H4UA 1N10A 4L48A 3X2HA 4ENGA 2GAEA 2G6GA 4JCWA 3X2PA 4ZM7A 3FT1A 3D30A 2VXQA 2HCZX 2PI8A 2PJJA 4FERA 3SUMA 1WHPA 1BMWA 4AVRA 4JS7A 1L8FA 4JP6A 3X2OA 3X2GA 2PICA 3X2NA 1BW3A 4FG4A 4FFTA 1BW4A 2G5DA 3SUKA 3ENGA 3CZBA 3SULA 5GLXA 3SUJA 3X2KA 2JNZA 3FT9A 3M3GA 1WHOA 4JJOA 2PNWA 1WC2A 2ENGA 3X2IA 3X2JA
chains in the Genus database with same CATH superfamily
3QPXH 1A7OH 2CO6B 3LOWA 5D1QE 4NYLA 4E0RB 1OSZA 5EZLB 3QXWA 1IAIM 2R0ZL 4QOKA 5GHWH 5J13C 1E8XA 2D0HA 3L9EA 3C9NA 1RZQA 4UYPA 2XFXB 3IPEA 4HWZB 3LZOA 3GSQB 3CFJB 1E5VA 2PR4L 4ALAH 5HHXH 3EJQA 2EH8L 4UQIM 3V0DA 4XC3L 4HOMA 4Z7WB 4FG0A 4TMPA 3EOTL 1KIUB 5F7LB 3AG4B 4G6MH 4UILL 4XX5A 5CHNB 5EA0H 5HI5C 1FVDB 4LMQE 4YHLH 3S37H 4MQSB 1UA3A 3BHBB 3EHBC 1FGVH 3PQYB 4HK3J 2JTYA 1R3HA 1NCGA 4J3OF 4KX9A 2QLYA 1EXHA 3BSZA 4FQHA 1FFNB 3QDAA 3GEWB 2CDEB 2C3XA 3IAQA 5L2JB 1FAKT 2B59B 2YKLL 1BHGA 1N4XL 1RJLB 3BZ5A 5GHWL 5ENWA 5BMFH 1HQRB 1TQUA 4TN9A 3G6JF 1B2WL 2ZYIA 1EO5A 4JM4H 3GI8H 4OI8A 2WXOA 4BFEA 2BS71 4ZSOA 2IAND 2VLJB 4E41D 3WY3A 3ZGHA 4XP4L 3VXOB 1IL1B 3QULA 1OT2A 4GKZA 3L4UA 4GP4B 2VMCA 5KSVA 3PHQB 2EO9A 1FO0L 2DQCL 5IHUH 4M8RA 43C9A 4U3HA 1T1XB 1PQEA 3PWPA 4EUPB 2IXQA 2AFNA 4AGPA 1LE5B 4EBQH 1NAMB 3TZVB 1U91A 5HVWA 3TJEH 1QW9A 2QEJA 3KD4A 5BV7L 3U48A 3EO1B 3MYJB 4QHNA 1NANH 3GXIA 4HLEA 1E9QA 2JKLA 4U3SA 3GTPA 5IK3A 1K4DA 2E8ZA 2FSEA 1NUFA 1P2CB 3GSVB 3GSWA 1M9SA 5IEHA 4WF7A 1T2JA 3E3QE 4HKXA 1V7ML 5FYKE 2RAMA 3BYTA 3F12B 1MVUB 3MSPA 1HTYA 3B3IB 4X9YA 2NX5A 4NN7B 3CFTA 2MJWA 2EH7L 5E51A 1VZGA 1ZHNA 5CXPA 2C3GA 4L4TD 5D7LE 3V4LA 3BGMB 2X89D 4CC4A 1BV8A 2Z4QA 5KYWB 1MSPA 5C09B 3QWOA 1T0NB 3CLFL 5CSGA 3GYRA 4JG5A 5KANI 1JPSH 4BZ2L 4QHUA 4LPWA 3DECA 2XDHA 3SQOL 1ZA6B 5HP5A 3DX6A 4BE6A 1HNGA 2VIRA 3CLEL 4ODUA 5HGBB 3Q1EA 1PZ5A 2DKUA 2H1LM 3VM7A 3FRUB 4F7MA 1MCCA 2WN2A 3QWRA 1PU0A 5E95B 5GSVA 2ZSWB 5EOQH 3JWNC 4N1CA 4N9GA 5KOMC 3MKGA 2DD8H 4UTCA 4ZUUB 2LHAA 3DUUA 3GRGA 3CH1B 3ASNB 4QEGA 2CKBB 5KBKA 3CUPB 4ZUUA 1I9IH 2OZ4H 1A7QH 1DQIA 4H40A 2B1AL 5I6NA 3J7HA 1WDAA 3LPFA 3MGOB 4KAQH 3RFRA 4UV4L 3VFUB 3JXAA 4DN4H 2OMXB 4YHML 4ZBJA 2ZX7A 3DI2B 2WXJA 1G0DA 3U30B 3PFUA 4GAFB 4E41B 2R4RH 3WEMA 2BVYA 4JFVA 4LKCA 5GRVL 2HX9A 4JZNB 4HPHA 1SGKA 4NJ9H 3T2NH 4BA8A 3EBAA 1CZ8L 3M8OH 4A6YB 2DIEA 2YFNA 2CUHA 3SGKC 2IH9A 2HT2C 3HNVH 1D2OA 1YEKH 2N56A 3CC5A 2JKNA 1O6TA 4OD1H 1RUML 3MLVL 3Q8EA 1UZ8B 1ICTA 5EORH 2P5WE 3FTGA 4LEEA 1SHWA 3S2CA 4OFVA 3F12A 3P4LA 4YS4A 4QHMB 3T6WA 3C8DA 4EPSA 4B5EA 1GY2A 2QKSA 3QIUD 2NLJA 4F8LA 1KB5H 1I7TB 1OGTA 2WQAA 4GO8A 4TULL 4C54A 1JZHA 2J1KA 1HEZB 3P11L 5C0GA 1AGCB 4HKZA 3ALXA 4WU5A 4G7YH 4MDJA 2GI0A 2XWJA 5A6LA 2QZQA 2RIKA 2F54A 3R0NA 2JKXA 4G80A 2EDEA 3Q2NA 3QJQB 2YC1B 3QDME 3N40F 1EEZA 1HZHH 4QHLA 1KCSH 2ZYRA 1YYMH 2G3ZA 2BZDA 4XPBH 1EBPA 1CFNA 1IC7H 3KPRE 3FQWA 1JNNH 2ZKHL 3FO9A 4BSWA 3RL2B 1MEXL 5L4MA 3CDGA 4NAMA 1HL4A 2VLJE 5I5RA 4HJ0D 1G7LB 5K9KA 1INDL 4NNXB 4PRBB 1YMMB 3WXWL 1RPUA 3B4NA 3I02B 4F91B 1NCDL 3I50H 2Z7ZA 1D7BA 4P59H 5AKTA 3D85B 4DF9A 4PJBF 2OP4H 5FDYA 3CVHB 2VDQB 3KPOA 2J12B 4EUPH 4K7FA 2IH1B 2G2RB 3PP4L 5F1SA 3X1FA 4IMLB 5IFAH 1XD1A 1IGYB 4D9LH 4XAWL 1S5HB 1PAMA 4GW1A 4MQTB 5TQ2H 1TF4A 1KJ3L 1JXJA 3VDCA 2BPBA 5TH2B 1QVOB 3BPLC 5E9AA 5ESQA 1OAQL 3D4ZA 5DTFB 3LEXB 2W65B 5DURD 1T0MB 1S9YA 1GKEA 2XPGB 5C0BA 3CBRA 3QDJB 4AYMC 2UWEA 1N0XH 1E27A 3E6FA 5GS3A 1I3VA 5FKPA 1PLAA 3AACA 1FIGL 1DSYA 5DLMH 5CEZD 2ZCZA 1KULA 1XCQB 5MENE 5E08H 2CUAA 2F5AL 2P5EE 4HJ0C 1U8OA 3L3GA 4GO6B 4L8DA 2ZP8A 1FN4B 3IMRA 1CR5A 3VWKB 3EYFB 4PJXE 3PP3H 2GSIB 1IKOP 4DTGL 4LQ1A 4OIIH 2ICES 3EW3B 4ENZA 4FABH 1MY7A 1AS8A 3LH2L 4O51B 4CJ1A 3JWOH 2Z31B 5ICUA 3D05A 1JF6A 4EF3A 4JCLA 2WVVB 4TNVK 4NT6B 1AGBB 3GZKA 3F58L 1DBKL 1YNKL 5IQ7L 1B0IA 3OSKA 3QUYA 4QRSB 2IWGA 4DZBA 4NUPA 4KPHL 4PRHB 5LBVA 1W6WA 5SWSA 2AJXH 4KJQC 5FWQA 3S35L 3V4UH 5IB2B 1IGIL 4PJHA 1PNCA 5C3IA 2LE9A 1GAFL 4PJDA 4RH4A 1MI5E 3NCFB 4Q4IA 4MZ3A 3MV9A 1KBWA 4LDOB 4WHDA 5DRXA 1JZ5A 2GW5A 2Z0BA 5J1SC 3N1FC 4YPGA 1IKFL 2BMKA 4J3OC 3VFOA 4WK4B 3ARFA 1XGYH 3RX5A 4I5BA 4ES9A 5JHLA 4AQ8A 5HY9B 1YNTA 2LLNA 2YMOA 2OL3L 4DGIH 4F2MB 4RRPG 1P4LA 1B0RA 1SOXA 3HB3B 1MEXH 4JQIH 3L9BA 4PRID 4OM1H 5HDOA 4HXAH 4XMKL 4HEPG 4KO8A 4BRJA 5C0BD 3DRQB 1HVXA 4LSTL 4M5TA 3D39B 2V37A 5EOTB 4G59C 4NZDA 3ZE1B 3EH4B 2CLRA 3KXFE 3K72A 4XOCA 1UOWA 3PUUA 4EXPX 1GS8A 2VRKA 4FKHA 3QUGA 2N0MA 1ZJAA 4UOZA 3MJ6A 1GRWA 3FUIA 4R3SA 3TH3T 4ZG1A 1OANA 3FBQA 3PWNB 1L8FA 1WA0X 4XPAH 2HFEA 5GZOA 3W1ZA 3BAIA 2M8XA 3CVBA 4XB8A 2YGVA 4BK5C 4X6CE 1YPZF 4DGIL 4ZX6A 5HHMB 4QRUA 4LHUD 1CD9B 5LGYA 3GRWH 2NY3C 5M95B 5IHUL 2RJMA 1HHGA 2X40A 3MJWA 4Y5XB 5BZXA 3VXUA 3NCWA 1CF8L 4I1PA 4ONOA 2YD8A 3IGAB 3HB3C 5E8PB 4QNPF 3FUMA 1EXUA 1Q72H 3I9IA 4PG2A 5JZ7C 5LG6A 1BA9A 1FWXA 1YJDC 4U6VL 4FQJH 2GJJA 4X7DC 3NJGA 1EEZB 1NFKA 5HHME 2VPWA 3AREC 5KYUB 3KYAA 1F90L 5DJ0B 4N5EC 4WUUD 1BM7A 3P3TA 2GJ6A 4Z7AA 3U6RA 4P05A 2YA2A 4WY7H 3SDAC 2P47B 5HYJB 4QXGL 2X05A 4XP1L 3G6JE 4MNGA 5I6KA 2XQ0A 4XP5H 4OZHF 3PV6B 4S0TD 5C0GB 5D96B 5I6XC 5SX5H 4JRLA 1G87A 2UXVA 5KSUB 2EIDA 2HTKC 3X1BA 4ELMA 5JHLL 4X4ZA 1XGZA 5EU6D 2YN5A 4OFKA 1C9SA 2PJJA 5C6TL 1FDIA 4TUUA 1B4LA 1MFVA 2P7TA 1HQ4A 3TNNB 4HHGA 3QW9A 1NDGB 5DF0A 5K9QG 5L8JB 3T8VA 1XR9A 2H6OA 5I74C 3BCDA 2G9KA 2OL3B 3NRFA 3FRPA 4QOKD 3KPPB 5KYNA 1DJYA 4P2OC 5AQ0A 3HJEA 3KYOB 4PRIE 1QYGH 4U1LB 4B96A 5GZOD 1X4YA 4JHZA 3GMPB 5HHOA 2FD6H 1OCCB 5K69A 5D4JA 3FFDA 4AVHA 4RAUB 3O2VH 4GRMA 4UAOC 2DBLL 5ESVA 3HPLB 2GJPA 1S7RB 3PABB 4R96B 4YSDA 2QADD 4NHUA 5D4HA 1WPCA 3QUZC 3V4VL 5D2LF 1J87A 1GMEA 3BSZH 2C7UA 3AS3A 4KZCA 4WWKC 1YEHL 4R84A 3WFCH 3UG3A 1KOAA 1C7TA 1XH3B 4J6RH 3AXIA 1U3HA 2OL3H 1TT6A 4HWNA 5TDOA 4AT6B 4C57C 3UDWA 3MRGB 4PJAE 1RIVL 2BVOA 1DUYB 3V6OC 3FT2B 2CK0L 2GTQA 4K2UL 3FB6B 4PJBA 4DAGH 3CFCL 3IE9A 4IMKC 1N26A 3DBXB 2KLRA 4D9RD 5CLYA 5T3XH 1LNUB 5JHDA 4I2XA 3ARBD 1U2CA 1GSKA 5JLZA 5IM7B 4ODUB 3FQXA 5J5EA 1BQHG 5H37A 5BZDB 5I74B 5CIPA 3L4ZA 4M3JA 1G7PA 1KJ2B 2ZONA 1CTOA 3UTZA 1U3NA 2G4EA 3IK2A 2P28B 4RRPM 1KYFA 2Z31C 1PCSA 4FXLA 3I02A 2YZ1A 3LPOA 2BSRA 4LLYB 5L4IA 4P2QB 2RCSL 3OKKA 4YSUA 4IW4C 3CSTA 1ZS8B 4RSYA 5EUOE 3DBSA 3GTJA 2ITDB 3QUZD 3Q43A 2CA4A 4IIQB 3W0WE 4BK5A 8PAZA 2DQGL 2VDPB 4R26L 3A5VA 4YDVB 1BLNA 3H55A 2WBJA 2XZQH 4LCCB 3D2UA 1OK8A 1E7UA 1AG6A 2PYEA 1IZKA 2WLZA 3P2TA 5DZOA 3VFTA 3MLPA 1KSRA 4LLUA 3E7JA 3X2QB 2APBA 1R47A 2LW3A 3A24A 3BKCL 5EO1A 2I9LB 3TPKA 3O6FB 4HHAA 3UXFA 4L8CB 2Q2LA 2J5LC 5BUPA 1WAAF 1OAQH 2E46A 1J5DA 2Q7AA 3FF7A 4B97A 3NJHA 1MFDL 3Q2WA 1BIHA 5F7NC 2W60A 1LK2B 1NGXA 4KO6A 3QPXL 5BUAA 3FU5A 4YSTA 4OCSL 3GGWB 3HAEG 3IDGA 3EOBB 4O9HH 4NQCE 4P0DA 3BP5B 1FNSL 4PRPD 2FZ3A 4D7BA 4WW2A 5DJDA 1LO3L 3W57A 4XOAA 2YGPA 1TU2B 3AUWB 5ERWA 2AQSA 3EGXA 1Q9OB 3AWGA 2FUQA 3S3JA 1DQJB 1WT5A 4FMFA 1FLRL 1ZCRA 4GLRH 4Y88A 5GJSL 3UADA 4NUMA 3WE6B 2EEDA 2X44D 2BCKA 3FFCB 4M56A 1NCTA 3ATEA 3PE9A 5EU6A 2ZCHL 3NDYE 4M93B 4CMMA 4Z1PA 1OF2A 2I07A 4ZAKB 4N22A 4MX7B 5DJYB 5I24A 1KCBA 4P2OA 3KWWA 5GGVY 4X6DE 2YEZA 2X6AA 3ZPDA 4DEPC 3MV01 3ILEA 1P5UA 1QRNB 1I50A 1HE7A 4QRRE 1I85A 4UTAA 3DIDA 3WSQH 1XGPB 3O3DA 3OJVC 2OJEB 3QNYB 1RHHB 4OZGF 2R7EA 4M1GL 4IOIA 4GRWH 1N6QL 4PJ5E 2GHZA 5GSVB 4HPOH 5DMGD 2EYRA 2B0SH 3H1ZA 4H8QA 3V5KB 4FQ1L 3ZBMA 1ZT7B 3WTVA 2FO8A 1GIGH 2X4PA 1JXFA 3WFDL 2A4ZA 5IKCB 2FT7A 3ZYZA 2WVTA 5DZLA 3SKJH 4XBPA 3OMNB 1NC2D 2YMXH 4IMKA 4KTEH 4QRRB 5GRVK 2QADB 1TVBB 2KI6A 4D2NA 3FONB 2B4CC 4ZDHB 1XX9C 4NJAL 2O26U 3HVDA 5CS7A 3S4SA 4HALA 2FWOB 3C5SA 3SOTA 4ZPVA 2ZG2A 1DQDL 1VADA 4M62H 1RHHA 2VW4A 1JYNA 1UURA 4U1SA 2HKHL 5INCB 4YDIL 3TVMC 4P5TB 1G0XA 1G7HA 4AG4H 3N06B 4KDWA 2JKRM 1W9XA 1ITBB 2RCSH 4LCIL 1NFIA 3S3PA 1E6JL 5D4IA 4JL1A 2VQ1A 5F9WB 5IW3A 5JXEC 1IGTA 1AH1A 4PJCA 4WFHD 2R56H 1CGTA 3EF7A 1NC4D 3DSNB 4FTVD 4YC2C 3T8XB 3ZDWA 2B15A 3VYOA 3TPUB 1IC1A 1F6LL 2EACA 4NUGH 5H35B 5C08E 3WE6A 1H8LA 1MFCH 4OV5B 3NJJA 4ODVH 1SEQL 4TUKL 2BVUA 3LIZA 4PG9B 1Y6MR 1MWAB 1PX3A 3BPOC 2JELH 2BXYA 4FNSA 4R97B 3HEIB 5L8LB 2DM7A 4OJAA 3ULSA 1RY7B 3MN8A 5H2BB 3L08A 3AS0A 1HWGB 3S37L 1U8IB 5JW4Q 2JCWA 4GIPD 2XN9E 3AXLB 3QHTC 4TVPE 1HEJC 4HCFA 1W0WA 3L1OH 5AVVB 4WWPA 1A47A 3PAYA 3X2OA 1FFNA 2P5EB 3DV6B 3NCCB 2OZNA 2IBBA 3QEHB 1QLEL 1VKXB 3LQMA 2V6HA 2DEYX 1ODAA 2BNQE 3FSZA 4J6IA 3TOPA 3IVKB 3TPUA 3MLZL 3REVA 4KUZL 5HHNA 3W3BA 5CSBA 3VU2A 2XVKA 1KLFB 2FJFB 3AFLA 4XNMB 1JN6A 4J2QA 1JWMA 4FZ8H 4KTGA 4X99B 1VJSA 1QR4A 3QXAA 3ESVF 4GW5A 2QMKA 4N8VB 5CILL 5DRWA 4I89A 2WBJB 4QMEA 1FF5A 4H1LA 5C08D 4KMTL 5T1KB 5LWYH 3CCHA 2ZX8A 4XVJL 2TSAA 2X4TA 4G71B 3EUDA 3TIWA 5FDWB 3P73A 2BP8B 4J3SA 5I1CH 5IFJA 4ZPVB 5IR1A 4RGND 4RMTA 1UWEH 1N2RB 4GXUM 2NY4D 1AMXA 2VDML 1I1YB 4I1NB 5D1QD 3MRIB 4IM8A 1DQTA 3G04A 3GHEH 4AEHH 1BJ1J 1G7HB 3OB8A 5A16B 5I15H 3T0VA 2MOGA 4LPUA 1AR1C 5IFHL 3B56A 3CFMA 1OIOA 1QLFB 3QFDA 4WEBL 1ZIAA 3HTLX 1KFGA 1O9WA 1N0LA 2VDNL 1MVFA 4NKIH 7PCYA 1Q9WA 3RPKA 1S7SB 4W4OA 3P0GB 4JQVA 2CCWA 2OXGB 4DNLA 4LT7A 1Q9WB 3SKUD 4LCWE 1SVBA 3QA3A 4I0KA 2YKLH 2VR7A 1ESOA 3IDUA 4YHPA 5CFHA 3W5NA 5EF3A 3IJ9A 2JKSA 1EZSA 4UINL 5DUBB 5F70A 5L9DL 4IEFB 4DKAA 5HDQL 4P57B 1JNLL 4G9FA 4ZFGH 1I8AA 1UACL 4M7JL 1Z0MA 4K07A 4KXBA 4P2CG 3RWFB 3QJXA 4ICXA 3IJ8A 3KCPB 1CYGA 4J1UA 4ADIA 3X3GH 2J3SA 3NIFF 1IT9L 3ZJAA 3TO2B 4CMMB 1L3NA 4CU6A 2AV7B 3QI9A 3QO0B 2JCCF 3P73B 2CZNA 3KS0H 4MHHI 3IU4H 5CINL 3KYMB 1IGJA 4S1SL 1U95B 3T4AA 2G5DA 5AVYB 1FL6A 2APXA 3EGXB 4TQEL 2Z1PA 3STZA 3T2NL 2X9XA 1CUOA 1X5AA 3LRLA 3QZMA 3V0AC 4RWYL 3JV4B 1QFOA 1AQMA 5GS2D 3EZ8A 1RXLA 1B0GB 1ZLDA 4ZFZB 3EOBA 3ARRA 4DZ8A 2XUWA 1YUHA 1NDGA 2M83A 2VLKD 3P3RA 4YSAA 3PNRB 4K5OA 4JNXA 2JFCA 3P0YH 3D39D 1G9MC 3X13A 5CBAB 1ECZA 1RU9H 1P5VA 1CQKA 4YQXL 3O6FA 3AXLA 4UTBA 1XB8A 4Y19B 5LXVA 5IT2L 4N0UB 2WXRA 4MVBD 2YU9A 2Y5QA 4PP1D 5IROA 4E42A 4YSRA 1RZJC 5IMLA 2AK4D 5GGRY 3ZGIA 3VTTA 1M7XA 1W15A 3JV6B 2WB1A 3HR5B 4GXVL 4OM0L 4JUTA 1QSVA 5CSZB 1VZHA 2VDMB 2ZXBA 5ICXB 4AK1A 1PKOA 4L1BA 2YD2A 5IBUB 3EJPA 3ZMRA 3IR5A 2J1YA 3OB0K 1JPSL 3U0WL 5C1MB 2A73A 4L1HA 1WTGT 4PHZA 4XN2A 4OJCA 5BJTA 5FTLA 3RL1B 2EKSB 2DQFA 3VRIA 4G8FB 4KVCL 5JUEL 3SJVA 4Y5XA 2BSRB 2GAZA 1A4KB 1XEDA 1WFUA 3BO8B 3FQUA 3E1F1 3GI9L 3MXVL 3BKJH 1MHHB 2UZIH 4M00A 4KK9C 1SY6L 3GMMA 2Q8AH 1A2YB 2O5NA 5JIMA 5B38A 2EDKA 3ABGA 1UM5L 3DPBA 3N0PB 3BYYA 4Q4EA 4J39A 1YC7A 3CFKB 3PWNA 4EAEA 4Q7DA 4HS3B 5BZZA 3ZN6A 5KVDH 2DS4A 1LNUA 3H9HA 3SDXA 4AQAA 4UUJB 4O02L 3NAAL 5JIQA 4YXLH 5E2VH 1PF3A 3H7BB 2V2XA 4HH8A 3V5DA 4Z7UE 5IKCA 1VGEH 3TTYA 1A7NL 4KDIA 1KY6A 1BGXH 4IU3B 2DMRA 3SGDI 3UTQA 3MTXA 4P23C 2WYTA 3U1SL 5EF1A 2FEDC 2JJSC 4Y5YB 3H3KA 5EUKA 3T0ED 1U36A 3HHSB 4GUPA 3DLQR 4F2MA 5T33L 1HI6A 1HH9A 3BIKA 3LKQB 3QEGH 1OAUL 4WK2B 4WWOA 5LHDA 2BVPB 5DQDH 3VFWA 4JM2B 2QVFB 3EJYD 3LMJH 4FG4A 1UUNA 3V52L 1ANUA 5DUML 2DQDL 1MAMH 2D7PA 2OTUA 3I9AA 1KPVA 3ZHKA 1EJOH 1P4BL 4KQ4H 1BQUA 3DX4A 3B2UD 2H32H 4HGWB 4K9EH 3HNTH 4AENB 4D94A 1DQJA 1H5BB 4L5FL 5J13B 2PMZA 1IC5H 1T3FA 2ESVD 3VXQA 4AEHL 5EEWA 2ZICA 4Y4FB 2OR8A 4QRSA 1ADQL 5DA4A 5TDNA 1CFVL 1PQZB 1TEYA 2GSMB 1LEKA 3WAJA 1YEHH 2GBVA 4Z23A 4G8AC 1GYUA 2AQ2A 1XF4A 1VCAA 2YUZA 4CKVX 5A6IA 2NZ1A 4YXKL 4HU8A 3FU0A 1EAOA 4GAYA 2OCFD 4NWTL 4Y4KC 1PYUB 3NGBC 1SM3L 5DVOA 1FVCA 4P2RA 1ZVHA 3C5JA 3HW7A 4D3CH 4ELMB 4P3DA 2F61A 4BFOA 4FA6A 4ZO8A 1XF1A 2YLHA 2NR6C 4N2GA 3WAKA 1XZ0B 4HIEB 1A4BA 3TTSA 1UT9A 1YEJL 5GISL 4HIJA 2K1MA 4KI5D 4HJGB 4XNZB 1A7RL 2B8OT 1E27B 2G3NA 1IKNA 2WTOA 1CFVH 2YEQA 1T04A 5BCAA 3RVTD 1R33A 2AXGB 3VD2A 3ILPA 3MACH 3MLVH 4X4ME 3EJRA 3OGCA 2ESVE 1U4FA 1ZRUA 3DC0A 2GCYA 3JSSA 4U0QB 3VI3F 3VG9B 4OFYD 1DBAH 4AQEB 2VXUL 1NBQA 2A4CA 3L81A 1XTLA 1X6NA 2DQJL 2V5MA 4B9JA 1BZOA 1M6OB 2MWCA 4R90L 4P46A 3QJHA 4LDEB 4LESA 5J6HB 4UNUA 2XTJC 4HCIA 2YAFA 1BF5A 1VPOH 4H1LH 5J6HA 4PRDB 4NPJA 2JK5A 3LNEA 1M6UA 3D3VA 4NNXA 2FGZA 3MA7B 4Q58C 2DBJA 2BC4A 5B38G 3SUJA 1YA5A 5C0FB 4EXKA 4ZS7H 1MRFH 1YMME 2Y5EA 2GCYB 4PUBH 5KW9L 3ZK0A 1VGEL 3RWHA 1DUYA 2DQ6A 1EH9A 4NM4L 3A22A 4GIAA 5A6MA 3E0GA 2X6UA 4XVSL 5AW2B 4HUUB 4S2SA 4KO9A 5A2CA 2BMKB 4AW7A 3IDYC 4JHAL 5DZAA 4PJ9C 4WU7A 2C7UB 3BI9X 1UUSA 5H37H 3WO4C 3MRQA 3KYKL 4UOW1 1DEEA 5E6IA 1AR1D 3ROLB 5E8DH 4KKQA 2E4FA 2K3HA 4NHUB 3AUVA 5TE7L 5E2UL 3OR6A 1URIA 4ZMTA 1RERA 4GOSA 5HHOB 3BVVA 3BE1L 1BBDL 2A9ML 1E43A 5TQ0H 3FCUB 3IDJB 4KV5E 1F00I 1ACZA 2GB2A 2I7OA 1X3DA 1KJ3H 1RK0B 4R83A 4FG2A 3OKEB 4YX2H 4BYHA 4BE5A 5KVEE 3IDNB 1NIDA 2VITA 3D4GA 3J27A 2GPZA 4IRJC 4Y2DA 5LAPA 4A7SA 5IB2A 3ULVE 4GI6A 2RTTA 3C5XA 5I0ZA 1LEKB 4PRPA 5J0BA 3V6ZA 3VRJA 1JPTH 2YD0A 4Y2NA 3PWJB 1OGYA 2YD4A 1MW1A 1A6AB 2Z8WC 4KC3B 4P5MA 4PJXB 5CO1A 2W91A 4AYFB 5MP6H 2LAAA 5KVDL 2NYYC 1OGAA 4IGBD 3TA3B 1VC3B 2NY0C 3AWEA 1S7XB 4UDTB 5C7XH 3QDJA 5DJ8A 2OA9A 4RETB 3A21A 5SWSE 5C97A 3DK2A 1WAAE 1HI6B 4PMFA 2NW3B 4XPFH 4ONFL 1EZLA 4KFZC 2F19L 1P9MC 2CRYA 2WPGA 3K2MC 1J86A 1LM8V 5DK2B 4ANKA 1N4XH 5FO2A 3MOAH 1OY3B 3I6KA 2HKFL 2OR9H 1KTLA 4BV1A 4M7LL 3UFIA 3FNKA 1YCSA 2OJZH 5T3XE 2I5YH 1SMYD 2G9HB 3SDYH 3VFNB 3HKFA 3N04A 1OOAA 4HAFA 4K7FB 2XQBL 3DO4A 3Q1SH 1HJCA 1F3RB 3OQ3B 3HBGA 2YUJA 4L23A 4ONGH 4DO5A 2BRRL 4PJFE 3QJFA 4NRZA 2G4GA 4H8HA 4PRBA 1WFOA 3OKNA 1LP9B 5I8KL 3DDGA 3KGUA 2DB8A 3STBA 2BW5A 1P4BH 4KQ4L 4Y4HD 3MBEA 2VAAA 1CLOH 2JELL 3KPOB 1KXHA 2H8PA 1DN0B 3JTSB 4PB0H 4OLUH 1J8HA 1LEIB 4PPTA 3MMEA 2ZXQA 5IQLA 5EIIA 1ZIBA 1FFPB 1AZCA 1C5BH 1ID2A 3QS2A 1A7PH 3WGVB 1M53A 1EHNA 1R3LB 3IKCB 5I8CB 3EYQD 5E4IA 4WWKD 3BVWA 1SQ2N 4DKDC 2DH3A 4V1DD 5F0PB 4MCYB 4F37F 2PCFA 3IRCA 4EI6B 1P4LB 2AXWA 4HWBL 1SJHA 1CG9B 1PD1A 1QFPA 4YDJA 1HFUA 5F21B 1XF2B 4QGTA 1HHIB 5IQOA 1CGWA 3M7OA 5DZ9A 5C70A 4YXLL 2JSFA 1KZQA 1RQ5A 4PLKC 2CJSA 4U1HB 2AJZB 2VLJA 4WU5B 3ALWA 3VCLA 2W9EL 1AGEB 1JNNL 5CZVL 1M7UA 1OW0C 3CC5B 1F8TH 2ZUQC 4LVNB 3HN5A 3UYRH 2EABA 4XXWA 2YMXL 4KTEL 3W37A 2FBJH 1AZNA 1OQOA 4IKIA 4MJHA 3ZY7A 4OJYA 3OHXC 1HXMA 1KCWA 1JVOA 2OMUB 2VDRH 5HHOD 2F74A 1DVFC 1JD9A 4AONB 5J7CC 4OT1L 4NPYA 5EULV 4A7GF 2O6EA 4PG2C 2WMPA 1TVHB 1UD8A 3D08A 2OYLA 2Q10A 3HI1A 4NHCL 1LO4L 3APFA 3BX7C 4M6NH 4R8WH 2Y25A 1T7ZA 5F7DB 2XTJE 4PVNA 3WY2A 1EO8H 4WV1B 2ED9A 2XXCB 3F85A 3HMXL 3IWVA 1NGWA 2KZBA 4EDWL 5AB2A 4JZNA 2XTSA 1HH9B 5DLLA 2GJRA 3NTCH 4HS8L 3BN9D 4PBWD 4OZHE 5M7QA 2ZCHH 1NH6A 1I1AD 2VMEA 4I2XE 5C6TH 4JN1H 2Y72A 1OAKL 5FM8A 1KCUL 1PLGL 3B7YA 3HHRB 4GRWE 1DE4B 3MJGX 1X5MA 1REIA 5IVNA 4IEFA 4HCGA 3FCSB 5C86A 4NJ9L 1QASA 1P6AB 3UC0H 5JPMA 1JXKA 3FCTB 3IRPX 5F3FA 2V7HB 4UUJA 2BP0B 3LKOB 1KC5L 1JMXA 3MRKA 3QIBA 5DJ6B 3US9A 2PPEA 3MLXL 4KOCA 4QNPE 5BOJA 3O2DH 4GP5B 5DMYA 2FQFA 4GYBA 3MV11 3DMMA 4X6BB 4JHWH 2JI2A 2XICA 4LSUL 1WS7A 4LNVA 4OVUA 4RFOH 2ZUUA 3B3IA 4KI5C 3ELAT 2F74B 4RDQF 5GGTA 4QAWA 3OD3A 1BZDA 4F8QA 5I0DA 2ZWNA 1TUPA 2G5BB 1YPZE 2HJFA 3QWOB 5EOQL 5C3LD 1L9QA 2CBPA 1DN2A 5KYWA 4PGJA 2KS0A 4JKNA 1V10A 4MS8C 4UDUB 3H2QA 2ZF9A 5TF1H 1HKFA 3TASA 3UERA 2P48B 2Y6SD 2VUMA 3HG1B 3Q8FA 5DMIL 3PU7A 2NUTA 1F4YL 3RYMA 3TZVA 1HX0A 2EIKB 4KU1A 4IRZA 3LXCA 2ZOWA 5AOLA 4K3HA 2BVEA 4OW6A 5T1DH 2IC2A 3UPCA 4OD2B 4MMYA 1KLFA 2FJFA 4E42B 3JZYA 3O3BA 4KNTA 5ADOL 5IMLB 4MNGE 1AGCA 4BEIA 2NSQA 4Y8AA 5I2IA 3QXVA 3PRZA 4XAWH 3PDGA 2X1WL 3HMXA 1VAHA 4YHMH 5KG9B 1GVIA 1V7MH 2CWRA 5JORB 5EZJB 4X7EC 2XXGA 3QEHA 4U2YA 4UV7H 2FWSA 1CXLA 2APFA 3U0PB 3ESUF 5IBTH 4BZ1L 2CPUA 3ARGC 1G9EA 4O2CB 3VXME 1P4IL 4MAYB 4GY4A 1T5XB 2H41A 1MJ8L 4AAYA 4N8CH 4IBTA 3RVXD 3NACL 3QYMA 1VLXA 3WTXA 2ICWA 5HGDB 1DFBH 1TJXA 2WJ7A 2WO3B 3MC0A 1RP8A 3BQUB 4U6TA 1GC1C 1QTSA 2V2WA 2W8CA 4FYQA 4KRMB 4PRNA 4U7KA 3SKNA 3V6FA 3BHBA 2GFBB 4HFWB 5FTMA 2E59A 5GLFA 2AV7A 35C8L 2G6GA 3FHQA 2BY0A 4YUEH 1XF5A 4DGYH 4NQCB 2VQ1B 1YHPA 1PG7H 4KNUA 4ZAKC 3ARYA 1KXVA 4L9LB 4PJXF 5C09E 1KV3A 2IF7A 1MCEA 1NWOA 1DBKH 1YNKH 1CFSB 4JX0A 4A2HA 2OMYB 3BE1H 2GITB 3T0BA 4YDLB 5AFAA 2C4XA 1BVKB 5J12B 2R93A 3V8CA 2OYPA 1FGVL 1VRSA 2DMKA 1OV8A 3MV7E 2VDOH 1Q90A 3Q5YA 4B6ZA 3BUYA 3KLKA 3ARGD 4P07A 3HE7A 1UJ3A 1I3GH 2XFGB 3UGEA 1HIML 1LMKA 1WT5C 5DJCA 2FO4A 2VCOA 3LH8A 1G1CA 3SBWC 4CRPA 5JHLH 2YA0A 2WP3T 4RMWA 4KGJA 43CAA 4LLVA 1AD0A 2IQ9H 1KT2B 3HS9A 4HIHA 4Z18A 1F3JB 3H3BC 5D1QA 1CIDA 3Q2CA 1G6RH 1NGZA 2P24B 3OR7B 1F1DA 3N40P 3I9GH 1HESA 1IAIH 4N2EA 3U7YH 1CDCA 1RK0A 2X2JA 3QT2A 1FNGA 4PGZA 1I9JH 3U7WH 4FQXB 4K5LA 1H3GA 4ES8A 4X0NA 5I30H 4GW5B 3D18A 3L3KB 4N8VA 5GRXG 4WEMB 3MR9B 1WH0A 3IFLH 4QF1B 2OCCB 1R75A 4DW2H 1AVAA 5ALCL 2COQA 4PJHF 2YHGA 2WM0A 1K8DB 5IJVB 4YHLL 3PWUA 4DPRA 3MCKB 3ARFD 1U3HC 3QRBA 4ZYKB 2XV2A 3ZT5A 1E4XH 5KSVB 5E1HB 3D9AH 2P5EA 3DV6A 3TYGL 2LGNA 1M56B 1KB5B 1MLCA 3OAYK 4AEFA 2UWEF 2XKUA 4Z3IA 3QHZH 3V4VH 4KHXH 4IRSA 3BOVA 1T6VN 1DCLA 2JB6B 2JB5H 1E4KA 4CSZA 1KCSL 4NQDA 5DK0B 1KY7A 3ERXA 5F7KC 3MLSL 4L4JA 2UUDK 2HVKB 4PEEA 2VDOB 1FUNA 4LU5L 3IMBA 5EO1B 4P46B 2AXJA 5SX4H 3DETD 1JL8A 4GSDL 3DYMA 4BH7B 5FB8B 3EFOB 4LLUB 1KIUA 2FQGA 1ZSHA 5F1KC 1FV1A 3B8YA 5ACMA 5MEQA 2VDKH 4F15C 3BP4A 3MV8B 1SLVA 1AXTL 5GJSH 3TF7C 2Z92A 4PJIF 1JWSA 2R29A 2ATPA 4Z5RA 3NJXA 1A9BA 2WBJC 2NAPA 3QUXB 2B9AA 2YLKA 1PBYA 2ATPB 1VFOA 3ISWA 1O7VA 4RFNC 1NBVH 4Y4FD 1VA9A 3MU3A 3RWCA 1NEZG 3S4SB 1YECL 3MNZA 3HG3A 5I6OA 4E9WA 2E5EA 1WC7A 3U7AA 3V9FA 4Y2DD 1DVFD 3CHXA 1SEBA 3QH3B 3LKRB 4IYKA 3IJHB 3GXPA 4K3EL 3ULUE 2VLLB 4XBPB 2R8SH 2L7JA 2NDFA 1T4KA 3EDEA 3FH7A 4YBHA 4Y16B 3KAAA 5JQ6L 2BZ7A 4JFEA 5I1LB 4Z7IA 3FOLB 5CM1A 3LRKA 3WNIA 1F5WA 1ADQA 3H9SA 5D5MA 3HLAB 4TLSA 3F7YA 1G7MA 2PYFA 5J11B 1EUTA 4Q6IA 4IOIB 3VM5A 3CSFA 3EGSB 5FA4A 5BQDA 1MAKA 4C56B 1KB5A 1MLCB 1T66D 5ANHA 5E2VL 3FHAA 4JG1H 5DGQA 5EO9A 1QRNA 2X70B 3CFDB 3S3BB 3GSNA 4HWEH 1INEL 5IGXH 5J89A 5TDOB 4AT6A 5BO1L 1UWXH 2P5WA 3F7QA 5A2KH 3MBWB 1MUJA 1WBXB 2XYCA 4HEPA 3T3PF 4B9IA 3C6EA 3PLYA 1CGUA 1C5DA 1X4ZA 2R7ZA 1R3KA 3AQYA 3VTAA 5DJ2A 3D0LB 8FABB 1KELH 4HF5H 1XSJA 3BDYL 3DJSA 4P4KB 1E5CA 4I0CC 4YHKH 4F9LA 4QXGH 5DDHB 3VGFA 1ZLEA 2AEIT 2MQCA 1A6VL 1JGLL 3DUSA 4MLIA 1VPOL 3MTRA 5HYEA 3VFPA 5ITBH 1WA2X 1K4CB 1DYZA 3HHSA 4GUPB 1TZHB 1Q4NX 1J8RA 5F0LB 5C7XL 3D0VB 2E7MA 1BAGA 3EGSA 3DYPA 1MF2H 2XJKA 5JPNA 3RTQC 1T5KA 1AIFB 4YFLI 3U0WH 3NZSA 3TA4D 2HUEA 3OAWA 3PGDB 4M48L 5FYLH 5LO7A 3TYGH 3L9RB 1WWCA 3MHZA 4WEEA 2JI3A 1AQKH 4PTUB 4YL4A 4N26A 3GWJA 1IM9B 3NFSH 4JFWA 4HJJL 4RIRB 2Y6SC 4ODWA 4DK6A 4TSBL 5CWSA 1U8PB 5FGBC 3E2HB 3V0IA 1R5WA 2IJ0C 1U8QA 2Y9RT 3QDMD 4FFZL 5AVUB 5DCCA 2BIMA 5LCVL 3ME0A 2C9AA 1I1FB 1RVFH 1OZTG 1TYJA 2ALWA 4JPQA 1MCOH 1DVUA 4HHWA 3U1PA 5CZXD 1U3JA 1N12A 1AR1B 5GGSA 4BFIB 1ZA3A 4H4NA 1SYVA 3OJDB 2PPDA 3DUHA 4G9DA 3TL5A 3INOA 1HT6A 1QNIA 3CF2A 1KJ2H 1ZTXE 5C92A 1JI1A 2YBGA 3K1KC 2YSSA 4A1RA 4XNUL 2GTWB 4YHKL 4G6AD 3BJLA 1FZMA 4HV8B 4IK6A 4EN3B 3D2TA 1FFOA 3CSPA 4PCYA 1MCFA 25C8L 2Y06H 3OC5A 4OVVA 3TNMA 5D7LA 1I7RB 3IGUA 2Z8RA 1FRGL 4BRVA 4ZUWA 1FZMB 1PLCA 4ELKA 5EDSA 1TZOA 4D0BA 1XEUA 2MQGA 5LLIC 4HFUH 4G6JL 5BRZE 1D6VH 2BNRD 4FC3E 1YEIL 1EMTL 4KI1A 3ZDXF 3T71A 4H7VA 4N2BA 3HUJA 1KCRL 5GS1B 1T20A 2OXHB 4G3YH 5CIPB 3QG7H 3RJOA 1YN7B 1NBZB 2AQ3A 1FZJB 2X4OB 3CVIH 2B2XH 3NK4A 3VSVA 2YIHA 2X1XR 3V9CA 5TE6H 2WTRB 5DUMH 1OM3H 4JZJA 4Y19A 1DLFL 4DEWA 1AS6A 1TZ8A 3N43F 3K72B 5JQ6H 2K7QA 3PWPE 4RIRA 4NKOA 3BFWA 3SUKA 2NDGA 1WITA 2FEEI 1OQXA 2QSTA 3R06A 1JRHH 5C6PB 3GRWA 4LIQH 4AMKL 4AL8H 1UM4H 3CBKB 4H5SB 3VWKC 1OE2A 3ARQA 2W0PA 5DI8B 2IANA 3BD3A 1BXAA 1YNTB 3VFPB 4U1NA 3ARFB 1FL6B 3BZEB 2IGLA 3ZKMD 1BQ5A 1MCHA 3ML1A 4TXVB 4Y16D 4UTAL 1NIBA 3X12B 3B2XA 5DO8A 5IMOB 1KDJA 4LPCA 2DLEA 4PYHA 4L3EB 1GPOH 1QFUL 2FQDA 4D0DB 5TD4A 2OJZL 2NTSP 1C5DB 1B0WA 1AOHA 1J9SA 3CLEH 4Z7VB 5IBTL 3ETBJ 3PXLA 1E4HA 4HZ1A 3GSNB 5IESL 4FXKC 2XN0A 4CVWA 4GG8A 2FATH 2VERA 4RAHA 3QUYC 5B1KA 1YDPA 2XQYK 4MJJA 2EDNA 4R4ND 2MCG1 3U4BH 2A38A 4NCC1 1K5NB 2HVJB 3UTPD 1DFXA 4JY5H 1AIZA 5I23A 2X4UB 3FL7A 3DVFA 1HILB 2UX7A 5ISZA 2VABB 2YPLE 1MCOL 3P3YA 3TV3L 4QT5A 3IXTB 2EDJA 5I8EA 2KKQA 4DWHA 1AG0A 1MIEH 1X7TA 4A39A 5CEZH 2ENPA 3IS1X 5TJWK 1Z5LA 1ZC1A 1GJWA 1RFDH 4QRRD 3T3ME 3MJ9L 1J9QA 1E4XL 3ARFC 2CO1A 2EE6A 4M29A 5E2TH 3H7LA 3NESA 5CZVH 4X8JB 4M5YH 5IEKA 1GAFH 3CQZA 1NMAL 2D7TH 4A7UA 1MJ7L 1E0OB 1ZV9A 2R1XA 5I0WA 5LGJA 4JY6B 4AGLA 3EJUA 3NVQA 4KXDA 5TK4A 4EBQL 1BP3B 3V0EA 1ND0A 1EHKB 2EIMB 5T1KA 3UAEA 3QQ4B 1HNFA 4Z7NB 2Z92B 5B3NA 2C9UA 2CMRL 4TLKA 1BG1A 5DD5H 5SX5K 4FXKB 4TQPA 4ZI8A 9PCYA 3LHPL 5L6YL 3D3VD 3MRJB 2XCMC 2YGQA 4R5XA 5HGDA 4ETYA 1DVTA 2C3VA 1CU4H 3NSDA 4JGMA 3NIFB 5D1ZD 4GJTB 3V95A 1OAZH 5HXMA 2VT0A 3REVB 3UTSB 5JW3H 5F6HI 1RZ8B 4J3VA 4WJKB 4LOFA 1PAZA 4AV0A 3EHBB 3V6BR 1FJ1A 3RP1A 1RMFL 2D4FA 2DYPB 2HVKA 1NJ9A 1HXMB 3HS0A 4NP4L 2TRHA 3BAWA 1IGCH 2H32B 4JFYA 3V8OA 3TFBA 4X6EA 1M71B 4XP6H 4MJIA 3O4LA 4YXHL 3PHOB 4KRPC 5KG9A 3SULA 5I16B 4GSQA 3MUGA 2ZOLB 1PPYA 1CFNB 1F6FB 4V33A 3GBML 3QE5A 3IDMB 2LU4A 1TCRB 1D3CA 4L1DA 1NGQL 3A67L 2XWTB 3MBXL 2ZD0A 2BSCA 4HULB 3NT0A 5ID0A 4TVSa 4B0MM 1QUNA 2OULB 3RPIB 3UCRA 2X12A 4XPGH 2YWYA 3GSOB 2QTVA 3WNOA 1RUKL 5FYKH 3TURA 1MFNA 1GA2A 3D12B 3GJFH 3GIVB 3O4LB 3C2AH 3LNHA 5E1IA 2HJFB 3UBHA 2CIIB 5AKSA 3UYRL 4DZBB 3QZBA 2EEXA 3PNWB 3QYNA 3VXSB 3TF4A 4OBRA 2Q9OA 5BV7H 2W9EH 1E61A 2Q6WB 2XHNA 3H2PA 4R7DA 3WL9A 4UI2A 3RU8L 3PQYD 1PDKA 4Q9BA 4JFPB 3GJEA 4QHPA 3LZFH 1AYRA 3P3UA 4FXKA 4WHTA 4AY0A 4LL4A 3GD1C 1EBAA 4RFEB 2E74C 2X9YA 1MRDL 4OCNC 4WQOA 1I4FB 1AA6A 4OZGA 1C12A 4D3CL 1ZT7A 3IWUA 4JO3H 3PWLA 4JKPL 3AGVA 4TOYH 4FX5A 4IJ3C 1K8IA 3DIFA 4OGZA 2ZXEB 3ZDZB 4QR7A 5CGMA 5CD3B 2MMXA 2F8XC 2FT8A 2OMYA 3JT2A 3AY4C 5A2LH 1F41A 5K1JA 5CD3A 2WXIA 1F4WL 1TJIL 3G6DH 4LL9A 5DJ8B 1DVXA 3GF8A 3TVMD 1QHPA 1BM3H 2I07B 1JS4A 2QGEA 4J4PA 3HG1E 1EJOL 1BX2A 2WXMA 5DZJA 4IHOA 1M7IB 4UOQA 4AUJA 1TYRA 3WTYA 4EN2A 3BWUC 3IFLL 2AJ3A 3LKPB 4LASH 4C59B 1NL0L 2G0LA 4RMVA 4FLOA 3VNZA 5DQDL 1CZ8H 1U8LA 1I7ZB 3LS5L 4GG8B 1FO0H 2DQCH 3TBSB 4RISH 4MYPA 3SE6A 3A4FA 2ETWA 1RPQA 1IAOA 4LCUA 4G6AC 4J23A 2R1WB 2VZUA 4Z3GA 3VXSA 3Q6GH 4F27A 2A6HD 1HS6A 4AYBA 3O3UN 2WQRA 4XNXH 4ACPA 1XF2A 3JTTA 3GK8L 1Y0LB 3O81A 4I0PB 3KPSB 3OV6A 5PAZA 4CU7A 3U25A 4HH9B 3RQ3A 1WEJL 3D34A 1FNFA 3F2LA 2BE5D 2RB8A 3KNBA 3O2WL 2UXFA 2WUCL 4M5YL 4XN4A 2NSMA 3HLKA 1EPFA 2BRRH 2CRZA 1AC6A 3FB8B 3X1EA 1IC0A 4NQQA 3CVHH 4LQFH 3I75B 4JDTH 3MJ9H 2MTPA 2Y1AA 2EEOB 1SN5A 4J6RL 3HMXH 1CXHA 1RULL 3L95A 2J71A 1R46A 4MAZA 4JG0H 4RRPA 3UJIH 5GGSY 2NRDA 2WOYA 4I18A 3F6JA 5DYIA 5DD0H 4Z0BH 3WO4B 1MWAL 5CU5A 4XNAA 1GGTA 3Q6FA 4HYTB 5KVEH 3DURB 2HUHA 4NO2B 1QBAA 3WUWA 1CR9H 2DYPA 5HYSA 5FA3A 4V1DB 3IPFA 3OHXB 1JK8B 3VSQA 4ANUA 2WZ6A 3NFNB 1QFWM 2MRYA 1UB6A 2YUXA 1G7PB 1KJ2A 3QFJB 4AXWB 3WKYA 4WI0B 3SQRA 3KW7A 4R4FH 1QWUA 4JAMB 1KG0B 2ZYSA 5EU5B 1KTLB 1XBDA 1T89A 4KZ0A 1IBZA 3T04D 1CGYA 3FO0L 1Q0YL 4NZRH 1RK1B 5EFIB 3QPKA 3TGXA 3X17A 1AYOA 4FQQB 3MNVB 1U8NB 2PWEA 2R2EA 3UEQA 2CRIA 3VYNA 3ZMNA 5IHBA 3L16A 1IC5L 2BVOB 3AREB 4L5FH 2OYKA 3VXSD 2VH5H 1B3JA 3OWRA 5E00B 1N18A 4G7SB 1JPFB 3HN8A 4KNQA 3MCLL 2DQDH 4PY8I 1LO0H 4NRYA 3T4YB 4BCZA 5IB1A 4UQDA 3DSFH 2K3TA 3FRUA 4F7MB 1UFUA 1IARB 4QHKJ 4I77L 1UB5A 3ZHFA 3G08B 5ADOH 3PG2A 1CDJA 3CZNA 3N55A 3LS5H 5E99L 4M5ZH 5EU4B 3HC4L 3MBXH 5AAMC 3DROA 1X7SA 5DVMA 2F53E 3OZLA 4I4WB 3E9UA 4NP9A 4ZM7A 2WKGA 4MQ7A 3PHAA 3O0RL 4JPVL 1THCA 4NENA 1MFAL 2HB0A 2X89A 3CDZB 1QPXA 5TE7H 2Q6WA 3S0PA 1JF5A 5B1JC 2MNUA 2B2XL 5IHZB 2LFEA 1P7QD 4QYOA 5HYQB 4ONGL 2P7TB 4PREA 2NTFA 1A1NB 2F68X 3IDJA 4F58L 3TCLB 4NO0A 1SN0A 1VEOA 2ZUVA 3QPQC 3MLUH 5DRZA 1ET7A 4JJHA 1FAIH 1OTUD 4N3UA 4GINA 5KSUA 4BFNA 4YO0B 2D7MA 4M43H 5AUMB 3ZTEA 1AZBA 5EBWB 3K80A 1S3KH 1CLZL 2EIEA 3O5AA 2HFGL 1NCCL 4LARL 4LOVA 3D0LA 3RGBA 5ISZE 2OK0L 1PT0A 3MGAA 1AO7B 4JO3L 4F1ZA 3MNWA 2QPUA 1PD0A 3QIUB 4MVBC 4WUUE 3RGVA 2F2HA 3MLXH 2FK9A 4X42A 4A2LA 3A4EA 4XP9L 4A2MA 5B39A 2F53D 4UQ3B 4TNGA 2NUPA 4EZJA 3QULB 2BSBA 1WQVT 5DI8A 1JUFA 5HDLA 3S3SA 2C1PA 4P2AA 4HETA 4U0RB 2ZWZA 1EXUB 3I74A 1GL4B 4OFPA 4OM1L 4Y4KB 4XRCA 4Z3HA 4UT6H 1Z2KA 1OO2A 3U79A 2EDDA 2R83A 1O5PA 3BKYL 1NKRA 1AQDB 2PWGA 3N9GL 5EWIL 1ZLUK 2ZSVB 3JWNE 1VCBC 3B5HA 5I1LA 4W9ZA 4JK0D 1XL6A 2ADGB 1QDNA 3HN3A 1FJ1B 5JR1L 2WYZA 4N2HA 1DEDA 1NCAL 1AXSA 1T4KB 3F7VA 3WFEH 1IFHH 4JHVA 4BFFA 4L3FA 4GXUN 5F7BA 3OKLB 3C08L 3SKMA 4A7QA 1TWHA 1EHLL 2OSYA 3MBEC 2Y7SA 3C2SA 3T08A 5B38B 2ZOOA 5IJBC 2WLYA 3IPBA 3WEOA 5HPMB 1M1XB 2L0DA 1B6DA 3RWGB 1SUJA 5AW1B 2PPFA 2IALB 4QTIL 3I9GL 2GBAA 3C6LC 3U4EB 2VKXA 2GAZB 2XFXA 3DX8B 4JRXA 1J9TA 1CURA 1OSZB 3QP3A 1SJMA 3FO1B 3OKDA 5FO7A 5B22A 4JMXA 1WLHA 3E3QC 2N59A 5DD6B 4M6OL 4CA4A 3AQZA 2VPZA 4IOFC 4TQEH 2AEOA 3LPGA 4WHYH 4Q0XH 2WYHA 2J25A 3MX0A 2I60L 3F7PC 3HUJE 2W88A 4YGVA 4HUKB 2VC2L 2AKRA 4MD5B 2PJHB 2AEQL 4FYRA 3HRZB 4FFVC 4HUXB 4WZ9A 4QT5B 1TEGA 3EXLA 4MMZC 1R24A 4GW4B 3TIDA 2WW8A 4PS7A 4BGLA 5CCKL 4YLQT 4AOKB 1EHAA 3A4AA 3B1UA 2HLFD 1J48A 3OF6D 4H25A 3REWA 1TZIB 4QTIH 2HCZX 4KI5F 3ZE2B 3DO7B 1KJ2L 5CUSH 2JIPA 3ZDYB 4CU8A 4Z7NF 3S5YA 4PCTA 3NOIA 5KBLA 32C2A 5C0AA 3DETC 3BGFB 4ZZKA 1ZVSA 5AAPA 3B34A 4L4VD 4LZKA 1KENH 2NZ9D 1KV7A 1MCSA 4AENA 2B5IC 4GMTL 1E2VA 4HJEA 5HTSA 2EVIA 3D0VA 3TWCH 4U6YB 5F72S 3VQ1C 3QHFL 2VW6A 2DL9A 4QLWA 3STZB 3X12A 4JJ5A 3TBYA 4N4YB 3GMRA 4N0YL 4PIRF 2JA6A 3Q8CA 4GB9A 3TT1L 3L3GB 1BEYH 2RQEA 3QG7L 1X5FA 4ZJ9A 5BVJB 5ES4B 5MEND 5IVZB 3KYMA 2VXVL 3DGCR 1MRCL 5F9OL 4ZUTA 1FNGB 4MRCA 5IBLD 4NRXB 5DJ2B 3ARBC 4KVNH 3FU3A 4Y5YA 4LSPL 5EUKB 8FABA 3DJTA 4HFUL 5DEJA 4RGMB 2XZZA 3U4AA 5I17A 4GSDH 1WD9A 4KX7A 5MERB 1QSFD 4WLCA 1MG2C 3P40A 5CP3A 2DWDB 4X6CB 3QC6X 1UHEA 2FD6L 5KSBB 4NCC2 1CD1B 5CILH 2DQIH 4O2FB 4HJSA 4U6HA 2R1YB 5HHVL 4LFHG 5DFTA 3VX0A 4HWBA 4N5UA 1B4JH 4YPJA 2DPKA 2NY3D 1CBVL 5AW8B 4WEUD 1JRHI 4HS3A 1I9RL 2PYED 1T22B 2PP8A 4KROC 2VDPH 5F6HJ 2X53A 3LN5B 4CW1B 3DX7B 4BUGA 2MKLC 3QDMB 1FLRH 3MNDA 4MYWB 5AVSB 4HZLB 3QJHB 3SY6A 4ZXBA 1X5KA 4WTQA 1JYVA 1K6QH 3W9EB 4F20A 5M94B 2PPAA 2PO6C 2MIZA 3MXWL 3X2LA 1MFAH 1WFTA 4MWFB 5C0JA 3MRBA 4XP5L 2XKSA 1DSFH 1SJEB 3TNMB 4YOKA 4M7JH 2OSWA 4ZODA 1NCBH 1QBMH 2EAEA 3NUKA 3RWCB 1CD0A 2F18A 3M17A 3US1A 1DSWA 4FL4C 3ZQWA 2BP8A 4OGXL 2PI8A 1Z9OA 4K5MA 3RWEA 5BV7B 2DMCA 4Y2OB 5E1GA 2EZ0C 1MHPL 2R4RL 5GGSB 1YEFH 1I7UA 4PB9L 5EZOL 4LDLB 3ENGA 1I8KA 1QOKA 3WIIL 4IBWA 4CN4A 3QNZA 4LEOB 1SBSH 3P4NB 1CVSC 4TRPH 5JZ7D 3VFRA 4RAVA 2YD5A 7PAZA 4HISA 3RI5F 5MI0B 3KYKH 1ZPLA 2A6DB 3ZE0E 1KBKA 4S1SH 4OZFB 3ULVH 2AXFA 3OAZH 4IRZH 4ONHB 3E1ZA 4MQXD 4G43B 5T1JA 1HIMH 4Q74A 2D7TL 3M6DA 5C71A 4L37A 4BJLA 4MHHG 3FTWA 1Q9KB 3T6VA 5FUOH 5JPNB 5E8OA 1H8SA 1CTNA 3U6XS 5TFSL 5LNEA 5A2BA 2H1PL 3N44F 5HI4C 4OD2A 4NUJA 2KYIA 4NN6C 4POUB 4PJ8C 2O5ZH 4PRAB 1ETZB 1F0LA 4ZO6A 1CK0L 1HSBB 1JGIA 1SN2A 1HWWA 3ARDB 2IDTA 5D1XC 5GGTH 4ZYKA 3ZTDC 1H5BC 2J88L 1OWWA 5PCYA 2R8SL 5JQIB 4K3EH 2X3CA 4TOYL 1EAQA 3WFBL 4L4VB 4YUEL 1X9QA 2GK0B 5A2FA 3G9AB 3OJ2C 4G42B 4O02A 3KPQA 4WI8A 1MRDH 4BDVA 1MJJA 5F7YC 5DRZB 1X5ZA 3V10A 1A0QL 5DFVC 1ADWA 2D03L 2EE9A 3F01A 4YDKH 1JZ3A 3FYIB 1JZIA 2CO3A 1I8UA 4WFED 3CK0H 3TO4A 2ZWSA 1EHXA 1GGUA 5EUOB 4MJ5B 4WI7A 3FOLA 1P4UA 5H4ZA 4E9TA 4AKOA 3W39A 1N0LB 1AKPA 2K0RA 4WW1B 4JE0A 4NN5C 1V54B 1GOHA 5DHYA 5ESAB 3H0GA 4HJTA 1N3NA 2VUYA 4AQAB 1I9EA 2XY2A 4WW1A 4NQTA 1UB5B 3DMMD 2YD9A 5FTNA 3T2LA 3VRLE 5D93C 1UJ3B 1NM9A 5D1XB 5DVKA 2IPTL 5B1AB 2HG0A 4F9LC 5J3HD 2AK1H 1EDQA 4G7YL 3WMPA 4FQ2L 3FHEA 1WC2A 5I1KL 3O6MH 4GPVA 4XN9A 4AH2A 3UTSE 3QQ3B 3NFPB 3CG8A 1OSPL 1K3ZA 2BNQA 4FQPA 2WNWA 2CE6A 2AJUL 2EDHA 2UY6B 3CSGA 3WFHA 2ZCKH 1AHWB 3QCTL 4NQXA 3L1EA 2CQVA 1SF5A 2X38A 5EC1B 4JO2L 3VI4B 1ES0B 1ET8A 1BZ7B 3SGKA 2NY5H 1KIPB 1PFOA 1EFXA 1MDAA 1WJ3A 2YK1L 4RGNB 5KTEH 5F44A 3EKCA 1I3QA 4XXCA 3HI1B 4HUCA 4EZMA 2GHWB 2IWFA 5IY5B 5I9QC 3IJ7A 1EAPB 3WXVH 3ULUH 3ATAA 5C08A 3O6ML 4WCYH 3DJ9A 2AABH 5BVPH 4JKPH 5C07A 3KWTA 2R56L 1H6UA 1WK0A 3GBNL 1QP1A 4XNUH 3N85L 2HA1A 4BH8A 1CXIA 3FSAA 3VCLB 2WLLB 4ONHA 4PN6A 4M8UA 1G9ML 5DHXB 1UCTA 5E5MA 2ZXCA 1FFRA 1KIRA 5FCUL 4ZD3H 3ZDYF 4L8CA 2BK8A 3LDBC 1WIOA 1J12A 1CG9A 2L3BA 3SDCB 5I1GL 4P9MH 2GSGA 4XI5D 1MPAH 5GM9A 1JHKH 1E90A 1Q94A 2Z64C 3P4NA 1ZVNA 2HT4C 3RDTB 4K3DL 2FX9L 2J56A 4OFDA 2OLDA 1ORQB 1ES0A 3FTXA 2XWCA 1UM5H 5DWUL 1KLGA 4XB3A 4NB7A 3HBQA 1FBIH 3ARBB 4BZ2H 4F93B 1NBYB 1EO8L 4PLOB 5FFOA 1OP3K 3WIHH 3TO2A 1E8WA 3CU1A 1NA8A 3I2CH 1GIGL 1IAOB 3QDGD 3SPJA 1MFDH 4MWFA 3S3CB 4HIHB 5BS0E 1C16A 3O2VL 4PJ5A 1QBLH 1YLEA 5EPMB 1KJVA 1TQWA 1KQGA 2VXSL 5AALA 4NPKA 3U46A 2AC0A 1ZHKB 4DGVH 4GG6B 3KMDA 3S36L 5I26A 1U4EA 4UZGA 3UAAA 2X88A 3ABZA 5E6YA 3H9ZA 2AP2A 5FYLD 1W0VB 3KLQA 3VQLA 4R7NA 4R7VA 1FHGA 2AW2A 3L5XL 4LBEA 2KBGA 1KEGL 3KYNA 4I0PD 2D3JA 3BUYB 4OUOA 1EDHA 3MRKB 5AB9A 2EYRB 3CMGA 1U93A 3QG6A 2ORBH 2KERA 3TO4D 3OG4B 4YBLC 5JPMB 2R1YA 2ZT9C 4N85A 1UKTA 1BPVA 2NY7L 5I30L 4XN8A 1V7NH 4LSUH 1H3TA 1V3KA 2MQ0A 1WE5A 2ADFH 2YO3A 4V11A 2ZOKB 2EYTB 2Y3AA 3VXRB 4QLRA 5L4FA 1KFAH 3HI5H 4PJ8B 1JGEA 4LMQI 4KRNA 5E4OA 3OB0H 1C12B 5IUCA 1S7WB 3RY6A 5BZWA 1JYXA 1D5MA 2VN6A 1T21B 4OV6F 4ZQKA 1IE4A 3LRSA 3WEBA 3WXVL 1BZ8A 4AWJC 3O3EB 4NUJB 1NL0H 3PWJA 5ERWB 4HMEA 4M6ML 4HX1B 3KLHC 4TUJB 5AVZB 5TE6L 1KYOK 3VWJD 1Q9KA 4XNDA 3G5ZA 4KKBD 1SJVA 1O7DE 3OZ9L 1HCYA 4PJGE 15C8L 3NJLA 4Q89A 3QQDA 3R8QA 3ZIYA 4YHNB 4P4RB 2FVNA 5CEZL 4Z3FA 4L18A 2PPCA 5T5MD 5JORA 4HHAB 2O93L 3BUQA 2PXYB 3DI3B 1UXWB 3V0JA 3ZOAA 2BFVH 2QMJA 2PF6A 2WQWA 5KYYB 4KDVA 3M1OA 1MZYA 2X4RA 4QRBA 2IBZX 1DMSA 1EK3A 1YEJH 1T1ZA 5DYOA 5GISH 3BUPA 1U8HB 5H2BA 3UJJL 4JO1H 4FYSA 5FYJE 3ULSB 3LB6D 4ATWA 5CCJA 5IJKC 5IOPB 5HDWA 3MRQB 1QNZH 1GHFL 3K6DA 3GBDA 3JWDH 3NSXA 5KBMA 4AGMA 5KSBE 4LSRH 1JOIA 1MCNA 4WWKB 3I3DA 5DJ0A 4PG9A 1SDYA 1KGCD 2FSDA 3UJTH 4PWGA 3LH9A 4YSSA 4HT1L 4H8UA 5EBMA 2VPYA 3LZFL 4QRFA 1NMBL 4P59L 1DFBL 5KN5A 2QVTA 5A3ID 3UC2A 2FE0A 5JHDE 3TN0C 1P53A 1Y7VA 1IC4H 2J8HA 1MXGA 3MA7A 3ZIMA 2WWNA 2OS7A 4XPTL 5INCA 1J8HB 1OP3H 2DLHA 4TNWF 1NKGA 3CFBA 5EZIH 2H8PB 3JTSA 3QR2A 4UM9B 5ALBL 3QWZA 2A3TA 2VE6A 2YOCA 3R7QA 1HHHA 4JFFD 2ZOUA 4FG6D 4NCDA 2J6EH 2J20A 2F5BL 1WHPA 3DMMB 3POCA 4LSRL 5AG8A 5IM7A 1WA1X 1J0HA 1G0YR 4ZDHA 1ACCA 1EWHA 3L5WA 4XR8C 4JEGB 5BVPL 1QCSA 5FECA 5I1DA 2IADB 5T5FH 2XBZA 3L4XA 2H2SD 1VIWA 3EYSH 3ETTA 3FZUD 4ISVB 3B43A 4V2CB 4EIGB 4PRIA 1NCBL 1QBML 2BERA 3SQBB 3COOA 2DEWX 4PJ9B 5G5DB 5BUGA 5MERA 1OGSA 5D5MF 2JKWA 2P80D 5GLYA 5EA0L 2IWKA 4G8GB 3UZEC 3QI9D 4MJ4A 4DTGH 4UF7C 4MASA 1VFBB 3UMTA 4PJFA 3Q06A 3HA0A 3I6SA 2OJEA 2V17H 4XC3H 4LFHD 1HXYB 3V4VB 1XZ0A 2F5AH 4NZUH 5AZ2H 4NZTL 4DN3L 4FYTA 1CI3M 5C3TA 1VF5C 2XETA 5KBNC 1GSMA 4ELME 3WJMA 2EDWA 4PJGF 1RZFL 5K1NA 1QMUA 2HTKD 4NUQA 5BS0A 4JQXC 5ISZB 1LQBC 4DP4X 4RMUA 4OZIF 4XP1H 5AUMA 3DMMC 3BFOA 3L3IB 4OJEH 5E70A 1BREA 4M9OA 5DYGA 4Z3EA 1HHKA 2DQIL 4M9PA 1XFPA 4M1CD 1CLYL 2CA3A 2Y1VA 2OMUA 1WAAA 4NO0B 3V6ZB 3VRJB 3T2QA 5F1OB 4X9GA 1DVYA 5JIKA 1A3ZA 1SVZA 4DGYL 3IDGB 3CDZA 4Z0XA 1A3LL 2OTUB 2XNAA 3FOMA 2VLRA 4AV5A 2I9TA 4MQ7B 3RVTC 2NY0D 4O2EB 2GSIA 1A1OB 4GXVH 4OM0H 3WJMB 4MDRA 4AJWA 1FVEA 1PJ9A 3NJNA 1QX1A 1XSOA 2HPTA 5KYUA 3HE6B 4AJ0A 1QD0A 3SGJA 5J9PB 1RZIA 4FMVA 1W16A 3G5VB 4X9HA 4YLBA 2EDOA 2VDPL 1HL5A 3WFDH 1P7QA 2Y4SA 3K7UA 4X7FC 3VQMA 4M6NL 3MOAL 5C0BB 3D2UB 1BYPA 4KUCD 4KQ0A 3QAZB 4ICWA 4IU3A 1QSFA 2KQMA 3ECWA 3ZT6A 3QUZB 3V5HB 1H9DA 1L9TA 2VNCA 4CN1A 5DTFA 1DN0A 2ZXDA 3UPRB 1M1XA 1P7BA 4U1GB 1P7KB 2ZJSH 3SDAA 4A37A 4H8WH 3LKSA 4YH6A 3UYPB 3N42B 2XVLA 4P2QE 4K15A 1SUHA 3PXJA 4BSJA 3RFZC 4TVPH 4YIQB 1CCZA 2FX9H 2VUOA 3EO0B 4K55A 3NEOA 2J57A 4FLRA 1AXSB 3BP6B 3UPRA 3CZFA 1Y18B 4OTXL 5DR5H 4LHUB 2EDTA 4DP1X 1BVLB 2D31A 2GJZB 2YAQA 3EO0A 3FO2B 3R0MA 3MV9E 3VI4E 2VR9A 5GRJH 1YMMA 3Q6FB 4FNLL 3RIAK 3QHFH 1O7DC 4F9PA 5SWSD 3IKKA 4ENED 3O0RH 5FS5A 4EIBA 4RMRA 2FL5A 5AZUA 2X9ZA 3K8KA 4NFCA 1E32A 5TGBB 3SYCA 3S8FB 4L48A 5DU7A 1PZ2A 2Z7UA 3TYFA 3ZDYE 5A40E 3EIFA 4XMUA 1SYVB 3CU7A 2EUVA 4JP6A 2IFFL 3FQ2A 2XZAL 3FB8A 4TTDC 1E30A 3MV9B 3EOAA 4OF0A 1L0YA 2V3EA 4RA3A 4ZMAT 2C45A 1S5IL 4JUSA 1YQVL 3LZLA 5ESVB 4PJHB 4F33A 1BOYA 2EUXA 5J9PA 3UG4A 4P5MB 3CVIL 4PJXA 2ESVA 3EOTH 3JTTB 4IJ3B 3NA4A 1IAMA 3GDCA 1N6UA 2WVUA 4R4BA 2ORBL 2EO7A 2A6JA 3TCLA 2HLAB 1QEWA 1MN4A 5ITFA 4O02H 1TDQA 3FT4B 4ALAL 5L88L 4Z0XB 2GUOB 3I84A 1FIGH 1J5HA 3P9WB 1U8MA 2WXGA 2E6JA 2QGDA 3U82B 2FH6A 5C2UB 2GUOA 1M4KA 5E1AB 3FT4A 4XVJH 4EJ1C 4KMTH 3PAVA 4E9YA 2GK2A 3P0VH 4I4WA 5F6IC 4XNQB 3J8F7 1P5UC 2OX5B 4IS6A 3EYSL 1NM4A 4FKKA 4P2RE 1BCIA 1XCQA 4RZCB 1TTGA 1U3ZA 2OPCA 4NC0B 5C6WH 3D7PA 1VFBA 1MFEH 4OSUL 4NKMA 2CHZA 4GKLA 4LSPH 1ZGLB 5DEFB 3VRLF 1HSAA 4FQIH 2PW1B 2X2YA 4FFZH 2OV0A 3VH8A 2K45A 4CUCA 4GG6E 1T0MA 1UXSB 4LNRB 1T5WA 15C8H 1D5XB 1FO0B 2VC2B 2OP4L 2CBTA 3CH1A 2BNUA 1J8HD 2CK0H 2EXWD 3FQNB 4BCXA 5CAYB 4LRNH 4ORGA 1OK0A 1P7HL 3FFCD 3KBEA 4IRSC 3ZZ1A 7CGTA 4PJEF 4TUOA 5KAQF 4WI5A 3KPRA 3N42F 4JFDE 4MZRA 1G8JA 2JIXD 3H3PH 1QSED 2NNXA 3SE9L 3MJ8B 4M61B 3BUBA 3L3JB 4ZTOL 1UB6B 5LXGL 3AM8A 2JIOA 1GMIA 1MHCB 1TJHH 3D85A 2BHUA 4F80A 5GGTL 4KK6D 5F3BB 3LXUX 5GGUA 3VXRE 1KJVB 2FLBT 1MNNA 2ICWI 2JQMA 4Z7WE 4YR6A 1AE6H 4HSCX 5C0EA 3GBNH 1AC0A 3JZ7A 4MA3A 2AQ1A 3RHWF 2IQ9L 5LB1A 3NEXA 3AXHA 3T5WA 3FO9B 4OCYL 4GRWB 4HIQA 3ULUL 3D51A 4AIZB 4OLEA 4JFHD 1UCBH 4Z7UA 1FYTB 4M62L 1ED3A 2CIIA 3FXIC 2XTLA 1UD3A 4KJWD 1ZD6A 4KVPA 4X5WA 4TSCH 4A7TA 4PGDB 1CQYA 1IILE 1U58B 4OGQC 2IAMC 4X99A 4NJAH 3GTLA 3RL1A 4F9PC 4B9ZA 1CO1A 3GTKA 1AFVH 3QCVH 4GQ9H 2HTLD 4HIJB 4PJGB 3T6QC 4UYQA 4ZW5A 1U91B 2RMNA 4M6MH 1IEHA 2VO8A 3LMJL 1G43A 3Q05A 1TCRA 1BQLH 1FYTE 4L9DA 3DJRA 2DTSA 1J0IA 4IBZA 5GJTH 1IL1A 1FVCB 1NANI 2BP5M 3HBZA 1A22B 1GZQA 1JHTA 2IDFA 5T33H 4OFYA 2R1WA 3QIWD 4I18C 4AC2A 2BJML 5D4QA 5T1LB 5DO2C 4D9LL 1JXDA 3ARTA 1KC5H 2NQCA 4LCYB 3VFVB 4BINA 5C08B 4JDTL 1EEYB 4POZC 4I88A 1HKLH 1Q38A 2VPXA 3T0XA 2X87A 5FEBA 2Z35A 1UZ6F 5CJOH 4C4UA 3FQTA 2ADJA 3HJ0A 3S34L 5JTWA 3QJOA 4YGAB 4AM0Q 1HJBC 1A6TB 1ROWA 3ATBA 4TUJA 2VN5A 2JJTA 4PHXA 1Q0YH 4NZRL 3VFWB 2NYKA 3O3EA 2XZCH 2YD6A 4V2BA 4PGEA 3HG0A 4NZ8A 3EYUL 1H3WM 1RV6X 4ZK8A 2I27N 4M3HA 4GSRA 4U1SB 3IDIA 2EUWA 1JV2B 2CIKB 3RY6C 2E4TA 4ZX5A 3U1QA 4AH2B 1JDDA 1LQSR 1RCYA 9CGTA 4XCNA 4TSAH 3O41A 3KCPA 3EG9A 4K3JL 3UYOD 3P11H 5IF0B 4B50A 5LGHL 1S3SA 1JF1A 3AG3B 1I4FA 4OLVH 4PGCB 4LASL 1FE8H 3LEXA 3NZ8B 4XCYB 3S7GA 2FO4B 4DKFH 5EO0B 2XQYA 4OCLC 4MS8D 4R0LA 1AZUA 1EQWA 4NIYE 4MXVF 1T0NA 3VFGL 5FOBB 2V9TA 2WIIA 4LBEB 1PZSA 3ZHNA 3ARGA 1KACB 3GJFK 2FEEL 1DBJL 1JHLL 4NQVB 4F3FB 4NO3A 3OL2A 1MLBA 5ALCH 1JXGA 1A2YA 1JI2A 4G9FE 3UX9B 4M5ZL 3ARBA 3WI9A 3IJEA 2QQKL 3KH3A 2ZWYA 4A38A 2AJXL 1G4RA 2APVA 2PNWA 4XBGB 4L4TB 2BDNH 2YEZB 3IJSA 3PL6C 5JW3L 2X5PA 4P2OB 5C09D 1YMHA 2EKSA 2VR8A 5GS2H 1PZUB 3MGTA 2J4WL 1NAKL 4Y4HC 1TR7A 3MYJA 4MNHA 4FNRA 4NQCD 1ZK5A 5SWZE 5HGHB 3N3EA 3PS6A 1MCLA 3BIBX 3ARSA 1NUGA 1BFTA 5EMYA 4FNUA 4O5LL 3ZRSA 1RHFA 3GUTB 4HLZH 5BV7C 4CC4C 3ZL1A 1IQDA 4P48A 1OLZA 4LAQH 4DN3H 2NY6D 5F71A 2B14A 2IVFC 5DJDB 5EOCL 4WW2B 4ZSOB 3U9UB 4LRNL 3O3AA 2FYYA 5IROC 1WISA 4NBZB 2HG5B 1CE6A 3T3PB 2P44B 4MJIB 2W07B 4P4RA 2IO5A 2F8VA 3X13B 1SXNA 4TQIA 4EDWH 1EANA 2XQBH 4RBPK 4BQ6A 4XCCL 1Y1UA 2EQDA 2IH8A 2AAAA 3GZOA 1IBFA 1DDHB 2FYYB 2Y7OA 4ZFZA 3UTSA 4DZ8B 2CUMA 5HHPB 3RUGF 2MH4A 1GGYA 4OB5L 5DA0B 1XR8B 3VXRD 1LP9F 5F6IB 3EH5B 1OARH 5FO9B 3SE3A 3D0AA 5CD5D 1TG8A 5LBGA 4JDVA 2Y7MA 4MD4A 2R29L 3LVTA 1IFHL 3F5WA 3CFJA 5D71L 3TX4A 3DSNA 4QKTA 3T8XA 3OZKA 1NGYA 1IM9D 1NCDH 2Q5BA 3B9AA 1N5AA 3DHUA 4JFTA 4Q2ZA 1ZS8A 2OMXA 3SYPA 1DBMH 2R1XB 5L88H 3K71B 2PTUA 4J1UB 1DANT 4J3WA 3SE4C 4LAQL 1ZGLM 1JAEA 4XBGA 2AI0L 4KK5C 3T0EE 1KYAA 2QHRL 4JJOA 4QIRA 3L3HB 4MNQB 3K46A 4J3UA 3IGKA 1ZDQA 2AAVA 1N7MH 3KR3H 2OW7A 3CMOL 3HMWL 4JFZH 4DERA 3FSVA 1H8OA 1N5YL 1S7SA 1TQBB 5B1BB 2ICCA 2FX8H 3KPLB 4FZEL 2I32A 1IJ9A 3L3HA 4MNQA 1Z9SB 1BQLL 3GXFA 2CCVA 1AS7A 1OB1B 5INDB 2IBZY 2N7AA 3HZYB 4RMQA 4UM8A 1T83A 1FZKA 2NY6B 2KZWA 5CCKH 3ESNA 4O02B 3BKCH 2YBRA 5AYUL 4R7XA 4Q9CA 2CALA 5I17B 4WSGA 4S0HA 2W81C 3L45A 1DTUA 1T4WA 2KDYA 4AVJA 4F92B 3BQUD 1IEAB 2OR7A 5HDBB 1WGOA 4JRXD 5K9QI 3I6LD 5GXBB 1W72L 3ZT7A 2XV3A 3TFKC 3D8MA 1PZBA 1DCEA 3KYOA 4HG4K 5ILTL 3ASOB 4DHLA 3EO1A 4QHNB 4U4BA 3E6HB 5C07D 1CDGA 1H0DA 4FZEH 1Q94B 1OTTC 2JJSA 1TVHA 1UT1A 2B3RA 2H3XC 2F1BA 1QHOA 1TTBA 4NSKA 3OKYA 1TQSA 3MLWH 5C0AB 1E6JH 1PD6A 5D7IA 3MJ9A 3BXNB 2DI7A 1HDMB 3IMSA 3K5RA 1N70A 3RZCB 4BSVB 2ZUTA 2H9GA 1EERB 4Y4KD 1JBJA 3WS3B 1R17A 2VDKB 5F8QC 4CSSA 4G7VH 5T8IA 3ZL2A 4ZT1A 3U9UA 4ELDA 3LXBA 4MNGB 1LK3H 1TNMA 2A6ED 5J1AB 1PT1A 1IUZA 2HFFB 1MWAA 5HVHC 4N1EA 3F65A 5IQMA 1IQDB 5BXFB 3NN8A 1J11A 2PR9A 2CKBL 2VMFA 1IGFL 4U0RC 4PJ7E 1XH1A 1M9WA 2H0PA 3MFFB 3IMVA 1TEFA 3NH7H 4LIQE 5CJBA 3IF1A 3GEFA 3ZKND 1ZHLB 3AU0A 3RDTC 1AY1H 3MGTB 3DV4A 1BAFH 5EC1A 5BW7A 2DBLH 4EZLA 3BWUF 1OTTD 4HV8A 4NQEB 1RZGA 2PICA 3MMEB 4NQED 5EIIB 2A9MH 3QUXA 3OBAA 2XIDA 1W72A 2AQPA 2WKLA 5JHAA 2ATAA 1QYGL 1OM3L 2BSSA 3FULA 2LFGA 3B83A 3VWJC 1JYWA 2R2BA 4GA5A 4FKEA 1PY9A 3CQQA 1UH4A 2VLMD 3WNMA 1ITCA 1T66C 5FHAH 1C1EL 3L4TA 2NNRA 4ETQA 4P9ML 4N2AA 1CDUA 4KTYA 1ONQA 1UWGL 1B88A 2W9LA 3FUDA 3NSJA 3LRGA 1IZJA 1IM3A 1UVQA 4ZPTB 2A1WL 4F7EA 5EUOA 1NDTA 3O8XC 1YRKA 3D39A 3HE6D 3QEQE 1MQ8A 4N28A 5AYUH 4KITB 1KB3A 2JB6A 3ILQD 3TWCL 4IRSB 3RWDB 2DIAA 4QRQB 4GRLA 1EFQA 5B39G 3GI8L 2N7SA 2RACA 4DQAA 1TZHA 4HUVB 3MUUA 4YZFE 2FHFA 3S97C 4BZYA 4LLQB 1DLHB 4FQJL 3GMRB 3OKOA 2WZPA 1KTDB 4L8BB 1XBRA 4PJDB 3HKZA 2FGWH 3D50A 2GQHA 2R9HD 4YNYA 5EU6B 1X9RA 2BNRB 3K0YA 5A2AA 3FFCA 3UG5A 4JHBA 2A69D 1PPIA 5EBWA 2DQHL 2Z3FA 3QZWG 3KPNB 1OEZW 1J0KA 2A1WH 3O11A 4F1SA 1HSBA 2NY5L 1DANU 5C9JA 1U30A 3TBYB 2CDFA 4XX1E 4HCRH 4KDTA 5LN4A 4PJIB 3L4VA 1S6NA 2EIBA 2NTFB 3KWVA 4FQIL 3ATFA 3UL4A 4TQ8A 4C2MA 4NT6A 1MF2L 3SKOB 4Q6IB 4ODTL 4OZHB 2VITB 4HJIA 4L37B 4OI9A 1NMBH 2GTZB 3EFDH 4HVBA 2LAGB 1BMWA 4LVOC 3T0WA 2V3DA 3RTQB 4M3KB 4JRXE 1NSNH 2ZPKH 4WUUB 1JMZA 3DROB 1KNOA 1XF3B 3PGCB 3BWSA 1FN4A 2CO4A 5E7BA 2BVTA 2YUVA 3MRDB 5KVFE 3P54A 4BD4A 2IPKA 1TQBC 4BM7A 2NXYC 4RGMC 4A6YH 2B1HH 3GMOB 4X83A 1D7DA 1HAWA 2ICEA 2DLFL 3P2BA 1AY1L 1QEXA 3ZZSA 4BWTA 1WZ1L 1OE1A 4Z7VE 4JFHE 2GJ6B 2H2PD 3C5ZB 1XXFC 2R9HC 2HZHA 4AC4A 2N1KA 4XC1L 5IVXE 5JXAL 1E60A 1OVZA 5E6SB 2NXZB 3H6AA 3TYFB 5DUPL 4N0YH 3OZ9H 3HNTL 4ABUA 3EYOA 5I18L 5JHMA 3GXDA 1T7WA 5EOCH 1H3VA 1CMOA 4JDEA 4X2UA 5F9JB 1E67A 4JDZB 2E6PA 3EFOA 4TLUA 3HC4H 2WAHA 2GJ6E 4G5ZL 5DJXA 3N1PC 5IHHA 4ODVL 4AJYV 2ARWA 3BWZA 1A7BA 4QRUB 5FXCH 3BP6A 4XCFL 4IOFD 2X09A 5D7HA 2WO2B 4V1DA 1PX4A 3LN5A 4LVHB 4Z95H 2VSDA 4CW1A 1YEEH 4UWQB 1PVHA 3JWNG 1J5OL 5C0RH 5CD5C 2DAVA 1AQDA 1FORL 4M7KH 4Z8FL 3B2MA 3JBG7 2WLIB 1WWWX 3TU6A 3RL2A 5GQBA 1U6AL 3C09B 1Q16A 5C0DA 4G3YL 5CKGA 2YSTA 2XYBA 2QELA 5MENB 5FW8A 3VD0A 1PZAA 1D5XA 3QUZA 3V5HA 4D8OA 2Z6FA 4AX3A 3BXNA 4X6CA 2J5WA 3ARVA 3I9PA 4AGOA 2OJ1A 3QARA 3FCGA 5DEFA 3UTTE 1XIWB 1AO7A 4AQ1A 3FH5A 4WJ5B 5T5ID 5K39B 4FP8L 2PUQT 2Q7YA 1MCPL 3G5VA 4HSQA 2B4CH 5I75C 3IFNH 4BA0A 4GBXB 4I5BB 4X9BA 1KCLA 2PKDA 4IS6B 1OAYL 3CZGA 3KXFA 4YPGB 5HYJD 4OFIA 4E9XA 4IJTA 2GEEA 1ERNA 4WGKA 4YBLB 1FGNH 5AG9A 4PJ7B 3RVWC 1UA6L 1TTFA 4TSAL 4N5ED 5AAWC 2VSKB 4IDLA 4YFLF 4QYOB 2YRPA 4JANB 5FO8A 1AOZA 3ZUCA 4MSWB 5GSRB 1Q72L 4Y5VA 3FTYA 2JQAA 2GKIA 1WUNT 5IFAL 1INQB 3EH1A 4GQRA 5FLVA 2Y1YA 1RP9A 2A6JB 1UWXK 4WNJA 5I1AB 4AJVA 3U9PL 2DM3A 4QY8B 4PIBA 3PJSB 2ESVB 1NOLA 3PY9A 2IANE 4PW9A 4PJDE 5E8EB 4E41A 2UZXB 1F86A 5KUMA 4D9QD 1KTBA 2NYAA 2YPKB 3V0HA 1SDDB 3EGDB 1OPGL 3APCA 2EYSA 4JO4L 4W9JC 1U8JB 1A3QA 4HIXL 5ANMA 3U4BL 1NFDB 3T3MF 3MLWL 3MI6A 5HJBA 1QACA 4FJYA 2N01B 1YNLH 3MRFA 4AYEC 4Y19E 5T3ZE 1GHFH 2L4OA 2BJMH 4QYAA 5FUCC 3WDHA 2P8LB 3R4RA 2AABL 3ZQXA 5FKAA 1MW3A 1Z66A 5JOPD 3TH4T 2IV8A 3NK3A 3WV0A 4HFWA 1R9TA 5AW6B 5AWNH 1J0ZA 2AGJL 3BPCA 1ZLUH 3H7BA 5FCSH 4P2QD 4MB4A 1JPGA 2WLNA 4MMXC 1U92A 5BRZA 2A77H 3V9EA 2HWZL 3INUH 3MRNB 3WUWB 4G6ML 2K9FB 2E9IA 4PJEB 3STLA 4EKXA 4FN0A 4IBUA 5I1IL 5GGRB 4JLRB 4PY7B 2DQEL 2ZNXA 2BRQA 1KPRA 4XH2B 3NZHH 4Z7WF 1YC8A 2PP9A 1ACYH 3DYOA 4FLHA 1RMFH 5FA3B 1KBGH 4Z3JA 3BDXA 1YJDL 3P1VA 5EN2A 4XNXL 5JW5A 3I6GA 4NUGL 4P46D 4KY2A 4MD0A 3BSHA 1OAZL 1CXEA 5DHVA 3CDGB 4U3SB 5E9DB 3QNXB 5JIHA 2C1PB 1JNHB 3PP4H 3MLYH 3HRZC 5DZVA 5GRYA 3K4DA 4QPEA 1H3PH 3VD5A 5TE4H 2WGXA 4UQ3A 5CSZA 2CJUL 3H8NA 3HCVB 3DX1A 5FHBH 2JIRA 3V7AG 1C8QA 1UWGH 3CJJA 1EO7A 1UZGA 4X4XA 1BFOA 2VLRB 4UQBA 1DBJH 2NUTB 3HG1A 2ZOLA 1F02I 1KEGH 4AGQA 4F7CA 2WCPA 4QD2E 4R4FL 1A0QH 4P5TC 5DS8B 3HE6C 2A0LD 4Y16C 3C2AL 5IB4