4FG4A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with hemithiocellodextrin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg4A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg4A02
5GLYA 1WHPA 3SUKA 2GAEA 1HD5A 2G6GA 4JJOA 2KQAA 4JS7A 2VXQA 3X2PA 4FG4A 4L48A 1BMWA 2HCZX 2ENGA 1BW4A 2BH0A 4AVRA 4JP6A 3CZBA 3ENGA 1L8FA 1WC2A 2G5DA 3X2GA 3SUJA 4FFTA 4ZM7A 5GLXA 3X2MA 3X2NA 5H4UA 1WHOA 3X2JA 1N10A 3X2IA 3FT9A 2AE0X 5GM9A 2PICA 3X2OA 4ENGA 4JCWA 1OA9A 3SULA 2JNZA 3FT1A 3D30A 1OA7A 2PJJA 4FERA 3M3GA 3X2LA 4JP7A 3X2KA 3X2HA 3SUMA 2PI8A 2PNWA 4FG2A 1BW3A
chains in the Genus database with same CATH superfamily
4JHUA 1MI5E 3SCMC 1URIA 3O3DA 3QG7L 3QEGL 4BKSC 1YEFL 4H8PA 5JUEH 4WFHE 3DVIA 4G7QB 4OCMC 2XETA 4WFGD 3IAQA 1RZFH 3FB5B 2KMWA 4URTB 2NNXA 1T20B 2ZXDA 1LTXA 1HX0A 2BERA 4YZFE 3FQWA 4RGNC 5E9AA 3HC0B 1NGWA 2FT8A 4WUUE 2V2WB 5M95B 1AD9B 1BAFL 3O45B 4RLDA 3OKMA 4O51B 2I07B 1TDQA 5HSFA 1GPOL 2AQ1A 2MKLC 4Q4IA 5DUML 1RP9A 1I8AA 1S46A 4R4BB 5KSAA 3EYOA 3O6FD 5KSAC 2A4EA 2MOQA 2DD8L 2DEWX 4RIRA 1C5BH 1QD0A 3Q01A 3VMOA 4CVZA 4X80H 3BPCB 1M2VA 1OAZH 4GAYB 2AVFA 1NEZG 5IIEA 3WI9A 1WC7A 1RURH 1IBYA 4JM2C 4UDTB 1DO6A 2GEQA 3LN5B 1U3NA 2QBWA 3MRDB 3MJ7B 1YC8A 4UNTA 4YHOL 5GRJH 4ZW7A 4LCUA 4R5VA 3CG8A 4LLMA 4N8VA 2ZG3A 1HEJC 2GW5A 4N2DA 3T0WA 1X5JA 4BKTC 1J1XH 3OJMB 3QJHB 4BWUA 4GRWB 3RILA 1Y1VA 4HSAC 5E6YA 5I1CL 2X6VA 4LQFH 2R9HC 3NH7L 1KTLA 3KXFA 5E99H 2J5LC 1U8JB 1KFGA 1MLBA 3P9MA 4FQ2H 4L4VD 4HKXB 3DXAD 5FKPA 3MUJA 1SPDA 3C6SA 5DWUL 2BVTA 1M42A 4V11A 1MXGA 5CCKH 1FAIL 3BVUA 1FNSL 4XNZC 4TNGA 1M1SA 5I6LA 3B5TA 1DQKA 1I8IB 3CFCL 4JY4B 3QDME 2EIZA 1H3WM 4Q7DA 1BQKA 4H0GA 5HYJA 2W59A 4XP9H 3S37H 1P9MA 5FYLE 3ULUH 1Q9KA 2AJXH 3D39A 4UT6H 3WO3B 3U0TA 3L81A 5E00A 2J6EL 3LZQA 1F3DH 4I0KA 3SZKC 3JV0A 3K3QA 4AK1A 3BUQA 1N0XH 4YOKA 2WO4A 4AKOA 4JEGB 1L0YA 3OM3B 4GS7B 1FL5B 4RMVA 1FORH 4R9HA 5GGTL 1WCBB 4RAHA 3QQDA 2AV1A 4HJJL 4KNSA 2FJHA 2QSCH 3LQAH 2ICWA 4Z76A 3DGDA 3BVNB 4GSDL 3WJJA 1A1OB 2G5UA 4HIJB 4OIIL 4Z6AT 2ROXA 1DBJL 1ZHNA 5EOCH 5KVGH 1A3ZA 1LO2H 1XGPB 5IF0A 1ZDQA 3G04B 3N91A 1OPGH 4X5XA 1MVYA 5K1JA 2QSVA 4YHNB 5IGXL 4LASH 1OF0A 4AVKA 1FDLL 4UQAA 5FA3B 3RX8A 1HDMB 1PG7X 2BCKA 3DMMA 4NXSA 5GGRB 4JFYB 1C16A 3GTTA 1ORSA 1KPUB 3HG1D 4PJAE 2VRKA 3UG5A 2EUZA 4XCCH 4K9JA 3ZRCC 3CPUA 2WIIA 1AZCA 1E65A 3H3PH 1Z32X 5HDBB 1OANA 3DDFA 5JDSB 1HHKB 3VSQA 3ULUL 3FB5A 3QRGL 3VD2A 2QTEA 5DFVC 1T20A 4Q0XL 2R2BB 2HRHA 3WIFB 2VLJB 3KPNB 4XX1G 3HC0A 4N9GB 5C07E 5E1AB 4HXAL 4NN7C 4PMEA 2CIIB 2V2WA 3ZPDA 1AD9A 2QADB 3ZOAA 3O45A 3VMPA 3D2UD 1DJSA 1SF3A 4O51A 2I07A 3WKPA 4L1SA 5JW4M 4M43L 5DVMA 4F2FA 4JL2A 1CZ4A 2G2RB 1EANA 4JPWL 3V4PH 4D3CH 4NQCD 4R4BA 4FABL 1GC1C 1QACA 4NIYE 2Q2EB 5DGQA 3WEXB 3B83A 4G2AA 3JWOL 4HWBA 5H37G 4HV8B 4NSKB 3RAJL 3B2VL 1QW8A 3EBIA 3GEWB 4W4OA 2OXGB 1O9VA 2RFXB 4QTIH 3S5ZA 4F2MB 2FSEB 3BPCA 3SBRA 1WZKA 4GAYA 2BOCB 2CUMA 1T2QH 2NZ1A 2KQMA 3RGHA 4HULB 3U7AA 4GW1B 1CGWA 4UDTA 3FFCE 4AC4A 2E7ZA 1AZUA 3PWVB 2R8SH 3IS1X 3LN5A 3MRDA 3MJ7A 3CIAA 3H0TB 2UV3A 1FFOB 3HZVA 2JELL 1WO2A 3ZK0A 1UTDA 3KD4A 3S9DB 1JD7A 1EV2E 5FPIA 4LOUC 2J2ZB 3QS3A 3QJHA 4OLYL 3VXSB 3FT0A 3ZO0A 3D06A 5T33L 5CGYD 1F1DA 4H0HB 1U8JA 5GZNC 2YAQA 3ATAA 1X9UA 2GC7C 3OKDB 1TWCA 4HKXA 2XOTA 5J3HD 4FG6D 1FYTB 5EULV 2VDNH 2WQAA 3FCBA 4DKEH 2EH7L 3QFJE 1N4XL 1F6LL 5D1ZC 1S78D 3F3HA 2VLLB 3EJTA 5D7EA 1TSRA 1BQ5A 2VLKB 2ATPB 4MXQD 3IR5A 4PRNB 2BSRB 4TPRL 4TQHA 1T2XA 4FG2A 4JY4A 2MCPH 5FWRA 3TX4A 1MXDA 1OGAB 1KENH 2WUCH 1DQLH 4KO7A 4NUMA 4HFUH 2KL6A 2J4WH 2A6IA 4NXKA 4OQTL 3S5LB 1M7DB 1QTPA 3VACA 4ANUA 3ES6B 3FHQA 3GINA 1UJ3C 5SWZE 2C9VA 2DWDB 3NBNA 2WAQA 1A7NH 3QIWB 5DFWH 3OQ3B 3O41A 1BZDA 2X4PB 3MUY1 4NUPA 1IAII 1OD7A 3ETTA 4KX7A 1OZTG 1FWXA 3U7WL 1PD1A 1WCBA 3B56A 2DMHA 4XI5C 3IJ9A 1BF5A 3BAXA 4XH2B 4FYRA 1YEGH 4P2QB 1HCYA 3BVNA 4PS4L 4B9YA 1A1OA 1E42A 4L0ZA 1U8OB 2VL5B 4HIJA 1RUKH 1TEGA 2JKWA 1ZLSL 1XGPA 5DJ8B 2HWZL 1XDTT 2CG9X 4OM0H 4YHNA 2Y5TB 2GFBB 4AIOA 2B39A 1WS8A 2EIMB 5FA3A 1HDMA 3NJNA 2HH0H 5B3SB 1NQBA 5IEHB 4LF3B 4Z95L 5GGRA 4JFYA 3V52H 1KPUA 4YX2H 2FEDD 4FNSA 4LARL 3V4UH 3P73B 4YDKH 3SPHA 3UBGA 1J9QA 2YIHA 5EBMB 5JDSA 1HHKA 3GBNL 4PG9B 3K5RA 4QNPF 2R2BA 3WIFA 1EXUB 4XN4A 2VLJA 2F15A 4N9GA 5CAYB 3OB0H 2FBJL 4PCTA 3VA6A 3AFLA 4AV5A 3R18A 4OZHA 3P69A 3MR9B 3C8KB 1QCSA 1XSKA 2G2RA 5I1IL 1RIVH 1C08B 2DKUA 4PWFA 1AA6A 3BGFB 4LVHB 3WEXA 4JZJC 3QBTB 2Q7YA 4HV8A 4KHXL 4WEBH 4YVUA 4YZWA 4NSKA 5G4NA 3UAAA 2QGBA 3T0XA 3H9SE 1N5AA 3BW9A 3OKOB 3SPVB 2RFXA 2OXGA 4FFZL 4ALAL 2FX9H 3V0WH 2FSEA 3X2QB 4G82A 1ZTXL 3O2VL 2JIQA 2D2OA 2BOCA 1G5AA 4NQDD 4KJYB 4KXAA 3AG2B 1BFVL 2WYZA 3WY3A 1WWWX 4GW1A 1RZ7L 1FGVL 4W9KC 1UCBL 5D4JA 3SYAA 2WQSA 4CRPA 3PWVA 1AGFB 2BMKB 3CFDA 4HXBL 1H6UA 3AWEA 4KV5F 2MNUA 5DZPA 4KZCA 3WIHA 3RZCD 1FFOA 5I75B 5IQOA 3GEFA 4HG4J 3IYLW 4XCNA 4MB4A 4IGBB 2JJUA 3AUVA 2J2ZA 3QARA 1ZLUH 3VXQB 3EG9B 4LSVL 2HB0A 3VXSA 3CUPB 1UUSA 3WL9B 4PJFF 2G5BB 1QQDA 4X7TB 1A0QL 2BY2A 2EAEA 5AKTA 1HINH 4F58H 3NCBB 4ABUA 1J8KA 4AT6B 3NABL 3MHZA 2DIBA 3GTJA 3OKDA 1DL7H 3IKCB 4YDVB 1FYTA 1AR1B 3BYTA 1MWAL 1M57B 1BQHG 1SJHB 3TT1L 2F58L 2F53D 1KJ2H 4HSCX 4A2HA 5AB2A 2VLLA 2XX1A 2LLLA 3RJDA 1HCVA 2VLKA 2ATPA 4PRNA 4IRJD 2BSRA 3Q9PA 1E4XH 1U8LB 3LOWA 3NMEA 1OGAA 1C1EL 3WGVB 4I3SL 4KHTH 5JXEC 4MAZA 3C5JB 4EI0A 5B6CA 5CEZL 1KBBA 4B7IA 3S5LA 3CSYB 2NXYD 1M7DA 1AXIB 3ES6A 1HNYA 3FQNB 2DWDA 4TVUA 4NWTH 4IRSC 1GAFL 2Q3XA 3QIWA 2X4PA 1LEGA 5D9SB 1OTTD 4QHKI 4DF9A 1I1AB 2CJUH 4XPFL 5E0FA 3QIUC 4N85A 3VU1A 2H32B 3GSNL 4P2QA 4PJHB 4CU7A 4JHVA 1U8OA 2VL5A 3K1DA 1TVBB 1LDPL 3EGDB 1YQVL 3OZ9L 5DJ8A 2Z8SA 4IDJL 3WNMA 1KXTA 3HPLB 1Y1DA 2Y5TA 2Q8BH 1L3WA 2EACA 2GFBA 3WY2A 1NFDE 4HJTA 3CZBA 3LZNA 4ZJ9A 2G5DA 2UWEF 4BDVB 2H9GB 1Z7JA 3FTSA 5IEHA 2FX8L 2VDRH 4LF3A 3SJVE 3FUHA 3SE3A 4NM8H 5B39B 5MHSE 4KXCA 3MI6A 4NP9A 5T5FH 4NJAL 2HPOA 1N18A 4LCIH 3T2QA 3P73A 3CFKA 1JGLL 1ZHBA 2EXSA 4EI6B 3TTSA 1INQB 5EBMA 5E6ID 4RDBA 1CR9H 2E8ZA 4PG9A 4FQJL 3K6OA 1W80A 2NY0D 1IBFA 5FO9B 4EZJA 3LEYL 3VO0A 4WFGE 2MFNA 1DQQB 2WO2B 4RGOH 4IKJA 3X3GH 1CFNB 1TSHA 4MNGE 1D7DA 3MR9A 1U3HB 3C8KA 4M1CD 2WVTA 1IEAB 2PPFA 1C08A 4TXVB 4M4RB 4TSBH 3JWNE 2LU7A 4EDXB 2ICEB 2WQ8A 3ARRA 3IRPX 4JQIL 4GT7A 1R3IL 3F00A 4GG6F 1KFAH 3OKOA 3SPVA 1UOLA 3FQRB 2CD0A 4NO2B 3U82B 3OL2A 3VA2C 1ZEAH 4KJYA 3UYOD 4YBLC 3H9HB 1P1ZB 4WLCA 5LBGA 5I1GL 4KTEH 3Q8BA 3ARDC 3BESR 1IU1A 2EIBA 2BMKA 2O5XH 4KKAC 2XXMB 4ZFFA 3RP1A 1U91B 1SOSA 1W0YT 3O0RL 4R97B 1Y18B 4M8RA 4IGBA 3A4FA 5T5ID 3FT4B 3LH8A 2WNWA 1WISA 3WKMH 3VXQA 1CLOL 2FUTA 3EG9A 5I71B 2XZQL 3CUPA 3WL9A 4KRPD 2F1AA 2WBWB 2G5BA 4R7VA 3BISA 4M5YL 1E9PB 2L0DA 3DJ9A 2JTYA 3S8FB 2YAPA 4AG4L 1MFCL 4JAMB 2J88H 1DLFH 4AT6A 5F7NC 4M7LL 3IKCA 5D7LB 4YDVA 5GHWH 2VM3A 5CSGA 5AAMC 3O6FC 1BFOB 1MRFH 3FB6B 4I1NB 4J8RA 4A2EA 5JMOC 5JOFB 2Y07L 4OGXL 2JLLA 3JZ7A 2ATAA 1RZIB 1CFSB 2EICA 1EMTL 3F12B 3DX7B 1U8LA 3VGFA 1AS6A 2VH5H 4PCSA 3G9VA 2D73A 2XWBB 3CE1A 3FHAA 3CX5K 2B16A 3C5JA 4U1HA 3PFQA 4OZIE 4GW4B 3CSYA 3MNMA 4Y2OA 4F7EB 3UPRB 3FQNA 3C5ZB 4NZRL 4KRMB 2WXFA 3B43A 3EYUH 3RDJA 5FYJU 2VDMB 5D9SA 1DJGA 4OLWH 1I1AA 1PZDA 3LEXB 4KK9C 3LPGA 1IM9D 1PAZA 5IHUH 1G1YA 4N87A 5AAPA 2QVFB 2H32A 3CAFA 2HRPH 3DPBA 3W5NA 3IFOB 4PWHA 1E3FA 4PJ8D 4MXWL 1CGXA 4L4VA 1TVBA 3EGDA 2EUVA 4BFBD 4UT9L 4TRPH 3VB8A 1CXHA 1FNAA 3HPLA 1ZT4B 4DGYH 1MIML 5ECJE 5A16B 3SE9L 3SOBH 2P24B 4BDVA 3CVHH 1GOHA 2H9GA 4ONFL 4AEFA 1DJIA 3U4EB 4BH7A 4P48A 3FQ2A 1GZQB 5B39A 3C60B 1P1VA 1P7BA 2BVYA 1C7TA 4HBCL 3LKOB 4PB0L 4F57L 4G71B 3HS0C 4X4YB 2L7JA 2B8OT 4Z78A 2ZNWA 3GTLA 3SDCB 1YN6B 4EI6A 4JO1L 4ODXB 3S37X 1INQA 1NC4D 4YK4B 3HRZC 1VENA 1OD9A 4FLQA 3UTTE 2FLRT 2NY5L 1S7QB 3RTLA 3DC0A 5FO9A 2Z65C 2EE9A 3SGKC 3T0VA 2X6BA 2ARJB 1DQQA 3HA0A 4JJHA 5CD3B 1CFNA 5D2NA 5HGHB 2YWZA 4Y88A 4QRUB 1U3HA 2OPCA 5D2NC 1DO5A 4P9MH 1F4WL 2JKTM 4M4RA 1TZ8A 1D2OA 3REWB 1ASQA 3LKQB 4EDXA 3JWNH 4ZG1A 4QHLA 4UCFA 4AY0A 3IU4H 3SBQA 2ICEA 4ZMWA 1MLCB 1SJEB 2PJJA 1JVLA 2GBUA 3B3IA 3B2PA 1FN4B 1QOKA 3FQRA 4QGTA 1IT9H 1FIGL 4NO2A 2HVKB 2WVUA 4G9FD 5LNGA 4DKFH 3FO0H 5FA4A 1ZVSB 2X42A 4GAJL 3VQ2C 4OZFG 4DFHA 2BNQE 3H9HA 1P1ZA 4F9LC 3SDYL 4J2QA 2EZ0D 1GY1A 2JKSA 2BFVH 4N9OB 5A1AA 2JB6B 1N12A 2NY6B 3NFSH 5D6DC 1PPYA 3RJOA 1A9EB 1VPOH 1RZKC 1BD2D 5I18L 2JA6A 1T6VN 4NJ9H 1Y18A 4ZO8A 3TT3H 4DP7X 4ZD3L 3TLRA 4DUWA 1SYVB 2NVXA 3FT4A 4EKXA 1EPFA 3MLSL 3GUTB 2X44D 2WKOF 3D2UA 3L3KB 3UDWA 5FGCE 3B9DA 4GUOA 1E9PA 1WUZA 1H15A 3B2XA 4JAMA 4PQXA 1KCWA 4B9ZA 2QPSA 3QPQD 2YWYA 1SBBA 1CPUA 5D7LA 1CDUA 4JFFB 5E9NA 3RX5A 4JL1A 1BFOA 3FB6A 4PJIE 5JHMA 4X7EC 5JOFA 4FNQA 5DVKA 4B9CA 3SDDB 4HW6A 3X2MA 3HB3B 1UURA 3KLDA 1RZIA 4U0QB 1CFSA 2Y1ZA 4M1GL 3O2DL 3F12A 2K6ZA 2Y1AA 3G5VB 4E9LA 2VSDA 2Y3NA 2QGCA 5C0CD 4OM1L 3NIFB 4PEEA 3EDJA 1AO7E 4R2GB 2XWBA 5F44A 5C6TL 3GLDA 1FSKC 3TM6A 4JM2F 1UC6A 2JJTA 4YH6A 2ED8A 4GW4A 3TEXA 5EZOH 1TQTA 4JR9L 3BSZA 4F7EA 4L4JA 3AACA 3C5ZA 3K72B 1YY9D 1OLLA 2GSGA 3BAWA 4JFSA 4WDIB 1JGVH 1SHMA 2F61A 2HN7B 5AD0B 1NBCA 4RDQG 5JOPD 1OT4A 4RWYL 3ZKQD 1F6AB 3QK0A 1KYAA 2FEEL 4ZFGL 5EU5B 1BQSA 3SE8H 3MOAH 5CGYC 3I9AA 3TFKD 4IHOB 2ITEA 2Z9TA 2HVBA 3TWCH 2NNCA 5EDXA 3Q3GB 1MCIA 5J3HC 1GYAA 1D5IH 1ZT4A 5DMIL 2AITA 3CBKB 5AQ0A 5HYEA 4MHHI 1AP2B 2V5TA 1NOFA 4FNLH 1ECYA 4XT1C 1S78C 2Y06L 5JR1L 1RCYA 1YC7A 1TQCB 4FGMA 4K5NA 1KWKA 2OCFD 3TL5A 1GZQA 4MXQC 3WNIA 3UEZA 4GP5B 3X3FL 1HKFA 3C60A 4BM7A 1AI1L 2XQYK 3LKOA 3IWVA 3NZSA 2HTKD 4YC2C 4X4YA 1SOKA 2OL3B 4HZ1A 3EDEA 3SDCA 1YN6A 4HIXH 4ODXA 4WEEA 1QKZH 2X38A 4UOJA 4PJDB 5MEND 1E40A 2VR6A 3CZSA 1JAEA 1G6VK 2RTTA 3OWRA 1S7QA 5AZEH 4DJMA 4KXDA 3U30C 4LVOB 1S9VB 2ARJA 5GIRB 4J3BA 4O02L 4K4KA 4QRUA 3CHRA 5DYFA 4ES9A 3IJEB 4HGKC 1B90A 3REWA 3MUGB 2MIZA 4QRTA 4JG0H 3CFBB 4GAFB 3FO1B 2AQTA 5B7MA 1MLCA 2G0LA 2V17L 5JIMA 2CU9A 4MJJA 1CXFA 1XSJA 3ULVL 1Q1JH 1N2RB 2CO3A 2DMGA 2HVKA 3UZEA 1TTRA 3B7UX 1ZVSA 3N55A 5IUSA 2I25N 2AJUH 1UYWL 4P5TD 3UZEC 2VQ4A 4YLBA 2ZG1A 4R0LB 4HKJB 3WDHA 1RUML 3OZKA 4NQDE 4PV8A 2JB6A 3BT0A 2C34A 1A9EA 1T4WA 1C12B 4I13B 2XUWA 4FHKA 2APTA 2B1HH 4WTZG 2QHLA 3OR7B 2F8VA 1DQML 1W8OA 5HJ3B 2I9LB 2ZCHH 3AU0A 4LCVA 1SYVA 4JG5A 4ZRGA 3GUTA 1NCNA 4ZPVB 1TJGL 3SB3A 1T04B 2B0SH 3NRPA 4Z7NF 3L3KA 1GKOA 3WJLA 4N2KA 3LNHA 4FEIA 1WZ1H 1JF5A 2IGTA 1A3RH 2Y23A 2QVKA 3IGAB 3WJLC 1CCZA 2VZVA 2MH4A 4JFFA 4N1EA 4Q56A 3MRFB 5DS1A 3ASOB 3SDDA 4XPTL 2JTDA 4YFLF 5F70A 4Z23A 3T65A 3ZE2F 2JB5L 2E27L 2KLSA 3DECA 3EGXA 2FJGA 3UL4A 1OAXH 4V2BA 1IM3B 1W8EA 2X89D 3G5VA 4PUBL 2F53E 3TEWA 2AXGB 2X6AA 1SOQA 3JVGA 5IJKC 4JRYB 3S4SB 1W6LA 1KJVB 4GXVL 1ZVYA 4Y5YB 5A2JH 5DZAA 3G9AB 4K5OA 3RZCC 4K94H 4LT7A 1MNUL 3K72A 3P9LB 3T1FB 4OFPA 4WDIA 1FE8H 1HI6B 2HN7A 1XF2B 5AD0A 2K8MA 2DL2A 4QF1B 4LL1A 3ARGD 3BE1L 4JN1H 5K69A 1F6AA 1H3PH 4PGZA 1AH1A 4L8SC 1YPZE 4WI2A 5EU5A 3BMWA 1IVTA 4F8LA 4A7UA 2YD1A 4IHOA 3L3GB 2A0LD 1M1XB 3NSYA 4KBPA 2CNYA 4V1DB 5JTWA 1X3DA 3WFBL 3Q3GA 4BBWA 4ODSL 4Y5XC 2EDBA 4OB5H 3P3UA 3VWJD 4N2GA 1AP2A 4F37F 4E5XG 4LSUH 5BNXD 1CFTB 4A39A 5AOJA 3ARBD 5HYFA 1KN4H 4N2NA 3E3QE 3L3DB 3KEDA 4IRJC 3LNIA 2DIJA 3RHWF 3S3JA 1T4KB 5IBTH 3D34A 4P06A 2OL3A 1X9QA 4I4WB 5B1KA 3AZUA 1DSYA 4PW9A 3W2DL 2NXYC 2IGLA 2DQGH 3U7YH 4PJDA 1QFHA 1UG9A 4PRHB 4HMDA 2XPYA 4M1DL 1H19A 3MRBB 1S9VA 1TTFA 4XMLL 4U1MB 4XCFL 4XP5H 4XR8C 2VPXA 1OTTC 2OJZH 3L45A 4FTVD 4LOVA 3QG6B 1HH6B 4BZ1H 2DN7A 1NCBH 2XLLA 2FEJA 2BVEA 3IJEA 3NAAL 5E4IA 4OGYL 3MUGA 4YDNA 2R69A 5F9OH 4QRPD 1X7QB 3PP4L 2HAZA 3GZKA 3CFBA 1S6NA 4L29B 5JQHC 2ZYSA 3QNFA 3ELQA 5DJCA 4XGZB 1AFVL 3G5YB 4UV4H 3II1A 4HWBL 4FA8A 2VMDA 1TCMA 1I9RL 4PJ5D 3GMRB 2F7OA 4OBRA 3JYBA 5ITBH 1GGUA 3JUYA 4R0LA 4HKJA 4N25A 1G6RH 1Z0NA 1ZS8B 4G9DB 1IILE 1ZSHA 1C12A 1HNGA 5E6IA 4HCGA 4NT6B 2D31B 2YKLL 5KANI 1EJOH 5E6IC 3L6FA 5CZVL 5HJ3A 2FNBA 2I9LA 5GGVH 5F7BA 4Z18A 2NY0C 2P80A 4MGXA 5HVHB 3G6AB 4ZPVA 3RUGB 1P4BL 4BSVB 5LDSA 1V27A 1T04A 1WITA 2P42B 1OHZA 4UQ9A 4M1CC 4WW1B 1UWGH 4F9PA 4PS8A 1DZ0A 1QR4A 4OZHF 2NNAA 3MV9D 3QJZA 4U1GC 2HJFB 1UM5L 1BQLL 1J11A 3MRFA 3EHBB 3OXRB 4WGWB 2DJSA 4YHYB 2FK9A 1XF3B 2CMRH 3S36H 1BMGA 5E03A 1IM3A 4YJZL 3H7BB 1TQBB 5L4JA 2IOOA 4KKPA 2AXGA 1LMKA 3L1EA 2XQBL 1FGNL 1ETJA 2VZOA 3MRCB 4JRYA 4QD2E 3S4SA 5AVRB 3ZE0E 2EDKA 3HPJB 5BOPA 4L5FL 1KJVA 5D2LB 4Y5YA 4IW4C 1UKTA 4NGHH 2ENJA 4NQUA 1YNKH 3MJ6A 4LHUB 3T3MB 4PRIE 1DBKH 5JPNB 3P9LA 3T1FA 3O9WB 1BMWA 1HI6A 1WG3A 1JYNA 4MAYD 1SN2A 3X1EA 4QF1A 1MHHB 2ZKMX 4GKSB 1VJSA 3SPCA 1ACXA 3LN4A 4QOKB 3VYNA 4KRPC 3WXWL 3MLXL 1QSEE 2B7DT 3L3GA 1G9MC 4F8TA 4E2OA 1NIBA 1RD6A 4V1DA 3O4OC 5JDJA 1A7PH 3EJSA 4HCFA 1DFBL 4CADB 1HQRA 1S3SA 3BRFA 3FONB 1CFTA 3ZDYB 4YUEL 5IOPB 1FNLA 5CGTA 3EJRA 4RQQB 3L3DA 1UD3A 4FMFA 2ZXCA 4LVEA 4WRLA 3CVIL 1T4KA 3Q6FB 4I4WA 4JHWL 3A6BL 4J3XA 4OZGE 4BHUI 5D5MB 1KPRB 1OAKH 4PRHA 2NQ3A 5C7ZA 4FFYA 3B5GA 4I48B 5DHEA 3MRBA 3S3SA 2BLFA 2QSTA 4U1MA 1ZLEA 4EI5B 3I74A 3QG6A 3GJFB 1HH6A 5AW8B 3S97C 4HPYL 1I4FB 5EZIH 4M8VA 1BVLB 5EEXA 4O2FB 3MV7B 4PJ8C 4L2YA 3TU6A 1J8HE 1X7QA 3W11D 3RNKB 4L29A 4R7DA 4YSAA 2E4TA 2EECA 2F19L 3UGUA 5HHXH 1PLAA 3OMAB 4H8WH 4XGZA 5ADPL 3G5YA 4HPOL 5JIIA 5FUZH 1E28B 4TQEL 5CM1A 4PH8A 2D3NA 5CZXD 2EYSB 5IFJB 4HWEH 1OAUL 3GMRA 4JDVB 4OLZL 4JGUA 4U6XB 4G9FE 1KACB 4NZFA 4DK6A 3V2AR 4WTWA 5TE7L 1ZS8A 1JHTB 1I1FB 3LXUX 4G9DA 4J27A 2OZNA 5DEJA 5LBSH 1P5VB 1L9QA 3ARED 2OTUB 2QKIC 4NHUA 5TDPB 5BUGA 4NT6A 3QYMA 2D31A 3A4DA 2PO6B 5L7XL 5DJDA 5BQDA 4LNRB 4XMUA 3V0IA 2A9DA 4DH2A 3GK8L 3LD8B 1M2OA 2E7MA 2YBRB 2PCXA 1BXAA 2GQHA 2NXZB 1NKOA 3G6AA 3WIHL 5J1SC 2YRPA 3RUGA 4BSVA 3CDZB 4L2LA 2G9HB 3IDYB 4Z7UF 2BS9A 3WEOA 3ZZQA 4BFOA 2FJFA 4WW1A 4EBQL 2CA3A 5KTEH 5FX3A 1B3JA 3NSDA 1GZPB 2YUJA 4GSXA 3MNVA 3CSTA 1PLGL 2HJFA 1ITBB 4PY7B 2AGJL 4F7KA 4NWUH 3NACL 3OXRA 4FL4C 5C0IB 3CZEA 5LN4A 1JPSL 3PAUA 4R4ND 1IQWH 1XF3A 1SJMA 3CH8A 3KS0J 4HU2A 4I5BB 3H7BA 2K70A 5HGGS 5BZXA 1YJDC 2IBZX 3MRCA 4NKIL 3RBSA 2EZ0C 3HNVL 1GMEA 1OA7A 5D2LA 2WLLA 4P57B 4PLJD 1IL1B 4DEPC 4KXZI 4FYSA 5EUKA 5JPNA 2Z64C 2IDUA 3O9WA 3T09A 1JPTH 1NM4A 2WXJA 1T3FB 1U30A 5GQBA 1XBDA 1MHHA 4GKSA 3JV6B 5GGRY 4QOKA 4PG2C 5JOPE 5FHBL 4KGLA 1ZA6A 4A38A 1MI5B 4R83A 1UA7A 1IGJB 3QPQC 1HHHB 1MWOA 2IADB 3TIWA 3BD4A 3S98A 3QSKB 3GXDA 4CADA 2YD8A 1PG7W 4K9EL 3K2KA 3FONA 5HI4D 5I74C 3VFOB 4APXB 4K7PH 5IOPA 5AKVA 2X4SB 3T77B 1PQZB 4RQQA 4NS0A 4NZTH 5K1NA 1VFOA 4DGIL 5BVPL 3V4PB 1RU9H 3BLBA 5AW6B 4IEFA 5DJAB 5FYKU 3Q6FA 1JGIA 4NUJB 4D9RD 4X99B 5CXPA 3QYNA 4YSDA 5E2JA 4ZUWB 5D5MA 5HPOA 1KPRA 2Q3AA 4NC1E 3VFPB 1UM6H 2IQ9L 1KBPA 3BDYL 4I48A 2RAMA 4LCYB 1WAAE 2NQDA 4TNEA 1IGYB 1E9OB 3GJFA 4N2IA 1YMHA 2NR6D 4GH7B 1CL7L 1BVLA 3FUFA 4O2FA 3TFKC 3TN0B 2BE5D 2CKBA 3MV7A 4PWEA 3G6JE 4R5TA 4FZ8H 3RNKA 5JXAH 4HQQH 3NCFB 4DTGH 1REIA 1FO0H 2VC2B 3VVWA 3E38A 3KVPA 5KS9E 5GS0L 3AM8A 3AS1A 1E28A 2C9SA 4WJ5B 3MRJB 4XCYA 2XBTA 2R0KH 2EYSA 2WSDA 3PDOB 5IFJA 4JDVA 3OJDB 4JM4L 1YNND 5LB1A 1DDTA 4U6XA 3KMDA 4LCCB 1BLIA 1R17A 3N0AA 1LWHA 5F7EH 1JHTA 1I1FA 4MA1C 2HTKC 4B9IA 1F90L 1P5VA 2ZX5A 2VDNB 2OTUA 3FT2B 1DFXA 3HE6D 5TDPA 5DDHB 4A6YB 4B5ZA 1CYGA 4DP6X 4JKMA 2G3NA 2EDFA 3F01A 4LNRA 2ZUVA 1GGIH 3OF6D 2X4RA 1WUNT 2DIAA 2YBRA 5HYIA 5BO1H 2HJKB 4K7FB 5AKSA 2ISDA 2HLAB 1QEXA 3RTQD 5A2CA 1QTSA 2AJSL 3CDZA 3QDMB 5TDNB 2G9HA 5D7HA 4UT6A 1JZ6A 4NZDA 2RACA 1ACCA 3NZHH 3QH3B 1E43A 4HHGA 4MAUL 5I16B 5IFHH 2AJYL 3GTQA 2PF6A 4PB9H 5T5NG 2BXZA 5IV2B 3SBWA 1TZIB 3V0AC 1GZPA 2LTQB 1K6QL 4C4UA 4GKNB 3RWEB 3SKOA 5HDQL 3LMJL 4PY7A 4KTDL 3NDZE 5E24E 3CZNA 2AP2A 2R1WB 1TZOA 4CMHB 1H0HA 4KNUA 4I5BA 3TV8A 4Y2NA 5LN8A 4LSTH 4P5TA 3HHRB 3P30L 1NFIB 1P4IH 4P5TC 4HC1H 1EO5A 5D72L 2DTSA 2MQCA 1W0WB 1WZLA 1HNFA 2YO3A 4HJGB 3T2LA 3TURA 4P57A 4G59C 4PD4K 1IL1A 2Q2LA 4OLXL 3MCLL 3V95A 3D18B 4CRYG 1FC2D 1T3FA 4IIQB 3V6BR 3JV6A 1NGPH 2BSTB 1OF2B 4KU1A 4R26H 3V55A 3J8F7 5DMYA 4PJAB 1FLTX 4D7ZB 2QTVA 2OR9L 3D85B 1MI5A 2Q1EA 2QQLL 1S5IL 4R96B 3OAUH 3OHXC 2IADA 3ZHLA 2WWKT 4UV7L 2QQKL 3WFEL 2WSPA 4RAVA 4Z7OE 3UABA 2D7NA 2FWLB 2C3XA 2WXKA 2CALA 4UQ2B 3VFOA 5C07B 4APXA 5DVOA 5JMRA 2Y2TA 2X4SA 3T77A 1PQZA 2NDGA 3MMEB 1X6NA 2LLNA 4OH2A 4X8GA 5TE4L 1U92B 4WI6A 3RIKA 2DMCA 1WD8A 5DJAA 4NUJA 1KG0B 1NC2D 3SY0B 3TEUA 3H55A 2DWXA 3U2SB 4X99A 5FDWB 4F7CA 2BJMH 5GLXA 3SSGA 3BAJA 4ZUWA 4GNKB 5F96L 2QR0B 5EV7A 3VFPA 1KCSL 5AW1B 3FOMB 4F5CE 5TE6L 4G72B 2ADGB 3W1ZA 4GG8A 2Y36H 5IREA 5IR1A 2RIKA 1IGYA 1E9OA 3ARGC 4UTAA 5HVFB 3NCYP 5KSBE 3EJYD 1GCYA 1SMOA 2CDGB 2V3EA 3PYCA 1IBBA 5LQBH 3NTCH 3CXHJ 3L1GA 5TQ2H 4I18C 3PDDA 2A0LC 5FM8A 2RH0A 5CHNB 5CFHA 4OTXL 4G3YL 3ZTJG 1ILSA 4PJIF 2YU9A 5GZOA 2OP4H 1ZHLB 4EIZC 5JW3L 4AM0B 4X0KB 4XAKD 4WJ5A 4YLQT 3MRJA 4FHJA 4ZOEA 1JUFB 3ARBC 3PDOA 4LESA 4ZO6A 1NMBL 1IE5A 3B2MA 1A25A 1PZ5B 4NKOB 4LCCA 1A5FH 2VABB 4GB9A 4LL4A 4AEIL 3FT2A 3US9A 1E4KA 1NLDH 1OO2A 2OTPA 5DDHA 5G4OA 4A6YA 4FNTA 1KJ2B 4UB0H 1N6UA 3W9EB 2XY1A 2YXMA 4XXCC 4WUKH 5ES4B 2Z35B 4NBZB 2HJKA 4K7FA 2HLAA 3NFNB 5TDNA 3MFFB 4QRQB 3FUIA 4YMPA 3HTLX 3QH3A 2FHCA 5ISZA 5IV2A 1CE6B 5IKCB 4NQTA 1SF5A 1TZIA 5JW5A 2QGDA 4OQ1A 4GKNA 3RWEA 5KZCD 2DQCL 2RB8A 2R29L 2XIIA 3F05A 3N41F 2R2EB 1P6WA 3MV9E 2R1WA 3O0LA 4P9HC 5KBPA 5EOQH 4P04A 2DQIL 1G1KA 5DO8A 3AXLB 1A7QL 1NFIA 4YFLI 5C92A 1XF5B 1W0WA 3R0MA 1RHHB 1OGTB 3EUUA 1AS7A 1Q16A 4HJGA 2BVPB 5A2BA 1NGZB 2ZXQA 4P5RA 2V5SA 3MGTB 3WIIL 5I0WA 4GUPB 4TUUA 3D18A 5DC0A 4AGLA 5E2WL 1J86A 2A99A 2WN2A 3F7YB 3U0PB 5HDRA 4KODA 1CLYL 4CW1B 3BSZL 3VXUD 2XWZA 4YDLC 3RX7A 3VUAA 2BSTA 4X98B 3CBJB 1OF2A 3THMH 1DDHB 4POUB 4XO3A 3ZE1E 4MWFB 4PJAA 1XTLA 3BKMH 3CC5B 1AXTL 4L8BB 1JZ4A 3D85A 3GQFA 2JIXD 1EHKB 4DK5A 4ZW8A 4R96A 1BOYA 4KC3B 4QY8B 4DVRH 2UXGA 2FQEA 1M7UA 4PP2B 1JDDA 3AAZB 1KEMH 4K5MA 4K3JH 1R75A 2HLFD 2OI9B 4M9PA 4F1SA 3US1A 2X1PA 1QW9A 5C07A 3P02A 3KZ8A 2AEWA 4AZUA 1KLFB 3BAEL 1CT8B 3SPIA 3S36X 1SM3L 4WWNA 4W9FC 2MHAA 5F0LB 1NGXB 2ZXAA 4X6FB 4J4PD 3SY0A 4EDWH 3CVDA 4AMKL 3U2SA 5FDWA 3GBEA 5LGHL 2XBDA 4BQ8A 4G83A 4MZIA 2OQJB 5GS1C 4CC0A 1JZ7A 4ERSH 3FOMA 5MERB 1RMFL 2ADGA 1TPXC 2R0LH 3ABMB 1DBML 4NRYB 2I32A 1A6PA 5J11B 5I73B 3IBEA 2CDGA 4P3CH 4KVNL 3ZR6A 2X70B 2XWEA 1R9TA 2CBOA 5CHNA 2WZPA 3T9WA 1T22B 4WNQB 1GVIA 3FOLB 2XSKA 1ES0B 3VE0B 5DQDH 2N4IA 3QXTA 1T6WA 4E9YA 4AM0A 4X0KA 3GF8A 1EZVX 4BJLA 1YYMH 1G9NC 1AQKH 1CZ8H 4TNWF 3W39B 1YEIL 2X3AA 2BHYA 3BXNA 1UVQB 1FV1B 1EXGA 1PZ5A 3QDGD 1OHQA 2VABA 2CGZA 4XPAL 4GOSA 4DAGH 1GGTA 2PXYB 1KJ2A 1AHWC 3W9EA 3V4LA 1L7IL 1BLNB 1NPJA 4N0CD 4X9BA 1PG7L 2WXHA 1SUJA 5EIIB 1A6UH 4NKMB 2KH2B 1T0NB 3MFFA 3MXVH 5IM7B 3WGUB 2GJ6D 4HCIA 1SLWA 4M6ML 3BGMB 1CE6A 2G4EA 5IKCA 3VFGH 5EOTA 4K55A 2IWKA 2O1AA 4FZEL 3WO4B 1YMMB 1O7DE 3W11C 5BRZB 2J12B 2LOEA 4X9HA 3CLWA 5FK9B 5BXFB 2R2EA 2AJ3B 3VXPB 1KNOB 1D5ZB 4TVPD 3V9EA 3AXLA 3VGBA 2FNWA 5CZXC 4GXUN 4RVBA 3SGDH 2W60A 4NRXB 5FR3A 1TQUA 1XF5A 4DP4X 5LGYA 1RHHA 2DBJA 1OGTA 1QO3B 4XMVA 5AOLA 3UBFA 2BVPA 1NGZA 2ESVE 4N26A 4PJCE 2VR7A 3MGTA 3AREC 4GUPA 4N22A 3A4EA 4QXUH 4TUKH 1NFDB 3F7YA 3U0PA 2TAAA 3CVHB 2EE0A 4UDUB 5E4EB 1NGYA 1V55B 1GRWA 3ZJAA 4X98A 5ACZB 3N1MC 5D1XD 4PWGA 1A3LH 4L8BA 3FW6A 3UADA 2ZCLH 4QY8A 5J13C 4HF5H 3FJTA 1DCLA 4EMZA 4Z7WF 2EDEA 4PP2A 4S1SL 4X50A 5BCAA 3AAZA 3BFQG 1MHEB 3T3PE 3FTUA 4TF4A 3G5XB 1ED3B 5AOZA 2OI9C 4XPHL 4DW2H 2E6QA 3HBZA 3NJHA 1WWCA 1KLFA 2WBJB 4HWZB 1CT8A 5SX5K 4JGNA 1EHLH 1KCUH 1CXLA 1SFOA 4Y4KB 5I30L 2Z1PA 1TJHH 1NGXA 3MLRL 4PYGA 4X6FA 1MCDA 3HG3A 3M6DA 1E50A 1EWHA 2OYKA 1FNFA 4PLJC 3D6GA 3BPLB 3BVVA 2OQJA 2WM0A 2OL3L 1B4JL 5MERA 1MFUA 3KWVA 4XNAA 4NRYA 2VZ1A 4FCAA 2IC2A 3WY1A 2FLBT 2V37A 1E5CA 2JIPA 3HC4L 3A22A 4XAWL 2X70A 2PR4L 3TYGH 4ODVH 3BT2H 4HEPA 4OKDA 1A6ZB 4MJIE 4M29A 1ICTA 2XYBA 3QQ9D 2MPVA 4NLHA 4W9LC 4WNQA 1I50A 3FOLA 3UYPB 1R0AH 1E5YA 1ES0A 3CLFL 3LNGA 3VE0A 3T2NH 1OZUA 2DQJL 5HI4C 3HLKA 5IY5B 3W39A 4NO5B 3HVDA 1UVQA 2GTWB 4OCSL 1FV1A 1UQSA 3CXFA 1JNLH 4Z7IA 3O6ML 5I2IA 4K7PX 3WAJA 2F5AL 4KKAD 1ZLVH 2Z34A 3HUJF 3BIKB 2P3YA 4YNYB 1JV5B 5JW4Q 1NMAL 3JVFC 4RBPK 4FXKC 4YE4H 1KGCD 2JWYA 4HZLB 3GKWL 4M7KH 1NUDA 5IQMA 5EIIA 4NKMA 1HEZB 2DYPD 1WQVT 1T0NA 3QZMA 5KVEH 5KJRH 3QUML 5IM7A 1WC2A 1P69B 1VADA 2YZ8A 5E1GA 4UM9B 4KMTH 2ITFA 2NR6C 3BGMA 2X28A 4QRSB 1BEYH 3D05A 3P3YA 2YMOA 1JXDA 2Z7WA 4FDWA 4OZIB 3CLEL 3HG2A 4FQIL 1YMMA 4Z1PA 3UAJA 3POHA 3CFMA 5HHMD 1CL7I 5BRZA 2YD2A 1I9JL 2XC8A 3RL2B 5BXFA 3V7MA 2AJ3A 4RA3A 2XN9D 3VXPA 2RCSH 1KNOA 3MJ8A 3OR6A 4Y1TA 3WEBA 2QQNH 2AK4D 1KB9J 1D5ZA 3KPOB 2WANA 5AOMA 4ZMYA 1SHWA 4G7YL 1E9QB 1L7TH 4Y7MA 3D4ZA 4NRXA 1RIHH 1P2CB 4AVIA 2W38A 1F00I 1QO3A 1H9VA 3DX0A 3BUTA 2XN0A 2C26A 1I8LA 4ORGB 3HE6C 4AW7A 3DIVA 1MY7A 1R1CA 2EIKB 1RJYB 4J3UA 4M56A 1NFDA 3SDXE 2G75B 3CVHA 3JZYA 5KVFL 4TNVF 3FUMA 4UDUA 4XZ4A 1G8KA 2BVOB 2QPEB 4PCKA 1QHPA 5IMLB 3RTQC 4ORZC 5ACZA 2ZP9A 4P23B 3D07A 4HH9B 1VACB 2XVKA 5B3JE 1ROCA 2W80C 2XJKA 3E80A 5EA0L 4JMXA 2WMPB 5AW7B 2VXSL 3NIGB 3P3TA 4QJ5B 5DD5H 3QUYD 3UTTB 4I2XA 35C8H 3BWUC 4AV4A 1MHEA 3KG5A 1H5BB 3QNXB 4KQ3H 4KRNA 2QV2A 3G5XA 4PJEE 1ED3A 2GITB 1SFDA 2LW3A 5A7EA 3QZOA 3VH8G 1K5WA 2DF3A 4Y4HB 1CICB 2DICA 2WBJA 4HWZA 3N3EA 3P11H 4HJEA 4MA7H 5F7DB 1A4JB 4Y4KA 2AMUA 2ORBL 1I7ZB 2CLZA 3A67L 1YUKB 4KZDH 1AY1L 5I15H 1CO1A 4JZNB 3VWKB 5FO7B 3MZTA 1C5CH 3LS4L 4NQQA 2WW8A 4LFHG 2DLGA 4R3SB 3CN3A 3LIZH 1AMXA 5DHMC 1ZT7B 5I76B 1ZIBA 4KVCL 4FHBD 4BFKA 1MY5A 3FB7A 5J7CC 2BNQB 4PIRF 1Q9LB 4WQOA 5HP5A 1CI5A 3AG1B 2X6CA 4R7NB 1KBKA 4E9QA 3VFRB 3X2LA 4OCLC 4OV5B 3ECQA 5AG9A 3UYPA 4KXBA 5I8OL 4OCXL 1JTTA 1FFNB 1QMUA 5E8DL 4EKJA 1JNNL 3QA3B 5DMGD 3NQIA 3PNWB 4NO5A 5FGCB 2GTWA 3BP5B 5I5RA 2XVLA 1T0MA 4R90H 3IDMB 4CSSA 1RUAL 1MCEA 1F4YH 3BIKA 3L3OB 2DQUL 3O3UN 2R2HA 3GSXB 3WNJA 1CD9B 2W91A 1JV5A 5EO9B 3GPEA 3B5HA 4HAKA 4HZLA 3SHSA 1OCCB 3JSSA 3M7FB 3IGUA 1HEZA 4LP5A 3U0WL 1A6WL 2ADIB 2XU9A 3PLYA 1M53A 3HE7B 3UX9B 1L9OA 4G6JL 2D7TH 3ILPA 4UM9A 3EJYC 4M8QA 2YQBA 1AO7B 1FFPB 4OZIA 4JBSA 3UPAA 1XZ0B 3Q5YA 4QUOA 2IG2H 4JFED 4QXGH 1S5HB 2DWTA 3RL2A 2B1AL 3IVKB 4UIKL 3IR6A 4MQTB 3LQMA 4NERA 3KPLB 3G7TA 5T3ZE 3CZFB 4NO0D 3PGCB 4TUOA 1DLHB 2HG0A 3G5WA 3KPOA 3VCLB 4FNPA 4HUCA 1U3ZA 1E9QA 1JHKH 3GI8L 4AKQA 4Y2DB 4AOKB 2CBQA 1G7PB 4C2MA 4FLOA 2QEJA 4UQIM 1I31A 1IAKB 4B0MM 3MBED 4ORGA 4P2OD 1N7ML 1YEDB 5JW4N 2JIOA 3VGEA 1E5VA 1ESOA 2G75A 1OARH 3CVCA 3SIKA 2BVOA 1HZHL 3D33A 5IMLA 3QORD 2EO7A 3P0YL 1FH5H 1MVUB 3NPZB 3SKNB 4P23A 5AUMB 3ZYIA 4HH9A 2VN6A 1VACA 4I3RH 5J8OA 1MRDL 1FCGA 3QHFL 3T0EE 2R4RH 4PV9A 1MAJA 2WMPA 3GTVA 4PRPE 3LDBB 3TGXA 5DQJB 3UTTA 1QYGH 1IC1A 4NKDB 1OGPA 4XB7A 3CVBA 3BUBA 2XX0A 4Z7VB 5KS9F 1DN0B 5JUEL 2GITA 2IQAB 3FT9A 4B7LA 1RZFL 2IVFC 2HKFH 1SDYA 2ZYHA 1CICA 1IFGA 1EDYA 5F7DA 1JGDB 1A4JA 3U4AA 3DRQB 3L4YA 3DJRA 3QJFB 1PJ9A 1GKEA 5F9AC 3HBPA 1L0XA 4JZNA 1BW3A 1S3KH 3VWKA 4BUGA 2YR3A 4QO1B 4X7SH 5CGBA 4R3SA 1A8JH 1ZT7A 4IJ3B 3EF7A 1E18A 2Y69B 1ITCA 5I1HH 5F1SA 1R3HB 2XVGA 1RH8A 4R6UA 2NY4B 1C5BL 2BNQA 1WHOA 4Y9FA 1Q9LA 1AGBA 1XT5A 1XCQB 3W82A 4X80L 3HEIB 1OAZL 4APQD 3M46A 4R7NA 4B5EA 2ZXGA 1G6RB 3KJ6H 3VFRA 4OV5A 1RURL 3OPZH 3KPMB 5DTFB 3PHOB 4N2AA 1TYRA 1FFNA 2JKJA 2Z7UA 1FNGA 3OUGA 5T1LB 3EZ8A 3QA3A 1MAKA 5GRJL 2XBZA 5DWPA 3DO3A 1L3NA 3PNWA 4X6CE 2UVEA 4BFFA 4N5EC 3SD2A 2GI7A 3L9BA 1J1XL 2LV4A 4LKCB 5DXWA 4B3EA 1D7BA 4M7JH 3IDMA 4AYGA 1RK1B 2VDKH 2YPVH 3L3OA 4TL5A 1AYRA 2DWEB 4LQFL 4EVNB 5IJCC 4J4PC 1RZQA 4NRZB 5E99L 2GBAA 3QWZA 3QDGE 5D55A 5EO9A 4PCYA 4FQ2L 2JJSA 2V2XB 1VGEH 4FP8H 3RVWD 3VJ6B 4JFPB 4OIAA 5MEQB 4LVNB 4BD4A 1WLHA 2ADIA 4GINA 3HE7A 5FCUH 3KDMA 4J3WA 5CCKL 4AYFB 4GKLA 2NYZA 1AO7A 1Q0YH 3Q8AA 4P4RB 1MCWM 2EE2A 1FFPA 4OFQA 2Y22A 2J43A 2UX6A 3BKYH 2GJ6E 4XP9L 4OBSA 1XZ0A 5E8EB 3S37L 5DMKB 4UT6L 2AJXL 2XG4A 3QRFM 1S5HA 2LFEA 4ZNCD 4LRNH 4XPGH 4AV0A 3TBBA 2P5ED 5B1AB 3FQYA 1F2XK 1WFMA 5DT1H 3KPLA 3MACH 5AVQB 4AEHL 1N0XL 4WU5B 3PGCA 1DLHA 1DVFD 1UH4A 1CC3A 2F74B 5T3ZH 3RGBA 3VCLA 4BQBA 1CDHA 5ID1B 3RVXD 5IBLD 1YLBB 2A6HD 2YD9A 1YPZB 5J57B 4W4NA 2EDHA 1FORL 4Y2DA 1WBXB 4ECNA 1G7PA 4IM8A 4ZODA 3DPDA 1ETB1 1IAKA 2IAAC 2QSCL 2WKGA 3LQAL 3V5HB 5L2JB 1HILB 1YEDA 4OGQC 5KG9B 5EOCL 5A2IH 5KVGL 5E0QA 4IBZA 2ZONA 1LO2L 5C0BD 1OPGL 5FOBB 1SBSH 4N0CC 5E08H 4BQ9A 4DOHB 4IJTA 4LASL 2RALA 4UBDD 4X6DB 4ZX3A 5KSBF 1MVUA 3SKNA 5DYOB 5AUMA 3E6HB 1BGXH 4N6RB 1JZ8A 2SEBB 1ZOXA 3RVVD 1AYOA 1VZIA 4OUOA 2P9RA 1ETA1 2ZICA 4NI6A 5IT2H 2EQDA 2WIMA 5DQJA 4XCCL 5A40E 4NKDA 2A9BA 2DS4A 3LDBC 2YQ3A 2ETWA 4Z7VA 3H3PL 2G2NA 1OGSA 5CCGE 2IQAA 3DYPA 4Q97A 4HA1A 4FXGB 5AVTB 4MA8H 1JPGB 4PJGE 2A73B 3LV3B 5E1HB 4BZ1A 1D2PA 1JGDA 1SQ2N 1HC1A 5D8JH 3VFUB 4OCYH 1PTZA 3EOTH 5EUOE 2P28B 3QJFA 5E8OB 2WLMA 3BRDA 4B41A 5DZOA 2JKLA 5FTNA 4QO1A 4D3CL 3V4PL 1WP6A 1PGRB 5C09B 4DNLA 4ZMPA 4IMLB 3GXFA 3D48R 4UMGA 1R3HA 5FKAB 2WTOA 1F42A 4X6BB 1CFMA 1SLUA 2DRUA 2NY4C 4QTIL 1XCQA 4CKQA 5CJ5A 5BMFL 5EWIH 1HWWA 5D1XC 5AVVB 1T2QL 2WWMD 4FJYA 5T1KD 1JF1B 4IBYA 3TA3B 3NSCA 2HX8A 4TVSa 3VI4F 2VDPH 1UB5B 4K5LA 4ZFZB 4P2RA 4UM8B 2R8SL 1AGDB 1R3JB 5D1QD 4KQ0A 3BI9X 3PHOA 4XB8A 1AZVA 1HESA 4J8QA 4ETYA 5T1LA 4NNPH 1OE2A 2W9EH 2KZWA 3PAZA 2V3VA 5IESH 1JGUH 1QG3A 2ZWSA 2VC2L 1QFWM 1XO8A 3VI3F 3GTNA 1MVFA 5L2KB 3SYOA 4LKCA 2A3TA 3IKKA 3QNZB 1RK1A 2FHBA 3QUXD 4HIHB 3GHEH 2DWEA 4EVNA 1JZJA 3N43F 4KQ4H 5KUKA 4LMQI 4MBOA 2FVNA 3MFGB 1QFUH 5C08B 1KTRL 2V2XA 3GJFK 3IDXH 1QSFD 2O4EA 3VJ6A 3ULUD 4JFPA 3MRHB 2VDNL 4WHCA 3HU1A 4Z7QF 4DKEL 5MEQA 2VERN 4HBQA 4ISVB 2C8NA 1KGCE 4LVNC 3TWYA 4E0RB 2B9BA 4AYFA 2F1BA 3SPJA 3ZE0B 4P4RA 4AUYA 2MCPL 2XZCH 5DMKA 5E8EA 4Z3JA 3I75B 1KENL 2WUCL 1DQLL 3QQ9C 4PRIB 1W0VB 3QEQD 4U1JB 3UTPD 4RMWA 2J4WL 2Y5EA 2O61B 4MNHB 4WU5A 4WW2B 1DTUA 5HHME 2F74A 1ACYH 3ZGIA 4URKA 5ID1A 1A7NL 1TTBA 3U6XA 2GABA 1IFHH 1OM9A 1YPZA 1OK0A 1QSEB 2AK4E 5F89B 5JHDE 1XAUA 4NKQB 4ILDA 3TV3H 3U4BH 1NM9A 2PR9A 2LFGA 2EDQA 1YEWA 2JQMA 3L48A 4EIBA 9CGTA 3M8OH 4CDGC 3V5HA 1YEGL 1SLVA 3UC2A 4DERA 1HILA 1P5UB 5L2JA 3NGBB 1XVSA 5I28A 1KXVA 5KG9A 1RUKL 2ZCKH 1CVRA 1CQYA 3L5IA 5FOBA 3DA0A 2ZXEB 2DYPA 3FUJA 4OM0L 1I1YB 2OJ1A 3O6KH 2NX5B 1EFXD 4X6DA 4G8AC 2I69A 1CFVH 5DYOA 3T6WA 5CR1A 2HH0L 3E6HA 4XNBA 4N6RA 2OYLA 4LSPH 3IRCA 2SEBA 4FF9A 1AG6A 3V52L 1OOWA 4HWNA 4YX2L 4ANWA 4OZGB 2AV7B 3V4UL 2GKIA 4YDKL 2HYMA 3IJ7A 3JWDH 5L8LB 2BWIA 5AW3B 5LKNA 2OMWB 4FXGA 3TH2T 1JPGA 3ARFD 2A73A 2YRZA 3LV3A 5DO2D 3ZHNA 3OSKA 1M9WA 2X1OA 2X6MA 3VFUA 1AQDB 1AZNA 4BFGA 1HZKA 4TSAH 2OCCB 1H8LA 5F1IB 3GT6A 5FYJH 1WFTA 2IAND 5ITFB 5BZDB 3Q2VA 1J8HB 3ZKXC 4G8GD 4FFWD 5TFSH 1RIVL 5D71H 1FO0B 5C09A 5DHXB 1ZE3C 2CHDA 3R7QA 4IMLA 2N0KA 3A4AA 3K81A 3QJRB 3UGXA 2KBGA 4CC4A 4WEBL 5FKAA 5BOJA 3ETBJ 2L3BA 4MJ5B 4X6BA 2FX9L 3AMLA 4PJ7F 4XMKH 3QQ3B 3V0WL 4Q2ZB 3TH3T 3FAXA 1JF1A 5LBSA 2B9AA 3TA3A 4HKZB 4K71B 3D1MC 2V5YA 1UB5A 4PHXA 2CR0A 4UM8A 3RIFK 1AGDA 1E8XA 1R3JA 3JV4B 2NOYA 1K4DB 4FA6A 4L4TD 4O2CA 1NFKA 3LNEA 3V0EA 3L3JB 3C09B 2NNFA 3QUYC 2VR3A 4M7ZB 4QYOB 5IMMB 5D7JB 4GBXB 1UFUA 1E8WA 1LJMA 3SGJC 1JRHH 5L2KA 1HHIB 4XMPH 1JHLH 3FYIB 1TR7A 2UX7A 4KI5E 5DS8B 3QNZA 3EFOB 2YK1H 3O5AA 4NM4H 4HIHA 3DVFA 1DZBA 1HINL 2CUHA 3N50A 5C08A 4F58L 4WI5A 1UGNA 1VRSA 5AEAA 5INCB 1RUPH 3RI5K 3PV6B 1DL7L 3V10A 3R4RA 3ZBMA 5E9DE 3MRHA 2C9AA 2GTZB 3M3GA 4FQXB 4JN2B 1U4EA 4FKKA 4MRBA 1YEKH 4ISVA 1KJ2L 1ZGLB 3ILEA 4GMTH 3ISRA 3LZOA 4CU8A 5BV7H 4E0RA 3PAYA 4YHIB 2R39A 1AGCB 1F1GA 1E4XL 4MNQE 2RMNA 3T4AB 4JE4B 4ZS6D 3I75A 1TQWA 4KHTL 2CSPA 4PRIA 5CINH 1W0VA 4U1JA 5D7IF 2EXTA 3T3PF 3B7SA 3IN0A 2O61A 2HFFB 4MNHA 4WW2A 3II2A 3BDXA 2B4CC 5DSCB 4NWTL 5LAXA 1W2KT 2DH2A 5DMGC 2KPNA 1K83A 4KDWA 1O0VA 2UYLB 3L9RB 1QSEA 3VDAA 5K93A 2XZAH 2CJUL 4I0PD 4ONHB 1KC5H 1P5UA 2AXWA 4YDJB 5SWSB 4MJ6B 3U46A 4AVJA 2JA5A 3O8XA 4A63A 2W07A 1B4LA 1ODAA 2FJUB 2N1TE 2Q8BL 3O8XC 1VZHA 2NX5A 1N64H 7FABH 3F7RA 4Y1AD 4MJ4A 3PG2A 4X4XB 4KUZH 4JFDE 2VDRL 1O75A 3P40A 4G6FB 4NM8L 2Y6SD 2YQ2A 1MFAH 5CZRA 5T5FL 3KPRD 2VO5A 2ALAA 2AV7A 4LCIL 2Y9RT 4QHUB 2ZKHH 4HGMA 4BELD 4JPQA 4Y4FB 1QABA 3K71B 4HWUA 5AW5B 2OMWA 2IV2X 2KT6A 2WO3B 2Z8RA 5CD5C 1SN5A 5I8CB 5D93C 4Q52A 1AQDA 2CM6A 4L9LB 1SNRA 4FLSA 4RGOL 5CSBA 3UZVA 3X3GL 1EUTA 3S88L 5ITFA 3G6JB 4WHTB 4E9TA 5BZDA 1J8HA 1Z1WA 3HVNA 4U0RB 1J0IA 3B1TA 3Q05A 4EQ3A 1NEZB 4MQXD 1Z5LB 1FO0A 3A6CH 3MBEC 4JDEB 4JRXB 4KJQD 4P2OC 3DTUB 4ODTH 1JVKA 4TSBL 1LP9E 4MTMA 2X9YA 1RZJH 4AQAB 4YWGH 3Q2NA 2F18A 3B9EA 1KFAL 1A1MB 1FZKB 4MJ5A 2WD0A 3LXCA 3QORC 4FKHA 5T3XE 2MSPA 3QQ3A 4Q2ZA 1ZEAL 1XF1A 3L8QA 2FBRA 4MLSA 4OIFA 2DB8A 4ZUVB 4HKZA 1EEYB 2XWXA 4KTEL 5F7AA 4D9QD 5E5LA 3BAKA 4LCWB 4YHZH 3QFGA 3JV4A 3P4MB 3QHTC 5K39B 2O5XL 2CQVA 3L3JA 4QYOA 3V4VH 2VZ3A 5IMMA 2F7QA 1ULVA 2Z93B 3S5LG 4ZNEA 4GBXA 3BWUF 4M7ZC 2BS8A 3D4CA 1HHIA 1FRGH 2V33A 3WKML 3DHJA 1TFHA 4KROD 4KUCD 4AITA 5FTLA 3N40F 4Z77B 2J8UB 1KGXA 1NAKH 2FRGP 2J88L 5INCA 1DLFL 3D3VD 3SDXF 3PABA 3PV6A 2P5PA 5GHWL 1MRFL 4FQXA 1CB4A 4JN2A 2XNAB 5FUCE 4FYTA 3STBA 1JZDC 1NMCC 1WT5A 2QQQA 4RGMB 5CN1A 5GGSB 1ZGLA 3QUHA 4JQVA 1WT5C 2L7UA 1YNTF 2EIJB 1J05A 3JBG7 2BNRD 3VFVB 4EE2A 3KL3A 4JQVC 2VH5L 2AZUA 4OF0A 4BRVA 4TOYH 3T4AA 3CMOH 3NYKA 4XXWA 1ZLUK 2M26A 4K3DH 3UBXI 1PZUB 2WLZA 5I8KH 1GL4B 1XV8A 4PJEF 4DN4H 5KW9H 2HFFA 3GLEA 2AABH 2XN1A 4O2EA 3D9AH 3WOVA 3T6VA 1WJ3A 5DSCA 2CAKA 2P5EE 2OSWA 5F97E 3EYUL 5I6XC 2VL4A 3IDIB 3L9RA 2UYLA 1OW0A 4OLWL 5SWQA 1RZ8B 3CMGA 3GTMA 3V8CA 1A8ZA 3LVEA 4WEUD 5ISZB 4XHJD 1ORQB 5IHUL 5CLWA 5LNEA 2Y72A 4AKPA 4AUJA 2HRPL 4V33A 4YDJA 5SWSA 1VFUA 5EMYA 4Z7OB 3QO1A 4MJ6A 4NFCA 3F84A 1QBMH 1WBYB 3RVWC 1U3YA 3NCYS 4TRPL 2V9RA 5C7XH 2A6KB 2WOYA 4OAWB 5ESVB 2WNXA 2PWEA 4DGYL 4XNUH 1L9PA 1PAMA 2A9MH 4N24A 4C4BA 5C0GB 1CURA 3SOBL 3KYNB 4WU7B 2OSYA 3O11B 3BKCH 3KNBB 6PAZA 5C0BE 1NCDH 2YD6A 3MRKB 4JRWA 1JDCA 3CVHL 3AWFA 4X4XA 5EBWB 2F54A 2VLRD 3WXVH 3I9PA 1QBBA 3K1KC 5KAQG 1LVEA 3UO1H 1WEJH 4PI0A 5I1JH 3AWGA 3MA7B 4QHUA 4KH2A 4NBYB 4Y4FA 2J8OA 1WAAA 2WXQA 3K71A 1J5OH 4Y4FC 4KK8D 2EUWA 2JKRM 1KZQA 1VEMA 3B9KD 3OXSB 5I8CA 2BFGA 4ZMLA 3RVXC 1BA9A 5IBLC 1G1OA 4L9LA 1F02I 1JZFA 4NQED 1G7HB 3G6JA 4WHTA 4K8RH 2XTJD 1PZBA 4UTBH 3KL5A 4P9ML 1Z5LA 1UOKA 4DP0X 4JDEA 4JRXA 2C9RA 4U49A 3ILQC 1NIAA 3H9ZA 5FXCH 3IU4L 4AQAA 2ZX7A 3V0DA 4A1RA 5AB1A 2AJZB 1A1MA 1FZKA 2YXWA 3MTRA 5T3XH 4TTGA 1IT9L 4A67A 2WQUA 4DKFL 3FO0L 1KYOJ 2ZJSH 3N44B 4ZUVA 4WNSA 3UPCA 2C7UB 5C0AD 4K5PA 1GMIA 3CXDH 4LCWA 3RVVC 4HPHA 2BFVL 3P4MA 5K39A 1BWWA 3ATBA 3ESPA 3GSWB 4JCWA 3NFSL 1I7UB 1VPOL 2YA1A 4LAJH 4H0IA 2VXQH 5EORH 1MEXH 5HHOE 5IOKA 3FS9A 3GM8A 3N1PC 2XT1B 4NJ9L 5D1QE 3TT3L 3PWLB 1OAQH 5SX4H 2R1YB 3COOA 1CDCA 1DUYB 4H44C 5FCSH 3QAZB 2OMZB 1HSBB 4ZW5A 3B7TA 3TVMD 4IYKA 4D0CB 5I0DA 2J8UA 2IDCA 4AZ8B 2A6ED 3QXAB 1C8QA 1KJ3H 1TJIH 4YQXH 3W0WD 1O9WA 1DJXA 1PVHA 5FB8A 2IV8A 2XNAA 2PPEA 4U1LB 5GGSA 3QHZL 1PY0A 1QSFE 3X2KA 2CCWA 5JW4R 3IBOA 1S9XA 4QTFA 2WWMC 3OAZH 3DYMA 3HKZA 4FI8A 3WIAA 4U05A 5B39G 4CN1A 3O4LE 2AEPL 2WV3A 2DQMA 4JUTA 3DO4A 4E9RA 5D1QC 4LDOB 4WIQA 1PX4A 4A7VA 1HL5A 4QKTA 2X09A 2Z31B 2I26N 5EZOL 3R7RA 4KITB 2YUWA 5DF0A 3RWFB 1KLUB 3GS0A 3QEQE 3ME0B 2LVCA 4JO3H 4ZUSB 3IDIA 4JDZB 4W9JC 1JGVL 3ZE1B 4HS6B 1GGCH 1RZ8A 3B7RL 4J1UB 2GPZA 4DGVH 4AX3A 3GHBH 1EIBA 3ASNB 5IROA 1JZ2A 3QUXC 3MVSA 4P46B 5CIPH 3MXWH 3SE8L 1EXHA 3MOAL 5IROC 2IPUK 2PETA 1ZCRA 2BCMA 3BPNB 4E42B 4HLEA 3X1GA 2O30A 1WBYA 2JCCE 1KELH 4JQXC 4PBVC 2VUOA 3I85A 4M9OA 4Q9RH 2A6KA 4OAWA 3ULUC 5ESVA 2EILB 1D5IL 5C9JA 5C0GA 4ZYKB 2BRQA 3WS3B 2AS5M 3KYNA 5ANHA 4FNLL 4M6OH 2MEJB 3LKNB 3KNBA 3O11A 4WU7A 3RYMA 2HUEA 3MRKA 3EOAB 5EBWA 1BZ7B 4LEEA 2JNZA 5BS0D 5J1AB 1U33A 3PU7A 1FBIH 4KDTA 2FQDA 3MA7A 1E8ZA 3Q8EA 2IBZY 5CLTA 4PJ9B 4FTDA 2JVUA 2CLRA 3JWOC 2NY2D 4HIXL 4F5CA 2CJSA 5JOEA 1QKZL 4OLVH 3F62A 1AKJD 3KBHE 3UERA 5D6CB 4PGCB 5AZEL 3GKZA 3CH1A 3QIBD 4AUUA 4L3EE 4X6CF 2LU4A 3OXSA 4M48H 1U41A 1UWEH 3QS2A 4PJBA 5JIQA 3WTVA 4MVBD 3D50A 1G7HA 1OAYL 2MCG1 2I24N 1F11B 3R8BB 1QRND 1SYSA 1EO7A 1BDYA 3LHAA 4JPIB 2LABA 5L4MA 4IBSA 4JG0L 3BPOC 5DD1H 5C2BH 1CTNA 2F6AA 5L8KB 4YDZA 1XD0A 1RPQA 2UXFA 2AJZA 5DLLA 3ZTJH 2VWEE 4JS7A 3TASA 1Q1JL 4C8XA 3K6NA 3CBRA 3K6DA 3MNDA 1DEDA 2CDFB 2AJUL 4F7MB 1OE1A 2NAPA 4XP1H 1BBJB 2CW0D 2C7UA 1A65A 1I3RB 1K8DB 2P7TA 4KFMA 3HCVB 4UU9B 5BUPA 2EDNA 3GSWA 1I7UA 2YPLD 1HK6A 2B1HL 1T7ZA 2JCWA 1NKRA 4JMNA 3ZU8A 5IWLC 2DLTA 5K9OB 3PWLA 4ZMNA 2DBLH 2HFTA 1MRCH 2R1YA 2ZCHL 5DO2C 1NCAH 2PLTA 1DUYA 2PUQT 2FGWH 3ARFC 4MFHA 1SMDA 1BIIA 1ZKAA 2OMZA 1BQHB 2PPAA 2I60H 4YHKH 1EO8H 2ZWLT 2IANA 2B0SL 3ARYA 4U1IB 3CD4A 3TBCA 3QXAA 1WZ1L 4FFWC 3K2UH 1A3RL 2ALWA 2FO4B 5L0QB 3SKMA 2NY1D 3RWGB 3WN6A 3ZYOA 2XHNA 2AJVH 3TPKA 3IJSB 5E8NB 3Q6GH 4NB7A 3WN5C 2H5UA 1Z2KA 2E74C 2V3DA 4U1LA 5B38G 4GEJA 1NPUA 3GSOA 1OAXL 3AY4A 4RGND 3AY4C 3QNYB 1T89C 4W68A 1EX0A 2ESVB 4PJCB 3JTSA 3L1OH 4WKZB 1X5MA 5EO1B 4P5KB 2VTFA 2Z31A 4KO5A 3UIYA 4K94L 1KLUA 2Z31C 3TCLB 4PJGF 3VMNA 1UEMA 3ME0A 3DUUB 3H7LA 3ULVD 4ZUSA 4JDZA 1FE8L 4GSUA 4HS6A 1BM3H 2Z91B 1F4HA 4H8HA 4J1UA 4XNYH 2BM3A 4JN1L 1UA6H 1H3PL 3HZKA 5DR5H 4P46A 5FECB 1PZ3A 3FB8B 4UZGA 1PNCA 1XHHA 3N2JA 4E42A 2VR4A 2WAHA 4UI2A 4QRRB 2KQAA 5EEWA 2VRQA 3WNKA 4AM0Q 4LL9A 5TJWK 4ZZFA 4QXVA 4OB5L 3VU2A 4F8OA 2TSAA 3WTUA 4ZYKA 3CX5J 3WS3A 2PWFA 3LKNA 4LSUL 1EZLA 3ET9F 4OI8A 1LGVA 5DK0B 1KN4L 3DI3B 3PREA 1BZ7A 1PZSA 1YEJH 2ADJB 2EO9A 4JX0A 3MAWA 5J1AA 4WHYH 3ZUNC 1EZSA 4Y1AE 1FFQA 4ADGA 1U8KB 5DZ9A 3BQVA 1SVBA 3FO2B 5F0JB 4AYDC 5CN3A 5IBTL 4XOCA 1YRKA 5CKGA 1RIUH 3UCQA 4PJ9A 1JXKA 3BVDB 4ZT1A 2WGXA 3KXFD 1O7SA 1TETH 5AL8A 3H3BC 4OCNC 2DQGL 2M1KA 3U7YL 5D6CA 5J89A 3KH4A 3C87A 4PGCA 5HDWA 1JERA 2Y25A 2NZ9D 5I66B 3HW7A 2YGPA 1M4KA 3APDA 5HGBB 3SEPA 2UZXB 4AJYV 3BZEB 4ALAC 3GS7A 1ZANH 4HETA 2BZCA 4PVNA 4XP5L 4BCYA 1I3GL 2OJZL 4WWOA 4BZ1L 1F11A 4CN6A 1NCBL 4MJIB 3QCVH 2OW7A 1Q38A 3Q2WA 4DPCX 1I8MB 4JREB 3P1VA 1U9KA 5EF1A 5E70A 5HYJD 5FW8A 4MASA 5F9OL 4JPIA 1Y1UA 1Z6JT 1ETZB 3ENEA 3KR3L 4W6YB 3D39D 3GBMH 3DGCR 5CFAA 3N42F 1UXMA 2KS0A 5C0ND 2DQEH 4DPAX 1IKNC 4KK6D 4UV4L 3RIAK 5ABDE 1DSFH 4N0YH 2CDFA 2DLIA 4KPHH 4F7MA 1T1WB 4KMLB 1BBJA 1K8DA 1I3RA 5ITBL 4C4KT 2Y6SC 3HCVA 4JZOB 4UU9A 3SY6A 1G6RL 4GLRH 2BS71 1G7JB 4KKBD 1MWAA 5K9OA 4PS4H 4XN9A 1EJOL 2HSIA 2FH6A 3D8MA 4G1MB 1U8MB 3D25B 5FYKH 5GGVL 2O5YH 2CHZA 3PWJB 3RFZB 2KDGA 1UD6A 1Y6KR 4U1IA 5MP6H 4HS8H 2VDOH 4N86A 4AQ8C 5KYXB 3DMMD 1UXSB 2XY2A 4CBZA 1UWGL 3ABLB 4FD0A 4MQXC 3VG9B 1TG8A 2GEEA 4NOHA 5A2FA 3GS4A 2EYTB 3QWOB 2VW7A 4KJQC 1U8QB 4OSUH 2DJMA 4LPUA 4QXWA 4ZFQA 3IJSA 5E8NA 3RWGA 2GBVA 3EXLA 4KV5E 2YFOA 1U8IA 2CMRL 3GZOA 3S36L 4NFDA 5KEZA 4L1HA 3W37A 5TQ0H 1PJWA 3GSNA 2XV0A 4PN6A 3QNYA 3T8XB 2ESVA 4PJCA 3GJEA 3BJLA 5HHQB 5C0JB 1GZHC 5MEOB 4WKZA 4M5TA 1LO0H 4PJFE 1R9FA 5EO1A 3IETB 4P5KA 4NGHL 3G6DH 2EABA 2HG5B 2V6HA 1YNKL 4AYSA 2H26B 2FECL 3TCLA 1DBKL 1NPNA 3NIDB 3FH7A 1J0JA 3DUUA 3WUWB 5I1LB 2WB7A 2Z91A 2HFGH 2A6JB 5FC9A 3QJUB 4KROC 1YYCA 4XN2A 3MQIA 1YQ2A 5DLMH 3RA7H 3N1FC 4FFZH 5FECA 3FB8A 4V2CB 4E41E 4L0YA 1J8RA 5ALBH 3B7YA 4JKLA 4YSTA 1SXNA 1A7PL 4X42A 4QRRA 1RZ7H 3CF2A 3FQUB 5IW1B 4CSZA 1L0QA 3EOBB 2H1PH 3WLBB 1O6TA 1K85A 2ZP0T 4CVXB 5DK0A 3NSFA 4W81A 3X2JA 3QQ4B 2N3JA 1BAWA 5B3NA 3ETBF 1U8KA 4GQZA 2EVHA 3C6LB 4FNUA 3MSPA 2ICES 4JQIA 2MOVA 2XWRA 5CJXA 2YLHA 5I66A 2BWDA 1E2VA 5AWNH 5HGBA 3BZEA 2UZXA 1UCTA 4BFEA 3LPFA 3QDJB 4GRLB 5CUSH 1SEBB 2EADA 4XHJC 2UWEE 4MJIA 3SYQA 5HHNA 2P5WA 5EZIL 2MRYA 1I8MA 4ZZKA 5GGVY 3DSNB 3V6OC 1MSPA 3GZPA 5FTMA 5CLZA 2X2UA 2GVYA 1PSKH 5HHXL 4H8WL 5AOIA 4BCXA 2WINB 2WLHA 1PS3A 3QI9B 5E2VH 5FUZL 4YXKH 4A7GA 2VDKB 3EH5B 1T1WA 3QXVA 4HWEL 3EJJX 3RY4A 4D7PA 2Z92B 1T03H 3D5OF 3S4SG 3C6EA 3WBDA 1JFHA 5LBSL 3F2LA 2PN5A 1G7JA 3V6FA 3L3HB 2Z0BA 2FB4H 4WFFD 3B9KA 4G1MA 4AGQA 1U8MA 4KK8C 3JTTB 3ULSB 3CFIC 3B9KC 2NUTB 3PWPB 2FD6H 2ZTBA 2WWKO 3PWJA 4JVUA 3RFZA 1IQDA 3OZLA 4BE5A 4OJEH 3ECUA 4GG6E 3PS6A 2AAAA 1ZMYA 1GCFA 5KYXA 4N6QA 1UXSA 2XTJC 5KTEL 1B0IA 1UZ6F 5ERWB 2EUXA 3T0AA 2EYTA 3QWOA 4U3CA 2FWOB 4J3OG 1RL1A 3GMPB 4JDTH 4K07A 3Q7JA 1I7RB 3MLYH 3V6ZB 4N8CH 3BJ91 2CHNA 4NWUL 2XQYA 3W0WE 1DEEB 1ZV9A 3O3EB 3FQXB 1EHAA 1IQWL 2NW3B 2DI7A 4UT7H 4MCYB 3B2DC 4I88A 3HU2A 2G4GA 4UILL 2VLJD 1XCXA 4C56E 3T8XA 1EZVY 2VN3A 4LPCA 2ZYIA 1HJCA 5HHQA 5EU3B 5AW0B 5C0JA 2KC0A 5MEOA 2HKHH 4JO5A 2KHAA 3KM1A 3IETA 1YA5A 1KXQE 2HG5A 4MMXB 3SE6A 1G7LA 3F6IA 4PP1D 2H26A 1QWNA 3BZ5A 5FTJA 3KLKA 4RMUA 3AG4B 1JPTL 5H8DA 3SDAB 3UP6A 3L5JA 3WUWA 5I1LA 3GXIA 2A6JA 2QDWA 1S9WB 1JTPA 4WAFA 3T0EB 3TVMC 5L9DH 4PRPB 2CR3A 2X2HA 4WK4B 3KAAA 5F6IC 2KZKA 5GS2H 4G5AA 1TIUA 5JZ7D 3EOBA 3X17A 2NY5C 4N1CA 3WLBA 1SXSA 1JS4A 3PGFH 4NNYB 3D0AA 3IMTA 1ADQH 3JV5A 5FGBC 4K7PL 1DQVA 4O02B 1DQIA 4NZTL 1P6FA 3QQ4A 3ZSTA 1IAOA 3KWUA 3BVWA 1SVZA 3RGVB 1A4KB 1RU9L 2NSMA 1CLOH 2PNDA 4NIKB 1KQGA 2R51A 3VXSD 4GO8A 3C6LA 3U2JA 1QPXA 2MJWA 3C6LC 1G84A 1EVTC 2MWCA 1ROWA 3BP7B 2B5IC 3RZWA 1LYQA 4FQ1H 1UM6L 2EEBA 1FYTD 3QDJA 2CRYA 4GRLA 3QWNA 3PPEA 1SEBA 1NWPA 3QISA 2VDPB 1HXKA 4CILA 1NJ9B 2VLKD 4H5SB 1IE4A 3ZIMA 3GMNB 3DSNA 1E3ZA 1R46A 1OGAD 4FZ8L 1EJ6A 5AW9B 4XX5A 2YEVB 2WHVA 4HQQL 4AIEA 4DTGL 1N68A 1FO0L 1N26A 4P59L 1I9IH 2WINA 3ZN6A 4QHPA 1NCWH 4KTYA 1XH2A 3UC0H 4AL8H 1CXEA 2R0KL 2YPVA 2GIYA 2I5YH 3QIWD 3F6LA 2LU3A 2XWDA 3FH5A 4GP8B 2Z92A 2D3LA 4XC3L 2K3TA 1QSVA 1MKFA 3WNOA 1M9SA 2EJ1A 3ABGA 3L3HA 4P2QD 1GW0A 2NY2C 4ATTA 1G0DA 3I2CH 1QLFB 3QIBA 5AYUH 3JTTA 2YPLE 5G2NA 3ULSA 1GGIL 2GK2A 3HN8A 3QIBC 3PWPA 2NUTA 3FT3A 3ZMEA 4HHWA 3BSHA 5BO1L 1E4WH 5CEYB 4AC2A 4MVBC 1CBVH 3HG0A 3C5SB 2GJ6B 5DEFB 4XO8A 3NZHL 4Y8DC 2JI3A 1QRNA 5IFHL 1BVOA 4PB9L 2WUBH 5DQ9A 3I6SA 1Z9SB 3EO9H 3EH2A 4AMWA 4OCWH 3GMPA 5KJ4A 1X6LA 1I7RA 4RMSA 3V6ZA 4W9GC 5HI3D 2B08A 2J1ZA 4AJWA 5B1JA 3GD1C 1UWXH 1DEEA 3O3EA 2CXGA 4UZUA 5ALCH 2FQGA 2WBXA 2NW3A 3HI6H 3GTGA 1KF9B 4MCYA 3HKFA 4LSTL 3IRZA 5A2LH 2K7QA 3ZDZB 4HMCA 4RWHA 1P4IL 3IJ8A 5CGMA 2A74B 3P4OB 4HC1L 3MA9H 4K3HA 1TJXA 2YGNA 5EU3A 3PE9A 2CO7B 4RGNE 2FIRT 4G8FB 1WHPA 1HIMH 2BSEA 3B2UD 4K7PY 4JJ5A 3B6SB 1FYHB 5JHAA 3NA4A 2C9XA 3CN4A 1NCJA 2J71A 3KL0A 5C0RH 1IGIH 1H3XA 1JCKA 5GS0D 4ZPTA 3SDAA 4FLRA 1DN2A 3D12B 4FQCH 3UOAB 1AXSB 3JYCA 3UBXG 3AGVA 4Z0BH 1MREH 4OY9A 1NGPL 1S9WA 2YBGA 3VRIB 5KN5B 3ULVE 1MAMH 4HIEA 4PRPA 4LPVA 4RSVA 2X53A 1O6SB 2PYFB 2NCEA 3OAUL 4LIQE 4O9HH 1FNEA 2VQ1A 2HPTA 1U2HA 1P84J 2X4QB 4KXZH 2XQ0A 5C2UB 1QFPA 3DYOA 4LRIA 1MPAH 2X2IA 4K3GA 4GI8A 4NNYA 4PREA 3RDTB 5JIPA 1LNUB 4O02A 5EUOB 3PXHA 3WENA 5FFLA 4IGBD 4A68A 1WIUA 1EAJA 5F0PB 1LQSR 1S7TB 3EOYG 1A4KA 2BIHA 5LBVA 4RA0C 3DJZA 4L8CB 4GUQA 1OP3H 3VXRB 4Y1SA 3GIVB 4QRBA 5D96B 4X2UA 2BJML 2IDTA 2BIQA 3WD5H 5IB5A 3WTTA 3BP7A 4NBXB 4HISA 1A6VH 4C47A 4DMRA 3BAYA 2BDNH 3ULVC 2ZUTA 4LPYA 1AR1D 2Y36L 2VDQH 4YSUA 1R34A 4JO2H 4NN6B 2VXVH 3HZMB 2ZPKH 1P7KB 1NJ9A 3QJOA 4H5SA 5LQBL 3NTCL 3OLEA 5ICYB 5TQ2L 3GMNA 4GI9A 3DJTA 4D94A 4IRZH 4LEOB 1IEHA 1KMGA 1TEYA 4QRFA 3MUHL 4NQSB 2OP4L 4G5ZH 5HYJE 1GYUA 3SBPA 4D7BA 3ULUF 2J20A 1IC7H 1YNLH 1VCBC 3NCXA 1K2DB 4HUVB 4EN2A 3GMLB 3N1QC 1NWOA 3E6FB 3ESNA 1A7RH 2Q6WB 8CGTA 1B0WA 4KK9D 2QKSA 1I1AD 3CHQA 4XO5A 1A5FL 2ICWJ 4I9WD 1X5LA 1XSIA 4M93B 2OMXB 3K0YA 4LPWA 4OF8A 5CP7A 4EN3B 4E68A 1NLDL 4EF3A 1QLFA 4OI7A 3M1BA 1XGUB 4W9EC 2ZUQB 4UB0L 2O5NA 5MI0B 3MN8A 3TBYB 2NZ9C 3BUPA 5BV7B 4WUKL 2CA4A 2V4LA 3Q8CA 5CEYA 5L4FA 3BH4A 4Q6KA 5AVXB 3C5SA 3TZVB 1OKEA 2QELA 5DEFA 2M8XA 4RFNC 3CHOA 1EAPB 4R8WH 2VDLH 2WQRA 1Z9SA 2JCCF 4H8VA 1NCIA 2WWOA 2AW2A 2ZOTA 4WO4B 1P9MC 4YAQB 4N2CA 5D4IA 5HHMB 5FW6A 4KMQA 1PBYA 4JE0A 5C0NC 4PVBA 5IBUB 3TXAA 5EOQL 4KK6C 3LRKA 5JHDB 3GDCA 1FVDB 2PKDA 2SODB 3P4OA 4P3DB 3QRBA 4QCIB 4MJHA 1AG0A 3NDYE 2X0VA 4RRPG 2IH9A 4Z7NE 3SUMA 5F9WC 4G8FA 1U3HD 3B6SA 4KKBC 4KAQH 1BVKB 3RNQB 4YSPA 3FQ1A 3WJJC 1DVZA 3LS5H 4TN9A 2E9GA 3TO4B 1W9XA 4OJDH 1WTGT 5DUBB 1L8FA 1NAMH 3VFTB 3UROR 1OT1A 4LB8A 3D09A 3THML 3VRIA 3ZE2E 4EO5A 5KN5A 1I75A 3WTWA 1WDAA 3ULVH 4D2NA 3BKML 4JPVH 3MRIB 1O6SA 2PYFA 2QLYA 3DMMC 2K6YA 1NCOA 5GRUH 1MELA 5E5UB 2ADYA 3RVTD 4DVRL 4LIQH 5CZKA 3IFPB 4OLUH 1UASA 2DKMA 4YL4A 5E4OA 3HN5A 3FBQA 1KEML 4N0FB 4K3JL 4PW3A 1A7BA 2MMXA 3OLDA 4JG1H 4ZTOH 2P46B 4G7RB 3RDTA 3WNPA 3BGAA 1QNZH 4FG4A 1LNUA 2DM2A 2HP4A 5E5RB 5EUOA 5DRWB 2VMCA 5TGBB 4Y19B 4AVRA 3EDFA 1S7TA 3FU7B 5L88H 4ZO9A 5HGAB 1XGQB 2ZAGA 1I8KB 3VXRA 5CKAA 3GIVA 4EDWL 4I1RA 1CDBA 3BQUB 4GIPD 1E4HA 2ENQA 3ZR5A 4HP5A 4YSQA 4L1BA 2X4TB 5D7LD 4ERSL 4N68A 1A14H 3AU1B 2R0LL 3ZTNH 3HZMA 1P7KA 2DPKA 4P3CL 4W4OC 2Y7SA 3U9UB 5ICYA 5IQNA 5CWSB 3V4VB 2UZYB 4GMSH 4NUQA 3LXAA 4LEOA 3FULA 1USQA 2E5EA 1MCCA 2YD7A 3LXBA 3HBGA 4NQSA 3ZQXA 5DEGB 1BXXA 1N70A 3DRTB 4P5SA 5JPMB 1KYFA 2X5PA 5DQDL 1JG9A 1YYML 2CO4A 3C5ZD 1AQKL 1CZ8L 1J9RA 1K2DA 4HUVA 3T08A 4N90D 4EUPG