4FG4A

Crystal structure of bacillus subtilis expansin (exlx1) in complex with hemithiocellodextrin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fg4A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fg4A02
2KQAA 1OA9A 3SULA 4FERA 2GAEA 1WHOA 4ZM7A 1BW3A 3X2KA 4JJOA 5GM9A 4FG2A 4L48A 3ENGA 3FT1A 1OA7A 3X2HA 2HCZX 3CZBA 2PJJA 1HD5A 3X2JA 4JCWA 1BMWA 3X2OA 4JP7A 3X2IA 3SUMA 1WHPA 2PI8A 4FFTA 3X2LA 5H4UA 1L8FA 3X2NA 3D30A 2VXQA 3SUJA 1WC2A 4JP6A 2G6GA 2PNWA 2AE0X 2BH0A 1N10A 4ENGA 2PICA 3M3GA 2JNZA 3FT9A 3X2PA 4FG4A 5GLXA 5GLYA 3X2MA 1BW4A 4AVRA 4JS7A 3SUKA 3X2GA 2G5DA 2ENGA
chains in the Genus database with same CATH superfamily
1RZGB 1I7ZB 2OJZH 4JG0L 5KS9B 4GSDH 3WN5B 3B4NA 5IFHL 4NGHH 5DEZA 2D03L 3FXIC 3H0GA 1BZEA 2Q8AH 3U82B 4JHAL 3FF7A 2D3JA 3ZY7A 5F6IB 1XV8A 2JQZA 3ECUA 1B0GB 2FO4A 2R0WH 3HS8A 9PCYA 3GSWB 3DUUB 1WHPA 3DX7A 4XPTL 1BFVL 3SGEH 4HWEH 2X41A 4Z7VF 3JZYA 1EUTA 3P77A 4C2MA 1G7PA 1QNZL 2KDYA 4XCCH 5FYLD 4B97A 3NZUA 4H8QA 4OD1H 1FFTB 3GS4A 3DPBA 4TKWA 4N28A 2P8LB 2IWKA 5CO1A 4EZKA 4LQFH 3DX1A 2VDML 4YBQD 3TZVB 5DYFA 2C9PA 1QLEB 1TZIB 2NYKA 1E9PB 2Y1VA 3LQAC 3VFPB 3VXRD 1FL3A 4R96B 5EC1A 1U3HA 4XNBA 1OAQL 1SLXA 2GJJA 3OAZH 4LRNL 1R3JB 2H47C 1CT8A 4GI8A 1NAMB 1MG3C 2VQ1A 4LIQE 1YYML 2IALA 4KNQA 4IQHA 3WTYA 2H0FA 2JNZA 3QEGH 1RUKH 5HHPA 3DWTA 2BWIA 4ZMLA 5CXPA 4YDLC 3A4DA 3HS9A 5I76B 1UG9A 2YPLD 2ZAIA 5ICUA 4NQEB 1LWJA 4HJTA 5KVDH 4IM8A 4QD2E 1AIFB 4LVOB 2CA3A 1UM6L 2AQNA 3L3OB 1KXVC 4TUJA 3X2QB 2WINA 2YU9A 5K33A 1G9MH 2ZSVA 1JGDA 4X99A 2V7NB 4FMFA 2GSMB 4ODTL 1N5YL 4YXLL 1KJ3H 1TEYA 2XY1A 3SUMA 2R69L 4LIQL 2WZAA 3MACH 3NFSL 3CSYA 1U6AH 1I31A 1UWXH 1A4BA 4HFUL 1XH1A 3TV3H 3L4TA 4GA6A 1S9YB 4N2HA 4Y4HC 3MRQB 4PWKA 1G1CA 1U58A 2NCEA 1M1SA 1A66A 2VDKH 3SULA 3BYYA 4ZTOL 3S3SA 1BVNP 3LKQA 3VGHA 4Y5XC 5IESL 1R5WB 4B9GA 2NW3A 3PL6D 5D70H 3ETBJ 5GJTL 4HGWB 5K9OA 5CWSA 4YHOH 4Q8BA 5D72H 1JBJA 5JPNA 1CICD 1KTJA 2MQGA 1ZANL 1I1RA 5IMKB 2EXYD 1Q16A 2A9ML 1MCOL 2UWEF 2I9LA 2NTFB 3MMEA 1LD9A 4DN3L 1JS4A 1EXUA 2FHFA 2DQEL 2R1WA 3MOQA 4I13B 2G2RB 2VW4A 3CDCA 4P46A 4Z7OB 1CK0L 3GLDA 4FFVD 3AWEA 5LKNA 1OCZB 5EU7C 5DHYB 4P8QA 4XCEA 2OMUB 2H0JA 3D2UD 2HJLB 1RUPH 2QLYA 4NYLA 4PJEE 3MBWB 1TDQA 1V3LA 4NT6A 5C0AD 1BXXA 2VC2L 4UDUA 1KPUB 3R19A 4HXBH 1X6NA 4IJ3C 3SQRA 2P8PB 4LMQI 4ZSOB 5I0YA 1PBYA 3HBGA 2H3XC 5HHVL 1UOVA 1FL6B 5TPWL 5TTRA 3RIAK 1LP9B 2B9AA 1SVZA 3QH3A 5KJ4A 1KXVA 1OAYH 3QIWA 4OUUA 2R0ZL 4K0OA 4XC1L 2NY4B 1BVKB 3FT1A 1NC2B 5L0QB 4YFLI 3PWNB 3O8XB 1XF3B 3IGLA 4S0HA 2HTKD 2E27H 3EYOB 1U92A 4ORGA 1VPOH 3BIAX 2CO6A 4XMVA 1XGQA 4L4VE 3IPEA 4ANXA 3RWJB 4FQXD 3UTSA 2J3SA 1JWMA 4D9RE 4B9JA 3VG0L 2VQ4A 1FZKA 1DLHB 3RZCD 3DURA 2I25N 1CR9H 1HNYA 4BUGA 4PJ9B 4G8IA 4RIRB 5D7JD 3MXWL 3ZYZA 3OXRB 4M4RA 3GTPA 3LPWA 2CDEA 3AW5A 4JJOA 4Y5XA 2HUHA 1KXHA 1VEPA 2ALWA 2WIIA 1MEXH 4YH6A 3ZSSA 4EKJA 3IJSB 1GCFA 3QZWG 3QHZH 3JVFC 4G6FB 4WFHE 3TN0C 4I1RA 4PLJD 3VXNB 3SBRA 5BJTA 1F90L 3K71A 2BVPB 4HIQA 1OCWL 4DOHE 1OSPH 4MQXD 1CL7H 1PY4A 1GS7A 2D31A 1KWKA 5BVJB 1A6PA 4AV4A 2VDRB 1PS3A 5F2FA 5HHNA 5CGBA 3UTTA 3A4FA 1PT1A 3U4EA 3VGAC 4AVRA 2WOBA 4OF3A 3C5JA 1F8TH 3G5VB 4Z0XB 1R0AH 5DRWB 3FPXA 2J55A 4LNRB 2AVGA 1HEJC 3CTTA 2GSIA 2ZOLA 4LSRL 4YGAB 2EINB 2CIIB 4JPVH 4BIKA 2EP6A 3HKZA 3T6ZA 5TE4H 1EJ6A 1PPYA 5I18H 3NZ8B 4QTFA 4ZAKB 1F3RB 1KGXA 5DHEA 3QZWA 2BSBA 4JRYB 1K8IA 4PJGE 5C0ND 5FA4A 3CFDA 3F5WA 3RJDA 1WBYB 1ACYL 2QDWA 4HZ1A 3T3MB 3X11B 2MIZA 5DD5H 2CM5A 1EBPA 4NQSA 1QUPA 1J05A 4Y89A 1EMTL 2AK4A 4YSSA 4OFKA 5ECJE 1MG2C 4AYSA 4BFEA 1UZGA 5CKAA 3AU0A 1UXSA 3MLVH 1KB9K 1T7ZA 3ALWA 3BSGA 1KLUA 2VDLL 3B83A 4C56B 1MNUL 4NQDB 2GHWB 5J11B 3MJGX 3Q9QA 4WJKB 2FEDD 3L7EB 2FH6A 3I6KA 2BPBA 5ICYA 1BX2A 1WA2X 1GRWA 3QE5A 4HCRL 2J5LB 4JFXB 3WD5L 3ZDXB 2X10A 3B9VA 4JFSA 1GYWA 4ZOCA 4GAJL 1TU2A 1U4FA 4NXKA 4Z76B 1JPTL 2W38A 4ZX4A 2HAZA 1DBJH 4NNPH 1SEQH 2EYTA 2Z0BA 4OBSA 1EH9A 2VISB 2P9RA 2WUCH 1BZ8A 2OR8A 3AQXA 3D85A 3BUTA 1BQ5A 4ODUA 4OZFB 1CJYA 2VLKA 4Z23A 3UJIL 3TU6A 4MNGA 2OSLA 4PY8J 4Q4EA 1MNNA 2Q76A 5K9QI 4KMTH 3TN0A 4HUVA 3QXTA 3TO4C 2GFBA 4OI7A 2CR0A 1EK3A 1QR1A 4L1BA 3VFOB 1EHXA 1G4RA 2HMID 4HKBA 2NMSA 7PAZA 5HHXH 5AZ2L 4FZEH 4E36A 1ETJA 1OM9A 4HHAA 1FZOB 2ID5A 4UT9H 5DT1L 2AJXH 4X6CB 2E75C 4PJFE 3K1KC 2CKBB 4LLUA 5FUZL 4F2MB 4Y4FC 3TT3L 3IGAA 1ES0A 4DZBA 4NUJA 3LHPL 1MN4A 3DMRA 2V5RA 3ERXA 2BP8B 5CN3A 5DRNB 1Z32X 1FGNL 3PXHA 4PVMA 4F5CE 2GAZB 1OY3B 5EIVA 4GBXB 1NLDL 5F7DA 2WCSA 3CMOL 3VU1A 3IJYB 2EVJA 4V1DB 3OXSB 3NGBC 1K8DA 2OR7A 4H0IA 4Q6IC 2V0AA 3IK2A 3FO9A 4M9OA 3L5HA 1SF3A 3ISWA 4J3VA 5HJ3A 2XFXA 2K8QA 4YHML 3FO1B 1H8NA 5DHDA 4XNZC 1TFPA 3QDME 4UDTA 5KSBB 1WCMA 3OG6B 4PJXA 3DX3A 3ROLB 3THMH 4TRPL 2WYZA 4I1NB 2QLVB 2QKSA 1PYWB 3B7SA 4CC4A 4GQPH 4YHZL 2VLRA 3EYFA 4WUUB 4YHIB 2E2HA 2RCSH 5D6CA 4N1CA 1YPZA 4HIIA 1VADB 1DVZA 3BLPX 4U6YA 4M1GH 3MRRA 5LN4A 4AE1A 4N85A 4AT6A 4CL7A 1P4IH 1UA6L 2XXFA 4FXKA 4NN6C 3EFFA 2QSVA 1WQVT 2HKAA 3K4DA 5CEZD 1NL0L 2FEEI 2R23B 3QJXA 4HIXH 2VDQH 3JBG7 4HD5A 3DHMA 4Y9EA 8FABA 3TJEL 3GBMH 4ZMXA 2XVKA 1KTCA 5T3ZD 3NA4A 5GGSA 2QJDA 2EDXA 3GJEA 4ONGH 4OM1H 2VXSH 1MJ8L 5FYJU 1FZJB 4M7LT 1IARB 4JN1L 5AALA 5LUMA 4DF9A 1JXFA 4Q0XH 1OIOA 1H3PH 3D34A 3HG0A 4I18B 2QEJA 4UILH 5BMFL 3U30B 3MJ7A 1DQIA 5GRUH 1I9JL 4HKZB 2NOYA 3RI5F 3UJTL 5FO7B 4ZMQA 3ZE2E 4OTXL 4O58L 2IANB 2FWLB 1MCQA 4Y4FA 5GZOD 3OMAB 4A55A 1R3LA 2ORBH 4NN7B 4HS3A 1OZUA 1OP5H 3BDXA 3BYTA 3B2UC 5DUMH 3FUIA 2BSEA 1CMOA 1CTMA 3VQLA 3N44B 1Q9OB 4IKNA 3ESMA 1YVLA 2CLVA 3CHQA 3RLSA 2W94A 3TA3B 3D33A 1J1XH 2FWSA 5ACMA 5INDB 5GPRA 1XIWD 4F92B 2IDUA 4PB0H 3SKNA 3U7YL 1O7VA 2W0FA 3P0YL 2DYPA 2EKSA 3UBHA 1HHHA 3L8QA 3VDCA 2R2HB 2APWA 4QKXB 5BV7B 3PDOB 3E3QE 4GO9A 4BWWA 4K8RL 1OP9A 3ZTEA 4PGEB 1M6OA 4B5EA 3O9WC 4GYBA 3FT2B 3U7WL 3ISRA 4KY1H 5G2NA 4BKTC 1E8YA 5I1IH 1MHPL 3O6FB 4JG9A 1K9TA 3DIVA 3O4OB 1SLWA 5GRWA 2XZQH 3BWAA 3PJNA 5FKPB 1YEKH 5GJSL 3DVGB 3LH9A 3T1FA 3WXWH 3N43B 4YAQA 1AO7A 4HX1B 1T6WA 4NZ8A 3V5DA 1RU9H 1KBWA 4U1NB 3O0RL 5DZOA 1LWRA 3ARDD 2HSIA 3GQFA 4XXCA 3ARQA 1OP3K 4GRLC 1ESOA 4Z95L 1BM3H 2NY0B 5DRXB 3S0PA 1SOXA 3WG7B 1LO2L 1YMMD 2VKXA 3RVVD 1GGCL 1WTLA 1ZSHA 5G4NA 1KJMB 1LXMA 5EPMA 4KBPA 4NKIH 4P23C 1KBBA 1ZT1A 1R3KB 4D9LL 3FB6A 5IVXF 3QO1B 3WMSA 2P8MB 4MNHA 3ZYIA 3QGVA 3GLZA 1IGJA 1MJUH 1U95A 2FWOA 2FRGP 4HT1L 4N90D 4F7PB 3GKWH 4G9FD 2QQKL 4XE5B 5C2UB 2FR4A 4I4WA 1FIGL 1S6NA 2VTFA 4MDIB 1IVLA 1KOAA 4CSTA 1DBAH 3IS0X 1XGUB 2ED7A 1WO2A 1RZKC 3PHSA 5GGVH 2WXFA 4PP1C 4C83B 1A6TB 3JWOL 3WTTA 3O11B 1UUNA 2ZUQB 3ARPA 1E6JL 3MRGA 3SPVA 2F53B 3HC3L 3B5GA 3FTXA 4FNPA 4FXGB 3UX9B 4E41D 4GKLA 5MP6L 1AXTL 2GJZA 5C08D 3W0WD 3QZBA 4LLWA 3HZYB 3F65A 4NJ9L 4DVRL 2HVJA 4GEIA 5I6NA 3VD2A 5F3HB 4TTGA 1AI1H 3DI2B 1GPOL 3FUMA 1R24A 4PJFF 5E2WH 2X0WA 1HIMH 2IC2A 4WZ9A 4NM8L 3DJZA 5T1KD 5IHUH 2P5WE 4NQCD 5ETUB 3IMSA 4RZCA 2JXMB 2R8SL 2XJKA 3KPRD 5HDLA 5INCA 5C0BB 4ZO6A 4O51A 4QWWC 2NPLX 4WHTB 1L9NA 4ZXBD 4TQPA 2WUBL 3UBGA 2GIMA 1YYLH 5CUSL 4Y16D 5EO0B 3RGVC 2FYYA 2J72A 4NOBA 3BCDA 3AZUA 3WIFA 2XICA 2XV6B 3BWUC 4UTBA 3WAJA 4APQA 4PJAF 4PJCA 4AL8H 1KXTB 3BKCH 3W39A 3IU3B 5DQJB 3FHAA 1FIEA 5TK4A 3A67H 5GIRA 1H0DA 4OCMC 2XTLA 2G75A 4MJ6A 2FECL 3FRPG 1B3IA 4KPHL 3TM7B 3WKNA 4F57H 1T1WB 3I75B 1KGWA 4PBXA 3MVSA 1DVQA 4AYMC 2CJSA 5GHWH 1M05B 4MA7L 4QT5A 4U6XA 2ICES 3MRNA 5E08H 2WBXA 1RXLA 4KNSA 4NRXA 4MLIA 5HPMB 3S7GA 5JYMA 2H1XA 3H9SA 4F8LA 4ONHB 2IEPA 1REIA 2MPAL 3HZVA 1E42A 1MFMA 2ZKMX 4HUKB 5D2NA 1ADQL 1D7CA 4KKLC 4NFDA 4L8SB 4JB9H 3FYIB 1FG2A 2EXWC 4IKKA 4HJJH 4L18A 4YHKH 4MCYA 5FECA 2ZICA 4JDTL 3FRPA 4Y5YB 4KAQH 3Q06A 1E5BA 1OAXL 4UV7L 1WFTA 2YSSB 1TNMA 3V0VA 1A65A 1CD8A 4W70A 2JIPA 4XPBL 4FNSA 4ZFGL 3C6LC 1MWAL 4UI2A 4OFPA 4CDGC 3LZNA 1FO0A 5E1GA 1S7SB 4JFDA 1BZDA 1OARH 1P84J 3ZJAA 2W0LA 3MOBL 1A0QH 2ZF9A 1CBVH 2NW2B 2F2HA 1QOKA 3FAWA 4ZYKA 1XCQB 2XT1B 1H3XA 1CZ4A 1AQMA 1SBBA 4YHPB 4YHLH 4U1HB 1PX4A 2XXMB 5J1SC 3BI9X 1OE3A 1SBSL 2E0PA 4WU7B 2XZCL 1A2YB 5EU6A 3MODH 5AOJA 2JA6A 1RK0A 1EEYB 3MNWB 1A6ZA 5C0CB 3LB6D 3QARA 3V0EA 5DWUH 1URZA 4ADIA 4IBWA 4W4OC 2OAAA 3IJ9A 3SDCC 2E7HA 3U1SH 2H6UA 4G3YH 3UYPA 4EBQL 3KR3L 4OF6A 3SE4C 1R7RA 4NX0A 2F8VA 4TMPA 1NA8A 1WWAX 3PREA 5EEZA 5AW9B 3GTJA 3LQZB 4Y2LA 4JVWA 3RDTD 1W72A 3GSXA 2FUTA 2UY7B 2IADA 4WDIA 1LNUA 1G6RA 3QR2A 4EXPX 4ZD3H 1E6OH 3BVNA 5E94B 3VYOA 3GI8L 3ULSB 5K39B 2QVIA 2YBGA 1RY7B 3VE0B 1CFQB 3W5NA 4BFBD 3FQ4A 2A6KA 1QSED 3S35H 1L6XA 1RZ7H 3TASA 4DUVA 1AACA 1S2EA 2W60B 1CLZL 4Y4KD 2YGNA 2XG5A 5I0VA 3IFPA 5IR1B 1S7XA 1M1XA 3KPSD 4KQ3H 3SOTA 1C1EL 1DN0A 2B3RA 4YBLC 2MOGA 5I2IB 4XX5A 4N2FA 3C6LA 5D96B 3SE8L 3DX9A 2G5UA 4GKZA 4TYUA 2NT0A 4X83A 4YXKH 4L5FH 2NUTA 5CJXC 3MV9E 1ZTMA 4QTIH 4Q4IA 5IEKB 3I6SA 1NMCC 4XC3H 4U6VH 1WAAE 4PS4L 1WV7T 1BD2A 1RKRA 3D51A 1KQFA 2GCYA 4KZDH 4BH8A 1HWGB 2ED8A 3L4WA 4G8EA 1NGPL 1DZBA 4ODBD 3KL5A 4CVZA 2N59A 2HLAB 4JHZA 3W9DB 3INUH 5D1QA 3IWUA 2EXYC 4MAYD 5ALCL 1GAFL 2WXRA 5BRZA 4ZMOA 3HS0B 3OSVA 1NDGB 1W8NA 1EDQA 1JK9A 1RURH 5BS0A 3H6JA 1I3RA 2L8AA 3WFBL 4L29A 1VZHA 2Q2LA 1TJHH 4W4OA 1IKFH 5DMGC 3TA4D 5JW4M 3RA7L 4D7ZB 3SDCA 1AC6A 1B6UA 1INEH 1ZA3B 3SE4A 3EF7A 3GB7A 2FBJH 3Q8FA 4DKFH 5IHZA 3OSKA 4XAWH 3UTQA 3WFEH 1H15B 1I1YB 3OC8A 3WI9A 3V0WL 3C8KA 5F9OH 4D0DA 2ZXWB 2WXPA 2F68X 4FULA 3WFDL 4PJIF 4W93A 1LP9F 1U8OB 2FDBP 5ICZB 1IEHA 1A4KB 3EH1A 4WY7L 1EAOA 1QQDA 5J3HC 3L81A 3MLUL 3E7JA 1MW0A 2F8IA 3KCWA 3L9RA 1J86A 3I85A 4MSWA 4NWUL 3KYKL 4XMWA 1BVLA 2NY5C 4KX8A 3RUGB 1H9DA 3VFRB 4LEXH 3QQ8A 1N64L 2AQTA 3GGWA 1U93A 3BO8B 3RWGA 2XN0A 2YPVA 1KJ2L 5KSAD 5I6XC 3WTSA 2HTKC 4Y19A 3KGUA 3UMNA 1VZGA 3AXLA 1YC8A 4AMWA 1IM3A 4A2LA 2QTVA 2ZJSH 4JHVA 4KKAD 1PLAA 4OLZH 3QEUB 3MLSL 4YZFE 2KQMA 4J1UB 4TNVK 3ULVE 1KY6A 2ZXAA 4LT7A 4R9HA 4HIPA 3DRTA 4NQXB 3UBXG 1G7JA 5I1GL 2I07A 5DMKB 3F7VB 1JN6B 4GIAA 4R0LC 4K2UL 2DMBA 2UZIL 3VD1A 4HUXA 3L4YA 4ES8A 1BW4A 4S1DD 1IO4C 3MJ8A 4JGNA 2OMXA 4N8PA 5IMLA 4HGKC 4LLVA 3VGDA 3BIBX 4PLJC 4ODHH 2Z34A 5KTEL 5GXBB 4GW4B 3MJ9H 2A77L 4MDJA 4NQUA 4L1HA 5JXEA 1U3ZA 3ULVL 1TG8A 5I1JH 4Y2DC 3NEEA 2WWOA 2W95A 5DLLA 4AM0B 2NZ1A 3T0EB 5CZXD 4X7CC 5L6YH 4Q56A 5KYWA 1PSKH 5FYLE 2H1PH 4M56A 2GI7A 1TTGA 1HXYB 2X4UB 1JPFB 1CIUA 3UBXA 4UF7C 1T22A 1DJGA 2OMTA 1OK0A 1Q72H 3CUPB 2D2CC 3FMGH 2DQTH 2G9KA 1A3LL 2Z93B 4M5TA 1YMHB 2OXGB 3BAIA 3T3MF 3VXRE 1PAMA 1FA4A 1I1AB 1EFQA 1MF2L 3I9AA 4Y7MA 2FATH 4MS8D 1RZQA 4N0CD 3MLWL 2D3NA 2P24A 3PPSA 2EC8A 15C8H 2OMVB 3OAYK 3QCUL 1QP1A 3X2LA 4Y0GA 1TTCA 3RQ3A 5FYLL 5I9QC 1A4JB 4PI2A 4FRWA 2L7UA 4QHLB 2FNWA 2YPLE 3I74A 3AT0A 2EH8L 1OGAA 4AGQA 2X4NB 2ESVB 3TOPA 4J6RH 3PWVB 5G5DB 4XVJH 4LCIL 4P4RA 5AVYB 4P2RD 1AGFB 1CYWA 4ADGA 3FU5A 4YSUA 4YSTA 3WJMA 3BUBA 4ZX6A 4I48B 1N2RA 1P4UA 4K3JH 2A0LD 3ARBA 3N9GH 1PVHA 2JB6B 5F89A 1K4CA 2VXQA 3P30H 2E6PA 4KX9A 3K8KA 2RBLA 1ORSA 1I9IH 4R8WH 3CVIH 4TQEL 3U46A 4E42B 3LPGA 3MAWA 1ICTA 2GJ6B 2CM6A 4N2AA 5TFSH 3SOBH 4PJDA 3BAJA 3T65B 4MB5A 2NVYA 1ND0A 3UG3A 3ZRCC 3HHRB 1WWWX 4HMDA 2P45B 4LVHC 4FQLL 2UZYA 1EXGA 1AGBB 1LO0L 3WENA 2RALA 1KBGL 4XBEL 4Y2DA 2YAOA 2PO6C 4LU5L 2LU4A 2Y25A 3DOIA 3QG6B 4MD4B 5ITBL 2NQCA 4S1RH 3TO2B 1PX8A 5LG1A 1BGXH 2R2BA 2A2QT 3H6AA 4PVLA 3BZDA 3TBWA 2DQGL 4Y1AA 4UOW1 5AWNL 4PRDB 4IBUA 2ROYA 2WO4A 5T33H 3BOVA 3IFLH 4JQIA 1INDH 4QRUA 3WGUB 3ZDWA 2NX5B 3OF6A 2WZPD 1WAAF 5GGQL 1MHCA 1PEWA 2Z4QA 4N8VB 3HCVA 5DS8B 3VCLA 1FVEB 3PHOA 1P4LA 5T1LA 4UTBH 5JW4R 3KPOB 1DJZA 3O3DB 1KBKA 3VSVA 5HYSB 1CI5A 4ZW7A 2CUIA 4IRSC 4E9YA 5JQIB 3WHE1 1A9EA 1Q4NX 2XWEA 5C0AE 1QSFA 1MFUA 1UOLA 1NPUA 1K5WA 3SDXB 1CLOH 3RYMA 3F7QA 4JPWH 1BXUA 1LO3L 3F04A 3HE6A 4A6YA 4HZLB 4X5PA 1G7LA 3MBXL 2RIKA 5K59E 2EIEA 4FX5A 1FNGA 3LN4B 3VXSA 2RACA 3DXAD 3A6OA 5DD1L 1RZKH 3PWJA 2YUJA 3KEHA 5FO8A 1OLZA 4JANB 4WWKD 4M5ZH 3T8MA 1PTZA 4Z7VA 1L5GA 2YIHA 4TVPH 1MFCL 3FZUC 4AEIH 1FV1B 1U21A 3ZZQA 2PWDA 4P9MH 5EBWA 2BZ7A 1W80A 5KAQF 3G6AB 2YOAA 4GP8B 3BH9B 1BLIA 4JFQA 1Z9PA 4J5VA 1Z6JT 1HSBA 2F54B 1ZKAA 1J1OL 3GZKA 3V6FA 1A02N 1AOZA 3TNMB 1N67A 2QZQA 4HETA 2YSTA 2YMXL 3OGCB 3L3IB 4HCFA 2IAAC 1WFIA 1FRGH 1AY1H 3BKJH 1QBML 4LMQE 1UWFA 4GW5A 1VF5C 3EO1A 2PO6A 1O7DC 3BKYH 4FE9A 3O6LH 4FG0A 4LHUG 3F3HA 4IK7A 4YWGL 1MLCB 5C09B 5TE6H 3WEAA 1NC2D 4K3DL 3CZKA 1FNSH 4U3SA 1AS8A 3V4LA 5FTNA 1FO0H 2W0KA 5FUOL 5CCKH 4QHMA 4P9HC 1JUFB 1SHWA 4YNYB 4Z18A 3SJVA 3D0LA 1JGUH 5C0FA 1MWOA 2X09A 5EUOE 2PYED 3P73B 5EZLB 5CZVH 3FUKA 3HJ0A 1JWUA 4FTVA 4LLDB 3VQMA 3OB0H 1NFIA 4K3GA 4NPJA 3OX8B 4TLSA 5SWZB 1JZ3A 4J3OD 3SBQA 4IRSA 4U33A 2KI6A 4PJ9D 5JUEH 4JO1L 2J4WL 4YDZA 2J8UB 2J25A 1G9NL 1KT2A 1KIRA 5GGTA 2FL5B 4XN7A 4L4TD 2FJGA 4LOEA 2HX8A 1YNLL 1CI3M 3PF2A 1VCBC 2JKXA 3N43F 3NSDA 1E7VA 5D7IB 1JVKA 1S7TB 4K23L 3KCPA 5E0QA 3WU1A 1ZS8A 2QQLH 5FWRA 1AXSA 3B3IB 4NHCH 3T8XB 1IMHC 1Q9LA 4WTWA 5I16B 3WUZA 4LPYA 3NJIA 1FC1A 1W72H 4G7SB 2YRLA 1G6RH 3IRPX 2LW3A 4JHWH 3ML1A 1ZE3H 3EHBC 4YSEA 3OLIA 5CINH 4DNLA 4P5KA 4JZJB 2JIXA 1S5IL 2Q5BA 3EFOB 4EVNB 4GUQA 3BAXA 2V3EA 3HI1A 3UZEC 4MD5A 4M93B 4Y9FA 1T66D 3CDZB 3RY5A 5I74C 1VFAA 2Y07L 4QO1A 5IK3A 4Z7NB 3G9VA 2I5YL 3H7BA 4PJBE 4M5SA 4P2CG 4KNTA 4X7DC 2BHYA 4GOSA 2P7TB 4DKDC 4M03A 1IBGL 2EIKB 2VAAB 2WKLA 4ALAH 4MWFB 1Z9MA 5C6TH 3EOTL 4P06A 4ETQA 1MCHA 3I2CH 3X3FL 4FG4A 4C56D 3TIEB 1WDAA 2JKLA 4PV8A 4DAGH 1F6AB 5JHDB 5I75B 1JF6A 4HYTB 1RJZB 3LXCA 3LNIA 1HKLH 2R59A 4MBOA 2CZNA 4FA8A 1CF8H 1D3CA 1L7IL 1UZ8A 2Z7YA 4IJTA 4JFYB 3RTQB 3ZGHA 4OUOA 3BP6A 3EGSA 2A1WH 1NCGA 3PDGA 5AYQA 4JUTA 4MA1B 4D0CA 2FEJA 1PKQA 4ZPVA 1EXHA 2WN3A 2OM5A 1YUHB 3EBAA 1BMWA 1L7TH 3PP3H 1WFMA 4KDIA 4YDVB 1L9OA 1HCYA 2DWTA 5GS0H 3WHXB 1SJEA 4A2FA 2O5XH 2GUOA 3TVMC 4JM2D 1JNNL 1UM5H 3QQXA 5AKVA 3W9EA 6PCYA 2X0VA 2BSSA 4PRIB 4PW4A 1EEZB 4XRCA 5I15H 1T1YA 4M7KL 4LFHD 4X98B 2W92A 4I3RL 5IGXL 2FX7L 1AD9B 1HI6A 5JIPA 5D6DA 2HWZL 2Y24A 2WMPB 1G1OA 3BLKA 3QUYD 3I9IA 1DQQA 1ZLSH 1QKZL 5E8EA 4PJ7A 1FFPB 5KJ7E 1BJMA 3TEWA 2WK2A 4PR5A 3F84A 4RGOL 3R8QA 4KJYB 2PLTA 2Z31B 5JQ6L 2V9QA 4JDEB 3SE9L 4PLNC 3ZE0B 4GBXD 1JMXA 3SE3C 5CEZE 3UZEA 3WE6A 4XX1G 5E9DD 2MHAB 4HU2A 1EX0A 3QUZB 5E6IB 3T09A 1ZVYA 2YPVH 2IFFL 1OP4A 2I60L 2EIDA 3FB8A 5L4MA 3HVNA 1HINL 5T3ZE 3O3BA 4L1SA 1ZIAA 5FUCC 1IRAY 4I77H 3LEVH 5EHFA 1OTSC 4PREB 3FB7B 4DP6X 1DQML 3FU9A 5DC0A 2AKRB 5CEXB 4HHGA 4XMLL 1UC6A 1KG0B 4I5BA 4X0KA 5I73B 3OKNB 3IDGA 3MCKA 3MRMA 4IIQC 3UPAA 5EOTB 2PCFB 1XGZA 5CEZL 2JKIS 5F3BB 1XH3B 4XCYA 4WUUD 3QQ4B 5E1AB 4NRZA 5IFJB 4ODWB 3VRJB 4WO0A 3POHA 1FYTA 1S5HB 4NKDA 1Z9NA 3VFSB 4Z7AA 5T3ZL 1BWMA 1GS6X 2MKWA 1EANA 2ZG2A 1R5VB 3EFDL 3O4LD 1ZLVH 2AC0A 1MHHA 2IPTL 4HQQL 3W57A 3SD2A 1OAKL 2R69A 4GUPA 4KI1A 4J27A 4KI5F 3C08H 1P0SE 1PQFA 3HBZA 5JIMA 4L3FA 1D5XA 3DRQB 4JDZB 1M57B 3RI5K 3FCTA 4YFLF 2FHCA 3ME0B 2QHRH 4R2GD 2XX1A 5F7NC 1M7IA 4U0QB 3S88H 4NO5A 5TF1H 2X2JA 1F58L 1LO4L 4WUKL 4TTDC 3A21A 4HAGA 1DVFB 3HJEA 5J4MA 1WBXA 3EJZC 3I3DA 1NSNH 1J7VR 2ZOWA 2N0KA 4EN3C 5E2JA 5EIIB 1DSFH 2FEEL 1U8KB 2OYMA 3VXTA 1AG0A 3IM1A 3CFEB 5DGQA 2CDFA 3B5HA 2ADGA 1HL8A 4LP4A 2ZYSA 3DV6B 5ESQA 3GXIA 4I9WD 2FX9H 1XB8A 1MFDH 4QRPB 4AQEA 4CKVX 2A9DA 1MVFA 1RVFH 5LGYA 5BRPA 3GUTB 5EBMB 1A6VH 3UPRA 3GMNB 4S1SL 5CP3A 4CNIA 3HG1A 1FF5A 4RGNC 4ZQTA 4YDKL 3OKMA 2FSDA 1U8MA 1RP9A 2FUQA 2PCPA 1KTDA 4N90E 2O61A 3IE4A 1SYSA 3EH4B 4HWUA 2XWBB 3NIFF 4G9FE 4P3CH 4JFEA 2E4TA 3WKYA 4WEBH 1Z9OA 4M8QA 4DQOH 1R4XA 4O2FA 5M94B 2VXUL 3H3PH 3HU1A 2BJMH 3GSRA 1QAWA 1FVDB 1AGCA 4M6MH 1YY8B 3S98A 3EGXA 1Y4ZA 3EIFA 4LSSH 4OZGB 1N0LB 5L9DL 3BE1H 3IDJA 2V9UA 5J9PB 4K5OA 3FUFA 1H5BA 3G5WA 1AC0A 2K9UA 3MGOA 4E41E 5I8CB 2EE2A 2OL3L 5C08E 1KCUH 3DDFA 2OYPA 3W0WE 2WBJA 4MNQA 4AQ1C 2GK0A 3D39E 1LK3H 5KYYB 3CN4A 1AE6H 2CPUA 1HC1A 2PI8A 3K6SA 4MMZA 1BXAA 2JCCE 3FT4B 4CW1B 4L0YA 2ITEA 3MI6A 4XTRD 3QEQA 2F0CA 1XCTA 5C0JB 2NY3B 3V6ZB 2HYMA 1CWVA 3P69A 4NQCE 5CU5A 1ODUA 1G84A 5H2BB 4JQIH 4JCLA 5EU5A 4JFFB 3U0PB 4RAVB 2OSYA 4F2FA 4F15C 4H88L 5ADOH 2FQGA 3QEHA 3KPRE 1F4YH 4CU8A 1Y07A 2OMZB 3PV7A 4EN3A 4TV3A 4WW2C 3DROB 3QFJD 2IVFC 4I2XE 1NCWH 2LFGA 1YEFL 3D9AH 1B9ZA 2X70B 1U91A 3M7FB 4NIKB 1KIQB 4OJFH 2HVBA 2VDKB 3B34A 4M6NL 2PICA 3QZMA 1MFAH 5JXAH 1MFEH 2PW1A 4A6YH 4WSGA 4C57C 1OTUC 2JKWA 3NJMA 3PWUB 2DQUL 5DSCB 3QCVH 1BQRA 2YD5A 3GMQB 4DVBA 2DL2A 3GRGA 1J48A 4BD4A 2ZOKB 5HYFA 4PVBA 1KWGA 2EYRA 3QUXC 2FB4H 4LDOB 3ATEA 1IEBA 1YC7A 3HPLB 3QIBA 1KXQA 1NCTA 2DDQH 4KDTC 1IM9D 1B4JH 4ONFL 1U8HB 3EOBB 3UIYA 3E2HB 1GGBL 4ZDHB 4X9IA 5CLWA 3RL1A 3LSOB 4NBXB 4HG4J 2HFEB 2CBQA 2ENYA 1YY9D 3Q5YA 4APXA 3RUGF 1JK8B 1UTDA 1XGPA 3QDJD 3EBGA 3Q0HA 3G7TA 4WRLA 3DX4A 4Z0BL 1M42A 1HKFA 3DHPA 2IV8A 1X7SA 5BOJA 3VGEA 4WHYH 1NKRA 2XG4A 5E8PA 4LO9A 1KTLA 1R3HB 1JYVA 1W0YT 3IRCA 3X13A 1MRCH 5IB4B 4P2OD 5DJAA 4HCRA 5A7BA 4MD0A 1XO8A 3SEPA 2NYAA 1TMOA 1ZYRD 1M7DB 4XVUD 1UCBH 2BMKB 4TPRL 5MERA 4HJGB 3EKCA 1KPVB 5AW7B 4MDRA 2H5UA 1OGPA 4JPSA 3WXVL 2DI7A 4KKAC 4R5XA 4LCWB 5IVXA 3G6DH 2B5IC 3S36H 2OFQA 3MUJA 1PMYA 4M48H 3ALPA 4NQVB 3VUAA 1E0OB 1ML0A 4YLQT 5DURD 4U49A 3OWEA 4O9HH 4DGYL 5C92A 4A39A 4NZRH 5EPPA 1SMDA 1KLFA 2OMYB 1C8QA 1LE5A 2KH2B 4LSQH 2OCCB 5J7CC 4GKSB 4QEGA 1SDAB 1SXNA 4NKOA 1MRFH 3DV4A 4JAMA 2NXZB 1CDGA 1ONQA 3J2PA 1FG9C 4UNIA 5GGTH 3F7KA 4NZUH 2ZUXA 3VU2A 3W3BA 2VO5A 2ATKB 5AAWC 2ZCZA 1F2QA 4AK2A 3WFZA 3CBRA 4JE4B 4EDWL 4XHJD 4Z7WE 4ZNCD 2L3BA 5HYJB 5EEXA 4KROC 4JW3A 1JV5B 1K2DB 2FX8H 3AREA 2XWCA 5BVPL 4X6FB 2AK1H 1CD0A 1E28B 1O9WA 3V0IA 1Z9SB 2XN9B 3VFMB 4IGBB 4PJFA 3LMJH 4ERSL 3RB7A 3QORA 4QJ5B 1N10A 4M62H 1QACA 4UWQB 1T4WA 1XGRA 4MQ7B 3SDDA 5B4MC 4WI6A 1NCCL 1L9TA 1TJGH 3NEXA 4RFOL 2IPKB 4B7LA 2CLZB 2OZ4L 3M88A 1VKXA 4IHOB 3WN5C 1BREA 1KYUA 3T71A 4HP5A 3AABA 4OAWB 4G43B 5F6IC 4Y9CA 2WBWB 3ATFA 1H3UA 1TQTA 4FYQA 3DJSA 2I32A 3U2JA 2A6DB 5DA0B 1W0VB 2P47B 5F7YC 5IW6A 3MLYL 4PJHB 2X4TA 2JH2A 1QSEE 3P9LB 1R27A 4R90H 2DZEA 5DUPL 1JZ7A 4PJAA 4ABUA 3A22A 5ISZA 3N1PC 1MZZA 5IROD 2G5DA 4P3DB 3O3EA 4PTTA 3IKKA 3MRPA 1C5DB 3KPSE 2AJVL 4UIKL 1V3KA 3NP4A 2B0SL 4CAGA 3T0DA 1Q9WA 1PLGL 1AJ7L 2A0LC 4XB8A 3B9EA 3TZVC 1GC1H 4XGZB 3EDKA 1DJIA 5SWSB 1XDTT 3PGFH 4L3EB 1MI5A 3RPKA 2RA1A 1QI3A 3EG9B 1QBLH 2DYSB 4G2AA 4E9QA 3VXMD 4Z78B 2NLJA 5JNYB 3JQOB 1RI8A 2YEVB 4NJAL 1UEMA 3OKEB 3QYNA 1BF2A 4U1SB 4ZUUA 1A7NH 3HC0A 2JCCF 4KHTH 4DTGL 5B38B 2YBRA 3CFKB 5JO5B 4BKLA 4OGYL 1N5AB 3G5XA 2EVFA 3QWZA 1E7UA 3FCUB 4Z7QB 1MDTA 1L4IA 3PNWB 3V7AE 2BCKA 5DVOA 3IJEA 4LVOC 5IFHH 2D03H 3L3OC 3MXVL 1Z3RA 5DO2C 4JHAH 2NQDA 3SE6A 2YMOA 4YLBA 1G7HB 1E43A 1IGTA 1QFPA 3GI9L 2HA1A 4JGJA 3MV7B 4XPTH 3RX9A 3IE9A 5IOPA 1BFVH 5DK0A 3KNBA 1EUUA 1HDMB 3T08A 4CJ1A 1XGYL 4CN6A 1RZFL 1QNZH 4LPXA 4ISVB 3LKPA 3SDXF 5FHBL 1G7QB 3VYPA 1YYCA 5L2KB 2WQXA 1FDLL 2VDMH 5H35B 2DY2A 3DJRA 1GVIA 1B0GA 4AYEC 1OAQH 1OAUH 4F7TA 5HI3C 1AR1B 1O9VA 1HZKA 4YDNA 4LRNH 2UY6B 5FGRA 1JWSB 2RR3A 1FHGA 1MREL 1YYMH 2VABB 3HLAA 3HVDA 1F42A 2VZ3A 4OZIE 1TZOA 3OJMB 1ETA1 1NCHA 4HJSA 4X6BB 1T2QL 1HS6A 3OHXA 3MRFA 5KUMA 4R4ND 2P8LA 2Z8WC 1DFBL 1NAKL 4KKPA 1QPKA 2V37A 1ET5A 4JPQA 1TZIA 1EAJA 4WEMB 1E9PA 1CD1A 1UM6H 2LT9A 3LEXA 4EDXB 3VFPA 1D6EA 2V7HB 2YUVA 4NNYB 4ODTH 1N5YH 3Q7JA 4YXLH 1L8FA 2PCXA 3KMDA 1NAMA 2R69H 4PGBA 4LIQH 1P1ZA 5I71B 2DWYA 2IV9A 3NFSH 2HRGA 4HFUH 2I7OA 2VDQB 4OZ4B 4GG6B 3QQ9D 1KMGA 1HWWA 2EDLA 1JHKL 3P0VL 4WQOA 4XCNA 5I76A 4KITB 4P5MB 1M2OA 4NQEA 3TPKA 1IGIL 3VFVB 1BWWA 4U1KB 3U4KA 1FBIL 1SOSA 3L4ZA 1AH1A 4ZTOH 1VENA 1EZVY 1THCA 4PV9B 4KTDL 4ODXB 1K6QL 2JLLA 2NY4C 2QFRA 4YPGB 3H4FA 5IESH 5L0QC 3O8XC 4HIEA 2VN3A 2QMKA 2ARWA 4WO4B 3NVQA 2PTTB 3D25B 5GJTH 5KSVB 5DC2A 1KCWA 3T6QC 4CKQA 4L8BA 1XXFC 2N0MA 2XIDA 1TJXA 4AXWA 4LBAA 4YFDB 2C7UA 1ZANH 3HFML 4BQ8A 4WWPA 4FL4B 3AY4C 2A9MH 4TL5A 5CHNA 1DLFL 1MCOH 4K94L 3ZK0A 3QXDA 5AVZB 4KKRA 3MRQA 3LQMA 4DN3H 2WQVA 2DQEH 2J8UF 2NT1A 1CK0H 1E27A 3S4SG 4UNVA 4RA3A 1UB6B 3ATDA 1OOWA 3RVUD 5KS9E 5CP3H 2FO4B 3OZKA 4QYAA 2V8MA 1S7QB 3KXFD 2HB0A 3D1MC 3NJKA 1W91A 2C3VB 1D7FA 4ZX5A 1HCVA 3P4NA 3KYOB 3P77B 1G7PB 2VUYA 5ALBL 4HC1L 4HJ1A 2Z7UA 2VC2H 4MCNA 4MRBA 5I1AA 2G2RA 4UM9D 4AQOA 2P5WA 4RX4A 3QB7C 4P2RE 5H94B 2JQAA 5HHVH 3RWDA 1K85A 4BYHA 4Y8DC 5TPWH 3V0DA 5I23A 3BH4A 1B0RB 2QV2A 1JHLL 4AIXA 4HBCL 4YSOA 1FL3B 4XC1H 1SHSA 2R0ZH 1U3HB 2AEPL 3NCWA 5EC1B 5GGRY 3RVTC 2AQ1A 4M7ZB 5LNDA 3S4SA 3BQUB 4X9BA 2HJLA 1NM4A 4Z7NF 2ICWA 2ZX9A 3RFRA 2VQ1B 2IALB 2JJWA 4ZAKC 3X2NA 2C9RA 3MBWA 4XXWC 1S78D 5HHPB 2W9DL 5JZ7D 1F2XK 3BAYA 2D8KA 3V0AC 3O5AA 4R7NA 1KPUA 1P5UA 2RJMA 4ICWA 2FZ3B 1PG7X 4OZHB 4W9ZA 2DLFL 5JW5B 2V5MA 3VG0H 4XPHL 1FL6A 5TDNB 4PJIA 1LP9A 3HN3A 3RWHA 1MCWW 3MXWH 3P4MA 4BRJA 3ZDYB 4QF1A 2ZSVB 1JGDB 4X99B 1QZNA 2XNAA 4P2QD 2JLPA 1XF3A 2ESVD 2VM3A 4JY4A 2NVXA 1KCRL 2CHDA 1I85C 4M4PA 3RVXC 3CSYB 1F90H 5FDWA 1EU1A 4JO5A 1OCWH 4TNEA 5J11C 2ZWSA 4A7VA 2IBGA 2NY1D 3P3UA 2J5LC 3LNGA 4FZ8L 4I0KA 4NCDA 1U58B 2WSDA 3ZTCC 4EO5A 3QR1A 5L4FA 1OGTA 3CZEA 4MKTA 3T9WA 3W56A 1E9QB 4KJPC 5AW2B 4IRJA 2GQHA 3MU3A 1DCLA 1NWPA 1QRND 5TE7L 3A4AA 5ELIA 3M6DA 1CXHA 3OXRA 4WU5B 4PGCB 3L2MA 3GSQB 1MWAA 4LSRH 3BFWA 3DVNA 4UIMB 1TOXA 5IKCB 3KLHD 5CWSB 1RPQA 5BQ7B 5JPNB 5T5NF 3UPCA 4KLNA 2BVPA 4OLVL 1A4CA 3ARTA 2I9LB 1NOFA 1SN0A 2WV3A 1Y1VA 1LD9B 2Z3FA 1EXUB 5IM7B 1SPDA 2R1WB 4P46B 3CSPA 3CFIC 4L9DA 1HYSD 3GXTA 3KJ6L 2WLLA 3L5XL 1ACYH 1ZMYA 2XI9A 1YEWA 2WCGA 4ZI8A 1DQLL 3DXAE 3ZQ9A 1UURA 5IBUB 1EMTH 3UO1L 1WICA 3V6OC 2JA5A 3BWSA 4XCEB 2OK0L 1ZGLM 2CIIA 4K5LA 4XP1L 5J6GA 2NXYB 1GW6A 1GGTA 4U7SA 1MVUA 4QRQA 1WE5A 4NYLB 3RVWD 2VDLH 4GBXC 1S3KL 5E03A 1MNUH 1UXMA 2EH7L 3OV6A 5DO8A 3T4AA 4JRYA 5DD6B 1J10A 4HCRH 1J0KA 3AROA 3WD5H 5MEQA 2DMCA 2ILLA 1WBYA 4FQHA 4I87A 4GAJH 4OZIF 1MIEL 4GIPD 4OZFG 1JPTH 4KOBA 1WIUA 4NZFA 3TLRA 3QIWB 3CN1A 1MDAA 2NTSP 1LEGB 4LKCB 4ZSOE 4ZW5A 4QNPE 3V0FA 4LSTL 4AW4A 1U92B 4TULL 3LZRA 4DFIA 2BWDA 4ORGB 1E4JA 1JMZA 4NQDA 2CO6B 4FJZA 2H7WA 3KHQA 1XGQB 4POUB 1E32A 2BXZA 4UM8A 3NCJL 2VR4A 1UGNA 5BCAA 3SDAD 2J12B 3QPKA 3TIDA 5AZ2H 5DUJA 4H8WC 1FZKB 3ZT6A 3DURB 3F7PC 1GR7A 5DT1H 4C8XA 2PYEE 4RQQA 2EO1A 4U4IA 5E9AA 4BWUA 1KIPA 2V8LA 2CDEB 5A6MA 5FUZH 1CDUA 4JR9L 2A68D 2LLNA 2WIIB 2VUOA 3TT3H 4OZFA 3LHPH 5CSZA 3HG3A 4HJIA 5ICXB 5BJTB 3K71B 1FGNH 3IFNL 1NLDH 2D31B 2EVHA 4L4TE 2COVD 3CMOH 2K7PA 3GTMA 3NK4A 3UTTB 3U1QA 4I18C 5DCCA 3U30C 4E0RA 5E7BA 1HZLA 1O5DT 3UABA 3UGUA 1ACZA 5HVWA 4PGDA 3SYAA 2CKBA 2VQTA 4QKTA 2OYLA 4ESKA 2DBLL 2X9XA 4YHMH 4NN7C 4WFED 4NCC1 2BP8A 2F61A 1AZUA 5DRNA 4HJ0D 4BE6A 2GAZA 3MV9A 3EJYD 4TRPH 1A22B 1R34A 4YHZH 3TA3C 5E1HB 4HF5L 1VEOA 1K8IB 4V1DA 2WQUA 5HHQA 1D2OA 1WAAA 1IJNA 2YWZA 3CFDB 3F5WB 4PPTA 4WI5A 4Z1PA 4N5ED 3Q8AA 1UJ3B 4M43L 3LH2L 2GTWB 3ESVF 1UA6H 4WFGD 4FNQA 5BV7C 4IU3B 2Z1PA 3ILPB 1WFJA 2AEIT 1QW9A 2VJ8A 2VZSA 1NL0H 2Z64C 3FO1A 5DVNA 5KAQG 5CZKA 1RFDL 2BNQD 5TDOA 4HPYL 2BWQA 1KLUB 3GJFA 2MKLC 3O6FC 5FGBA 3TJEH 3OUGA 2NRDA 3O4OC 1EZVX 3I6KB 1U3YA 5ICYB 5CD5D 2JB5L 3ATAA 4UB0L 4YHIA 2J56A 1MJ8H 1U9KA 4G5ZL 2P5EB 1E2ZA 1OKEA 4YSDA 1VADA 2JKRM 4JN1H 4C56E 3TESA 2CGZA 4WWOA 5BMFH 5GRVK 4F3FA 2K6ZA 1KJ2A 3ZDXE 1M7XA 1I9JH 2EYTB 2NY0C 2KQAA 4OTXH 4OI9A 2R23A 3D85B 4O58H 4ODUB 4F1SA 2EEFA 5EO1B 2OSLB 2Q76B 3BP5B 4HUVB 3KGTA 1R33A 1F4HA 2GFBB 4B3VA 3HUJE 1QR1B 4FS0A 4FLQA 3MBED 4HSCX 4MBRA 4W6YB 1K5NA 1W9XA 1TVBA 2V2WA 4HWBL 4PHXA 1CTOA 4HHAB 3PAZA 5HYEA 1ECYA 1VA9A 4UQ2A 3DETD 1PL3A 1T7WA 2C4FT 3LRLA 3P0YH 4Y7OC 3U7YH 3PJLA 2R4SL 4HDIA 4HKZA 1I1CA 4LLUB 5FO7A 4FQ2L 4AQAA 1T2XA 3IGAB 1K4DB 1FDOA 4J4PA 4ODSL 1ES0B 4K8RH 4N0RA 4X6CE 1G87A 2VITB 3U7WH 1MHPH 1DMSA 4I9XA 1Q9OA 2BY1A 2ZUQC 1I8UA 3RX5A 5F7DB 1MCRA 4AVHA 1KB5L 3H7LA 5DJ8A 3TA3A 4FXGC 1MPAL 1K8DB 4HD9A 3DYOA 5TK2A 3FO9B 5GJSH 1E5UI 3CK0L 4P59L 1UA3A 2X89D 4CSSA 2PPEA 3O0RH 4PSPA 2XFXB 5E9DE 3NAAL 3PDOA 5AL0A 4RA0C 4Z95H 2CG9X 3QZPA 5FWQA 1LO2H 3KWUA 5JIDA 1GGCH 3T3PB 1JRHI 4UDTB 3FT2A 3DHJA 3SGKA 4ELME 4AIOA 4Q2ZA 5KANI 4D9LH 2GBTA 2Z92A 4AKOA 3K81A 2EC9U 1HT6A 2VLRB 3EYFB 4FKKA 4HLZG 2BVQA 3GK8L 3NDYE 1SNRA 5D6CB 4N6QA 1YPZB 3DNKA 4EXKA 1CGVA 4AT6B 4HT1H 1ROWA 4OF5A 2DL9A 4WUUE 2A7BA 2QQKH 4FXKB 1NAMH 3CXDL 3CQFA 1TQBB 3EFFB 1GGIL 4POZD 4RNRA 4XPGL 4ZTEA 5AW8B 2X9ZA 4YE0A 2ENSA 1FIGH 5JHAA 5BO1L 3PABA 4PBVC 3VXRA 3WYRA 3O4LE 4GG8B 3VXOB 2CIKA 4UT6L 1EFXD 1P9MC 3LCYA 1R3KA 2MCPL 4HH8A 3JWOH 1NOLA 5GGSB 2VB5A 3OG4B 2DPKA 2VXVL 2LABA 1NC4D 1E6JH 3HC3H 4CADB 3QUZD 4F7PA 5MP6H 1AXTH 2WZ5A 2HPTA 4X5WA 2YPLA 3MJ7B 1MCSA 2ZE0A 4NJ9H 4OGAC 2HT4D 5AUMA 4DVRH 3EF4A 3CFBA 2YZ1A 1JZ6A 2XKNA 2H32H 3EBIA 1GPOH 1R3LB 3X1NA 2QL1A 4HS3B 4LEEA 3TC9A 2QADD 5JW4N 4HS6A 4NM8H 4QRAA 2LE9A 3ARFD 2CLVB 2ATAA 3O11A 3WOVA 2IIJA 4TUKL 3FFDB 2F53A 1GGUA 2Q9OA 2R8SH 4FXGA 3VXUD 3Q9PA 4L8SC 2DN7A 3WDIA 2MOVA 1NINA 3V52H 3IXAB 3GIVA 5G55A 3SKNB 3BRDA 2W0FB 4X6EA 2DYPB 1VERA 2EKSB 3HZYA 1HHHB 2WUBH 4I9WE 2UVEA 4GRWE 4XHJC 3ROOB 5CUSH 3K74B 4M1DL 2VPYA 3NESA 3ARVA 2OSXA 4Y5YC 4G72B 1M6OB 3PL6A 3I6LD 2SODB 2UV3A 3F83A 3AACA 2KBGA 4ZMNA 1DVXA 3SGEI 1FVCA 1KACB 3FUNA 4KI5C 4QRSA 3R4DA 3ZKMD 3BWAB 3Q01A 4J3XA 1G8KA 1PEZA 2OPCA 4DGIL 5CGYD 5EOCJ 5C0BA 4YAQB 3RKPA 1AO7B 4WHTA 4IDJL 3V5DB 2WXJA 4KPHH 2BX5A 4XP5L 1Q0EA 4WSKA 3L3GB 4JS7A 4Q9BA 4WI0A 1D2PA 4MA7H 1D7BA 4HJEA 1I53A 5EPMB 4HLJA 5GS2H 1D9KB 3D2UA 2EZ0D 1SJHA 1B3JA 3ZRSA 4PY8I 4JO4L 1P6FA 3MUZ1 4OI8A 4MNHB 5FGCB 2AANA 3TTYA 1IGFL 2PKDA 2MPAH 2FWOB 4NUMA 1U95B 5KVGE 2CRZA 1ADQH 5E23A 1JVOA 4Z5RB 2NZIA 4XNUL 4KVNL 1T1WA 2ICCA 2FR4B 1TCRA 2ZUUA 4I4WB 4UYPA 5HDBB 1QBBA 4LF3A 2EDTA 4JDTH 2VCOA 3OVUB 4P0DA 4KK9D 1OAXH 2CHZA 4UV7H 4D7BA 4JMNA 2AFNA 2VH5L 4NUGL 1OCCB 2ATPB 3MRGB 3SPVB 1A6UL 1S9XB 3QFJE 4XPBH 4ONHA 2QPFA 5C2BL 1SXZA 3N0AA 4Z7QF 5KVGL 5FGSA 2GJZB 4ZFGH 1NIAA 4L8SA 3ULAB 3W38A 1MWAH 4FQXA 4LLWB 1XEDA 1DQJA 3BDYL 1DO5A 1WFNA 3POCA 5A2KH 5I0WA 5HYIA 4WENB 4G6JL 4HPOL 1OF2B 2LR4A 4Y5YA 1AR2A 4MXVE 2ZAGA 1UKSA 4WWNA 5C97A 1T5WB 3SYPA 2CXKA 4BSJA 4A7TA 4ANUA 4UBDC 2A73A 1OTTC 4RZCB 4GI9A 4OD3L 3HIZA 1I8IA 3TCLB 3SB3A 2OKMA 2BNRB 1G9HA 2X3AA 5D96C 2XZCH 1JD7A 5DR5L 4IRZL 1ZLWK 2E9IA 4GQRA 3BP4B 5DA4A 2APTA 3MRJB 5CCJA 1USZA 2WTPA 3VI4E 4N24A 1EGJL 1XCQA 4MVBC 3N85L 3QDJE 2K78A 3R0MA 2WB7A 4EBQH 3KR3H 4APQB 3F7YA 4PJCB 2VXTL 4YHPA 1TSRA 3RIKA 4NC1E 5TJWK 3W39B 2P52A 1RZ8A 2ZWNA 3AWFA 3MC0A 4R4FL 1CE6B 4G8FA 1LEKA 2ZKYA 2XJLA 2DD8L 1CFVL 1RL1A 4WVRA 1A2YA 4ELMF 5C6PB 2DWEB 4B0MM 2WLJA 2G75B 4MJ6B 4FAAB 3HS0C 3UCRA 5ENWA 5A2IH 3U2IA 2HN7A 3GI8H 3K2KA 4B50A 5GZNC 3HB3B 4QT5B 4U6XB 3BZ4B 3MRNB 3F12B 1HH6A 3DBSA 3CU1A 2YD9A 4DT2A 3JWDL 2E7DA 1J1PL 1NH6A 4NRXB 3CHOA 4AV5A 4V2BA 5B1BB 4Z77B 1JZ8A 1CLZH 3E8UL 4FYSA 2OXHB 3H9SB 3VFWB 2EE0A 5E00B 5IV2A 3HZVB 4ZS6D 4GG6F 5D2NB 3DMMD 1C1EH 1J87A 3M8OL 1DJSA 1FG2B 4OZFH 3SE8H 1U41A 4ZBJA 2BCMA 4IMLB 2R1XB 3MTRA 2CW0D 4IOIB 4KRLB 3QQ9C 5FLVA 5FECB 3OC5A 3QI9A 4PLOB 2CBTA 1LHZA 2HX9A 3FRPB 4MJHA 5HJGA 4DEPB 2DQDL 4A7SA 1R5IA 4XE0A 3C75A 2ZOOA 3MHZA 3BPOB 4PS4H 3L9BA 2BW5A 3NCFB 1KB3A 3B9KA 4Q58C 1N6VA 2W60A 5C3TA 4HK3N 1VFBA 4R3SA 3PCYA 4YUEL 2Y7NA 4EPSA 1QO3A 4PJBA 4DP1X 5FTJA 1CL7I 1E3ZA 1NGPH 1OB0A 3DX2A 4PG9A 2IWEA 3US9A 1FHNA 4ELKA 2DEYX 2J20A 1GAFH 2BW4A 4N6RB 3STLA 3Q2NA 1V3JA 3TH4T 2DICA 5EBLA 4HUNB 1QCSA 3WFBH 4F9PC 5IEKA 4ZYKB 3UJJL 3RA7H 4XNXL 2RMNA 2RHEA 4GLRH 4QHKJ 1KTBA 2WJ5A 2IOOA 1Q0YL 2F5AL 3NCCB 5AKSA 4QI3A 3V0WH 2ZCHL 2HLAA 3W9DA 4NRYA 4UAOB 3WFDH 3JT2A 4LL9A 3GJFH 1A6ZB 2AEWA 1NDGA 3ILDA 3CPLB 2Q86B 4WY7H 5LBVA 2B8OT 3MLUH 3T0EC 2YKKA 3C12A 3GXPA 4RESB 1PJWA 5F0LB 5GZNA 4NWUH 3KYKH 3UYPB 4FLSA 2BVOA 2DMKA 3FCSA 1N64H 4DP5X 1TKWB 2HT3C 1PU0A 1YN6A 3PYCA 2D3VA 3BESR 1KJ2H 1H15A 4PRPA 1W72B 2FE0A 1BZ7A 1RUQL 1Z3GL 3GSXB 2IADB 4OZHF 4BGLA 4G42B 1LNUB 2B2XL 5MENA 1G6RB 2ICWJ 1OXYA 1I1AC 3AJ7A 3MCG1 4KNUA 5JZ7C 3VXME 1BBDL 3M1CA 3MLSH 2IPUK 2V6HA 4B9PA 3EZJB 3ZDYF 3LXAA 2PP7A 4ZO9A 3EADA 2F5BL 3RUGA 5I1GH 5EA0L 2A6KB 4BFIA 2YXMA 2X3CA 3FBKA 4K2UH 1J9RA 1D5BB 2UZIH 3KM2A 4XBPA 1ITBB 2VGLM 3SQOL 2XG5B 3IFPB 4Z3IA 5LQBL 3VMOA 1M1XB 1LDPL 2OJEA 3IYLW 4M02A 4NO0D 3S9DB 4MASA 3C6LB 4PTUB 3DX9B 3CU7A 4KKCC 4GKZB 5TDPA 4FADA 5KTEH 1DVUA 3I02A 1ZLUK 2A77H 4HUMB 4UQCA 1TWCA 2NUTB 1EHKB 3ULVH 5DJDA 3MYZA 5I82A 1EQWA 1WLFA 1E90A 3AGWA 3KLAA 4F9PA 1G0YR 1KIUA 5GZOA 3LVEA 1BD2B 1JN6A 2VW6A 2ARJQ 4L8DA 4AYDC 3HKFA 1P7QD 3GDBA 32C2B 3HFFA 2XIIA 1F02I 4G8EB 3PQYD 2NR6C 5C1BA 3H2QA 1F3JB 2EEAA 3H54A 3OGOE 4CVZB 5JMOC 1A3LH 1JF1A 2WYTA 3FSZA 3NFNB 3OQRA 5CJBA 3ESOA 5D1QB 5SX4H 2FJFB 2NCMA 3CD4A 1F1DA 1XIWA 1Y18B 2XWZA 4GW4A 4MZ2A 3R1GL 5E99L 5BRZB 1MF2H 3Q5OA 1BIIA 1ZA6B 1KNOA 3MLWH 4AM0A 3BKML 3MV8D 4L29B 1XH2A 3T0EA 4YDJB 1DHKA 2AXHA 4MMYA 3QCUH 2F74A 5FYLH 2ADJB 3MRCA 4FHBD 3GB7B 1HXYA 4KWUA 5AW6B 3VWKD 3ZE1E 1ZEAL 3VI4F 2VR5A 3EBHA 3FQUA 3MYJA 2EH8H 2ZXDA 5FYJD 4H13C 5C8JA 4MQSB 3C8KB 2BINA 4XBGB 4D0DB 1YMHA 3BXNB 1CXLA 4LCIH 2WLNA 1NM9A 4YSRA 3CH1B 3ARGB 4U3CA 1QQDB 4XP9L 3JV5A 2P46B 3APDA 3ARDA 3L9RB 5CMAA 4G8GD 4MSWB 1XD0A 2NYYC 1W0WB 4R26L 1BVLB 3GMLA 1V7ML 1YMMA 3Q5TA 4N9OB 3GGWB 3BN9D 3FQYA 1KV3A 1IJ9A 3RWGB 4UQ3A 4HLZH 4TQEH 1HL5A 2QZ5A 3OKKA 3FU0A 5F88A 2E9WA 1AR1D 1BG9A 1IM3B 3PWVA 1KCBA 5ESVA 6FABL 1JZ5A 3EYQD 1AGFA 1QFWM 3ZZLA 3JTBA 2OL3A 3FHQA 3NIGB 4FQLH 3B2XA 1Z0NA 1LO0H 1DL7L 3M1OA 1KBGH 2XTJB 4XBEH 3ZR6A 4ANVA 2ZF8A 3RZWA 3DRTB 2BFGA 2CLRA 1G7JB 4LU5H 2J71A 5TF0A 2Z1KA 3H3BC 5ITBH 2PCYA 3UFIA 1S9WA 3UAFA 1A3ZA 3VFUA 3LS4L 3WO3B 2VWEC 3MJ8B 4WCYL 1JXGA 2DQGH 5IMLB 4LLVB 5FR3A 2X12A 5AWNH 1GHFL 2GJ6A 2BOBB 5HJDA 2NR6A 1XCWA 3NYKA 5GGQH 2DH2A 2XZAL 1J8HB 3CVDA 5C08A 3W0WA 2DI9A 5CJQL 12E8L 3IXTA 1P2CA 4LSPL 5DC9B 3KXFE 3QIUC 2UUDH 3UDWC 2JCCA 2VPWA 5DVKA 4MD4A 2KLTA 2CO1A 1SY6L 3TO2A 2APVA 1QDNA 3VI3E 4FCHA 4ENGA 1L6ZA 1T22B 1X7QA 4PI0A 2OMTB 5G4MA 5LGJA 1J5HA 4PRDA 4RZKA 3QWNA 1RZJL 5JTWA 1LO3H 1AQHA 3HTLX 2NX5A 2KLRA 1KTKE 1IBBA 3MBXH 1F4XL 1UB5A 3P2TA 1LL1A 3ATBA 4FMVA 3GRWA 5DD1H 4ZXBA 4B0MB 1ACXA 2P24B 5B3JF 3QXVA 4N5EC 1TYJA 4Y16A 2GPZA 3WELA 3RFZB 3KM1A 1MFCH 1JHTB 3DARA 4PCTA 4U6HA 5I5JA 3DLQR 4OFYD 2BM3A 2PPFA 3QJHB 4HZLA 4UZSA 1W2KT 5AW0B 1OZTG 1J1OH 1GOFA 3LN4A 2X53A 4E9XA 3WJMB 5EU3A 2YMXH 2MQ0A 5FM8A 3BEWA 4O2EB 4P2QE 1IE4A 2ESVE 4JANA 3CN3A 4ZODA 1QBMH 2LGNA 1ETZB 4IDLA 3ARBB 1XHHA 2HUEA 3MR9B 5F89B 1YG9A 4KH9A 1FV1A 5F9WB 2BY3A 1WC2A 4YWGH 3U46B 1U3HD 5CILL 1BOGB 1DE4B 3P3SA 3VTMA 4K3DH 4JZJC 3CJJA 1T0PB 5FUOH 4BCXA 5C6WH 1QRNE 2VN4A 2KZKA 4PJDB 4N0UB 1YEJL 4HXAL 3O81A 3TNMA 1ND0B 4M93C 4AIZB 3FCBA 3K6NA 3ESUF 3D69A 3WAKA 5EC2A 3QIUA 5D2LE 3UDWA 2BHUA 4GIOA 5JYLA 4MXQD 4GQZA 4M3KB 5D7LB 5FCUL 3WY3A 2IAMD 4JO1H 2J4WH 4PWGA 3TBWB 4L4JA 5CBAA 4XNQA 1G9NH 5IQ9A 1HFUA 4A2EA 2VM9A 5DZAA 4YNYA 3T2NL 4ZG1A 1YNLH 1S4IA 1J9SA 4BQBA 3WJJC 3BT2L 3BMWA 4YEEA 5T1LB 5I75C 5EZLA 4K23H 2G9HB 1CTNA 3RTQC 3MRDA 3OX8A 5CLZA 4MA1C 4AQ8C 1A9EB 1MY5A 1BJ1J 1QSFB 4GRMA 3KPLB 3MGTB 1ZVSA 4GW1A 3WEXA 3ULUC 2TSBA 3LV3A 4I8DA 5LBSL 3SO5A 1TJMA 1N3NB 2BIMA 3HE6B 4MJ2A 1F00I 1G7LB 4U1LA 4CGUB 4ADJA 4X80L 3CDYA 1S5IH 5AOMA 5ECGA 4M3JA 1FNGB 3VXSB 2EJ1A 3ZOAA 3NIDE 4Z8FL 2OZ4A 4O4YL 3SYQA 3PWJB 3OKLA 4LEOA 5DQDL 4Y1SA 2Y07H 3UCQA 4Z7VB 3B3IA 3T8XA 1BHGA 2I5YH 1X5XA 3N55A 5LDSA 2H26A 4A2MA 1SJXA 1NCNA 3APCA 3GHPA 1HHIA 3C6SB 1QHQA 1W8OA 3D2TA 1MY7A 1IBGH 3OAYH 4YO0B 4NUPA 3WDHA 2Z31C 3VVVA 2MPVA 1HSBB 3MNZB 3EOTH 5T5FL 4KKNA 2DBJA 2YEZA 1U8LA 3EFOA 3IDUA 4X6DE 4Y2OB 3V6FB 3X3FH 4FFWD 3N41B 5I17A 3DO4A 2NSXA 3CDZA 4QRFA 5CSGA 4WI2A 3QUZC 1BZ9A 5E6IC 5E7FA 4Q6YA 4UQBA 1L7IH 4GW5B 5B1KA 2R7ZA 5HY9B 2YLHA 5DJXA 3NK3A 1MIML 3QIWD 2D0HA 2VAAA 1IAOB 3VGFA 4MWFA 5I73C 1UWEL 3V7AG 4QHMB 3WY1A 2E9JA 2I24N 3NCBB 4WI9A 4Y4KA 4QIRA 2IDTA 1C7SA 3FBQA 1JNNH 5T5NG 5C0FB 3Q6FB 2XXGA 3DKHA 2EABA 5F7FA 4M7KH 2GI0A 3LKOB 4N8CL 1AANA 2VSCA 3C5ZC 4I3RH 1JWUB 4N1EA 4WFEE 3TBBA 3UTSD 4BWTA 5IWLC 1BW3A 1NFIB 1UATA 2FX7H 5IGXH 2BHFA 2YA0A 2HWZH 4AUYA 3V9EA 3CX2A 4AQ8A 4CVUA 5F21B 5E1QA 1QKZH 3CZNA 3P9WB 1TVHA 4R4BA 3Q48A 1KT2B 1KIRB 4U6TA 1WIPA 1GXEA 4RGOH 2FJGB 3N3EA 5DEFA 1IU1A 3DUSB 4WFGE 5JQ6H 1T5XB 4Q6KA 3ZYOA 3OD3A 3SE9H 3RNKA 3S37L 4X98A 2ZG1A 5FF6A 1ZS8B 2QT6A 2BNQE 1KYFA 3WGVB 5FB8A 4Z3JA 3K91A 3U83A 5DS2A 1AD9A 1EO8L 4YMPA 4QLRA 1NMAL 2CMRL 4PP2B 1Q9LB 3REWB 3VRLF 1DVFC 1T6BX 2I60H 2IFFH 1HINH 1GJUA 4OFDA 3EO0A 1BSIA 1U8CB 1DQMH 1QWNA 2A9BA 4P5KB 1UOWA 3KWWB 4J23A 4XMLH 5J06A 2Z31A 4YE4L 2JIXB 4JDEA 3I6GB 4FA6A 3VQ1C 2WGNB 4YGVA 3HR6A 4MD5B 4LBEA 4N22A 4WJ5A 5DFAA 4AZUA 1KEGL 2ZXCA 1XSJA 3EW3B 3FKUS 1VFAB 4QO1B 5IK3B 3B2PA 5ANME 2MHAA 5E6IA 5HDBF 1CIDA 1T03L 1JNHB 3H7BB 1ODAA 1PJ9A 4P3WA 1HQRB 1JPEA 5T3ZH 3RDJA 2UZXB 1WEJL 3H42L 4O02L 3KBHE 2AK4D 3EFDH 3R06A 4NAJA 2JJSC 1J11A 3OAZK 4BGDA 4N2GA 2IPTH 4HQQH 3TYFA 2PPAA 2V45A 5E70A 1OAKH 4P4KB 1KG0A 4D8OA 2WOYA 4ETQB 4OZIA 2EUXA 1QPXA 3SBWC 5EOTA 2PCFA 3CPUA 3KYAA 3RY6A 2X4PA 5KBKA 2PWGA 1JI1A 1XH3A 5BRQA 2X28A 3KVPA 3QQ4A 2HJKA 3WNPA 3C5ZA 1UZ8B 3VRJA 4DKEL 2ZKHL 3BP6B 4KXDA 3RURA 1F58H 2G5BA 1LO4H 2VLLB 4D0CB 3DBXB 3FFCB 1RQ5A 3PWPB 1R5VA 1PKQB 3ZIYA 4ZPVB 1QUNB 3V0GA 2YJLA 4HWZA 2AXGA 1SJEB 3ZQXA 3D85D 2GUOB 3JVGA 2VLKD 4OCYL 4P5TB 1UWXK 3GSNB 5C3LD 2W88A 3TN0D 4EI5C 1NUDA 4UOQA 4XRCB 3KPPB 1T1YB 4FTDA 3QWQB 3ME0A 1AXIB 1IB5A 2NY3C 4JCMA 1HI6B 4XZUB 3VWJB 3ZGIA 3UGEA 4WJG3 4NC0B 2H2SC 2IDCA 1UYWL 1TYRA 1G9MC 4AEEA 25C8L 3KLDA 1QYGL 1DVFA 1MCNA 1MXGA 3HC2A 4NKMA 3BEVA 4S1SH 3AT8A 5E8EB 1TMQA 4PJ7B 1EJ8A 1KENL 4D8PA 4LARL 2ADIA 4YDKH 1U8KA 4FKEA 3CFEA 3AG3B 5FHAL 4MCMA 2YD6A 4HC1A 5JOPD 3DV6A 2VXUH 1DSYA 4NLAA 4AJVA 4YIQA 1OWWA 1MFNA 1V3MA 5GRJL 2VDMB 5M95B 2Y23A 4OF0A 5EBMA 3X1BA 4U05A 4J7RA 3ZE0E 4KO7A 1PNCA 3O3BB 4R7DA 5L9DH 2JJSA 1H6UA 5E2VL 1VCAA 5C0RL 2OL3H 4DUXA 4YDIL 4PJ6A 4I5BB 3HI5L 2HXAA 2XWBA 3IDGB 3MCKB 3MRMB 4IBTA 1UCTA 1INQB 1Q1JL 1ZPUA 2VERA 1G0XA 3KS0J 3RU8L 3E2HC 2DLIA 4F27A 4MYPA 4P2RA 3VXQB 1FCCA 1T0MA 4MAUL 1YY8A 4NRZB 4NIYE 2AAAA 2OQJB 5J6SA 4UCFA 2ZSWB 1ACCA 1J8RA 1FYTB 1XR8A 2NSQA 4JM4L 4NKDB 1DANU 3L13A 4W9LC 1TIUA 3GLEA 5GSRB 2Z35A 1MHHB 1E8XA 4H88H 5AKRA 3VXUE 5I8CA 1RLWA 1JRHL 3G6JE 3AQDA 3RJQB 3IR5A 2R9HC 1RSFA 1D5XB 1RCYA 3HBQA 5FM4A 1YEFH 5D4HA 1OM3L 5IJVA 4EI5A 3TO4D 4BSWB 1O9ZA 1EVTC 1CUOA 1M7IB 4M6NH 1GZHC 3I6LE 2BY2A 4FQQA 1E9OA 3E0GA 3K6FA 1AYOA 2FQDA 3V4UL 3V6ZA 3VD9A 4KJQC 5H2BA 1WBXB 4JFFA 1CD9B 4RAVA 1YECL 1FE8L 3KPQA 5CLTA 1ADWA 2DQUH 3LDBB 4Y4FD 3TBTA 3VXTB 3DROA 5DFWH 2J44A 3MJWA 1XFPA 1NIEA 4W68A 3RWEB 1UVQB 2WSPA 4KH2A 5DJ6B 3VFTA 2ADGB 2BSED 4OU3A 1Q0XL 5T5ID 4ONFH 1F6LL 5ESQB 3ZQWA 4JGUA 4DPAX 3AAZA 4N0FA 1GGBH 2NXZC 3ARRA 5DHVH 4OSUL 1CU4L 1XF4A 3UPRB 4X9YA 1I75A 2NZ9C 3MLTA 3ASNB 4LL1A 3BRFA 2DYPD 4CNIB 1JZ2A 3PP4L 3NZSA 3PWUA 2G4EA 4ZO7A 2VIRB 4Z0BH 3OKMB 5DSCA 2XTSA 1U8MB 3GMQA 1KTDB 2O61B 4HKXA 1R75A 1COBA 1SYSB 3TJHD 3PFQA 5KUKA 1X5YA 1PQHA 2GIXA 2WGXA 1RZPA 2VC2B 3LD8B 4M8QB 5AB1A 4AJYV 3QYMA 1IAMA 1U8HA 4YXHL 3GSRB 1KF9B 1AGCB 4IGBC 1OQXA 4A2GA 4TPRH 3LSOA 3EGXB 4OQ1A 2I9TB 5F7LB 3WXVH 3T0BA 1JK8A 4FERA 3GKZA 2DYRB 3HI6L 3IDJB 4L05A 3HN5A 2BP5M 2FJHA 3MGOB 1H5BB 2APFA 2NNCA 4KTEL 2WBJB 1GKOA 2GK0B 4OZGE 4DGYH 4HUCA 5IJBC 4E2OA 1R3HA 2QMJA 5CEYA 3K6SB 2NQ3A 4MMZB 3BUYA 5BW7C 4F2EA 2O5JD 3BSHA 4F7KA 4LGRB 2BMKA 1XCTB 4NI6A 1GZHA 2K70A 2VMCA 5A16A 4DP8X 1I7UA 2I69A 3OL2A 5EU5B 5JW4Q 2EEOB 4LCWA 1A21A 5KBMA 5E8DH 4WI8A 4EDWH 5A3IC 2F58L 1X4XA 4RBPH 2D4DA 1F45A 2A83A 4LPCA 4XPFL 2L4OA 2AEQL 1LE9A 4A2DA 2PJJA 1EAQA 2AJZA 2VAJA 3B2UD 2OMYA 4LB8A 4F9LC 5BVPH 2QDVA 1JZDC 1U91B 1YQVL 2ZAHA 3AM8C 1V10A 2OCJA 1RUKL 3T0VA 2PYEA 4ERSH 1EHNA 1JZGA 2X4RA 3DGCR 4X5LA 2PW1B 4HV8A 3H55A 3WJLC 4FQCL 4EQ3A 5HGGS 2MNUA 5C1MB 2XLLA 5A6IA 4PIRF 1NCCH 4JUSA 1AGDA 2DWDA 4HH9A 2B59A 4HCIA 4RFOH 1S3SA 4PS7A 2G3XA 4DVBB 2CHNA 2OZ4H 1UD5A 5HYJA 4DOHB 5DJCA 2EYRB 1FNHA 2WWMC 3O9WD 4L4TA 3QIBB 2SEBB 2R0LL 5AB9A 1UD3A 2EDNA 3D5OF 4AOFA 4XR8C 2XN9A 3RL1B 2HLFC 2CQVA 3MLYH 4AGPA 5CR8A 4F8QA 5DUPH 3O41B 3TCXA 4APXB 2FO1A 1H8SA 1MH5B 3JWNE 1XGPB 4NO2B 3WSQL 2FNBA 2IPKA 2AJVH 4GRLD 4UIKH 3TWCL 2ICEB 3X2KA 2XG4B 2B0SH 2QBWA 4IHOA 3SYCA 2VDLB 5E8PB 5ADPL 1PLGH 1FN4A 5F1NB 1AJ7H 1KTLB 1I7RA 4G43A 3BN9C 4P23D 1QWHA 1TQCB 3FTWA 4MD0B 4YDMA 5D7HA 3U4BH 4MRCA 3X3GL 5B38G 1KGCD 1W0VA 2ZUSA 3NIGF 1AR1C 5MERB 4NJAH 2YGOA 3QW9A 3AT9A 4QUOA 5AL8A 4DTGH 4HFWB 2KDGA 4P3DA 5E4AA 5IVXB 4OGYH 1E61A 3MRKB 1VDGA 3SKJL 1SJMA 5BUPA 4LCCA 2XA8L 3GS0A 2DIBA 3L17A 5SWSA 3CVHL 3AS2A 1HE8A 4PP1D 4IBZA 1KLFB 4L3EA 3K72A 4LFHG 5DMJB 2QGBA 3EG9A 4HWBA 2JK5A 3B8SA 3T2QA 5IQOA 3H9SD 3P11L 4X4ME 3AM8A 3GI9H 3I3BA 3DV4B 4JAMB 1MRDL 4K07A 3X12A 4UOZA 2DTML 5I71C 1TZHB 3WJLA 5B38A 4G59C 1VLXA 1XGYH 3LKRB 5JO5A 3BUDA 3MGAA 1RZFH 3H0TB 3ILEA 1NBVL 4ZM7A 1U8JA 5IB2A 3PNWA 3QJQB 1OP5K 1GJIA 5IP4A 5FHBH 4XWOD 3BIKA 1FDLH 3D3VD 2CGYA 3AREB 3BSZL 1KB5A 4KO8A 1X5FA 1OW0C 1P4BL 4FNLL 4OFQA 1WWCA 4KV5F 4WO4C 5LNGA 3IAQA 4AC2A 3DIFB 2A6IA 4PJFB 5DD3L 3QORB 3L3HB 1B4RA 3MV7A 2DB8A 1XGRB 4ZS7L 4QWWD 1IILE 3SDDB 1JYNA 1MREH 4FL4C 1LQSR 5AVSB 2XYBA 3QUYA 1WFUA 2JI2A 3O2WL 5D4JA 4JFDD 1T2QH 3B37A 1E5VA 4ISVA 1VKXB 4X7TB 2YR3A 1DFBH 1NAKH 5L2KA 3ENGA 2E6QA 3GSOA 3IU4L 5H35A 5K9JL 1HE7A 4IK6A 4AV0A 2VLJD 3GRBA 2QSCL 3CH8A 5IW6B 4KUCF 3DC0A 5EF2A 1RP8A 1QMUA 3TBVB 5E9DA 1XGTA 5EU6D 2C9SA 3A23A 3KWXA 3SDYL 2VABA 3DI3B 3O3EB 4ENED 3MRPB 4MTMA 1B2WL 3QDMB 3K2MC 4PJHE 1OAZL 4ELMA 3P0VH 4JHBA 1JHKH 4UT6A 4WW1B 5E8OA 5AVVB 4QLWA 5JIKA 5F8QC 1N68A 1QFWL 1IGIH 5SX5H 3L95A 1FBIH 1U8IA 3RNQA 2GUYA 4OCWL 3BPNB 4EDXA 1U3HC 4KTDH 1A7OL 1K6QH 4M7ZC 2NLJB 3BQUC 2V7HA 3AITA 4NNYA 3K6IA 4XODA 4ZUUB 2BS71 1IEAA 2G3ZA 4KKLD 3HC0B 2ITDA 2EXWD 3H56A 2YBRB 2PN5A 3HFMH 5JOFA 1VSCA 3G5XB 3PQYE 1DLFH 1T7XA 2X4SA 4JVPA 4K94H 2WXOA 4GG6A 2EVIA 4LVNB 2X4OA 4P5MA 5MEOB 3IJEB 2RGSA 2XUWA 5D7EA 4FA7B 4GO6B 1BF5A 2OX5A 3PHAA 1F97A 2BC4A 2G3MA 4PV9A 1LMKA 4DK5A 5LBGA 2WD0A 4AENB 3MV8E 2WXGA 1IGTB 5IJKA 3CG8A 4MA3A 4WO4A 3ASOB 4ANWA 1AKJB 3TTSA 4L9LA 1H6EA 2K6WA 4RWHA 1BLNA 5IOPB 3C6LD 5DK0B 2YC1A 3ZE2B 3GSNL 1ZIBA 1CPUA 3Q13A 5ALBH 5FYJE 1TWGA 4HC1H 4CU6A 3LKPB 1DQDL 1SVBA 5C07D 2LAGB 4PUBL 2E7MA 3LRHA 4K9EL 1BD2D 5AW4B 1UB6A 3NJVA 4TOYL 2ROXA 1JHLH 1JZFA 2ERJB 1XF2A 4HBCH 1WZ1L 3CFCL 2AEPH 4G8GE 2DM2A 3L3DB 4RETB 4C54A 1S7QA 4RAHA 1TENA 4B9ZA 2B16A 4F7TB 5HVHB 4DH2A 5JPNC 1UZ6E 2C3VA 3L2LA 2FQFA 1I8LA 2OMWB 3KYOA 5IBLC 3HLAB 5I1DB 2B77A 1V05A 5BRZD 2IBZX 4OGXL 3OHXB 2W9DH 3QNFA 5FYJL 3MRFB 5BS0D 4P46C 1ZT4A 3NJXA 2DLFH 1MSPA 5H94A 3PV6A 4XPHH 3SDCD 1YQ2A 2VPXA 4DEUA 1B0RA 1CD1B 3FTVA 3LEXB 4B7IA 4OLWL 2G30A 1OCOB 1D6EB 3N41F 5D1ZB 3OLEA 1Q94B 5IQ7L 5KYXB 2NXYC 3BQUA 3WLBB 4CVXA 5HHOD 4PGBB 4PRHA 1P1ZB 2XFGB 4FFWC 2Q3ZA 1KCRH 1EZSA 2ZYIA 1HOCB 1IAIM 3ASWA 3A6CL 3L3JA 3DYPA 3JV0A 3GNML 3GMMA 4J39A 2PMZA 2FZ3A 4FZ8H 4OZHA 3X2GA 3E8VA 4XCNB 4AL8C 5JW5A 1BMGA 1XR9A 2Q0ZX 1YN7A 5TDNA 3C09B 4GO8A 3QIWC 4KGJA 1W8EA 2QPEB 5TE7H 3E6HB 3THML 4UTAL 4HIEB 2J1YA 1TZGL 4K5NA 2Y1ZA 2PF6A 4Y19D 3GWJA 4L8BB 4XI5D 3U79A 1IM3D 4AXWB 4H2AA 3ECBA 1ZLDA 3T0XA 1B0IA 2IQAA 2C7UB 4GAYA 4M1CC 3UBXI 4OLVH 4ZMPA 2H32B 5CHNB 2BHZA 5C7XL 3GS7A 1KBVA 3QXDB 4KODA 5GGRA 1UH3A 5IBUG 1F5WA 3CFJA 2VZ1A 3WNIA 3QG7L 2BP3A 1PZ5A 3KJ6H 2BNUA 1E27B 1E9QA 2IF7A 3FUEA 1GGYA 3L5XH 4FFYL 3BZFA 2P80A 1DQLH 4QRRD 3QFJA 4YL9A 4WU5A 4PGCA 3QZOA 3S6CA 3GSQA 1XVSA 3UO1H 1PZAA 3OJVC 1NEPA 4KXBA 4PCYA 4UIMA 2OK0H 5IKCA 4XP1H 4XVSL 4IRZA 5BQ7A 5I0DA 1H5NA 2LVEA 3D4YA 3P4NB 2AI0L 3DOSA 3VRIB 1S3KH 3OPZL 3QS3A 5FAAA 3V10A 3WKML 2EH7H 1OSEA 1WCBB 2ZWZA 5I1AB 3BUPA 1EGJA 4TM9A 4M9PA 1T21A 2P5WB 4B95C 5A2FA 3E80A 2ZD0A 4GI6A 3RWDB 2GC4C 1FPTH 5DMGD 4AGMA 1E4XL 1MIEH 3IB4A 2DKUA 5JHBA 4K71B 1PZDA 3CE1A 1YZZA 4DPCX 3HW7A 1XT5A 3S4SB 4A38A 1IM9A 3KBFA 5I8KL 2L7JA 4LSTH 2ICWB 4TULH 2DQMA 1CDYA 3UYOD 1YUKB 1IC5L 2BOCB 1NANH 1S7WA 2UXVA 3OZ9L 3VI4A 5DD6A 1HESA 2WXMA 4OLUL 3NCJH 5L88L 4R7NB 4XMZA 1P5UB 2Y7MA 3QDJA 4QAMB 2EDJA 3M3GA 5IVZA 2NNAA 5J3HD 5LB1A 1UJ3C 4RGMB 3MRLB 2YFOA 5LCVL 3U2SA 4PJIB 4XO8A 2BZCA 4F58L 4RLDA 3N40P 3RWHB 5I8EA 3DX6B 3GBNL 4W9EC 5AOKA 3P4MB 5AVTB 3N5AA 4NB7A 4QF1B 2DKMA 1LEGA 3NCYS 4LKCA 4LRIA 2ZYHA 2PPCA 3QFDA 4JR9H 1OGAD 3QO0A 4KVCL 2XNAB 5FFGA 2XZQL 1QZ1A 4JY4B 2MNJB 4JFHD 3LIZL 1JPGA 4X4YA 5FDWB 5E4EB 1NCDL 3GTVA 4HOZA 2WAQA 4KRPB 4OQTL 3IFNH 1MCPL 1TEFA 2A9NL 2V3FA 1OGTB 5KEZA 4G6AC 2UXFA 3OLGA 4X9FA 4IRJB 1U8PA 2B4CL 3MX0A 2HT2C 1WC7A 1IBYA 4MMXB 1TQWA 5D5MF 2DBLH 1MWAB 3DVNB 1DBBL 5IOKA 2NY2B 1AAJA 5ICXA 2D0FA 1S7UA 3HE7B 3ZW3A 4LCVA 5F6HJ 4LPTA 3FUDA 1QI5A 4X42A 1N18A 4X8JA 1LO5A 4PJ7F 4HF5H 2PNWA 4Y2DD 4E9WA 1J0HA 3FFOA 3OMNB 2WLLB 4WNQA 4XMTA 1Y6NR 4OGQC 4M43H 4CVWA 3LH2H 3HLKA 3NQIA 3CXFA 4XPAL