1UHEA

Crystal structure of aspartate decarboxylase, isoaspargine complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase beta chain
total genus 17
structure length 97
sequence length 97
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1uheA00
1Y1VA 4KODA 2YU9A 2KI8A 3IR5A 4GA6A 1AA6A 2B63A 1E18A 1H0HA 1CZ4A 2JIPA 2VPWA 3QC8A 4CRYG 1CZ5A 1KQGA 1H5NA 1TWAA 5DYGA 2E7ZA 5DYIA 3GTGA 3QWZA 3CF2A 5T5MD 2PMZA 4CRZA 4KO8A 4AAYA 2IV2X 3H0GA 1UHDA 2E2HA 3GTJA 4KLNA 5EPPA 2JA6A 4D7ZB 3IR6A 2PJHB 2NVYA 4AYBA 3IR7A 1FDIA 1CR5A 1R27A 3DMRA 5FTLA 1AW8B 1E60A 1PYQA 5C1BA 2DMRA 5FTMA 3OUGA 1VC3B 2VPZA 3PLXB 3QQ7A 1IW7D 2JIMA 2Y0SA 2JIRA 2VUMA 1S3SA 2NAPA 3GTQA 3TM7B 5GLFA 1Y5IA 2JA7A 2E2IA 2C45A 2JA5A 3HKZA 1E5VA 1Y1WA 2R93A 2VPYA 1PT1A 2NVXA 1DMSA 1PT0A 3HU3A 4CS0A 5FTKA 3GTOA 4AZDA 2WAQA 1YLEA 1TWCA 4KDIA 2JIOA 2R7ZA 1PYUB 1KQFA 1PQEA 4RV0A 2V3VA 3FKIA 4KDLA 1PQHA 1DMRA 5FTJA 1UHEA 2JIQA 4DMRA 1PPYA 3ML1A 3O5AA 1TWGA 1QDNA 2V45A 1R9TA 1EU1A 1TWHA 3CQZA 2WB1A 1TWFA 1PQFA 3GTKA 3HU1A 4GA5A 3TIWA 3GTMA 1WCMA 4QIWA 4AOKB 2R92A 2EEOB 3GTPA 1E32A 3HU2A 4C2MA 1FDOA 5FTNA 1TMOA 1SIWA 2VPXA 1R7RA 3GTLA 5T5ID 1I50A 1Y4ZA 5C18A 1QCSA 1Q16A 3QQ8A 4AONB 5B6CA 1G8JA 2NYAA 1E61A 1SFOA 1WLFA 1G8KA 1OGYA 1I3QA 1K83A
chains in the Genus database with same CATH superfamily
1WC2A 1Y1VA 3SUKA 4KODA 2YU9A 1N10A 1YNJD 2KI8A 3IR5A 3X2OA 4GA6A 1AA6A 1OGYA 3SULA 2B63A 1E18A 1H0HA 1CZ4A 1OA9A 2JIPA 2VPWA 3QC8A 4CRYG 4JP6A 1CZ5A 3X2KA 1KQGA 1H5NA 1TWAA 2G5DA 5DYGA 2E7ZA 2CW0D 5DYIA 3GTGA 3QWZA 3CZBA 2A69D 3CF2A 5GLXA 5T5MD 2PMZA 4CRZA 4KO8A 2G6GA 2IV2X 4AAYA 1SMYD 2O5JD 3H0GA 4L48A 1UHDA 5H4UA 2E2HA 3GTJA 4KLNA 2A6ED 2GAEA 1ZC1A 5EPPA 3GTOA 1YNND 2JA6A 4D7ZB 4ZM7A 3IR6A 2PJHB 2NVYA 4AYBA 3IR7A 1FDIA 3ENGA 1CR5A 1R27A 3DMRA 5FTLA 1AW8B 1E60A 1PYQA 2A6HD 5C1BA 2DMRA 5FTMA 3X2HA 1BW4A 3OUGA 3SUJA 4JCWA 1VC3B 4AVRA 2VPZA 3PLXB 3QQ7A 1IW7D 1BW3A 2JIMA 2Y0SA 2JIRA 2VUMA 1S3SA 2NAPA 3GTQA 3TM7B 3X2MA 3M3GA 4FFTA 4NOHA 5GLFA 1Y5IA 3D30A 4JJOA 3X2JA 2BH0A 2JA7A 2E2IA 2C45A 2JA5A 4FERA 3HKZA 1E5VA 2PI8A 1Y1WA 4FG4A 2R93A 3SUMA 2VPYA 1PT1A 2NVXA 1DMSA 1PT0A 3HU3A 2PJJA 2ENGA 5FTKA 3X2IA 4AZDA 2A68D 4CS0A 4ENGA 2WAQA 1YLEA 5GLYA 1TWCA 4KDIA 2JIOA 2R7ZA 2PICA 1PYUB 1KQFA 1PQEA 4RV0A 2V3VA 2BE5D 3FKIA 1ZYRD 4KDLA 1PQHA 1DMRA 5FTJA 1UHEA 2JIQA 3X2NA 4DMRA 1PPYA 3ML1A 2PNWA 3O5AA 1HD5A 1TWGA 1QDNA 2V45A 1R9TA 1EU1A 1TWHA 3X2LA 3CQZA 3X2PA 2WB1A 1TWFA 3GTKA 3HU1A 2KQAA 4GA5A 3TIWA 2AE0X 1WCMA 4QIWA 4AOKB 3GTMA 2R92A 2EEOB 3GTPA 1E32A 3HU2A 4C2MA 1FDOA 5FTNA 1OA7A 1TMOA 4JP7A 2HCZX 1SIWA 2VPXA 1L8FA 1R7RA 3X2GA 5T5ID 3GTLA 1I50A 1Y4ZA 5C18A 1QCSA 1Q16A 2YUJA 3QQ8A 4AONB 5B6CA 1G8JA 2NYAA 1E61A 5GM9A 1SFOA 4JS7A 4FG2A 1WLFA 1G8KA 1PQFA 1I3QA 1K83A
chains in the Genus database with same CATH topology
1Y1VA 4KODA 2YU9A 1YNJD 2KI8A 3IR5A 4GA6A 1AA6A 2B63A 1E18A 1H0HA 1CZ4A 2JIPA 2VPWA 3QC8A 4CRYG 1CZ5A 1KQGA 1H5NA 1TWAA 2G5DA 5DYGA 2E7ZA 2CW0D 5DYIA 3GTGA 3QWZA 3CZBA 2A69D 3CF2A 5T5MD 2PMZA 4CRZA 4KO8A 2G6GA 2IV2X 4AAYA 1SMYD 2O5JD 3H0GA 1UHDA 2E2HA 3GTJA 4KLNA 2A6ED 2GAEA 1ZC1A 5EPPA 1YNND 2JA6A 4D7ZB 3IR6A 2PJHB 2NVYA 4AYBA 3IR7A 1FDIA 1CR5A 1R27A 3DMRA 5FTLA 1AW8B 1E60A 1PYQA 2A6HD 5C1BA 2DMRA 5FTMA 3OUGA 1VC3B 2VPZA 3PLXB 3QQ7A 1IW7D 2JIMA 2Y0SA 2JIRA 2VUMA 1S3SA 2NAPA 3GTQA 3TM7B 4NOHA 5GLFA 1Y5IA 2JA7A 2E2IA 2C45A 2JA5A 3HKZA 1E5VA 2PI8A 1Y1WA 2R93A 2VPYA 1PT1A 2NVXA 1DMSA 1PT0A 3HU3A 2PJJA 5FTKA 4CS0A 3GTOA 4AZDA 2A68D 2WAQA 1YLEA 1TWCA 4KDIA 2JIOA 2R7ZA 2PICA 1PYUB 1KQFA 1PQEA 4RV0A 2V3VA 2BE5D 3FKIA 1ZYRD 4KDLA 1PQHA 1DMRA 5FTJA 1UHEA 2JIQA 4DMRA 1PPYA 3ML1A 2PNWA 3O5AA 1TWGA 1QDNA 2V45A 1R9TA 1EU1A 1TWHA 3CQZA 2WB1A 1TWFA 1PQFA 3GTKA 3HU1A 4GA5A 3TIWA 2AE0X 1WCMA 4QIWA 4AOKB 3GTMA 2R92A 2EEOB 3GTPA 1E32A 3HU2A 4C2MA 1FDOA 5FTNA 1TMOA 1SIWA 2VPXA 1R7RA 3GTLA 5T5ID 1I50A 1Y4ZA 5C18A 1QCSA 1Q16A 2YUJA 3QQ8A 4AONB 5B6CA 1G8JA 2NYAA 1E61A 1SFOA 1WLFA 1G8KA 1OGYA 1I3QA 1K83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V A;  4KOD A;  2YU9 A;  2KI8 A;  3IR5 A;  4GA6 A;  1AA6 A;  2B63 A;  1E18 A;  1H0H A;  1CZ4 A;  2JIP A;  2VPW A;  3QC8 A;  4CRY G;  1CZ5 A;  1KQG A;  1H5N A;  1TWA A;  5DYG A;  2E7Z A;  5DYI A;  3GTG A;  3QWZ A;  3CF2 A;  5T5M D;  2PMZ A;  4CRZ A;  4KO8 A;  4AAY A;  2IV2 X;  3H0G A;  1UHD A;  2E2H A;  3GTJ A;  4KLN A;  5EPP A;  2JA6 A;  4D7Z B;  3IR6 A;  2PJH B;  2NVY A;  4AYB A;  3IR7 A;  1FDI A;  1CR5 A;  1R27 A;  3DMR A;  5FTL A;  1AW8 B;  1E60 A;  1PYQ A;  5C1B A;  2DMR A;  5FTM A;  3OUG A;  1VC3 B;  2VPZ A;  3PLX B;  3QQ7 A;  1IW7 D;  2JIM A;  2Y0S A;  2JIR A;  2VUM A;  1S3S A;  2NAP A;  3GTQ A;  3TM7 B;  5GLF A;  1Y5I A;  2JA7 A;  2E2I A;  2C45 A;  2JA5 A;  3HKZ A;  1E5V A;  1Y1W A;  2R93 A;  2VPY A;  1PT1 A;  2NVX A;  1DMS A;  1PT0 A;  3HU3 A;  4CS0 A;  5FTK A;  3GTO A;  4AZD A;  2WAQ A;  1YLE A;  1TWC A;  4KDI A;  2JIO A;  2R7Z A;  1PYU B;  1KQF A;  1PQE A;  4RV0 A;  2V3V A;  3FKI A;  4KDL A;  1PQH A;  1DMR A;  5FTJ A;  1UHE A;  2JIQ A;  4DMR A;  1PPY A;  3ML1 A;  3O5A A;  1TWG A;  1QDN A;  2V45 A;  1R9T A;  1EU1 A;  1TWH A;  3CQZ A;  2WB1 A;  1TWF A;  1PQF A;  3GTK A;  3HU1 A;  4GA5 A;  3TIW A;  3GTM A;  1WCM A;  4QIW A;  4AOK B;  2R92 A;  2EEO B;  3GTP A;  1E32 A;  3HU2 A;  4C2M A;  1FDO A;  5FTN A;  1TMO A;  1SIW A;  2VPX A;  1R7R A;  3GTL A;  5T5I D;  1I50 A;  1Y4Z A;  5C18 A;  1QCS A;  1Q16 A;  3QQ8 A;  4AON B;  5B6C A;  1G8J A;  2NYA A;  1E61 A;  1SFO A;  1WLF A;  1G8K A;  1OGY A;  1I3Q A;  1K83 A; 
#chains in the Genus database with same CATH topology
 1WC2 A;  1Y1V A;  3SUK A;  4KOD A;  2YU9 A;  1N10 A;  1YNJ D;  2KI8 A;  3IR5 A;  3X2O A;  4GA6 A;  1AA6 A;  1OGY A;  3SUL A;  2B63 A;  1E18 A;  1H0H A;  1CZ4 A;  1OA9 A;  2JIP A;  2VPW A;  3QC8 A;  4CRY G;  4JP6 A;  1CZ5 A;  3X2K A;  1KQG A;  1H5N A;  1TWA A;  2G5D A;  5DYG A;  2E7Z A;  2CW0 D;  5DYI A;  3GTG A;  3QWZ A;  3CZB A;  2A69 D;  3CF2 A;  5GLX A;  5T5M D;  2PMZ A;  4CRZ A;  4KO8 A;  2G6G A;  2IV2 X;  4AAY A;  1SMY D;  2O5J D;  3H0G A;  4L48 A;  1UHD A;  5H4U A;  2E2H A;  3GTJ A;  4KLN A;  2A6E D;  2GAE A;  1ZC1 A;  5EPP A;  3GTO A;  1YNN D;  2JA6 A;  4D7Z B;  4ZM7 A;  3IR6 A;  2PJH B;  2NVY A;  4AYB A;  3IR7 A;  1FDI A;  3ENG A;  1CR5 A;  1R27 A;  3DMR A;  5FTL A;  1AW8 B;  1E60 A;  1PYQ A;  2A6H D;  5C1B A;  2DMR A;  5FTM A;  3X2H A;  1BW4 A;  3OUG A;  3SUJ A;  4JCW A;  1VC3 B;  4AVR A;  2VPZ A;  3PLX B;  3QQ7 A;  1IW7 D;  1BW3 A;  2JIM A;  2Y0S A;  2JIR A;  2VUM A;  1S3S A;  2NAP A;  3GTQ A;  3TM7 B;  3X2M A;  3M3G A;  4FFT A;  4NOH A;  5GLF A;  1Y5I A;  3D30 A;  4JJO A;  3X2J A;  2BH0 A;  2JA7 A;  2E2I A;  2C45 A;  2JA5 A;  4FER A;  3HKZ A;  1E5V A;  2PI8 A;  1Y1W A;  4FG4 A;  2R93 A;  3SUM A;  2VPY A;  1PT1 A;  2NVX A;  1DMS A;  1PT0 A;  3HU3 A;  2PJJ A;  2ENG A;  5FTK A;  3X2I A;  4AZD A;  2A68 D;  4CS0 A;  4ENG A;  2WAQ A;  1YLE A;  5GLY A;  1TWC A;  4KDI A;  2JIO A;  2R7Z A;  2PIC A;  1PYU B;  1KQF A;  1PQE A;  4RV0 A;  2V3V A;  2BE5 D;  3FKI A;  1ZYR D;  4KDL A;  1PQH A;  1DMR A;  5FTJ A;  1UHE A;  2JIQ A;  3X2N A;  4DMR A;  1PPY A;  3ML1 A;  2PNW A;  3O5A A;  1HD5 A;  1TWG A;  1QDN A;  2V45 A;  1R9T A;  1EU1 A;  1TWH A;  3X2L A;  3CQZ A;  3X2P A;  2WB1 A;  1TWF A;  3GTK A;  3HU1 A;  2KQA A;  4GA5 A;  3TIW A;  2AE0 X;  1WCM A;  4QIW A;  4AOK B;  3GTM A;  2R92 A;  2EEO B;  3GTP A;  1E32 A;  3HU2 A;  4C2M A;  1FDO A;  5FTN A;  1OA7 A;  1TMO A;  4JP7 A;  2HCZ X;  1SIW A;  2VPX A;  1L8F A;  1R7R A;  3X2G A;  5T5I D;  3GTL A;  1I50 A;  1Y4Z A;  5C18 A;  1QCS A;  1Q16 A;  2YUJ A;  3QQ8 A;  4AON B;  5B6C A;  1G8J A;  2NYA A;  1E61 A;  5GM9 A;  1SFO A;  4JS7 A;  4FG2 A;  1WLF A;  1G8K A;  1PQF A;  1I3Q A;  1K83 A; 
#chains in the Genus database with same CATH homology
 1Y1V A;  4KOD A;  2YU9 A;  1YNJ D;  2KI8 A;  3IR5 A;  4GA6 A;  1AA6 A;  2B63 A;  1E18 A;  1H0H A;  1CZ4 A;  2JIP A;  2VPW A;  3QC8 A;  4CRY G;  1CZ5 A;  1KQG A;  1H5N A;  1TWA A;  2G5D A;  5DYG A;  2E7Z A;  2CW0 D;  5DYI A;  3GTG A;  3QWZ A;  3CZB A;  2A69 D;  3CF2 A;  5T5M D;  2PMZ A;  4CRZ A;  4KO8 A;  2G6G A;  2IV2 X;  4AAY A;  1SMY D;  2O5J D;  3H0G A;  1UHD A;  2E2H A;  3GTJ A;  4KLN A;  2A6E D;  2GAE A;  1ZC1 A;  5EPP A;  1YNN D;  2JA6 A;  4D7Z B;  3IR6 A;  2PJH B;  2NVY A;  4AYB A;  3IR7 A;  1FDI A;  1CR5 A;  1R27 A;  3DMR A;  5FTL A;  1AW8 B;  1E60 A;  1PYQ A;  2A6H D;  5C1B A;  2DMR A;  5FTM A;  3OUG A;  1VC3 B;  2VPZ A;  3PLX B;  3QQ7 A;  1IW7 D;  2JIM A;  2Y0S A;  2JIR A;  2VUM A;  1S3S A;  2NAP A;  3GTQ A;  3TM7 B;  4NOH A;  5GLF A;  1Y5I A;  2JA7 A;  2E2I A;  2C45 A;  2JA5 A;  3HKZ A;  1E5V A;  2PI8 A;  1Y1W A;  2R93 A;  2VPY A;  1PT1 A;  2NVX A;  1DMS A;  1PT0 A;  3HU3 A;  2PJJ A;  5FTK A;  4CS0 A;  3GTO A;  4AZD A;  2A68 D;  2WAQ A;  1YLE A;  1TWC A;  4KDI A;  2JIO A;  2R7Z A;  2PIC A;  1PYU B;  1KQF A;  1PQE A;  4RV0 A;  2V3V A;  2BE5 D;  3FKI A;  1ZYR D;  4KDL A;  1PQH A;  1DMR A;  5FTJ A;  1UHE A;  2JIQ A;  4DMR A;  1PPY A;  3ML1 A;  2PNW A;  3O5A A;  1TWG A;  1QDN A;  2V45 A;  1R9T A;  1EU1 A;  1TWH A;  3CQZ A;  2WB1 A;  1TWF A;  1PQF A;  3GTK A;  3HU1 A;  4GA5 A;  3TIW A;  2AE0 X;  1WCM A;  4QIW A;  4AOK B;  3GTM A;  2R92 A;  2EEO B;  3GTP A;  1E32 A;  3HU2 A;  4C2M A;  1FDO A;  5FTN A;  1TMO A;  1SIW A;  2VPX A;  1R7R A;  3GTL A;  5T5I D;  1I50 A;  1Y4Z A;  5C18 A;  1QCS A;  1Q16 A;  2YUJ A;  3QQ8 A;  4AON B;  5B6C A;  1G8J A;  2NYA A;  1E61 A;  1SFO A;  1WLF A;  1G8K A;  1OGY A;  1I3Q A;  1K83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...