1UHEA

Crystal structure of aspartate decarboxylase, isoaspargine complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
b'ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 17
structure length 97
sequence length 97
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1uheA00
2VPWA 1AW8B 3GTMA 2E2HA 2DMRA 4KO8A 1TWCA 1SFOA 1PYQA 1VC3B 1TWAA 5DYIA 4CRZA 1E60A 2IV2X 3HU1A 4AZDA 2WB1A 3IR5A 2NYAA 2R93A 4KDLA 1FDOA 3GTJA 2JIRA 4CRYG 2JIOA 3IR6A 2YU9A 5FTKA 1E18A 1FDIA 3PLXB 3O5AA 3CF2A 1K83A 1Y1WA 3GTPA 4DMRA 1WCMA 1PYUB 2KI8A 5C18A 1SIWA 3QQ7A 2R7ZA 1DMSA 1PQFA 1R7RA 1UHEA 2JA6A 4GA6A 4D7ZB 1KQGA 1CR5A 3CQZA 4AYBA 1E61A 2V3VA 2NVXA 3FKIA 1Y5IA 1H5NA 3OUGA 5DYGA 1G8JA 5B6CA 2WAQA 1QDNA 3GTOA 3HU3A 1AA6A 5T5MD 3GTKA 3GTLA 2E7ZA 1G8KA 3HKZA 3DMRA 2JA7A 4KODA 1I50A 4GA5A 5GLFA 2B63A 3HU2A 5C1BA 1PT1A 1Y4ZA 5FTJA 3TM7B 1CZ5A 1OGYA 1TWGA 1TWFA 1R9TA 1TMOA 2V45A 2R92A 4CS0A 4AAYA 2VPXA 3QC8A 3QQ8A 1WLFA 2VPZA 1S3SA 4KDIA 1PT0A 3QWZA 3GTGA 2Y0SA 3GTQA 5FTNA 1EU1A 2JIMA 5FTMA 4AOKB 1E5VA 1E32A 1CZ4A 1R27A 2NAPA 1Y1VA 4RV0A 3ML1A 5EPPA 1QCSA 1PQEA 2VPYA 2PJHB 1KQFA 4AONB 5T5ID 1DMRA 1TWHA 2PMZA 2NVYA 4C2MA 2E2IA 1PPYA 1YLEA 2VUMA 1PQHA 2JA5A 2JIPA 4QIWA 1H0HA 4KLNA 5FTLA 1I3QA 1Q16A 1IW7D 2C45A 3IR7A 3H0GA 3TIWA 1UHDA 2EEOB 2JIQA
chains in the Genus database with same CATH superfamily
2VPWA 1AW8B 3GTMA 2E2HA 3SUKA 3SUMA 2DMRA 4KO8A 1TWCA 1SFOA 1PYQA 1VC3B 2A69D 1TWAA 5DYIA 4JP6A 2O5JD 1N10A 4CRZA 2YUJA 1E60A 2IV2X 3HU1A 4AZDA 2WB1A 3IR5A 2NYAA 2R93A 1ZC1A 1FDOA 2ENGA 1OA7A 4KDLA 3GTJA 2JIRA 4CRYG 2JIOA 3IR6A 3X2MA 2YU9A 2G6GA 5FTKA 4NOHA 1E18A 1FDIA 3ENGA 3PLXB 3O5AA 3CF2A 1K83A 1Y1WA 3X2PA 1OA9A 4DMRA 1WCMA 1PYUB 2KI8A 4JJOA 5C18A 3GTPA 1SIWA 5GLXA 1BW4A 4JP7A 3QQ7A 1SMYD 2R7ZA 1DMSA 1PQFA 1R7RA 1UHEA 2JA6A 3CZBA 4GA6A 4D7ZB 1KQGA 1ZYRD 1CR5A 2A68D 3CQZA 3X2LA 4AYBA 1E61A 2V3VA 3X2KA 2NVXA 1YNJD 3FKIA 1Y5IA 1H5NA 3OUGA 4JS7A 5DYGA 3SUJA 1G8JA 3X2HA 5B6CA 2WAQA 1QDNA 3GTOA 3HU3A 1AA6A 2CW0D 5T5MD 3GTKA 3GTLA 2E7ZA 1G8KA 2PICA 4FG2A 3DMRA 3HKZA 3M3GA 2JA7A 4KODA 2BE5D 1I50A 2KQAA 4GA5A 5GLFA 3X2JA 2B63A 3HU2A 5C1BA 1PT1A 1Y4ZA 2A6ED 5FTJA 3TM7B 1L8FA 4FFTA 1OGYA 1TWGA 1TWFA 1R9TA 1CZ5A 1TMOA 2V45A 2R92A 4CS0A 3X2GA 4ENGA 4AAYA 2A6HD 2VPXA 3QC8A 3QQ8A 4ZM7A 1WLFA 2VPZA 1S3SA 4KDIA 3X2OA 1PT0A 3X2NA 3QWZA 3GTGA 1WC2A 2Y0SA 3GTQA 4AVRA 2G5DA 5FTNA 1EU1A 2JIMA 2PJJA 4JCWA 5FTMA 2BH0A 2PNWA 4AOKB 1E5VA 1E32A 1CZ4A 1R27A 2NAPA 1Y1VA 1BW3A 4RV0A 5GM9A 2JIQA 3ML1A 5EPPA 1QCSA 1PQEA 2PJHB 2VPYA 4L48A 1KQFA 4AONB 5T5ID 1YNND 1DMRA 3SULA 3TIWA 1TWHA 2PMZA 5H4UA 2HCZX 2NVYA 3D30A 4C2MA 2E2IA 1PPYA 1YLEA 2GAEA 1PQHA 5GLYA 2VUMA 2JA5A 2AE0X 2JIPA 4QIWA 1H0HA 4KLNA 4FERA 5FTLA 1I3QA 1Q16A 1IW7D 2C45A 3IR7A 3H0GA 2PI8A 3X2IA 4FG4A 1UHDA 2EEOB 1HD5A
chains in the Genus database with same CATH topology
2VPWA 1AW8B 3GTMA 2E2HA 2DMRA 4KO8A 1TWCA 1SFOA 1PYQA 1VC3B 2A69D 1TWAA 5DYIA 2O5JD 4CRZA 2YUJA 1E60A 2IV2X 3HU1A 4AZDA 2WB1A 3IR5A 2NYAA 2R93A 1ZC1A 1FDOA 4KDLA 3GTJA 2JIRA 4CRYG 2JIOA 3IR6A 2YU9A 2G6GA 5FTKA 4NOHA 1E18A 1FDIA 3PLXB 3O5AA 3CF2A 1K83A 1Y1WA 3GTPA 4DMRA 1WCMA 1PYUB 2KI8A 5C18A 1SIWA 3QQ7A 1SMYD 2R7ZA 1DMSA 1PQFA 1R7RA 1UHEA 2JA6A 3CZBA 4GA6A 4D7ZB 1KQGA 1ZYRD 1CR5A 2A68D 3CQZA 4AYBA 1E61A 2V3VA 2NVXA 1YNJD 3FKIA 1Y5IA 1H5NA 3OUGA 5DYGA 1G8JA 5B6CA 2WAQA 1QDNA 3GTOA 3HU3A 1AA6A 2CW0D 5T5MD 3GTKA 3GTLA 2E7ZA 1G8KA 2PICA 3DMRA 3HKZA 2JA7A 4KODA 2BE5D 1I50A 4GA5A 5GLFA 2B63A 3HU2A 5C1BA 1PT1A 2A6ED 1Y4ZA 5FTJA 3TM7B 1CZ5A 1OGYA 1TWGA 1TWFA 1R9TA 1TMOA 2V45A 2R92A 4CS0A 4AAYA 2A6HD 2VPXA 3QC8A 3QQ8A 1WLFA 2VPZA 1S3SA 4KDIA 1PT0A 3QWZA 3GTGA 2Y0SA 3GTQA 2G5DA 5FTNA 1EU1A 2JIMA 2PJJA 5FTMA 2PNWA 4AOKB 1E5VA 1E32A 1CZ4A 1R27A 2NAPA 1Y1VA 4RV0A 3ML1A 5EPPA 1QCSA 1PQEA 2PJHB 2VPYA 1KQFA 4AONB 5T5ID 1YNND 1DMRA 1TWHA 2PMZA 2NVYA 4C2MA 2E2IA 1PPYA 1YLEA 2GAEA 1PQHA 2VUMA 2JA5A 2AE0X 2JIPA 4QIWA 1H0HA 4KLNA 5FTLA 1I3QA 1Q16A 1IW7D 2C45A 3IR7A 3H0GA 2PI8A 3TIWA 1UHDA 2EEOB 2JIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPW A;  1AW8 B;  3GTM A;  2E2H A;  2DMR A;  4KO8 A;  1TWC A;  1SFO A;  1PYQ A;  1VC3 B;  1TWA A;  5DYI A;  4CRZ A;  1E60 A;  2IV2 X;  3HU1 A;  4AZD A;  2WB1 A;  3IR5 A;  2NYA A;  2R93 A;  4KDL A;  1FDO A;  3GTJ A;  2JIR A;  4CRY G;  2JIO A;  3IR6 A;  2YU9 A;  5FTK A;  1E18 A;  1FDI A;  3PLX B;  3O5A A;  3CF2 A;  1K83 A;  1Y1W A;  3GTP A;  4DMR A;  1WCM A;  1PYU B;  2KI8 A;  5C18 A;  1SIW A;  3QQ7 A;  2R7Z A;  1DMS A;  1PQF A;  1R7R A;  1UHE A;  2JA6 A;  4GA6 A;  4D7Z B;  1KQG A;  1CR5 A;  3CQZ A;  4AYB A;  1E61 A;  2V3V A;  2NVX A;  3FKI A;  1Y5I A;  1H5N A;  3OUG A;  5DYG A;  1G8J A;  5B6C A;  2WAQ A;  1QDN A;  3GTO A;  3HU3 A;  1AA6 A;  5T5M D;  3GTK A;  3GTL A;  2E7Z A;  1G8K A;  3HKZ A;  3DMR A;  2JA7 A;  4KOD A;  1I50 A;  4GA5 A;  5GLF A;  2B63 A;  3HU2 A;  5C1B A;  1PT1 A;  1Y4Z A;  5FTJ A;  3TM7 B;  1CZ5 A;  1OGY A;  1TWG A;  1TWF A;  1R9T A;  1TMO A;  2V45 A;  2R92 A;  4CS0 A;  4AAY A;  2VPX A;  3QC8 A;  3QQ8 A;  1WLF A;  2VPZ A;  1S3S A;  4KDI A;  1PT0 A;  3QWZ A;  3GTG A;  2Y0S A;  3GTQ A;  5FTN A;  1EU1 A;  2JIM A;  5FTM A;  4AOK B;  1E5V A;  1E32 A;  1CZ4 A;  1R27 A;  2NAP A;  1Y1V A;  4RV0 A;  3ML1 A;  5EPP A;  1QCS A;  1PQE A;  2VPY A;  2PJH B;  1KQF A;  4AON B;  5T5I D;  1DMR A;  1TWH A;  2PMZ A;  2NVY A;  4C2M A;  2E2I A;  1PPY A;  1YLE A;  2VUM A;  1PQH A;  2JA5 A;  2JIP A;  4QIW A;  1H0H A;  4KLN A;  5FTL A;  1I3Q A;  1Q16 A;  1IW7 D;  2C45 A;  3IR7 A;  3H0G A;  3TIW A;  1UHD A;  2EEO B;  2JIQ A; 
#chains in the Genus database with same CATH topology
 2VPW A;  1AW8 B;  3GTM A;  2E2H A;  3SUK A;  3SUM A;  2DMR A;  4KO8 A;  1TWC A;  1SFO A;  1PYQ A;  1VC3 B;  2A69 D;  1TWA A;  5DYI A;  4JP6 A;  2O5J D;  1N10 A;  4CRZ A;  2YUJ A;  1E60 A;  2IV2 X;  3HU1 A;  4AZD A;  2WB1 A;  3IR5 A;  2NYA A;  2R93 A;  1ZC1 A;  1FDO A;  2ENG A;  1OA7 A;  4KDL A;  3GTJ A;  2JIR A;  4CRY G;  2JIO A;  3IR6 A;  3X2M A;  2YU9 A;  2G6G A;  5FTK A;  4NOH A;  1E18 A;  1FDI A;  3ENG A;  3PLX B;  3O5A A;  3CF2 A;  1K83 A;  1Y1W A;  3X2P A;  1OA9 A;  4DMR A;  1WCM A;  1PYU B;  2KI8 A;  4JJO A;  5C18 A;  3GTP A;  1SIW A;  5GLX A;  1BW4 A;  4JP7 A;  3QQ7 A;  1SMY D;  2R7Z A;  1DMS A;  1PQF A;  1R7R A;  1UHE A;  2JA6 A;  3CZB A;  4GA6 A;  4D7Z B;  1KQG A;  1ZYR D;  1CR5 A;  2A68 D;  3CQZ A;  3X2L A;  4AYB A;  1E61 A;  2V3V A;  3X2K A;  2NVX A;  1YNJ D;  3FKI A;  1Y5I A;  1H5N A;  3OUG A;  4JS7 A;  5DYG A;  3SUJ A;  1G8J A;  3X2H A;  5B6C A;  2WAQ A;  1QDN A;  3GTO A;  3HU3 A;  1AA6 A;  2CW0 D;  5T5M D;  3GTK A;  3GTL A;  2E7Z A;  1G8K A;  2PIC A;  4FG2 A;  3DMR A;  3HKZ A;  3M3G A;  2JA7 A;  4KOD A;  2BE5 D;  1I50 A;  2KQA A;  4GA5 A;  5GLF A;  3X2J A;  2B63 A;  3HU2 A;  5C1B A;  1PT1 A;  1Y4Z A;  2A6E D;  5FTJ A;  3TM7 B;  1L8F A;  4FFT A;  1OGY A;  1TWG A;  1TWF A;  1R9T A;  1CZ5 A;  1TMO A;  2V45 A;  2R92 A;  4CS0 A;  3X2G A;  4ENG A;  4AAY A;  2A6H D;  2VPX A;  3QC8 A;  3QQ8 A;  4ZM7 A;  1WLF A;  2VPZ A;  1S3S A;  4KDI A;  3X2O A;  1PT0 A;  3X2N A;  3QWZ A;  3GTG A;  1WC2 A;  2Y0S A;  3GTQ A;  4AVR A;  2G5D A;  5FTN A;  1EU1 A;  2JIM A;  2PJJ A;  4JCW A;  5FTM A;  2BH0 A;  2PNW A;  4AOK B;  1E5V A;  1E32 A;  1CZ4 A;  1R27 A;  2NAP A;  1Y1V A;  1BW3 A;  4RV0 A;  5GM9 A;  2JIQ A;  3ML1 A;  5EPP A;  1QCS A;  1PQE A;  2PJH B;  2VPY A;  4L48 A;  1KQF A;  4AON B;  5T5I D;  1YNN D;  1DMR A;  3SUL A;  3TIW A;  1TWH A;  2PMZ A;  5H4U A;  2HCZ X;  2NVY A;  3D30 A;  4C2M A;  2E2I A;  1PPY A;  1YLE A;  2GAE A;  1PQH A;  5GLY A;  2VUM A;  2JA5 A;  2AE0 X;  2JIP A;  4QIW A;  1H0H A;  4KLN A;  4FER A;  5FTL A;  1I3Q A;  1Q16 A;  1IW7 D;  2C45 A;  3IR7 A;  3H0G A;  2PI8 A;  3X2I A;  4FG4 A;  1UHD A;  2EEO B;  1HD5 A; 
#chains in the Genus database with same CATH homology
 2VPW A;  1AW8 B;  3GTM A;  2E2H A;  2DMR A;  4KO8 A;  1TWC A;  1SFO A;  1PYQ A;  1VC3 B;  2A69 D;  1TWA A;  5DYI A;  2O5J D;  4CRZ A;  2YUJ A;  1E60 A;  2IV2 X;  3HU1 A;  4AZD A;  2WB1 A;  3IR5 A;  2NYA A;  2R93 A;  1ZC1 A;  1FDO A;  4KDL A;  3GTJ A;  2JIR A;  4CRY G;  2JIO A;  3IR6 A;  2YU9 A;  2G6G A;  5FTK A;  4NOH A;  1E18 A;  1FDI A;  3PLX B;  3O5A A;  3CF2 A;  1K83 A;  1Y1W A;  3GTP A;  4DMR A;  1WCM A;  1PYU B;  2KI8 A;  5C18 A;  1SIW A;  3QQ7 A;  1SMY D;  2R7Z A;  1DMS A;  1PQF A;  1R7R A;  1UHE A;  2JA6 A;  3CZB A;  4GA6 A;  4D7Z B;  1KQG A;  1ZYR D;  1CR5 A;  2A68 D;  3CQZ A;  4AYB A;  1E61 A;  2V3V A;  2NVX A;  1YNJ D;  3FKI A;  1Y5I A;  1H5N A;  3OUG A;  5DYG A;  1G8J A;  5B6C A;  2WAQ A;  1QDN A;  3GTO A;  3HU3 A;  1AA6 A;  2CW0 D;  5T5M D;  3GTK A;  3GTL A;  2E7Z A;  1G8K A;  2PIC A;  3DMR A;  3HKZ A;  2JA7 A;  4KOD A;  2BE5 D;  1I50 A;  4GA5 A;  5GLF A;  2B63 A;  3HU2 A;  5C1B A;  1PT1 A;  2A6E D;  1Y4Z A;  5FTJ A;  3TM7 B;  1CZ5 A;  1OGY A;  1TWG A;  1TWF A;  1R9T A;  1TMO A;  2V45 A;  2R92 A;  4CS0 A;  4AAY A;  2A6H D;  2VPX A;  3QC8 A;  3QQ8 A;  1WLF A;  2VPZ A;  1S3S A;  4KDI A;  1PT0 A;  3QWZ A;  3GTG A;  2Y0S A;  3GTQ A;  2G5D A;  5FTN A;  1EU1 A;  2JIM A;  2PJJ A;  5FTM A;  2PNW A;  4AOK B;  1E5V A;  1E32 A;  1CZ4 A;  1R27 A;  2NAP A;  1Y1V A;  4RV0 A;  3ML1 A;  5EPP A;  1QCS A;  1PQE A;  2PJH B;  2VPY A;  1KQF A;  4AON B;  5T5I D;  1YNN D;  1DMR A;  1TWH A;  2PMZ A;  2NVY A;  4C2M A;  2E2I A;  1PPY A;  1YLE A;  2GAE A;  1PQH A;  2VUM A;  2JA5 A;  2AE0 X;  2JIP A;  4QIW A;  1H0H A;  4KLN A;  5FTL A;  1I3Q A;  1Q16 A;  1IW7 D;  2C45 A;  3IR7 A;  3H0G A;  2PI8 A;  3TIW A;  1UHD A;  2EEO B;  2JIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...