1UHEA

Crystal structure of aspartate decarboxylase, isoaspargine complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 17
structure length 97
sequence length 97
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1uheA00
5GLFA 4DMRA 3GTQA 2E2IA 3QQ8A 5T5MD 3HU3A 4AZDA 1KQGA 1Q16A 1KQFA 1R9TA 2E7ZA 2KI8A 2JA7A 2NVYA 1WCMA 3OUGA 3DMRA 3QC8A 2V3VA 1TMOA 1K83A 1TWAA 1Y1VA 2JIPA 2PMZA 3O5AA 1AW8B 2EEOB 3FKIA 1H0HA 1PT0A 2R92A 2WB1A 4RV0A 3QQ7A 1IW7D 3GTMA 4CRZA 2VPWA 5FTJA 1TWFA 1OGYA 1FDOA 4GA5A 2Y0SA 4AAYA 2C45A 3CF2A 2YU9A 2JIQA 4QIWA 5DYGA 1PYQA 3QWZA 2IV2X 3GTGA 2VPYA 4D7ZB 2PJHB 3GTOA 5C1BA 1PYUB 3PLXB 2JIOA 2JIRA 1UHEA 1QCSA 1PQHA 2DMRA 5DYIA 1E32A 1G8JA 1E18A 3IR7A 2JA5A 2JIMA 5T5ID 5C18A 1DMRA 1UHDA 5FTKA 2NYAA 3HKZA 4CS0A 1SFOA 5FTMA 1G8KA 2NAPA 1CZ5A 1R7RA 1TWHA 3CQZA 1Y1WA 1E5VA 1I50A 1PT1A 2JA6A 2B63A 3TIWA 4C2MA 3IR5A 2E2HA 2VUMA 1EU1A 3GTJA 1SIWA 1TWCA 3GTKA 1R27A 1CR5A 3IR6A 4KODA 2NVXA 4KO8A 1PQEA 4KLNA 1CZ4A 4AYBA 5EPPA 1PPYA 5FTNA 1I3QA 3H0GA 1H5NA 1E61A 2R7ZA 1E60A 4GA6A 2R93A 1TWGA 3GTPA 2V45A 3HU1A 4CRYG 2VPZA 4AOKB 1S3SA 1FDIA 1PQFA 3GTLA 2WAQA 3ML1A 1VC3B 1WLFA 1AA6A 1Y5IA 4KDLA 3TM7B 5B6CA 3HU2A 5FTLA 1Y4ZA 1YLEA 1DMSA 4KDIA 1QDNA 2VPXA 4AONB
chains in the Genus database with same CATH superfamily
5GLFA 4DMRA 2BH0A 3SUJA 3GTQA 2E2IA 5GLXA 3QQ8A 5T5MD 3X2OA 3X2GA 3HU3A 4AZDA 1KQGA 1Q16A 1KQFA 1R9TA 2E7ZA 2KI8A 2JA7A 1WCMA 2ENGA 2NVYA 3DMRA 3OUGA 1ZC1A 1TMOA 2V3VA 3QC8A 4JS7A 1K83A 1N10A 1TWAA 1Y1VA 2JIPA 2PMZA 3O5AA 1AW8B 2EEOB 3FKIA 1BW3A 3ENGA 1H0HA 1L8FA 2A6HD 3X2KA 1PT0A 2R92A 2WB1A 4RV0A 1OA7A 4JJOA 1ZYRD 3QQ7A 1IW7D 3GTMA 4CRZA 3X2LA 3X2MA 2VPWA 1SMYD 5FTJA 1TWFA 1OGYA 1FDOA 4FFTA 2Y0SA 1OA9A 2PNWA 4GA5A 1YNJD 4AAYA 2O5JD 3X2NA 2C45A 3CF2A 2YU9A 2JIQA 4QIWA 5DYGA 1PYQA 3QWZA 2IV2X 3GTGA 2VPYA 4D7ZB 2PJHB 3GTOA 5C1BA 1PYUB 3PLXB 2JIOA 2JIRA 1UHEA 1QCSA 2A69D 1PQHA 1BW4A 2DMRA 5DYIA 1E32A 1G8JA 1E18A 4L48A 3IR7A 2JA5A 3SUMA 2JIMA 5H4UA 5T5ID 5C18A 1DMRA 1UHDA 5FTKA 4NOHA 2NYAA 3HKZA 4CS0A 2YUJA 1SFOA 5FTMA 1G8KA 2NAPA 2CW0D 1YNND 1R7RA 1TWHA 3CQZA 1CZ5A 1Y1WA 1E5VA 3X2HA 1I50A 1PT1A 2G5DA 3CZBA 2A68D 4FG4A 2JA6A 2B63A 3TIWA 4C2MA 2KQAA 3IR5A 2E2HA 3X2JA 5GLYA 2VUMA 2GAEA 2PICA 5GM9A 1EU1A 3X2IA 3GTJA 1SIWA 2AE0X 4AVRA 1TWCA 3SULA 3GTKA 1R27A 1CR5A 3SUKA 3IR6A 2HCZX 4KODA 2NVXA 4ENGA 4KO8A 1PQEA 4KLNA 1CZ4A 3M3GA 4AYBA 5EPPA 1PPYA 5FTNA 1WC2A 3H0GA 1H5NA 2BE5D 1I3QA 1E61A 2R7ZA 1E60A 4GA6A 2R93A 1TWGA 3GTPA 4JCWA 2V45A 3HU1A 4FG2A 4CRYG 2VPZA 4FERA 4AOKB 1S3SA 1FDIA 1PQFA 3GTLA 2WAQA 4JP7A 3ML1A 1VC3B 1WLFA 1HD5A 2PI8A 1AA6A 1Y5IA 4JP6A 2G6GA 4KDLA 3TM7B 5B6CA 3D30A 3HU2A 4ZM7A 5FTLA 2PJJA 1Y4ZA 1YLEA 1DMSA 4KDIA 2A6ED 1QDNA 3X2PA 2VPXA 4AONB
chains in the Genus database with same CATH topology
5GLFA 4DMRA 3GTQA 2E2IA 3QQ8A 5T5MD 3HU3A 4AZDA 1KQGA 1Q16A 1KQFA 1R9TA 2E7ZA 2KI8A 2JA7A 1WCMA 2NVYA 3OUGA 3DMRA 3QC8A 1ZC1A 1TMOA 2V3VA 1K83A 1TWAA 1Y1VA 2JIPA 2PMZA 3O5AA 1AW8B 2EEOB 3FKIA 1H0HA 2A6HD 1PT0A 2R92A 2WB1A 4RV0A 1ZYRD 3QQ7A 1IW7D 3GTMA 4CRZA 2VPWA 1SMYD 5FTJA 1TWFA 1OGYA 1FDOA 4GA5A 2Y0SA 2O5JD 2PNWA 4AAYA 1YNJD 2C45A 3CF2A 2YU9A 2JIQA 4QIWA 5DYGA 1PYQA 3QWZA 2IV2X 3GTGA 2VPYA 4D7ZB 2PJHB 3GTOA 5C1BA 1PYUB 3PLXB 2JIOA 2JIRA 1UHEA 1QCSA 2A69D 1PQHA 2DMRA 5DYIA 1E32A 1G8JA 1E18A 3IR7A 2JA5A 2JIMA 5T5ID 5C18A 1DMRA 1UHDA 5FTKA 4NOHA 2NYAA 3HKZA 4CS0A 2YUJA 1SFOA 5FTMA 1G8KA 2NAPA 2CW0D 1YNND 1R7RA 1TWHA 3CQZA 1CZ5A 1Y1WA 1E5VA 1I50A 1PT1A 2G5DA 3CZBA 2A68D 2JA6A 2B63A 3TIWA 4C2MA 3IR5A 2E2HA 2VUMA 2GAEA 2PICA 1EU1A 3GTJA 1SIWA 2AE0X 1TWCA 3GTKA 1R27A 1CR5A 3IR6A 4KODA 2NVXA 4KO8A 1PQEA 4KLNA 1CZ4A 4AYBA 5EPPA 1PPYA 5FTNA 1I3QA 3H0GA 1H5NA 2BE5D 1E61A 2R7ZA 1E60A 4GA6A 2R93A 1TWGA 3GTPA 2V45A 3HU1A 4CRYG 2VPZA 4AOKB 1S3SA 1FDIA 1PQFA 3GTLA 2WAQA 3ML1A 1VC3B 1WLFA 2PI8A 1AA6A 1Y5IA 4KDLA 2G6GA 3TM7B 5B6CA 3HU2A 5FTLA 2PJJA 1Y4ZA 1YLEA 1DMSA 4KDIA 2A6ED 1QDNA 2VPXA 4AONB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLF A;  4DMR A;  3GTQ A;  2E2I A;  3QQ8 A;  5T5M D;  3HU3 A;  4AZD A;  1KQG A;  1Q16 A;  1KQF A;  1R9T A;  2E7Z A;  2KI8 A;  2JA7 A;  2NVY A;  1WCM A;  3OUG A;  3DMR A;  3QC8 A;  2V3V A;  1TMO A;  1K83 A;  1TWA A;  1Y1V A;  2JIP A;  2PMZ A;  3O5A A;  1AW8 B;  2EEO B;  3FKI A;  1H0H A;  1PT0 A;  2R92 A;  2WB1 A;  4RV0 A;  3QQ7 A;  1IW7 D;  3GTM A;  4CRZ A;  2VPW A;  5FTJ A;  1TWF A;  1OGY A;  1FDO A;  4GA5 A;  2Y0S A;  4AAY A;  2C45 A;  3CF2 A;  2YU9 A;  2JIQ A;  4QIW A;  5DYG A;  1PYQ A;  3QWZ A;  2IV2 X;  3GTG A;  2VPY A;  4D7Z B;  2PJH B;  3GTO A;  5C1B A;  1PYU B;  3PLX B;  2JIO A;  2JIR A;  1UHE A;  1QCS A;  1PQH A;  2DMR A;  5DYI A;  1E32 A;  1G8J A;  1E18 A;  3IR7 A;  2JA5 A;  2JIM A;  5T5I D;  5C18 A;  1DMR A;  1UHD A;  5FTK A;  2NYA A;  3HKZ A;  4CS0 A;  1SFO A;  5FTM A;  1G8K A;  2NAP A;  1CZ5 A;  1R7R A;  1TWH A;  3CQZ A;  1Y1W A;  1E5V A;  1I50 A;  1PT1 A;  2JA6 A;  2B63 A;  3TIW A;  4C2M A;  3IR5 A;  2E2H A;  2VUM A;  1EU1 A;  3GTJ A;  1SIW A;  1TWC A;  3GTK A;  1R27 A;  1CR5 A;  3IR6 A;  4KOD A;  2NVX A;  4KO8 A;  1PQE A;  4KLN A;  1CZ4 A;  4AYB A;  5EPP A;  1PPY A;  5FTN A;  1I3Q A;  3H0G A;  1H5N A;  1E61 A;  2R7Z A;  1E60 A;  4GA6 A;  2R93 A;  1TWG A;  3GTP A;  2V45 A;  3HU1 A;  4CRY G;  2VPZ A;  4AOK B;  1S3S A;  1FDI A;  1PQF A;  3GTL A;  2WAQ A;  3ML1 A;  1VC3 B;  1WLF A;  1AA6 A;  1Y5I A;  4KDL A;  3TM7 B;  5B6C A;  3HU2 A;  5FTL A;  1Y4Z A;  1YLE A;  1DMS A;  4KDI A;  1QDN A;  2VPX A;  4AON B; 
#chains in the Genus database with same CATH topology
 5GLF A;  4DMR A;  2BH0 A;  3SUJ A;  3GTQ A;  2E2I A;  5GLX A;  3QQ8 A;  5T5M D;  3X2O A;  3X2G A;  3HU3 A;  4AZD A;  1KQG A;  1Q16 A;  1KQF A;  1R9T A;  2E7Z A;  2KI8 A;  2JA7 A;  1WCM A;  2ENG A;  2NVY A;  3DMR A;  3OUG A;  1ZC1 A;  1TMO A;  2V3V A;  3QC8 A;  4JS7 A;  1K83 A;  1N10 A;  1TWA A;  1Y1V A;  2JIP A;  2PMZ A;  3O5A A;  1AW8 B;  2EEO B;  3FKI A;  1BW3 A;  3ENG A;  1H0H A;  1L8F A;  2A6H D;  3X2K A;  1PT0 A;  2R92 A;  2WB1 A;  4RV0 A;  1OA7 A;  4JJO A;  1ZYR D;  3QQ7 A;  1IW7 D;  3GTM A;  4CRZ A;  3X2L A;  3X2M A;  2VPW A;  1SMY D;  5FTJ A;  1TWF A;  1OGY A;  1FDO A;  4FFT A;  2Y0S A;  1OA9 A;  2PNW A;  4GA5 A;  1YNJ D;  4AAY A;  2O5J D;  3X2N A;  2C45 A;  3CF2 A;  2YU9 A;  2JIQ A;  4QIW A;  5DYG A;  1PYQ A;  3QWZ A;  2IV2 X;  3GTG A;  2VPY A;  4D7Z B;  2PJH B;  3GTO A;  5C1B A;  1PYU B;  3PLX B;  2JIO A;  2JIR A;  1UHE A;  1QCS A;  2A69 D;  1PQH A;  1BW4 A;  2DMR A;  5DYI A;  1E32 A;  1G8J A;  1E18 A;  4L48 A;  3IR7 A;  2JA5 A;  3SUM A;  2JIM A;  5H4U A;  5T5I D;  5C18 A;  1DMR A;  1UHD A;  5FTK A;  4NOH A;  2NYA A;  3HKZ A;  4CS0 A;  2YUJ A;  1SFO A;  5FTM A;  1G8K A;  2NAP A;  2CW0 D;  1YNN D;  1R7R A;  1TWH A;  3CQZ A;  1CZ5 A;  1Y1W A;  1E5V A;  3X2H A;  1I50 A;  1PT1 A;  2G5D A;  3CZB A;  2A68 D;  4FG4 A;  2JA6 A;  2B63 A;  3TIW A;  4C2M A;  2KQA A;  3IR5 A;  2E2H A;  3X2J A;  5GLY A;  2VUM A;  2GAE A;  2PIC A;  5GM9 A;  1EU1 A;  3X2I A;  3GTJ A;  1SIW A;  2AE0 X;  4AVR A;  1TWC A;  3SUL A;  3GTK A;  1R27 A;  1CR5 A;  3SUK A;  3IR6 A;  2HCZ X;  4KOD A;  2NVX A;  4ENG A;  4KO8 A;  1PQE A;  4KLN A;  1CZ4 A;  3M3G A;  4AYB A;  5EPP A;  1PPY A;  5FTN A;  1WC2 A;  3H0G A;  1H5N A;  2BE5 D;  1I3Q A;  1E61 A;  2R7Z A;  1E60 A;  4GA6 A;  2R93 A;  1TWG A;  3GTP A;  4JCW A;  2V45 A;  3HU1 A;  4FG2 A;  4CRY G;  2VPZ A;  4FER A;  4AOK B;  1S3S A;  1FDI A;  1PQF A;  3GTL A;  2WAQ A;  4JP7 A;  3ML1 A;  1VC3 B;  1WLF A;  1HD5 A;  2PI8 A;  1AA6 A;  1Y5I A;  4JP6 A;  2G6G A;  4KDL A;  3TM7 B;  5B6C A;  3D30 A;  3HU2 A;  4ZM7 A;  5FTL A;  2PJJ A;  1Y4Z A;  1YLE A;  1DMS A;  4KDI A;  2A6E D;  1QDN A;  3X2P A;  2VPX A;  4AON B; 
#chains in the Genus database with same CATH homology
 5GLF A;  4DMR A;  3GTQ A;  2E2I A;  3QQ8 A;  5T5M D;  3HU3 A;  4AZD A;  1KQG A;  1Q16 A;  1KQF A;  1R9T A;  2E7Z A;  2KI8 A;  2JA7 A;  1WCM A;  2NVY A;  3OUG A;  3DMR A;  3QC8 A;  1ZC1 A;  1TMO A;  2V3V A;  1K83 A;  1TWA A;  1Y1V A;  2JIP A;  2PMZ A;  3O5A A;  1AW8 B;  2EEO B;  3FKI A;  1H0H A;  2A6H D;  1PT0 A;  2R92 A;  2WB1 A;  4RV0 A;  1ZYR D;  3QQ7 A;  1IW7 D;  3GTM A;  4CRZ A;  2VPW A;  1SMY D;  5FTJ A;  1TWF A;  1OGY A;  1FDO A;  4GA5 A;  2Y0S A;  2O5J D;  2PNW A;  4AAY A;  1YNJ D;  2C45 A;  3CF2 A;  2YU9 A;  2JIQ A;  4QIW A;  5DYG A;  1PYQ A;  3QWZ A;  2IV2 X;  3GTG A;  2VPY A;  4D7Z B;  2PJH B;  3GTO A;  5C1B A;  1PYU B;  3PLX B;  2JIO A;  2JIR A;  1UHE A;  1QCS A;  2A69 D;  1PQH A;  2DMR A;  5DYI A;  1E32 A;  1G8J A;  1E18 A;  3IR7 A;  2JA5 A;  2JIM A;  5T5I D;  5C18 A;  1DMR A;  1UHD A;  5FTK A;  4NOH A;  2NYA A;  3HKZ A;  4CS0 A;  2YUJ A;  1SFO A;  5FTM A;  1G8K A;  2NAP A;  2CW0 D;  1YNN D;  1R7R A;  1TWH A;  3CQZ A;  1CZ5 A;  1Y1W A;  1E5V A;  1I50 A;  1PT1 A;  2G5D A;  3CZB A;  2A68 D;  2JA6 A;  2B63 A;  3TIW A;  4C2M A;  3IR5 A;  2E2H A;  2VUM A;  2GAE A;  2PIC A;  1EU1 A;  3GTJ A;  1SIW A;  2AE0 X;  1TWC A;  3GTK A;  1R27 A;  1CR5 A;  3IR6 A;  4KOD A;  2NVX A;  4KO8 A;  1PQE A;  4KLN A;  1CZ4 A;  4AYB A;  5EPP A;  1PPY A;  5FTN A;  1I3Q A;  3H0G A;  1H5N A;  2BE5 D;  1E61 A;  2R7Z A;  1E60 A;  4GA6 A;  2R93 A;  1TWG A;  3GTP A;  2V45 A;  3HU1 A;  4CRY G;  2VPZ A;  4AOK B;  1S3S A;  1FDI A;  1PQF A;  3GTL A;  2WAQ A;  3ML1 A;  1VC3 B;  1WLF A;  2PI8 A;  1AA6 A;  1Y5I A;  4KDL A;  2G6G A;  3TM7 B;  5B6C A;  3HU2 A;  5FTL A;  2PJJ A;  1Y4Z A;  1YLE A;  1DMS A;  4KDI A;  2A6E D;  1QDN A;  2VPX A;  4AON B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...