1UHEA

Crystal structure of aspartate decarboxylase, isoaspargine complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 17
structure length 97
sequence length 97
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1uheA00
2VPWA 4AAYA 3O5AA 1I50A 2E2HA 3QC8A 2NAPA 1CR5A 3TIWA 1FDOA 1AW8B 1TWGA 3H0GA 2Y0SA 1DMRA 2PJHB 4CS0A 3HU3A 1PQHA 1S3SA 4AZDA 4DMRA 3GTPA 1H0HA 2DMRA 2VPYA 3HU1A 5DYGA 4QIWA 2R7ZA 1TMOA 1H5NA 2V3VA 5FTLA 1KQFA 1EU1A 1UHEA 1AA6A 1PPYA 3TM7B 1E60A 1Y5IA 3CQZA 2C45A 2JIPA 5DYIA 2EEOB 2NYAA 5FTKA 4GA5A 3CF2A 3QQ7A 1R9TA 1PT1A 3FKIA 1TWAA 3GTJA 5EPPA 1IW7D 1QCSA 2JIOA 1SIWA 2WB1A 2B63A 3DMRA 2IV2X 1PT0A 3GTGA 2E7ZA 1PYQA 1Q16A 4KODA 2YU9A 3GTOA 1WCMA 1OGYA 2R93A 2VUMA 2WAQA 3GTLA 3OUGA 2JA7A 5FTMA 2PMZA 1Y1VA 1VC3B 1E61A 4RV0A 1K83A 3PLXB 5C18A 2NVXA 2JA6A 2NVYA 1CZ4A 1R7RA 3IR6A 1G8KA 1PYUB 1G8JA 1I3QA 1PQEA 5T5MD 1Y1WA 1SFOA 2VPXA 1QDNA 5T5ID 1WLFA 4KDIA 1FDIA 3HU2A 4AYBA 3ML1A 4CRYG 1TWHA 5FTNA 4CRZA 3IR7A 1R27A 1E32A 4KLNA 4GA6A 2JIRA 2R92A 4KDLA 3GTKA 4C2MA 1E5VA 5GLFA 1UHDA 2VPZA 1TWFA 3IR5A 5C1BA 4AONB 2JIQA 1DMSA 4D7ZB 2V45A 3QWZA 1CZ5A 3HKZA 2JA5A 1Y4ZA 5FTJA 5B6CA 2KI8A 3QQ8A 1E18A 1TWCA 2E2IA 4KO8A 3GTMA 1PQFA 3GTQA 4AOKB 2JIMA 1KQGA 1YLEA
chains in the Genus database with same CATH superfamily
2VPWA 4AAYA 3O5AA 1I50A 3X2KA 2E2HA 3QC8A 2NAPA 3SUMA 1CR5A 3TIWA 1FDOA 3D30A 1AW8B 1TWGA 3H0GA 2Y0SA 1DMRA 2PJHB 4L48A 4CS0A 1YNND 3HU3A 1PQHA 1S3SA 1ZYRD 4AZDA 4DMRA 3GTPA 1H0HA 2DMRA 4JP7A 3X2HA 5GLYA 2VPYA 3HU1A 5DYGA 4QIWA 2R7ZA 4FG2A 1TMOA 1H5NA 2V3VA 5FTLA 2G5DA 1EU1A 1KQFA 1HD5A 1UHEA 2ENGA 2G6GA 5H4UA 1AA6A 1PPYA 3TM7B 1E60A 1Y5IA 3CQZA 2C45A 2BE5D 2JIPA 5DYIA 2EEOB 2NYAA 4FG4A 4GA5A 5FTKA 1OA7A 2AE0X 3CF2A 3QQ7A 2A6HD 2CW0D 4FERA 1R9TA 1PT1A 4FFTA 3FKIA 1TWAA 3GTJA 5EPPA 1IW7D 1QCSA 2JIOA 2GAEA 3X2MA 5GM9A 1SIWA 2WB1A 2B63A 3DMRA 2IV2X 2PNWA 1PT0A 3GTGA 2E7ZA 2PJJA 1PYQA 1Q16A 4KODA 1OA9A 2YU9A 3GTOA 1WCMA 3X2GA 3X2OA 1OGYA 2R93A 2VUMA 2WAQA 4JJOA 4ENGA 3GTLA 3OUGA 2JA7A 5FTMA 2PMZA 1Y1VA 3ENGA 1VC3B 1E61A 4RV0A 1K83A 3PLXB 4JP6A 3X2PA 5C18A 2NVXA 2JA6A 2NVYA 3CZBA 1N10A 1CZ4A 1R7RA 3SUJA 3IR6A 1G8KA 1PYUB 3SULA 1G8JA 4ZM7A 1I3QA 1PQEA 5T5MD 1Y1WA 1SFOA 2VPXA 1QDNA 2KQAA 5T5ID 1WLFA 4KDIA 1FDIA 3HU2A 2BH0A 4AYBA 3ML1A 3SUKA 1YNJD 4CRYG 2A69D 1TWHA 1ZC1A 4JS7A 5FTNA 4CRZA 4JCWA 3IR7A 1R27A 1E32A 1SMYD 1WC2A 4KLNA 3X2NA 4GA6A 2JIRA 2R92A 3X2JA 2PI8A 4KDLA 3GTKA 4C2MA 1E5VA 5GLFA 1UHDA 2A6ED 3X2IA 2VPZA 1TWFA 3IR5A 4NOHA 4AONB 5C1BA 2O5JD 2JIQA 3X2LA 1DMSA 4D7ZB 2V45A 3QWZA 1CZ5A 3HKZA 2YUJA 2JA5A 1BW3A 1Y4ZA 5FTJA 5B6CA 4AVRA 2HCZX 2KI8A 3QQ8A 1E18A 1L8FA 5GLXA 1TWCA 2E2IA 4KO8A 2A68D 3M3GA 3GTMA 1PQFA 3GTQA 4AOKB 2JIMA 1KQGA 1BW4A 1YLEA 2PICA
chains in the Genus database with same CATH topology
2VPWA 4AAYA 3O5AA 1I50A 2E2HA 3QC8A 2NAPA 1CR5A 3TIWA 1FDOA 1AW8B 1TWGA 3H0GA 2Y0SA 1DMRA 2PJHB 4CS0A 1YNND 3HU3A 1PQHA 1S3SA 1ZYRD 4AZDA 4DMRA 3GTPA 1H0HA 2DMRA 2VPYA 3HU1A 5DYGA 4QIWA 2R7ZA 1TMOA 1H5NA 2V3VA 5FTLA 2G5DA 1EU1A 1KQFA 1UHEA 2G6GA 1AA6A 1PPYA 3TM7B 1E60A 1Y5IA 3CQZA 2C45A 2JIPA 2BE5D 5DYIA 2EEOB 2NYAA 5FTKA 4GA5A 2AE0X 3CF2A 3QQ7A 2A6HD 2CW0D 1R9TA 1PT1A 3FKIA 1TWAA 3GTJA 5EPPA 1IW7D 1QCSA 2JIOA 2GAEA 1SIWA 2WB1A 2B63A 3DMRA 2IV2X 2PNWA 1PT0A 3GTGA 2E7ZA 2PJJA 1PYQA 1Q16A 4KODA 2YU9A 3GTOA 1WCMA 1OGYA 2R93A 2VUMA 2WAQA 3GTLA 3OUGA 2JA7A 5FTMA 2PMZA 1Y1VA 1VC3B 1E61A 4RV0A 1K83A 3PLXB 5C18A 2NVXA 2JA6A 2NVYA 3CZBA 1CZ4A 1R7RA 3IR6A 1G8KA 1PYUB 1G8JA 1I3QA 1PQEA 5T5MD 1Y1WA 1SFOA 2VPXA 1QDNA 5T5ID 1WLFA 4KDIA 1FDIA 3HU2A 4AYBA 3ML1A 1YNJD 4CRYG 2A69D 1TWHA 1ZC1A 5FTNA 4CRZA 3IR7A 1R27A 1E32A 1SMYD 4KLNA 4GA6A 2JIRA 2R92A 2PI8A 4KDLA 3GTKA 4C2MA 1E5VA 5GLFA 1UHDA 2A6ED 2VPZA 1TWFA 3IR5A 4NOHA 4AONB 5C1BA 2O5JD 2JIQA 1DMSA 4D7ZB 2V45A 3QWZA 1CZ5A 3HKZA 2YUJA 2JA5A 1Y4ZA 5FTJA 5B6CA 2KI8A 3QQ8A 1E18A 1TWCA 2E2IA 4KO8A 2A68D 3GTMA 1PQFA 3GTQA 4AOKB 2JIMA 1KQGA 1YLEA 2PICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPW A;  4AAY A;  3O5A A;  1I50 A;  2E2H A;  3QC8 A;  2NAP A;  1CR5 A;  3TIW A;  1FDO A;  1AW8 B;  1TWG A;  3H0G A;  2Y0S A;  1DMR A;  2PJH B;  4CS0 A;  3HU3 A;  1PQH A;  1S3S A;  4AZD A;  4DMR A;  3GTP A;  1H0H A;  2DMR A;  2VPY A;  3HU1 A;  5DYG A;  4QIW A;  2R7Z A;  1TMO A;  1H5N A;  2V3V A;  5FTL A;  1KQF A;  1EU1 A;  1UHE A;  1AA6 A;  1PPY A;  3TM7 B;  1E60 A;  1Y5I A;  3CQZ A;  2C45 A;  2JIP A;  5DYI A;  2EEO B;  2NYA A;  5FTK A;  4GA5 A;  3CF2 A;  3QQ7 A;  1R9T A;  1PT1 A;  3FKI A;  1TWA A;  3GTJ A;  5EPP A;  1IW7 D;  1QCS A;  2JIO A;  1SIW A;  2WB1 A;  2B63 A;  3DMR A;  2IV2 X;  1PT0 A;  3GTG A;  2E7Z A;  1PYQ A;  1Q16 A;  4KOD A;  2YU9 A;  3GTO A;  1WCM A;  1OGY A;  2R93 A;  2VUM A;  2WAQ A;  3GTL A;  3OUG A;  2JA7 A;  5FTM A;  2PMZ A;  1Y1V A;  1VC3 B;  1E61 A;  4RV0 A;  1K83 A;  3PLX B;  5C18 A;  2NVX A;  2JA6 A;  2NVY A;  1CZ4 A;  1R7R A;  3IR6 A;  1G8K A;  1PYU B;  1G8J A;  1I3Q A;  1PQE A;  5T5M D;  1Y1W A;  1SFO A;  2VPX A;  1QDN A;  5T5I D;  1WLF A;  4KDI A;  1FDI A;  3HU2 A;  4AYB A;  3ML1 A;  4CRY G;  1TWH A;  5FTN A;  4CRZ A;  3IR7 A;  1R27 A;  1E32 A;  4KLN A;  4GA6 A;  2JIR A;  2R92 A;  4KDL A;  3GTK A;  4C2M A;  1E5V A;  5GLF A;  1UHD A;  2VPZ A;  1TWF A;  3IR5 A;  5C1B A;  4AON B;  2JIQ A;  1DMS A;  4D7Z B;  2V45 A;  3QWZ A;  1CZ5 A;  3HKZ A;  2JA5 A;  1Y4Z A;  5FTJ A;  5B6C A;  2KI8 A;  3QQ8 A;  1E18 A;  1TWC A;  2E2I A;  4KO8 A;  3GTM A;  1PQF A;  3GTQ A;  4AOK B;  2JIM A;  1KQG A;  1YLE A; 
#chains in the Genus database with same CATH topology
 2VPW A;  4AAY A;  3O5A A;  1I50 A;  3X2K A;  2E2H A;  3QC8 A;  2NAP A;  3SUM A;  1CR5 A;  3TIW A;  1FDO A;  3D30 A;  1AW8 B;  1TWG A;  3H0G A;  2Y0S A;  1DMR A;  2PJH B;  4L48 A;  4CS0 A;  1YNN D;  3HU3 A;  1PQH A;  1S3S A;  1ZYR D;  4AZD A;  4DMR A;  3GTP A;  1H0H A;  2DMR A;  4JP7 A;  3X2H A;  5GLY A;  2VPY A;  3HU1 A;  5DYG A;  4QIW A;  2R7Z A;  4FG2 A;  1TMO A;  1H5N A;  2V3V A;  5FTL A;  2G5D A;  1EU1 A;  1KQF A;  1HD5 A;  1UHE A;  2ENG A;  2G6G A;  5H4U A;  1AA6 A;  1PPY A;  3TM7 B;  1E60 A;  1Y5I A;  3CQZ A;  2C45 A;  2BE5 D;  2JIP A;  5DYI A;  2EEO B;  2NYA A;  4FG4 A;  4GA5 A;  5FTK A;  1OA7 A;  2AE0 X;  3CF2 A;  3QQ7 A;  2A6H D;  2CW0 D;  4FER A;  1R9T A;  1PT1 A;  4FFT A;  3FKI A;  1TWA A;  3GTJ A;  5EPP A;  1IW7 D;  1QCS A;  2JIO A;  2GAE A;  3X2M A;  5GM9 A;  1SIW A;  2WB1 A;  2B63 A;  3DMR A;  2IV2 X;  2PNW A;  1PT0 A;  3GTG A;  2E7Z A;  2PJJ A;  1PYQ A;  1Q16 A;  4KOD A;  1OA9 A;  2YU9 A;  3GTO A;  1WCM A;  3X2G A;  3X2O A;  1OGY A;  2R93 A;  2VUM A;  2WAQ A;  4JJO A;  4ENG A;  3GTL A;  3OUG A;  2JA7 A;  5FTM A;  2PMZ A;  1Y1V A;  3ENG A;  1VC3 B;  1E61 A;  4RV0 A;  1K83 A;  3PLX B;  4JP6 A;  3X2P A;  5C18 A;  2NVX A;  2JA6 A;  2NVY A;  3CZB A;  1N10 A;  1CZ4 A;  1R7R A;  3SUJ A;  3IR6 A;  1G8K A;  1PYU B;  3SUL A;  1G8J A;  4ZM7 A;  1I3Q A;  1PQE A;  5T5M D;  1Y1W A;  1SFO A;  2VPX A;  1QDN A;  2KQA A;  5T5I D;  1WLF A;  4KDI A;  1FDI A;  3HU2 A;  2BH0 A;  4AYB A;  3ML1 A;  3SUK A;  1YNJ D;  4CRY G;  2A69 D;  1TWH A;  1ZC1 A;  4JS7 A;  5FTN A;  4CRZ A;  4JCW A;  3IR7 A;  1R27 A;  1E32 A;  1SMY D;  1WC2 A;  4KLN A;  3X2N A;  4GA6 A;  2JIR A;  2R92 A;  3X2J A;  2PI8 A;  4KDL A;  3GTK A;  4C2M A;  1E5V A;  5GLF A;  1UHD A;  2A6E D;  3X2I A;  2VPZ A;  1TWF A;  3IR5 A;  4NOH A;  4AON B;  5C1B A;  2O5J D;  2JIQ A;  3X2L A;  1DMS A;  4D7Z B;  2V45 A;  3QWZ A;  1CZ5 A;  3HKZ A;  2YUJ A;  2JA5 A;  1BW3 A;  1Y4Z A;  5FTJ A;  5B6C A;  4AVR A;  2HCZ X;  2KI8 A;  3QQ8 A;  1E18 A;  1L8F A;  5GLX A;  1TWC A;  2E2I A;  4KO8 A;  2A68 D;  3M3G A;  3GTM A;  1PQF A;  3GTQ A;  4AOK B;  2JIM A;  1KQG A;  1BW4 A;  1YLE A;  2PIC A; 
#chains in the Genus database with same CATH homology
 2VPW A;  4AAY A;  3O5A A;  1I50 A;  2E2H A;  3QC8 A;  2NAP A;  1CR5 A;  3TIW A;  1FDO A;  1AW8 B;  1TWG A;  3H0G A;  2Y0S A;  1DMR A;  2PJH B;  4CS0 A;  1YNN D;  3HU3 A;  1PQH A;  1S3S A;  1ZYR D;  4AZD A;  4DMR A;  3GTP A;  1H0H A;  2DMR A;  2VPY A;  3HU1 A;  5DYG A;  4QIW A;  2R7Z A;  1TMO A;  1H5N A;  2V3V A;  5FTL A;  2G5D A;  1EU1 A;  1KQF A;  1UHE A;  2G6G A;  1AA6 A;  1PPY A;  3TM7 B;  1E60 A;  1Y5I A;  3CQZ A;  2C45 A;  2JIP A;  2BE5 D;  5DYI A;  2EEO B;  2NYA A;  5FTK A;  4GA5 A;  2AE0 X;  3CF2 A;  3QQ7 A;  2A6H D;  2CW0 D;  1R9T A;  1PT1 A;  3FKI A;  1TWA A;  3GTJ A;  5EPP A;  1IW7 D;  1QCS A;  2JIO A;  2GAE A;  1SIW A;  2WB1 A;  2B63 A;  3DMR A;  2IV2 X;  2PNW A;  1PT0 A;  3GTG A;  2E7Z A;  2PJJ A;  1PYQ A;  1Q16 A;  4KOD A;  2YU9 A;  3GTO A;  1WCM A;  1OGY A;  2R93 A;  2VUM A;  2WAQ A;  3GTL A;  3OUG A;  2JA7 A;  5FTM A;  2PMZ A;  1Y1V A;  1VC3 B;  1E61 A;  4RV0 A;  1K83 A;  3PLX B;  5C18 A;  2NVX A;  2JA6 A;  2NVY A;  3CZB A;  1CZ4 A;  1R7R A;  3IR6 A;  1G8K A;  1PYU B;  1G8J A;  1I3Q A;  1PQE A;  5T5M D;  1Y1W A;  1SFO A;  2VPX A;  1QDN A;  5T5I D;  1WLF A;  4KDI A;  1FDI A;  3HU2 A;  4AYB A;  3ML1 A;  1YNJ D;  4CRY G;  2A69 D;  1TWH A;  1ZC1 A;  5FTN A;  4CRZ A;  3IR7 A;  1R27 A;  1E32 A;  1SMY D;  4KLN A;  4GA6 A;  2JIR A;  2R92 A;  2PI8 A;  4KDL A;  3GTK A;  4C2M A;  1E5V A;  5GLF A;  1UHD A;  2A6E D;  2VPZ A;  1TWF A;  3IR5 A;  4NOH A;  4AON B;  5C1B A;  2O5J D;  2JIQ A;  1DMS A;  4D7Z B;  2V45 A;  3QWZ A;  1CZ5 A;  3HKZ A;  2YUJ A;  2JA5 A;  1Y4Z A;  5FTJ A;  5B6C A;  2KI8 A;  3QQ8 A;  1E18 A;  1TWC A;  2E2I A;  4KO8 A;  2A68 D;  3GTM A;  1PQF A;  3GTQ A;  4AOK B;  2JIM A;  1KQG A;  1YLE A;  2PIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...