1UHEA

Crystal structure of aspartate decarboxylase, isoaspargine complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
pubmed doi rcsb
source organism Helicobacter pylori
total genus 17
structure length 97
sequence length 97
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1uheA00
3ML1A 1TWGA 1CZ4A 3GTMA 2JA6A 3HU2A 1SFOA 1PYUB 1PQHA 1I50A 1PT0A 3QWZA 1PPYA 4GA6A 3GTPA 1WCMA 2NVYA 3HU3A 2VUMA 1PQFA 2JIQA 2JA7A 1EU1A 3QQ7A 5B6CA 2NAPA 4KODA 1SIWA 4CRYG 2WB1A 1VC3B 2DMRA 3FKIA 2JIRA 1I3QA 2VPXA 1PYQA 1WLFA 1FDIA 1AW8B 4KO8A 2PJHB 2JIMA 4RV0A 3HKZA 1KQFA 1H5NA 3DMRA 2Y0SA 4CRZA 2PMZA 2JIOA 1QCSA 3H0GA 1UHDA 1R9TA 4C2MA 3QQ8A 3QC8A 1Y1VA 4QIWA 1G8KA 4D7ZB 2V45A 1E18A 2NYAA 3O5AA 3OUGA 5FTMA 1S3SA 5C18A 2VPYA 4GA5A 3CQZA 2R7ZA 1Y1WA 1TWFA 2B63A 3GTQA 2C45A 2E2HA 1KQGA 3TM7B 4AAYA 2JIPA 1PQEA 4DMRA 3IR5A 2R92A 3IR6A 4AOKB 1TMOA 3GTLA 1H0HA 3IR7A 5FTKA 3GTJA 3TIWA 3GTKA 5T5MD 4AONB 4AZDA 1E60A 4AYBA 3GTGA 2E2IA 5EPPA 1PT1A 2YU9A 1QDNA 2R93A 1FDOA 1CR5A 1IW7D 1E61A 2V3VA 5DYGA 2EEOB 1E32A 1Y5IA 3GTOA 4KDLA 1Y4ZA 2IV2X 3HU1A 5FTLA 2VPWA 5T5ID 4CS0A 5FTJA 5C1BA 2VPZA 1E5VA 1R7RA 4KDIA 5GLFA 1DMRA 2E7ZA 1TWHA 2KI8A 3CF2A 1OGYA 1AA6A 2NVXA 1G8JA 2WAQA 5FTNA 1Q16A 1UHEA 3PLXB 1TWCA 1YLEA 2JA5A 5DYIA 4KLNA 1R27A 1CZ5A 1TWAA 1K83A 1DMSA
chains in the Genus database with same CATH superfamily
3ML1A 1TWGA 1N10A 1CZ4A 3M3GA 3GTMA 3HU2A 2JA6A 4FG2A 1PYUB 1SFOA 1PQHA 1I50A 1PT0A 3QWZA 1PPYA 4GA6A 1WC2A 3GTPA 1WCMA 2NVYA 3HU3A 2VUMA 1PQFA 2JIQA 2JA7A 5GLYA 2PI8A 3SUKA 1EU1A 3QQ7A 5B6CA 2NAPA 4KODA 1SIWA 3X2MA 4CRYG 2WB1A 1VC3B 2DMRA 4ZM7A 2ENGA 3FKIA 2KQAA 2JIRA 1I3QA 2VPXA 1PYQA 1WLFA 1FDIA 1AW8B 4KO8A 2PICA 2PJHB 2JIMA 4RV0A 5GLXA 3HKZA 1KQFA 3X2PA 1H5NA 3DMRA 2Y0SA 3X2KA 4CRZA 2PMZA 2JIOA 4JP6A 1BW4A 1OA7A 3X2HA 2CW0D 3X2JA 1QCSA 3H0GA 1UHDA 1R9TA 3X2IA 3ENGA 4C2MA 3QQ8A 3QC8A 1Y1VA 2O5JD 4QIWA 1OA9A 1G8KA 3SULA 4D7ZB 2V45A 1E18A 3CZBA 2G6GA 2NYAA 3O5AA 3OUGA 5FTMA 1S3SA 1YNND 5C18A 2VPYA 2YUJA 4GA5A 3CQZA 2A6HD 2BH0A 4FERA 2R7ZA 1Y1WA 1TWFA 4JS7A 2B63A 2AE0X 3GTQA 1SMYD 2C45A 2E2HA 1ZYRD 5H4UA 2BE5D 1KQGA 3TM7B 3X2LA 4AAYA 2JIPA 1PQEA 4DMRA 3IR5A 2R92A 3IR6A 4AOKB 1TMOA 4ENGA 3GTLA 1H0HA 3IR7A 5FTKA 3GTJA 3TIWA 3GTKA 5T5MD 4AONB 4AZDA 1BW3A 1E60A 4JP7A 4AYBA 3GTGA 2E2IA 2HCZX 5EPPA 1PT1A 2YU9A 1QDNA 2R93A 2A6ED 1FDOA 1CR5A 1IW7D 1E61A 2V3VA 4L48A 5DYGA 4FFTA 2A68D 2EEOB 1E32A 3D30A 1Y5IA 3GTOA 4KDLA 1Y4ZA 2IV2X 3X2GA 3HU1A 4NOHA 1ZC1A 5FTLA 2VPWA 5T5ID 4CS0A 1L8FA 5FTJA 2GAEA 5C1BA 2A69D 2VPZA 1E5VA 2PNWA 1R7RA 4KDIA 2PJJA 5GLFA 1DMRA 4JCWA 2E7ZA 1TWHA 1HD5A 2KI8A 4FG4A 3CF2A 1OGYA 1AA6A 2NVXA 1G8JA 2G5DA 2WAQA 5FTNA 3SUJA 3X2NA 1Q16A 1UHEA 3PLXB 1TWCA 1YLEA 2JA5A 4AVRA 1YNJD 5DYIA 4JJOA 3SUMA 4KLNA 1R27A 5GM9A 1CZ5A 1TWAA 1K83A 1DMSA 3X2OA
chains in the Genus database with same CATH topology
3ML1A 1TWGA 1CZ4A 3GTMA 2JA6A 3HU2A 1SFOA 1PYUB 1PQHA 1I50A 1PT0A 3QWZA 1PPYA 4GA6A 3GTPA 1WCMA 2NVYA 3HU3A 2VUMA 1PQFA 2JIQA 2JA7A 2PI8A 1EU1A 3QQ7A 5B6CA 2NAPA 4KODA 1SIWA 4CRYG 2WB1A 1VC3B 2DMRA 3FKIA 2JIRA 1I3QA 2VPXA 1PYQA 1WLFA 1FDIA 1AW8B 4KO8A 2PICA 2PJHB 2JIMA 4RV0A 3HKZA 1KQFA 1H5NA 3DMRA 2Y0SA 4CRZA 2PMZA 2JIOA 2CW0D 1QCSA 3H0GA 1UHDA 1R9TA 4C2MA 3QQ8A 3QC8A 1Y1VA 2O5JD 4QIWA 1G8KA 4D7ZB 2V45A 1E18A 3CZBA 2G6GA 2NYAA 3O5AA 3OUGA 5FTMA 1S3SA 1YNND 5C18A 2VPYA 2YUJA 4GA5A 3CQZA 2A6HD 2R7ZA 1Y1WA 1TWFA 2B63A 2AE0X 3GTQA 1SMYD 2C45A 2E2HA 1ZYRD 2BE5D 1KQGA 3TM7B 4AAYA 2JIPA 1PQEA 4DMRA 3IR5A 2R92A 3IR6A 4AOKB 1TMOA 3GTLA 1H0HA 3IR7A 5FTKA 3GTJA 3TIWA 3GTKA 5T5MD 4AONB 4AZDA 1E60A 4AYBA 3GTGA 2E2IA 5EPPA 1PT1A 2YU9A 1QDNA 2R93A 2A6ED 1FDOA 1CR5A 1IW7D 1E61A 2V3VA 5DYGA 2A68D 2EEOB 1E32A 1Y5IA 3GTOA 4KDLA 1Y4ZA 2IV2X 3HU1A 4NOHA 1ZC1A 5FTLA 2VPWA 5T5ID 4CS0A 5FTJA 2GAEA 5C1BA 2A69D 2VPZA 1E5VA 2PNWA 1R7RA 4KDIA 2PJJA 5GLFA 1DMRA 2E7ZA 1TWHA 2KI8A 3CF2A 1OGYA 1AA6A 2NVXA 1G8JA 2G5DA 2WAQA 5FTNA 1Q16A 1UHEA 3PLXB 1TWCA 1YLEA 2JA5A 1YNJD 5DYIA 4KLNA 1R27A 1CZ5A 1TWAA 1K83A 1DMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML1 A;  1TWG A;  1CZ4 A;  3GTM A;  2JA6 A;  3HU2 A;  1SFO A;  1PYU B;  1PQH A;  1I50 A;  1PT0 A;  3QWZ A;  1PPY A;  4GA6 A;  3GTP A;  1WCM A;  2NVY A;  3HU3 A;  2VUM A;  1PQF A;  2JIQ A;  2JA7 A;  1EU1 A;  3QQ7 A;  5B6C A;  2NAP A;  4KOD A;  1SIW A;  4CRY G;  2WB1 A;  1VC3 B;  2DMR A;  3FKI A;  2JIR A;  1I3Q A;  2VPX A;  1PYQ A;  1WLF A;  1FDI A;  1AW8 B;  4KO8 A;  2PJH B;  2JIM A;  4RV0 A;  3HKZ A;  1KQF A;  1H5N A;  3DMR A;  2Y0S A;  4CRZ A;  2PMZ A;  2JIO A;  1QCS A;  3H0G A;  1UHD A;  1R9T A;  4C2M A;  3QQ8 A;  3QC8 A;  1Y1V A;  4QIW A;  1G8K A;  4D7Z B;  2V45 A;  1E18 A;  2NYA A;  3O5A A;  3OUG A;  5FTM A;  1S3S A;  5C18 A;  2VPY A;  4GA5 A;  3CQZ A;  2R7Z A;  1Y1W A;  1TWF A;  2B63 A;  3GTQ A;  2C45 A;  2E2H A;  1KQG A;  3TM7 B;  4AAY A;  2JIP A;  1PQE A;  4DMR A;  3IR5 A;  2R92 A;  3IR6 A;  4AOK B;  1TMO A;  3GTL A;  1H0H A;  3IR7 A;  5FTK A;  3GTJ A;  3TIW A;  3GTK A;  5T5M D;  4AON B;  4AZD A;  1E60 A;  4AYB A;  3GTG A;  2E2I A;  5EPP A;  1PT1 A;  2YU9 A;  1QDN A;  2R93 A;  1FDO A;  1CR5 A;  1IW7 D;  1E61 A;  2V3V A;  5DYG A;  2EEO B;  1E32 A;  1Y5I A;  3GTO A;  4KDL A;  1Y4Z A;  2IV2 X;  3HU1 A;  5FTL A;  2VPW A;  5T5I D;  4CS0 A;  5FTJ A;  5C1B A;  2VPZ A;  1E5V A;  1R7R A;  4KDI A;  5GLF A;  1DMR A;  2E7Z A;  1TWH A;  2KI8 A;  3CF2 A;  1OGY A;  1AA6 A;  2NVX A;  1G8J A;  2WAQ A;  5FTN A;  1Q16 A;  1UHE A;  3PLX B;  1TWC A;  1YLE A;  2JA5 A;  5DYI A;  4KLN A;  1R27 A;  1CZ5 A;  1TWA A;  1K83 A;  1DMS A; 
#chains in the Genus database with same CATH topology
 3ML1 A;  1TWG A;  1N10 A;  1CZ4 A;  3M3G A;  3GTM A;  3HU2 A;  2JA6 A;  4FG2 A;  1PYU B;  1SFO A;  1PQH A;  1I50 A;  1PT0 A;  3QWZ A;  1PPY A;  4GA6 A;  1WC2 A;  3GTP A;  1WCM A;  2NVY A;  3HU3 A;  2VUM A;  1PQF A;  2JIQ A;  2JA7 A;  5GLY A;  2PI8 A;  3SUK A;  1EU1 A;  3QQ7 A;  5B6C A;  2NAP A;  4KOD A;  1SIW A;  3X2M A;  4CRY G;  2WB1 A;  1VC3 B;  2DMR A;  4ZM7 A;  2ENG A;  3FKI A;  2KQA A;  2JIR A;  1I3Q A;  2VPX A;  1PYQ A;  1WLF A;  1FDI A;  1AW8 B;  4KO8 A;  2PIC A;  2PJH B;  2JIM A;  4RV0 A;  5GLX A;  3HKZ A;  1KQF A;  3X2P A;  1H5N A;  3DMR A;  2Y0S A;  3X2K A;  4CRZ A;  2PMZ A;  2JIO A;  4JP6 A;  1BW4 A;  1OA7 A;  3X2H A;  2CW0 D;  3X2J A;  1QCS A;  3H0G A;  1UHD A;  1R9T A;  3X2I A;  3ENG A;  4C2M A;  3QQ8 A;  3QC8 A;  1Y1V A;  2O5J D;  4QIW A;  1OA9 A;  1G8K A;  3SUL A;  4D7Z B;  2V45 A;  1E18 A;  3CZB A;  2G6G A;  2NYA A;  3O5A A;  3OUG A;  5FTM A;  1S3S A;  1YNN D;  5C18 A;  2VPY A;  2YUJ A;  4GA5 A;  3CQZ A;  2A6H D;  2BH0 A;  4FER A;  2R7Z A;  1Y1W A;  1TWF A;  4JS7 A;  2B63 A;  2AE0 X;  3GTQ A;  1SMY D;  2C45 A;  2E2H A;  1ZYR D;  5H4U A;  2BE5 D;  1KQG A;  3TM7 B;  3X2L A;  4AAY A;  2JIP A;  1PQE A;  4DMR A;  3IR5 A;  2R92 A;  3IR6 A;  4AOK B;  1TMO A;  4ENG A;  3GTL A;  1H0H A;  3IR7 A;  5FTK A;  3GTJ A;  3TIW A;  3GTK A;  5T5M D;  4AON B;  4AZD A;  1BW3 A;  1E60 A;  4JP7 A;  4AYB A;  3GTG A;  2E2I A;  2HCZ X;  5EPP A;  1PT1 A;  2YU9 A;  1QDN A;  2R93 A;  2A6E D;  1FDO A;  1CR5 A;  1IW7 D;  1E61 A;  2V3V A;  4L48 A;  5DYG A;  4FFT A;  2A68 D;  2EEO B;  1E32 A;  3D30 A;  1Y5I A;  3GTO A;  4KDL A;  1Y4Z A;  2IV2 X;  3X2G A;  3HU1 A;  4NOH A;  1ZC1 A;  5FTL A;  2VPW A;  5T5I D;  4CS0 A;  1L8F A;  5FTJ A;  2GAE A;  5C1B A;  2A69 D;  2VPZ A;  1E5V A;  2PNW A;  1R7R A;  4KDI A;  2PJJ A;  5GLF A;  1DMR A;  4JCW A;  2E7Z A;  1TWH A;  1HD5 A;  2KI8 A;  4FG4 A;  3CF2 A;  1OGY A;  1AA6 A;  2NVX A;  1G8J A;  2G5D A;  2WAQ A;  5FTN A;  3SUJ A;  3X2N A;  1Q16 A;  1UHE A;  3PLX B;  1TWC A;  1YLE A;  2JA5 A;  4AVR A;  1YNJ D;  5DYI A;  4JJO A;  3SUM A;  4KLN A;  1R27 A;  5GM9 A;  1CZ5 A;  1TWA A;  1K83 A;  1DMS A;  3X2O A; 
#chains in the Genus database with same CATH homology
 3ML1 A;  1TWG A;  1CZ4 A;  3GTM A;  2JA6 A;  3HU2 A;  1SFO A;  1PYU B;  1PQH A;  1I50 A;  1PT0 A;  3QWZ A;  1PPY A;  4GA6 A;  3GTP A;  1WCM A;  2NVY A;  3HU3 A;  2VUM A;  1PQF A;  2JIQ A;  2JA7 A;  2PI8 A;  1EU1 A;  3QQ7 A;  5B6C A;  2NAP A;  4KOD A;  1SIW A;  4CRY G;  2WB1 A;  1VC3 B;  2DMR A;  3FKI A;  2JIR A;  1I3Q A;  2VPX A;  1PYQ A;  1WLF A;  1FDI A;  1AW8 B;  4KO8 A;  2PIC A;  2PJH B;  2JIM A;  4RV0 A;  3HKZ A;  1KQF A;  1H5N A;  3DMR A;  2Y0S A;  4CRZ A;  2PMZ A;  2JIO A;  2CW0 D;  1QCS A;  3H0G A;  1UHD A;  1R9T A;  4C2M A;  3QQ8 A;  3QC8 A;  1Y1V A;  2O5J D;  4QIW A;  1G8K A;  4D7Z B;  2V45 A;  1E18 A;  3CZB A;  2G6G A;  2NYA A;  3O5A A;  3OUG A;  5FTM A;  1S3S A;  1YNN D;  5C18 A;  2VPY A;  2YUJ A;  4GA5 A;  3CQZ A;  2A6H D;  2R7Z A;  1Y1W A;  1TWF A;  2B63 A;  2AE0 X;  3GTQ A;  1SMY D;  2C45 A;  2E2H A;  1ZYR D;  2BE5 D;  1KQG A;  3TM7 B;  4AAY A;  2JIP A;  1PQE A;  4DMR A;  3IR5 A;  2R92 A;  3IR6 A;  4AOK B;  1TMO A;  3GTL A;  1H0H A;  3IR7 A;  5FTK A;  3GTJ A;  3TIW A;  3GTK A;  5T5M D;  4AON B;  4AZD A;  1E60 A;  4AYB A;  3GTG A;  2E2I A;  5EPP A;  1PT1 A;  2YU9 A;  1QDN A;  2R93 A;  2A6E D;  1FDO A;  1CR5 A;  1IW7 D;  1E61 A;  2V3V A;  5DYG A;  2A68 D;  2EEO B;  1E32 A;  1Y5I A;  3GTO A;  4KDL A;  1Y4Z A;  2IV2 X;  3HU1 A;  4NOH A;  1ZC1 A;  5FTL A;  2VPW A;  5T5I D;  4CS0 A;  5FTJ A;  2GAE A;  5C1B A;  2A69 D;  2VPZ A;  1E5V A;  2PNW A;  1R7R A;  4KDI A;  2PJJ A;  5GLF A;  1DMR A;  2E7Z A;  1TWH A;  2KI8 A;  3CF2 A;  1OGY A;  1AA6 A;  2NVX A;  1G8J A;  2G5D A;  2WAQ A;  5FTN A;  1Q16 A;  1UHE A;  3PLX B;  1TWC A;  1YLE A;  2JA5 A;  1YNJ D;  5DYI A;  4KLN A;  1R27 A;  1CZ5 A;  1TWA A;  1K83 A;  1DMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...