1HD5A

Endoglucanase from humicola insolens at 1.7a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
205
Chain Sequence
ADGKSTRYWDCCKPSCGWAKKAPVNQPVFSCNANFQRLTDFDAKSGCEPGGVAYSCADQTPWAVNDDFAFGFAATSIAGSNEAGWCCACYELTFTSGPVAGKKMVVQSTSTSNHFDLNIPGGGVGIFDGCTPQFGGLPGQRYGGISSRNECDRFPDALKPGCYWRFDWFKNADNPSFSFRQVQCPAELVARTGCRRNDDGNFPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
publication title Endoglucanase from Humicola Insolens at 1.7A Resolution
rcsb
total genus 64
structure length 205
sequence length 210
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1hd5A00
2KQAA 3X2IA 4JP6A 3X2NA 3SUKA 3X2MA 3X2HA 2ENGA 2PICA 2HCZX 4ENGA 4JJOA 3M3GA 3SUMA 3SUJA 3X2KA 1OA7A 3X2GA 4FG2A 3X2LA 4AVRA 2PJJA 2PI8A 2AE0X 1OA9A 3X2JA 2BH0A 1WC2A 3X2OA 1BW4A 2PNWA 4FERA 3D30A 2GAEA 5H4UA 5GLYA 3CZBA 4ZM7A 1HD5A 4L48A 3X2PA 3SULA 5GLXA 1L8FA 4JP7A 5GM9A 4FFTA 1BW3A 4JS7A 1N10A 3ENGA 4FG4A 2G5DA 2G6GA 4JCWA
chains in the Genus database with same CATH superfamily
3H0GA 3X2IA 3SUKA 3X2MA 2A6HD 2PICA 2HCZX 1TWAA 2JA6A 3M3GA 1CR5A 3IR7A 1OA7A 3X2KA 1QCSA 1H5NA 3HU1A 4AOKB 5DYGA 3GTJA 2KI8A 3X2OA 3D30A 2PMZA 1K83A 5H4UA 1PYQA 5GLYA 4KDIA 3OUGA 4ZM7A 4AAYA 1UHDA 4RV0A 1PYUB 3X2PA 3HKZA 3SULA 2E2IA 1UHEA 1QDNA 5T5MD 4JP7A 1CZ4A 5GM9A 1I3QA 3QQ7A 1TMOA 4CS0A 5GLFA 1N10A 1TWFA 1E5VA 2Y0SA 1I50A 1DMSA 2IV2X 2KQAA 4AYBA 3X2NA 2JIOA 1E18A 4ENGA 4JJOA 1VC3B 3SUMA 3IR5A 2PJHB 2E7ZA 3X2GA 2R92A 4KODA 5FTMA 4AVRA 1AA6A 2C45A 1PT0A 1KQFA 3GTQA 2NVXA 5EPPA 1PQEA 4KLNA 4NOHA 1DMRA 4DMRA 1TWGA 2VPYA 2WAQA 1R9TA 1HD5A 1Y1VA 2A69D 1FDIA 1L8FA 2VPWA 1EU1A 4GA5A 4AZDA 1YNJD 2VUMA 1SIWA 3SUJA 4FG4A 3GTGA 2G5DA 2JIRA 2G6GA 2V3VA 3HU3A 3O5AA 3DMRA 4JCWA 2B63A 3QQ8A 4GA6A 1KQGA 3X2HA 2ENGA 1E61A 1ZC1A 2JIQA 2V45A 3GTKA 1TWCA 4FG2A 3X2LA 3GTOA 5FTNA 1E32A 2PJJA 1R7RA 1WLFA 3QWZA 2JA7A 1OA9A 3X2JA 2BH0A 4KDLA 4QIWA 3TIWA 1PPYA 2NAPA 4FERA 1BW4A 1SMYD 5C18A 1Y5IA 2BE5D 5T5ID 5B6CA 2CW0D 2JIPA 2EEOB 1Y1WA 2WB1A 2VPXA 1CZ5A 2NYAA 4D7ZB 5GLXA 1Y4ZA 3ML1A 1H0HA 2YUJA 4FFTA 3GTLA 5C1BA 1Q16A 3IR6A 4JS7A 3ENGA 1PQHA 1AW8B 2A6ED 1IW7D 1E60A 1SFOA 4CRYG 2DMRA 2E2HA 2JA5A 4JP6A 3FKIA 1FDOA 1YNND 4CRZA 4C2MA 1ZYRD 1G8JA 1PQFA 3QC8A 2R7ZA 2R93A 2NVYA 5DYIA 5FTJA 1R27A 2PI8A 1TWHA 2AE0X 5FTKA 3GTPA 1PT1A 1WC2A 5FTLA 3TM7B 2PNWA 2GAEA 3PLXB 1YLEA 3CZBA 4L48A 4KO8A 1G8KA 3GTMA 1S3SA 2VPZA 3CQZA 1WCMA 2O5JD 3HU2A 2A68D 2YU9A 2JIMA 1BW3A 3CF2A 1OGYA 4AONB
chains in the Genus database with same CATH topology
2KQAA 3X2IA 4JP6A 3X2NA 3SUKA 3X2MA 3X2HA 2ENGA 2PICA 2HCZX 4ENGA 4JJOA 3M3GA 3SUMA 3SUJA 3X2KA 1OA7A 3X2GA 4FG2A 3X2LA 4AVRA 2PJJA 2PI8A 2AE0X 1OA9A 3X2JA 2BH0A 1WC2A 3X2OA 1BW4A 2PNWA 4FERA 3D30A 2GAEA 5H4UA 5GLYA 3CZBA 4ZM7A 1HD5A 4L48A 3X2PA 3SULA 5GLXA 1L8FA 4JP7A 5GM9A 4FFTA 1BW3A 4JS7A 1N10A 3ENGA 4FG4A 2G5DA 2G6GA 4JCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQA A;  3X2I A;  4JP6 A;  3X2N A;  3SUK A;  3X2M A;  3X2H A;  2ENG A;  2PIC A;  2HCZ X;  4ENG A;  4JJO A;  3M3G A;  3SUM A;  3SUJ A;  3X2K A;  1OA7 A;  3X2G A;  4FG2 A;  3X2L A;  4AVR A;  2PJJ A;  2PI8 A;  2AE0 X;  1OA9 A;  3X2J A;  2BH0 A;  1WC2 A;  3X2O A;  1BW4 A;  2PNW A;  4FER A;  3D30 A;  2GAE A;  5H4U A;  5GLY A;  3CZB A;  4ZM7 A;  1HD5 A;  4L48 A;  3X2P A;  3SUL A;  5GLX A;  1L8F A;  4JP7 A;  5GM9 A;  4FFT A;  1BW3 A;  4JS7 A;  1N10 A;  3ENG A;  4FG4 A;  2G5D A;  2G6G A;  4JCW A; 
#chains in the Genus database with same CATH topology
 3H0G A;  3X2I A;  3SUK A;  3X2M A;  2A6H D;  2PIC A;  2HCZ X;  1TWA A;  2JA6 A;  3M3G A;  1CR5 A;  3IR7 A;  1OA7 A;  3X2K A;  1QCS A;  1H5N A;  3HU1 A;  4AOK B;  5DYG A;  3GTJ A;  2KI8 A;  3X2O A;  3D30 A;  2PMZ A;  1K83 A;  5H4U A;  1PYQ A;  5GLY A;  4KDI A;  3OUG A;  4ZM7 A;  4AAY A;  1UHD A;  4RV0 A;  1PYU B;  3X2P A;  3HKZ A;  3SUL A;  2E2I A;  1UHE A;  1QDN A;  5T5M D;  4JP7 A;  1CZ4 A;  5GM9 A;  1I3Q A;  3QQ7 A;  1TMO A;  4CS0 A;  5GLF A;  1N10 A;  1TWF A;  1E5V A;  2Y0S A;  1I50 A;  1DMS A;  2IV2 X;  2KQA A;  4AYB A;  3X2N A;  2JIO A;  1E18 A;  4ENG A;  4JJO A;  1VC3 B;  3SUM A;  3IR5 A;  2PJH B;  2E7Z A;  3X2G A;  2R92 A;  4KOD A;  5FTM A;  4AVR A;  1AA6 A;  2C45 A;  1PT0 A;  1KQF A;  3GTQ A;  2NVX A;  5EPP A;  1PQE A;  4KLN A;  4NOH A;  1DMR A;  4DMR A;  1TWG A;  2VPY A;  2WAQ A;  1R9T A;  1HD5 A;  1Y1V A;  2A69 D;  1FDI A;  1L8F A;  2VPW A;  1EU1 A;  4GA5 A;  4AZD A;  1YNJ D;  2VUM A;  1SIW A;  3SUJ A;  4FG4 A;  3GTG A;  2G5D A;  2JIR A;  2G6G A;  2V3V A;  3HU3 A;  3O5A A;  3DMR A;  4JCW A;  2B63 A;  3QQ8 A;  4GA6 A;  1KQG A;  3X2H A;  2ENG A;  1E61 A;  1ZC1 A;  2JIQ A;  2V45 A;  3GTK A;  1TWC A;  4FG2 A;  3X2L A;  3GTO A;  5FTN A;  1E32 A;  2PJJ A;  1R7R A;  1WLF A;  3QWZ A;  2JA7 A;  1OA9 A;  3X2J A;  2BH0 A;  4KDL A;  4QIW A;  3TIW A;  1PPY A;  2NAP A;  4FER A;  1BW4 A;  1SMY D;  5C18 A;  1Y5I A;  2BE5 D;  5T5I D;  5B6C A;  2CW0 D;  2JIP A;  2EEO B;  1Y1W A;  2WB1 A;  2VPX A;  1CZ5 A;  2NYA A;  4D7Z B;  5GLX A;  1Y4Z A;  3ML1 A;  1H0H A;  2YUJ A;  4FFT A;  3GTL A;  5C1B A;  1Q16 A;  3IR6 A;  4JS7 A;  3ENG A;  1PQH A;  1AW8 B;  2A6E D;  1IW7 D;  1E60 A;  1SFO A;  4CRY G;  2DMR A;  2E2H A;  2JA5 A;  4JP6 A;  3FKI A;  1FDO A;  1YNN D;  4CRZ A;  4C2M A;  1ZYR D;  1G8J A;  1PQF A;  3QC8 A;  2R7Z A;  2R93 A;  2NVY A;  5DYI A;  5FTJ A;  1R27 A;  2PI8 A;  1TWH A;  2AE0 X;  5FTK A;  3GTP A;  1PT1 A;  1WC2 A;  5FTL A;  3TM7 B;  2PNW A;  2GAE A;  3PLX B;  1YLE A;  3CZB A;  4L48 A;  4KO8 A;  1G8K A;  3GTM A;  1S3S A;  2VPZ A;  3CQZ A;  1WCM A;  2O5J D;  3HU2 A;  2A68 D;  2YU9 A;  2JIM A;  1BW3 A;  3CF2 A;  1OGY A;  4AON B; 
#chains in the Genus database with same CATH homology
 2KQA A;  3X2I A;  4JP6 A;  3X2N A;  3SUK A;  3X2M A;  3X2H A;  2ENG A;  2PIC A;  2HCZ X;  4ENG A;  4JJO A;  3M3G A;  3SUM A;  3SUJ A;  3X2K A;  1OA7 A;  3X2G A;  4FG2 A;  3X2L A;  4AVR A;  2PJJ A;  2PI8 A;  2AE0 X;  1OA9 A;  3X2J A;  2BH0 A;  1WC2 A;  3X2O A;  1BW4 A;  2PNW A;  4FER A;  3D30 A;  2GAE A;  5H4U A;  5GLY A;  3CZB A;  4ZM7 A;  1HD5 A;  4L48 A;  3X2P A;  3SUL A;  5GLX A;  1L8F A;  4JP7 A;  5GM9 A;  4FFT A;  1BW3 A;  4JS7 A;  1N10 A;  3ENG A;  4FG4 A;  2G5D A;  2G6G A;  4JCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...