1HD5A

Endoglucanase from humicola insolens at 1.7a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
205
Chain Sequence
ADGKSTRYWDCCKPSCGWAKKAPVNQPVFSCNANFQRLTDFDAKSGCEPGGVAYSCADQTPWAVNDDFAFGFAATSIAGSNEAGWCCACYELTFTSGPVAGKKMVVQSTSTSNHFDLNIPGGGVGIFDGCTPQFGGLPGQRYGGISSRNECDRFPDALKPGCYWRFDWFKNADNPSFSFRQVQCPAELVARTGCRRNDDGNFPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Endoglucanase from Humicola Insolens at 1.7A Resolution
rcsb
molecule tags Hydrolase
total genus 64
structure length 205
sequence length 210
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1hd5A00
2BH0A 4FERA 2PI8A 2PICA 3M3GA 3SULA 5GM9A 2AE0X 3X2LA 4L48A 3X2OA 2G6GA 4FFTA 1WC2A 5H4UA 2ENGA 2PNWA 3X2KA 3X2PA 3D30A 1OA9A 4JP7A 3ENGA 3SUJA 3X2NA 2HCZX 5GLXA 4AVRA 4JCWA 3SUMA 3X2HA 4JS7A 4ENGA 2KQAA 2G5DA 3X2GA 1BW3A 3X2IA 3X2MA 4FG2A 4ZM7A 1HD5A 4FG4A 4JP6A 1OA7A 4JJOA 5GLYA 3CZBA 2PJJA 1L8FA 3X2JA 1BW4A 2GAEA 3SUKA 1N10A
chains in the Genus database with same CATH superfamily
2JIPA 1E60A 4FERA 1PT1A 2PMZA 4KDIA 2YU9A 5FTKA 2R7ZA 2AE0X 2JIMA 2VPWA 1QCSA 2A68D 1OGYA 3X2LA 5C18A 2G6GA 4FFTA 4GA5A 5H4UA 4RV0A 4C2MA 1PQFA 3FKIA 3X2PA 5C1BA 1SIWA 3TM7B 1FDIA 3GTOA 1YNJD 1SFOA 2JA6A 2HCZX 5GLXA 2NVXA 3X2HA 1AA6A 2BE5D 4JS7A 4AYBA 2E2IA 2WB1A 3O5AA 3GTPA 2DMRA 1KQGA 2VPXA 4ZM7A 4JP6A 3X2JA 1L8FA 1ZYRD 2E7ZA 2NYAA 4KDLA 4DMRA 2YUJA 1WLFA 2PICA 1G8JA 2A6HD 2V3VA 1E5VA 1H5NA 2JA5A 2JIRA 1CR5A 2EEOB 2VPYA 3H0GA 1CZ5A 3HU3A 3OUGA 1TWHA 1WC2A 2ENGA 4AOKB 5B6CA 1Y4ZA 3X2KA 3D30A 5EPPA 1QDNA 1PQHA 1VC3B 3HU1A 3X2NA 2Y0SA 4AVRA 3SUMA 2KQAA 4NOHA 4KO8A 1E32A 1KQFA 1SMYD 4FG2A 1Y1VA 1S3SA 3IR7A 3HKZA 1Y5IA 5DYGA 1BW4A 2JIQA 2KI8A 2VPZA 2E2HA 3SUKA 1TMOA 1N10A 1PQEA 3GTQA 1Y1WA 2BH0A 3M3GA 1ZC1A 3SULA 5GM9A 2A6ED 2WAQA 3TIWA 2IV2X 5FTMA 1I3QA 3QQ7A 1FDOA 5FTNA 1DMSA 5FTJA 1EU1A 2PJHB 1IW7D 2PNWA 2V45A 1PYUB 3ML1A 5DYIA 3QC8A 3HU2A 4JP7A 4QIWA 3ENGA 3SUJA 1R27A 3IR6A 1PPYA 4JCWA 4ENGA 3GTJA 3GTLA 2G5DA 3IR5A 1YLEA 3X2GA 1BW3A 1TWGA 3X2MA 1CZ4A 3GTMA 5GLFA 1R9TA 1HD5A 4FG4A 1OA7A 4JJOA 5GLYA 3CZBA 3GTGA 2GAEA 1UHDA 4KLNA 2PI8A 4CRZA 1PYQA 5T5MD 4AONB 2R92A 3CQZA 3CF2A 2B63A 4AZDA 4D7ZB 2O5JD 1YNND 4L48A 3X2OA 4CRYG 5T5ID 3QWZA 1Q16A 1TWFA 1OA9A 2R93A 2CW0D 4AAYA 1DMRA 3QQ8A 4GA6A 2VUMA 2NAPA 1E18A 1E61A 1AW8B 1K83A 1TWCA 4CS0A 2JA7A 1G8KA 1WCMA 3PLXB 1H0HA 3X2IA 1I50A 4KODA 1PT0A 3GTKA 2C45A 2PJJA 1UHEA 3DMRA 1TWAA 2JIOA 5FTLA 2NVYA 1R7RA 2A69D
chains in the Genus database with same CATH topology
2BH0A 4FERA 2PI8A 2PICA 3M3GA 3SULA 5GM9A 2AE0X 3X2LA 4L48A 3X2OA 2G6GA 4FFTA 1WC2A 5H4UA 2ENGA 2PNWA 3X2KA 3X2PA 3D30A 1OA9A 4JP7A 3ENGA 3SUJA 3X2NA 2HCZX 5GLXA 4AVRA 4JCWA 3SUMA 3X2HA 4JS7A 4ENGA 2KQAA 2G5DA 3X2GA 1BW3A 3X2IA 3X2MA 4FG2A 4ZM7A 1HD5A 4FG4A 4JP6A 1OA7A 4JJOA 5GLYA 3CZBA 2PJJA 1L8FA 3X2JA 1BW4A 2GAEA 3SUKA 1N10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH0 A;  4FER A;  2PI8 A;  2PIC A;  3M3G A;  3SUL A;  5GM9 A;  2AE0 X;  3X2L A;  4L48 A;  3X2O A;  2G6G A;  4FFT A;  1WC2 A;  5H4U A;  2ENG A;  2PNW A;  3X2K A;  3X2P A;  3D30 A;  1OA9 A;  4JP7 A;  3ENG A;  3SUJ A;  3X2N A;  2HCZ X;  5GLX A;  4AVR A;  4JCW A;  3SUM A;  3X2H A;  4JS7 A;  4ENG A;  2KQA A;  2G5D A;  3X2G A;  1BW3 A;  3X2I A;  3X2M A;  4FG2 A;  4ZM7 A;  1HD5 A;  4FG4 A;  4JP6 A;  1OA7 A;  4JJO A;  5GLY A;  3CZB A;  2PJJ A;  1L8F A;  3X2J A;  1BW4 A;  2GAE A;  3SUK A;  1N10 A; 
#chains in the Genus database with same CATH topology
 2JIP A;  1E60 A;  4FER A;  1PT1 A;  2PMZ A;  4KDI A;  2YU9 A;  5FTK A;  2R7Z A;  2AE0 X;  2JIM A;  2VPW A;  1QCS A;  2A68 D;  1OGY A;  3X2L A;  5C18 A;  2G6G A;  4FFT A;  4GA5 A;  5H4U A;  4RV0 A;  4C2M A;  1PQF A;  3FKI A;  3X2P A;  5C1B A;  1SIW A;  3TM7 B;  1FDI A;  3GTO A;  1YNJ D;  1SFO A;  2JA6 A;  2HCZ X;  5GLX A;  2NVX A;  3X2H A;  1AA6 A;  2BE5 D;  4JS7 A;  4AYB A;  2E2I A;  2WB1 A;  3O5A A;  3GTP A;  2DMR A;  1KQG A;  2VPX A;  4ZM7 A;  4JP6 A;  3X2J A;  1L8F A;  1ZYR D;  2E7Z A;  2NYA A;  4KDL A;  4DMR A;  2YUJ A;  1WLF A;  2PIC A;  1G8J A;  2A6H D;  2V3V A;  1E5V A;  1H5N A;  2JA5 A;  2JIR A;  1CR5 A;  2EEO B;  2VPY A;  3H0G A;  1CZ5 A;  3HU3 A;  3OUG A;  1TWH A;  1WC2 A;  2ENG A;  4AOK B;  5B6C A;  1Y4Z A;  3X2K A;  3D30 A;  5EPP A;  1QDN A;  1PQH A;  1VC3 B;  3HU1 A;  3X2N A;  2Y0S A;  4AVR A;  3SUM A;  2KQA A;  4NOH A;  4KO8 A;  1E32 A;  1KQF A;  1SMY D;  4FG2 A;  1Y1V A;  1S3S A;  3IR7 A;  3HKZ A;  1Y5I A;  5DYG A;  1BW4 A;  2JIQ A;  2KI8 A;  2VPZ A;  2E2H A;  3SUK A;  1TMO A;  1N10 A;  1PQE A;  3GTQ A;  1Y1W A;  2BH0 A;  3M3G A;  1ZC1 A;  3SUL A;  5GM9 A;  2A6E D;  2WAQ A;  3TIW A;  2IV2 X;  5FTM A;  1I3Q A;  3QQ7 A;  1FDO A;  5FTN A;  1DMS A;  5FTJ A;  1EU1 A;  2PJH B;  1IW7 D;  2PNW A;  2V45 A;  1PYU B;  3ML1 A;  5DYI A;  3QC8 A;  3HU2 A;  4JP7 A;  4QIW A;  3ENG A;  3SUJ A;  1R27 A;  3IR6 A;  1PPY A;  4JCW A;  4ENG A;  3GTJ A;  3GTL A;  2G5D A;  3IR5 A;  1YLE A;  3X2G A;  1BW3 A;  1TWG A;  3X2M A;  1CZ4 A;  3GTM A;  5GLF A;  1R9T A;  1HD5 A;  4FG4 A;  1OA7 A;  4JJO A;  5GLY A;  3CZB A;  3GTG A;  2GAE A;  1UHD A;  4KLN A;  2PI8 A;  4CRZ A;  1PYQ A;  5T5M D;  4AON B;  2R92 A;  3CQZ A;  3CF2 A;  2B63 A;  4AZD A;  4D7Z B;  2O5J D;  1YNN D;  4L48 A;  3X2O A;  4CRY G;  5T5I D;  3QWZ A;  1Q16 A;  1TWF A;  1OA9 A;  2R93 A;  2CW0 D;  4AAY A;  1DMR A;  3QQ8 A;  4GA6 A;  2VUM A;  2NAP A;  1E18 A;  1E61 A;  1AW8 B;  1K83 A;  1TWC A;  4CS0 A;  2JA7 A;  1G8K A;  1WCM A;  3PLX B;  1H0H A;  3X2I A;  1I50 A;  4KOD A;  1PT0 A;  3GTK A;  2C45 A;  2PJJ A;  1UHE A;  3DMR A;  1TWA A;  2JIO A;  5FTL A;  2NVY A;  1R7R A;  2A69 D; 
#chains in the Genus database with same CATH homology
 2BH0 A;  4FER A;  2PI8 A;  2PIC A;  3M3G A;  3SUL A;  5GM9 A;  2AE0 X;  3X2L A;  4L48 A;  3X2O A;  2G6G A;  4FFT A;  1WC2 A;  5H4U A;  2ENG A;  2PNW A;  3X2K A;  3X2P A;  3D30 A;  1OA9 A;  4JP7 A;  3ENG A;  3SUJ A;  3X2N A;  2HCZ X;  5GLX A;  4AVR A;  4JCW A;  3SUM A;  3X2H A;  4JS7 A;  4ENG A;  2KQA A;  2G5D A;  3X2G A;  1BW3 A;  3X2I A;  3X2M A;  4FG2 A;  4ZM7 A;  1HD5 A;  4FG4 A;  4JP6 A;  1OA7 A;  4JJO A;  5GLY A;  3CZB A;  2PJJ A;  1L8F A;  3X2J A;  1BW4 A;  2GAE A;  3SUK A;  1N10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...