1HD5A

Endoglucanase from humicola insolens at 1.7a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
205
Chain Sequence
ADGKSTRYWDCCKPSCGWAKKAPVNQPVFSCNANFQRLTDFDAKSGCEPGGVAYSCADQTPWAVNDDFAFGFAATSIAGSNEAGWCCACYELTFTSGPVAGKKMVVQSTSTSNHFDLNIPGGGVGIFDGCTPQFGGLPGQRYGGISSRNECDRFPDALKPGCYWRFDWFKNADNPSFSFRQVQCPAELVARTGCRRNDDGNFPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Endoglucanase from Humicola Insolens at 1.7A Resolution
rcsb
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
total genus 64
structure length 205
sequence length 210
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1hd5A00
1OA9A 3X2IA 5GM9A 4JS7A 2KQAA 3X2KA 1BW4A 3SUMA 3SUJA 3X2LA 4FG2A 4L48A 3X2MA 1N10A 1OA7A 3D30A 4ENGA 2PICA 1WC2A 3X2HA 1BW3A 2BH0A 4JP7A 3M3GA 4JP6A 4FG4A 2HCZX 2G5DA 4FFTA 2PNWA 1L8FA 5GLXA 2AE0X 3X2OA 4FERA 2PI8A 4JJOA 5GLYA 3SULA 1HD5A 3X2GA 4AVRA 3X2JA 3SUKA 4ZM7A 3CZBA 4JCWA 2ENGA 2G6GA 2PJJA 5H4UA 3X2NA 3X2PA 2GAEA 3ENGA
chains in the Genus database with same CATH superfamily
2R7ZA 3H0GA 2JA5A 1E60A 2VPXA 2KQAA 1TWGA 2JIQA 1G8JA 2VPZA 3SUJA 4AONB 1I50A 1N10A 1OA7A 2JIRA 3D30A 4AYBA 4ENGA 1K83A 3HU2A 3DMRA 1Y1WA 2NVXA 1WC2A 3CF2A 3X2HA 3TIWA 4JP7A 1VC3B 5DYGA 1EU1A 2NVYA 2HCZX 1TWHA 1YLEA 1DMSA 3PLXB 1QDNA 3QWZA 5GLXA 1SMYD 1YNJD 2VPWA 4AAYA 2PI8A 1FDIA 1PYQA 1AA6A 1FDOA 1S3SA 1OGYA 2PMZA 1CZ4A 2E2IA 3IR7A 2E7ZA 5T5ID 2R92A 3ENGA 3CQZA 1E32A 2V45A 3SUMA 1WLFA 3QQ8A 4L48A 4D7ZB 2PJHB 2NAPA 4KDLA 1PT1A 1BW3A 1IW7D 3TM7B 4JP6A 4QIWA 4AOKB 1Y1VA 4GA6A 1TWAA 2A68D 1Q16A 1R7RA 2PNWA 4FFTA 2JIPA 3X2OA 4FERA 2JA7A 4JJOA 1H5NA 1QCSA 1HD5A 1TWFA 1PQFA 5GLYA 3GTPA 1PYUB 5GLFA 4DMRA 5FTLA 4ZM7A 3CZBA 5T5MD 3IR6A 1E18A 5H4UA 3X2PA 1ZC1A 1AW8B 2C45A 1TWCA 1CR5A 2IV2X 3GTGA 1OA9A 5EPPA 5C1BA 4CRZA 2YU9A 5FTJA 1H0HA 3X2LA 4FG2A 2WB1A 3GTLA 1Y5IA 3ML1A 3QQ7A 4C2MA 4RV0A 2YUJA 2JIMA 4CRYG 2BH0A 4CS0A 3M3GA 4KODA 1I3QA 4FG4A 4NOHA 2O5JD 2A6HD 2KI8A 3HKZA 2G5DA 1TMOA 1CZ5A 1PT0A 1L8FA 2EEOB 2A69D 5B6CA 1E61A 3SULA 2B63A 3GTQA 1R27A 5C18A 3X2JA 4KDIA 2WAQA 4JCWA 2ENGA 1YNND 2PJJA 2V3VA 2DMRA 5DYIA 3X2IA 5GM9A 4JS7A 3X2KA 1SFOA 2E2HA 1BW4A 1G8KA 1WCMA 2BE5D 2CW0D 2Y0SA 4GA5A 3X2MA 4AZDA 3GTOA 3O5AA 2NYAA 3GTJA 3HU3A 1DMRA 2R93A 2A6ED 2PICA 1R9TA 3GTMA 1UHDA 4KLNA 4KO8A 2VPYA 1KQFA 1UHEA 2JA6A 3OUGA 3GTKA 3HU1A 2AE0X 1SIWA 2JIOA 3FKIA 1E5VA 1KQGA 1PPYA 3IR5A 3X2GA 4AVRA 1Y4ZA 5FTMA 1PQHA 3SUKA 1PQEA 2VUMA 3QC8A 5FTNA 2G6GA 5FTKA 3X2NA 1ZYRD 2GAEA
chains in the Genus database with same CATH topology
1OA9A 3X2IA 5GM9A 4JS7A 2KQAA 3X2KA 1BW4A 3SUMA 3SUJA 3X2LA 4FG2A 4L48A 3X2MA 1N10A 1OA7A 3D30A 4ENGA 2PICA 1WC2A 3X2HA 1BW3A 2BH0A 4JP7A 3M3GA 4JP6A 4FG4A 2HCZX 2G5DA 4FFTA 2PNWA 1L8FA 5GLXA 2AE0X 3X2OA 4FERA 2PI8A 4JJOA 5GLYA 3SULA 1HD5A 3X2GA 4AVRA 3X2JA 3SUKA 4ZM7A 3CZBA 4JCWA 2ENGA 2G6GA 2PJJA 5H4UA 3X2NA 3X2PA 2GAEA 3ENGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OA9 A;  3X2I A;  5GM9 A;  4JS7 A;  2KQA A;  3X2K A;  1BW4 A;  3SUM A;  3SUJ A;  3X2L A;  4FG2 A;  4L48 A;  3X2M A;  1N10 A;  1OA7 A;  3D30 A;  4ENG A;  2PIC A;  1WC2 A;  3X2H A;  1BW3 A;  2BH0 A;  4JP7 A;  3M3G A;  4JP6 A;  4FG4 A;  2HCZ X;  2G5D A;  4FFT A;  2PNW A;  1L8F A;  5GLX A;  2AE0 X;  3X2O A;  4FER A;  2PI8 A;  4JJO A;  5GLY A;  3SUL A;  1HD5 A;  3X2G A;  4AVR A;  3X2J A;  3SUK A;  4ZM7 A;  3CZB A;  4JCW A;  2ENG A;  2G6G A;  2PJJ A;  5H4U A;  3X2N A;  3X2P A;  2GAE A;  3ENG A; 
#chains in the Genus database with same CATH topology
 2R7Z A;  3H0G A;  2JA5 A;  1E60 A;  2VPX A;  2KQA A;  1TWG A;  2JIQ A;  1G8J A;  2VPZ A;  3SUJ A;  4AON B;  1I50 A;  1N10 A;  1OA7 A;  2JIR A;  3D30 A;  4AYB A;  4ENG A;  1K83 A;  3HU2 A;  3DMR A;  1Y1W A;  2NVX A;  1WC2 A;  3CF2 A;  3X2H A;  3TIW A;  4JP7 A;  1VC3 B;  5DYG A;  1EU1 A;  2NVY A;  2HCZ X;  1TWH A;  1YLE A;  1DMS A;  3PLX B;  1QDN A;  3QWZ A;  5GLX A;  1SMY D;  1YNJ D;  2VPW A;  4AAY A;  2PI8 A;  1FDI A;  1PYQ A;  1AA6 A;  1FDO A;  1S3S A;  1OGY A;  2PMZ A;  1CZ4 A;  2E2I A;  3IR7 A;  2E7Z A;  5T5I D;  2R92 A;  3ENG A;  3CQZ A;  1E32 A;  2V45 A;  3SUM A;  1WLF A;  3QQ8 A;  4L48 A;  4D7Z B;  2PJH B;  2NAP A;  4KDL A;  1PT1 A;  1BW3 A;  1IW7 D;  3TM7 B;  4JP6 A;  4QIW A;  4AOK B;  1Y1V A;  4GA6 A;  1TWA A;  2A68 D;  1Q16 A;  1R7R A;  2PNW A;  4FFT A;  2JIP A;  3X2O A;  4FER A;  2JA7 A;  4JJO A;  1H5N A;  1QCS A;  1HD5 A;  1TWF A;  1PQF A;  5GLY A;  3GTP A;  1PYU B;  5GLF A;  4DMR A;  5FTL A;  4ZM7 A;  3CZB A;  5T5M D;  3IR6 A;  1E18 A;  5H4U A;  3X2P A;  1ZC1 A;  1AW8 B;  2C45 A;  1TWC A;  1CR5 A;  2IV2 X;  3GTG A;  1OA9 A;  5EPP A;  5C1B A;  4CRZ A;  2YU9 A;  5FTJ A;  1H0H A;  3X2L A;  4FG2 A;  2WB1 A;  3GTL A;  1Y5I A;  3ML1 A;  3QQ7 A;  4C2M A;  4RV0 A;  2YUJ A;  2JIM A;  4CRY G;  2BH0 A;  4CS0 A;  3M3G A;  4KOD A;  1I3Q A;  4FG4 A;  4NOH A;  2O5J D;  2A6H D;  2KI8 A;  3HKZ A;  2G5D A;  1TMO A;  1CZ5 A;  1PT0 A;  1L8F A;  2EEO B;  2A69 D;  5B6C A;  1E61 A;  3SUL A;  2B63 A;  3GTQ A;  1R27 A;  5C18 A;  3X2J A;  4KDI A;  2WAQ A;  4JCW A;  2ENG A;  1YNN D;  2PJJ A;  2V3V A;  2DMR A;  5DYI A;  3X2I A;  5GM9 A;  4JS7 A;  3X2K A;  1SFO A;  2E2H A;  1BW4 A;  1G8K A;  1WCM A;  2BE5 D;  2CW0 D;  2Y0S A;  4GA5 A;  3X2M A;  4AZD A;  3GTO A;  3O5A A;  2NYA A;  3GTJ A;  3HU3 A;  1DMR A;  2R93 A;  2A6E D;  2PIC A;  1R9T A;  3GTM A;  1UHD A;  4KLN A;  4KO8 A;  2VPY A;  1KQF A;  1UHE A;  2JA6 A;  3OUG A;  3GTK A;  3HU1 A;  2AE0 X;  1SIW A;  2JIO A;  3FKI A;  1E5V A;  1KQG A;  1PPY A;  3IR5 A;  3X2G A;  4AVR A;  1Y4Z A;  5FTM A;  1PQH A;  3SUK A;  1PQE A;  2VUM A;  3QC8 A;  5FTN A;  2G6G A;  5FTK A;  3X2N A;  1ZYR D;  2GAE A; 
#chains in the Genus database with same CATH homology
 1OA9 A;  3X2I A;  5GM9 A;  4JS7 A;  2KQA A;  3X2K A;  1BW4 A;  3SUM A;  3SUJ A;  3X2L A;  4FG2 A;  4L48 A;  3X2M A;  1N10 A;  1OA7 A;  3D30 A;  4ENG A;  2PIC A;  1WC2 A;  3X2H A;  1BW3 A;  2BH0 A;  4JP7 A;  3M3G A;  4JP6 A;  4FG4 A;  2HCZ X;  2G5D A;  4FFT A;  2PNW A;  1L8F A;  5GLX A;  2AE0 X;  3X2O A;  4FER A;  2PI8 A;  4JJO A;  5GLY A;  3SUL A;  1HD5 A;  3X2G A;  4AVR A;  3X2J A;  3SUK A;  4ZM7 A;  3CZB A;  4JCW A;  2ENG A;  2G6G A;  2PJJ A;  5H4U A;  3X2N A;  3X2P A;  2GAE A;  3ENG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...