1HD5A

Endoglucanase from humicola insolens at 1.7a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
205
Chain Sequence
b'ADGKSTRYWDCCKPSCGWAKKAPVNQPVFSCNANFQRLTDFDAKSGCEPGGVAYSCADQTPWAVNDDFAFGFAATSIAGSNEAGWCCACYELTFTSGPVAGKKMVVQSTSTSNHFDLNIPGGGVGIFDGCTPQFGGLPGQRYGGISSRNECDRFPDALKPGCYWRFDWFKNADNPSFSFRQVQCPAELVARTGCRRNDDGNFPAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Endoglucanase from Humicola Insolens at 1.7A Resolution
rcsb
molecule tags Hydrolase
total genus 64
structure length 205
sequence length 210
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1hd5A00
1WC2A 3X2GA 1HD5A 5GLXA 1BW3A 2PJJA 3SUKA 2ENGA 3SUMA 4FERA 3X2IA 1OA9A 3X2NA 2KQAA 4AVRA 3D30A 3SUJA 3X2PA 3X2JA 3M3GA 4JS7A 2G5DA 2PNWA 3CZBA 4JJOA 2G6GA 3X2OA 2PICA 3SULA 4ENGA 3ENGA 4FG2A 5GM9A 4FFTA 4FG4A 1OA7A 5H4UA 4JP7A 3X2LA 3X2MA 1N10A 2HCZX 3X2HA 1BW4A 4JCWA 5GLYA 4L48A 3X2KA 2AE0X 1L8FA 2GAEA 4JP6A 2PI8A 4ZM7A 2BH0A
chains in the Genus database with same CATH superfamily
1UHEA 4AONB 2R7ZA 5FTKA 1R7RA 3X2NA 3GTGA 5FTMA 1PT1A 1ZYRD 3M3GA 2PJHB 1VC3B 4JS7A 3QWZA 2G5DA 5FTJA 3CZBA 2YU9A 1E61A 2Y0SA 1Y4ZA 2IV2X 3QQ7A 2VPXA 5B6CA 5T5MD 4FG4A 2JIPA 4KLNA 2WB1A 1AW8B 1SIWA 4AAYA 1KQFA 3X2MA 4AOKB 3PLXB 3HU1A 5DYIA 4CRZA 1CR5A 3FKIA 1I50A 3GTLA 1TWCA 4RV0A 5FTLA 2AE0X 1YNJD 2VPWA 3HU3A 2JA5A 3DMRA 1FDIA 2PI8A 1PQEA 4ZM7A 3GTOA 2BH0A 4CS0A 3GTPA 2NVXA 1CZ4A 5DYGA 4KDIA 5C1BA 1K83A 4KDLA 1Y5IA 1R27A 2JIQA 3SUJA 5EPPA 2E2HA 1TWFA 2PNWA 1TMOA 2G6GA 3X2OA 2R92A 3SULA 1FDOA 4ENGA 4GA6A 3ENGA 1DMRA 3OUGA 3ML1A 1SFOA 3HU2A 1Y1VA 4QIWA 2WAQA 4JP7A 3TM7B 4AZDA 3O5AA 2NAPA 1N10A 3H0GA 3X2HA 3QC8A 4NOHA 5C18A 2V3VA 3X2KA 1L8FA 1IW7D 3IR7A 5GM9A 1WCMA 1DMSA 2KI8A 3GTQA 1WC2A 3X2GA 1HD5A 1E32A 1KQGA 2PJJA 3SUKA 2ENGA 3SUMA 3X2IA 1OA9A 1PQFA 2KQAA 1PT0A 3D30A 2JIOA 3X2PA 3X2JA 2E7ZA 3CQZA 4CRYG 3TIWA 1WLFA 4DMRA 2CW0D 1ZC1A 1YLEA 1E60A 2E2IA 2B63A 2A6ED 4C2MA 1PYUB 2A68D 1H5NA 4FFTA 3HKZA 2C45A 1G8KA 1PQHA 1TWHA 2PMZA 1H0HA 1Y1WA 4AYBA 3IR6A 2A69D 2JA7A 1Q16A 5GLYA 4L48A 1PYQA 1QDNA 1TWAA 3GTJA 1QCSA 1E18A 2JIMA 1CZ5A 3CF2A 5GLXA 2JIRA 1SMYD 1BW3A 1PPYA 4FERA 4GA5A 3GTKA 2NYAA 4AVRA 2JA6A 5T5ID 1TWGA 4KODA 4D7ZB 2EEOB 3QQ8A 1S3SA 4JJOA 2PICA 2VUMA 2V45A 4FG2A 2A6HD 1UHDA 2O5JD 2VPYA 2YUJA 1OA7A 5H4UA 1AA6A 3X2LA 5FTNA 1EU1A 3GTMA 1I3QA 2DMRA 2HCZX 1R9TA 1BW4A 4JCWA 4KO8A 2R93A 3IR5A 5GLFA 2NVYA 1YNND 2BE5D 1E5VA 2GAEA 2VPZA 4JP6A 1G8JA 1OGYA
chains in the Genus database with same CATH topology
1WC2A 3X2GA 1HD5A 5GLXA 1BW3A 2PJJA 3SUKA 2ENGA 3SUMA 4FERA 3X2IA 1OA9A 3X2NA 2KQAA 4AVRA 3D30A 3SUJA 3X2PA 3X2JA 3M3GA 4JS7A 2G5DA 2PNWA 3CZBA 4JJOA 2G6GA 3X2OA 2PICA 3SULA 4ENGA 3ENGA 4FG2A 5GM9A 4FFTA 4FG4A 1OA7A 5H4UA 4JP7A 3X2LA 3X2MA 1N10A 2HCZX 3X2HA 1BW4A 4JCWA 5GLYA 4L48A 3X2KA 2AE0X 1L8FA 2GAEA 4JP6A 2PI8A 4ZM7A 2BH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WC2 A;  3X2G A;  1HD5 A;  5GLX A;  1BW3 A;  2PJJ A;  3SUK A;  2ENG A;  3SUM A;  4FER A;  3X2I A;  1OA9 A;  3X2N A;  2KQA A;  4AVR A;  3D30 A;  3SUJ A;  3X2P A;  3X2J A;  3M3G A;  4JS7 A;  2G5D A;  2PNW A;  3CZB A;  4JJO A;  2G6G A;  3X2O A;  2PIC A;  3SUL A;  4ENG A;  3ENG A;  4FG2 A;  5GM9 A;  4FFT A;  4FG4 A;  1OA7 A;  5H4U A;  4JP7 A;  3X2L A;  3X2M A;  1N10 A;  2HCZ X;  3X2H A;  1BW4 A;  4JCW A;  5GLY A;  4L48 A;  3X2K A;  2AE0 X;  1L8F A;  2GAE A;  4JP6 A;  2PI8 A;  4ZM7 A;  2BH0 A; 
#chains in the Genus database with same CATH topology
 1UHE A;  4AON B;  2R7Z A;  5FTK A;  1R7R A;  3X2N A;  3GTG A;  5FTM A;  1PT1 A;  1ZYR D;  3M3G A;  2PJH B;  1VC3 B;  4JS7 A;  3QWZ A;  2G5D A;  5FTJ A;  3CZB A;  2YU9 A;  1E61 A;  2Y0S A;  1Y4Z A;  2IV2 X;  3QQ7 A;  2VPX A;  5B6C A;  5T5M D;  4FG4 A;  2JIP A;  4KLN A;  2WB1 A;  1AW8 B;  1SIW A;  4AAY A;  1KQF A;  3X2M A;  4AOK B;  3PLX B;  3HU1 A;  5DYI A;  4CRZ A;  1CR5 A;  3FKI A;  1I50 A;  3GTL A;  1TWC A;  4RV0 A;  5FTL A;  2AE0 X;  1YNJ D;  2VPW A;  3HU3 A;  2JA5 A;  3DMR A;  1FDI A;  2PI8 A;  1PQE A;  4ZM7 A;  3GTO A;  2BH0 A;  4CS0 A;  3GTP A;  2NVX A;  1CZ4 A;  5DYG A;  4KDI A;  5C1B A;  1K83 A;  4KDL A;  1Y5I A;  1R27 A;  2JIQ A;  3SUJ A;  5EPP A;  2E2H A;  1TWF A;  2PNW A;  1TMO A;  2G6G A;  3X2O A;  2R92 A;  3SUL A;  1FDO A;  4ENG A;  4GA6 A;  3ENG A;  1DMR A;  3OUG A;  3ML1 A;  1SFO A;  3HU2 A;  1Y1V A;  4QIW A;  2WAQ A;  4JP7 A;  3TM7 B;  4AZD A;  3O5A A;  2NAP A;  1N10 A;  3H0G A;  3X2H A;  3QC8 A;  4NOH A;  5C18 A;  2V3V A;  3X2K A;  1L8F A;  1IW7 D;  3IR7 A;  5GM9 A;  1WCM A;  1DMS A;  2KI8 A;  3GTQ A;  1WC2 A;  3X2G A;  1HD5 A;  1E32 A;  1KQG A;  2PJJ A;  3SUK A;  2ENG A;  3SUM A;  3X2I A;  1OA9 A;  1PQF A;  2KQA A;  1PT0 A;  3D30 A;  2JIO A;  3X2P A;  3X2J A;  2E7Z A;  3CQZ A;  4CRY G;  3TIW A;  1WLF A;  4DMR A;  2CW0 D;  1ZC1 A;  1YLE A;  1E60 A;  2E2I A;  2B63 A;  2A6E D;  4C2M A;  1PYU B;  2A68 D;  1H5N A;  4FFT A;  3HKZ A;  2C45 A;  1G8K A;  1PQH A;  1TWH A;  2PMZ A;  1H0H A;  1Y1W A;  4AYB A;  3IR6 A;  2A69 D;  2JA7 A;  1Q16 A;  5GLY A;  4L48 A;  1PYQ A;  1QDN A;  1TWA A;  3GTJ A;  1QCS A;  1E18 A;  2JIM A;  1CZ5 A;  3CF2 A;  5GLX A;  2JIR A;  1SMY D;  1BW3 A;  1PPY A;  4FER A;  4GA5 A;  3GTK A;  2NYA A;  4AVR A;  2JA6 A;  5T5I D;  1TWG A;  4KOD A;  4D7Z B;  2EEO B;  3QQ8 A;  1S3S A;  4JJO A;  2PIC A;  2VUM A;  2V45 A;  4FG2 A;  2A6H D;  1UHD A;  2O5J D;  2VPY A;  2YUJ A;  1OA7 A;  5H4U A;  1AA6 A;  3X2L A;  5FTN A;  1EU1 A;  3GTM A;  1I3Q A;  2DMR A;  2HCZ X;  1R9T A;  1BW4 A;  4JCW A;  4KO8 A;  2R93 A;  3IR5 A;  5GLF A;  2NVY A;  1YNN D;  2BE5 D;  1E5V A;  2GAE A;  2VPZ A;  4JP6 A;  1G8J A;  1OGY A; 
#chains in the Genus database with same CATH homology
 1WC2 A;  3X2G A;  1HD5 A;  5GLX A;  1BW3 A;  2PJJ A;  3SUK A;  2ENG A;  3SUM A;  4FER A;  3X2I A;  1OA9 A;  3X2N A;  2KQA A;  4AVR A;  3D30 A;  3SUJ A;  3X2P A;  3X2J A;  3M3G A;  4JS7 A;  2G5D A;  2PNW A;  3CZB A;  4JJO A;  2G6G A;  3X2O A;  2PIC A;  3SUL A;  4ENG A;  3ENG A;  4FG2 A;  5GM9 A;  4FFT A;  4FG4 A;  1OA7 A;  5H4U A;  4JP7 A;  3X2L A;  3X2M A;  1N10 A;  2HCZ X;  3X2H A;  1BW4 A;  4JCW A;  5GLY A;  4L48 A;  3X2K A;  2AE0 X;  1L8F A;  2GAE A;  4JP6 A;  2PI8 A;  4ZM7 A;  2BH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...