1FDIA

Oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite
Total Genus 251
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
251
sequence length
715
structure length
715
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 251
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdiA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdiA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdiA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdiA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdiA03
5FTMA 3FKIA 1Q16A 3CF2A 3TIWA 1Y1WA 3DMRA 2NVXA 1Y5IA 1TWHA 1AW8B 1TWFA 4DMRA 1WCMA 2V3VA 4AONB 1PT1A 1QDNA 1Y1VA 2NYAA 4CS0A 1TMOA 2PMZA 2R7ZA 2JA6A 1UHEA 1KQGA 5T5MD 3QC8A 4AYBA 1CZ5A 1S3SA 2R93A 1I50A 1G8KA 2VPYA 1DMSA 1TWGA 3IR6A 1VC3B 4CRYG 4C2MA 3QQ8A 2JIPA 1CR5A 3CQZA 4RV0A 1TWAA 1DMRA 2EEOB 1UHDA 2WAQA 1I3QA 3PLXB 1G8JA 2JA5A 2PJHB 1FDOA 1R7RA 4AOKB 1ZMEC 2VPXA 5B6CA 2JIMA 5T5ID 1WLFA 1H0HA 1SIWA 2V45A 2E2HA 3QWZA 1E5VA 3EWKA 1WMKA 4CRZA 1FDIA 4GA6A 1IW7D 2NVYA 1PT0A 2IVFA 4KDLA 5FTLA 2VPZA 3O5AA 2JIOA 2Y0SA 1CZ4A 3GTGA 3HKZA 2R92A 3IR7A 1OGYA 2YU9A 3IR5A 3HU3A 1AA6A 1OMIA 2B63A 2DMRA 3GTQA 1R27A 2WB1A 3TM7B 3H25A 4GA5A 3GTLA 1YLEA 4KODA 5DYIA 4QIWA 3GTPA 5FTNA 1KQFA 5DYGA 2E2IA 5EPPA 2G8YA 3OUGA 1SFOA 1E18A 1E32A 2E7ZA 4KDIA 1K83A 4D7ZB 2NAPA 2VUMA 2KI8A 1PPYA 1E61A 2JIRA 2IV2X 1EU1A 1TWCA 3GTOA 1PQFA 3GTKA 3QQ7A 5FTJA 3GTJA 2JA7A 3ML1A 4KO8A 2JIQA 2VPWA 1AJYA 4AZDA 1R9TA 1PYUB 1PYQA 1PQEA 2P10A 5FTKA 4KLNA 5C18A 1QCSA 2C45A 1Y4ZA 3IN6A 3HU2A 5GLFA 4AAYA 5C1BA 3HU1A 1E60A 1H5NA 3GTMA 1PQHA 3O6QA 3H0GA
chains in the Genus database with same CATH superfamily
3EGOA 4G01B 3NAQA 3SG0A 4KWHA 5I7SA 5JXHA 3C8ZA 2ZAGA 2AHRA 5T3UA 3IE0A 3PL5A 4O6VA 1K2VN 4F7DA 1T13A 2PH7A 3T1OA 1PBNA 1VKJA 2R751 4IIBA 4I1IA 3GYGA 1U9CA 2BFWA 4EI9A 1URQC 1L5FA 1RXVA 2ZXFA 4GPIB 3K70B 1PO7A 3T1VA 3DE3X 4NQZA 3KHKA 4LRUA 4NIMA 4MPDA 4URYR 2RJOA 4OGKA 3DEHA 1DWOA 1SG9A 4B4WA 3BBLA 4D4LA 4EJ2A 4XH9B 5H70A 4GOKA 1YLEA 4URUR 3FNGA 3H4IA 3LLUA 4EW3A 5KJ7C 1VYHA 3GI1A 1RCFA 4U7PB 4KK4A 4KXFB 4JDUA 2BGUA 1UBOS 2W8ZA 1U0SY 1YJWP 1Z2OX 1D4OA 2CHQA 3WB1A 3REQA 3ZZMA 1EXVA 4RGBA 2OBFA 3H8VA 4DCPA 1GPKA 1OA9A 4HK4A 4ZK2A 1EUYA 3E1RA 5CIYA 4U2CA 4GIBA 1RHJA 1BXGA 3PP8A 4GLLA 5B3JC 1U1CA 3E03A 1Y0BA 1N2JA 1WHTB 1NLMA 4FVTA 3GRYA 2QE7A 1NI4B 1XCLA 4Q4LA 2AJDA 4DMHA 1J0BA 3PNOA 1YTZT 2I91A 2I76A 1P72A 5HE9A 5DHQA 4L73A 3HOYI 2W2OA 2YY6A 1IVSA 3BSYA 1T2EA 4DDUA 2C7VA 5DN6D 4FSHA 1PZEA 2FQYA 3I76A 1GPUA 1GN9A 3OMWA 1YDGA 3HCFA 3TH5A 1EX9A 3T6KA 1A8IA 3G711 3H7IA 4UTVA 4EX7A 2DWQA 5IAJA 3AR5A 1HL7A 4BEVA 1Y8ZA 4RABA 4E5MA 1P2GA 2F4MA 2R8RA 4LS3A 5G3YA 2I3ZA 1QVRA 1Y8QB 5NLLA 1X0TA 4ROTA 2Q4DA 3S16I 4OVKA 5F23A 3UK2A 4Z3KA 4W7YA 1DC4A 3ZUGA 3I23A 1P7WA 3I56Z 4Q4CA 5K3AA 1XD9A 4B31A 3D4OA 4YAFA 3L71D 4ZHQF 2FW9A 2H7YA 1JMYA 4ES6A 5F33A 2OLJA 1M0TA 3IODA 5H82A 5EYPB 3REGA 1WU7A 4ZT5A 3EJ6A 1TAGA 4W5NA 2YXNA 3L4SO 5F9FA 5AHXA 2O7RA 5CDFA 3VTKA 1U7DA 5I9SA 3PFWO 5AW0B 1FDUA 2NO5A 3FTCA 3ENVA 4NULA 5HWSA 5JSHA 2NPSD 1XFAA 2V3CC 2OEPA 2P65A 4RJIA 1GVHA 1I6LA 4MJ7A 1SZPA 1H4TA 1HOTA 4MD7A 5JDIA 1TAHA 2P90A 5BNZA 2Z8ZA 4UOEA 3WGVA 3SNKA 1FQWA 4I1LA 4D46A 3MJEA 4PBRA 3MUFA 2YJGA 2PIDA 4EQ6B 1C4WA 2Z9CA 5G3ZA 3CC2Z 3VR1A 4L95C 2A4KA 4DR1B 1VJRA 1IOLA 1KO5A 2IE8A 2RGAA 1K83I 1DKOA 3O8DA 5T7BA 4ESVA 4C4XA 1YHQP 5LBUA 4H2DA 3BL5A 2O06A 4R4MA 4RK0A 3ANSA 1UBJS 5BQPA 1EVJA 4RSRA 5A4MS 5KIAA 2VF4X 4JA0A 1W25A 4LBZA 3S2YA 4ZOLF 4IIGA 1G6Q1 3DE4X 2DFLA 1W4AA 1Z15A 2O2SA 4KAFA 3OEHD 1E3TA 1MFTA 1HNWB 3FOZA 3QMMA 4Z1OA 2B87A 1H94A 3GELA 1XVIA 2FXPA 2PVSA 2PJJA 1QIDA 1CV2A 3L2OB 1F7VA 3T38A 2DCUA 1DAGA 1XRNA 1OBVA 2H54A 4HB2A 1PV1A 1I36A 4J6FA 2YQ5A 3VGPA 4HGRA 5LKRA 1GITA 4IBOA 5B37A 2J3QA 1B42A 2YXLA 5HRUA 3CWBJ 2QEXZ 3PL1A 2ON6A 3NGXA 2PE5A 2ZRNA 1UHDA 2D1TA 3NYWA 5DVZA 3PQ5A 1A4XA 1W73A 1H65A 1BYUA 4RIIA 3TFWA 2H4XA 2HA4A 3HCEA 2RH4A 4QBIA 1ZZEA 2BBSA 3OM8A 4EGFA 1YK1A 3Q11A 2FSHA 3ABVC 1XE3A 5GM9A 1KWKA 4ZAFA 1QQTA 1SIUA 2WU1A 2QG6A 5JYEA 3UWKA 1L7OA 1JIIA 2IKSA 5C5EA 3TPZA 1YZ3A 3NHWA 5MHTA 1VJ0A 2PSSA 2HTFA 2HF2A 5KREA 5AK5A 4NMXB 2WOJA 3CX8A 2CLLB 3KKZA 1MX9A 1KEKA 4H4EA 1F4LA 2WQ6A 2X8WA 1OH6A 3TKAA 4OHMA 5D00A 3UQYS 4JL5A 3HBMA 3QV2A 3GLGB 3C8VA 4LNUA 2CMKA 3PNSA 3F6PA 4CPGA 3V7NA 5AVZA 4AS3A 1O6CA 2D5AA 3RT9A 1YGPA 5C4MA 2FSFA 5KLVG 5K2MA 4NHEA 1USIA 2BVNA 5KX5A 2Q4OA 3K6SA 2WF8A 4HDMB 1PT8A 5IJXA 4JMLA 1R88A 1R4MA 1YCFA 1XHFA 5J5AA 4CR7A 3QTBA 3DGFC 1MUUA 1J42A 1ST2A 2R60A 3LH5A 1BCCE 5GADl 2GUSA 4HEHA 4CG3A 2V7TA 1OLUB 1PLLA 2NRGA 1HDZA 4J1TC 1JWAB 2JJ1A 5EJEA 5I51A 1JY2N 2IDKA 1Y98A 1I1HA 4BCBA 3AVQA 2BISA 3KB1A 5BOSB 2E2HI 4R8SA 1CJUC 3IX7A 5EUQB 2OK7A 4W1SA 1DWUA 1ORRA 3L8GA 1SU8A 3DKKA 1GM5A 2O3SA 2EATA 4QRDA 2YIUC 3COZA 3DW1X 4ZKEA 3S17I 4BN5A 2REBA 1SHZA 3RC1A 1SU7A 2I99A 4IVRA 4MV5A 1KEEB 5KSYA 4X71A 1K1EA 4B80A 3I9OA 2OLKA 3LIDA 2I7VA 3IOCA 1EEHA 3CMMA 2H9IA 1KE2A 3RVKA 1R66A 1NIPA 3H05A 3OJWA 4B8ZA 1QB8A 5IH3A 2LXNA 2ONYA 4EAQA 2CLDX 2NUTA 1L7VC 3IYLW 3LWZA 2J4CA 1DAIA 3IUSA 2CLOB 3QWBA 2AN4A 4S0ZA 3H11A 4J7XA 1TLLA 2WNHA 3C6ZA 1HT1E 3BCSA 2CZGA 4RESB 3G6E1 2GPWA 3Q0TA 4CGYA 4PNPA 1ZYRD 4ZVMA 1SMYD 1GUBA 4J75A 2Q8NA 4XIJA 1Q1QA 2O8BB 2C0PA 1MXFA 2PJUA 2CFSA 2HF9A 2FFDA 1UK9A 2PL3A 4Q93A 1FZEA 1DEBA 3MGCA 1SXIA 3AF0A 4RBNA 5DM1A 4DLWA 4CFZA 2NADA 4KQHA 2WP8J 3QX7A 2F17A 3JQ6A 2XEXA 4P3PA 3M6IA 2OZLA 2LFUA 3ENQA 3KT8A 3QFCA 2YXDA 1YJCA 1A71A 5DYWA 2JLSA 5IEJA 2AD5A 3VU1A 1JBKA 1JA1A 2RH5A 4M3LA 4N8SA 3OTWA 2VP2A 3D0OA 1U2RA 3NP7A 4JP6A 1Y6ZA 1JAZA 3MT8A 1N92A 3ET4A 4ER3A 1UEIA 2HRBA 4IM7A 3L72E 4WXYB 5H3LA 1HPLA 3JZAA 4B6SA 4I6EA 3NH4A 1BMDA 4B3MB 3GJ8A 2WB2A 1QJCA 1LTTC 2K9JA 3LC7O 2ZUDA 1GNVA 3WICA 4G3XA 3NTUA 3CX4A 5AIAA 2PRKA 4F84A 5F2NA 3LWNA 3NHLA 5BSKA 4HEJA 3ED5A 1MU0A 4CDRA 2IH4A 2QLLA 5CB4A 4L22A 4HY3A 4BZPA 5APXA 2V6FA 2C00A 4CIAA 3V9PA 1M6HA 2P0YA 3D7LA 1K86A 3PH0A 1TYEB 1M8OB 1JPVA 3KIFA 1ZVQA 2QR2A 2P9TA 2BEQD 2IOHA 4C4PA 3MC1A 2YINC 1BE3G 2QN3A 1WQ3A 3TGUE 3KYDB 2V1XA 3EQ8A 3ZX5A 2HFJA 2B0CA 1BCCD 1FBMA 5EJ7A 5KBYA 4FFDA 2E9SA 2YY5A 2VXCA 3B5EA 3B7PA 4UUQA 3AHCA 1EWRA 4GL2A 3PXEA 2HBYA 2Y9ZA 2LTAA 1U2DC 6CHYA 4BFTA 4O2RA 3AHHA 5JHGB 4QLAA 3PC4A 4ZD6A 3CB2A 4M7WA 3SNHA 2H1OA 1ZLYA 4BGIA 3LT0A 2JFGA 1IY0A 4M3NA 3F5QA 2B34A 3MOSA 3WL7A 1NBAA 3OO0A 1IULA 3ZPXA 2I1LA 2R44A 1N77A 1AKNA 3NI2A 1JWLA 1I3MA 3E7DA 3L41A 4M0UA 3JWPA 1JI0A 3OZTA 2IUFA 1MB2A 2A1IA 1GV0A 4FFSA 3P20A 3SPXA 3HL0A 3UT5B 3O7WA 3OT4A 5JH7A 4PEVA 3DM5A 2J9YB 3W2EA 4M8KA 3CS3A 4HAIA 4PV7A 1NAYA 1QYWA 1LD3A 1TK9A 4WLOA 1Q3HA 2O4UX 1GL2A 3L71J 1S2OA 1PRYA 1H4VB 3N8GA 4LHVA 2VDNB 5HKOA 1XTCC 2C5BA 4XVQA 3THYA 4FMCF 4M46A 4NL4H 4BP8A 3IMGA 2H1IA 2KI5A 4JU8A 3JXEA 1KWGA 4E5KA 4NYJR 4YPFA 1AS2A 1D6JA 5IM5A 4DV3B 5HF5A 1TUIA 2ZVJA 3MUDA 4GAEA 2AJ8A 1R3DA 3BWVA 1R5NA 3HHEA 3BL8A 1FC0A 1CF9A 3P0RA 2RGBA 1KILA 3V2GA 2PQ6A 4CCAA 3B8HA 3HZZA 5G4LA 5BRNA 2O2IA 3GZJA 3W5UA 1O97D 1SPXA 3HCCA 2IYRA 2B8JA 4EYOA 4MDEA 5J5VA 2HJGA 2E2WA 5LOVF 2BZGA 4DIKA 1PHRA 5EE3A 4AICA 1G7TA 2P2SA 3B70A 2LGJA 2CZCA 1FFDA 3REQB 2I29A 3ESXA 1OZFA 1YRWA 1SOVA 4QC2A 2XD4A 2RGGA 4RWEA 2WV7A 1MTZA 3QEMA 4XR9A 1WIIA 3E81A 3VU3A 3JD2A 3FKSA 1O54A 2R8XA 1BXGB 5CUQA 1CVIA 4XGRA 1KS2A 3MWGA 3P8CD 3KT3A 2L2QA 3UFBA 1TTPB 4E88A 1Z74A 1XSEA 2QQGA 3TSIA 1SHKA 3SMVA 1NI5A 2OQIA 2OP0A 5BV7A 3JD3A 3B85A 2NP7A 2IXGA 2BFPA 2JLRA 1TC1A 1YRAA 2BFDA 2PGIA 3AMVA 4XW2A 1X42A 1CUZA 4RADA 3CV3A 4N5LA 4HJXA 3SFZA 5DP1A 4BE9A 1FJGB 1N2SA 3CEAA 2CB9A 5C7LO 2YZMA 1U0BB 3PEEA 4O4HF 2BE7A 1IMOA 4OQNA 521PA 3JSXA 5C7IO 2XCSB 5A2Qb 4HNUA 3PTZA 2YWHA 2XNXA 2W6NA 1NMSA 1XDZA 2G0AA 3ABQB 2CKMA 4NBSA 1H2HA 4Z9BA 4TMVA 2XGSA 2DKOA 1WDLA 3PLXB 2P9QA 1JBEA 3EX7C 5HDQA 1E7RA 2VJPA 4GZMA 1G5IA 1V96A 1ZICA 3I72A 1XU7A 1T5IA 4NOHA 2D5BA 2H4FA 4U7TB 3MRVA 2H08A 3NXKA 3HD7A 5LP6A 3A26A 4WY4D 3ASYA 1FSSA 5AKHA 1SH7A 1ABEA 2X13A 1VHJA 4C3OB 1UWKA 3TNUB 3C6MA 3MUNA 3S2SA 4X8MA 1H8AA 4B8WA 3NDPA 3G68A 4GZLA 4YRBA 1A9XA 3PB3A 5A4IS 2CLMB 3LX6A 1SBHA 2DFPA 2OYIA 4UEWA 2QVAA 4DNOA 4ZVRA 1CC1S 4Z4QA 1L5NA 4ER5A 5KJCA 5TQ0A 1JPUA 3WLRA 3CF0A 2A7QA 1E63A 4EF5A 1UZMA 4Y2XA 2GUGA 3DZIA 4YX9A 2PWYA 4IH9A 5K51A 4ML3A 3CCL1 4LE1A 2PUJA 4N8EA 4E3ZA 1PU2A 2FZVA 2P4QA 4WXEA 1GG2A 3C6BA 1M8FA 1R18A 2PZ8A 2E48A 4X1IA 4Y30A 2I6XA 3T94A 3VTFA 2GLUA 1IHOA 4TMKA 5D5HA 1N1MA 4LSWA 4GPTA 3NKLA 2D1SA 4H3KB 1GGNA 4GQBA 2CNOA 2A57A 4MWEA 1MQSA 4O1MA 1GRRA 3PT9A 1HF9A 1VL5A 4FCCA 5IK2D 1I0LA 4YCJA 4E21A 1VQ5Z 1ZGCA 1JSCA 5KYXA 5DJTB 1NXWA 1ZK4A 2Q2VA 3ZE9A 2DYKA 1YIDA 2CCGA 3FZEA 4L4YA 4ZAYA 3GBPA 7ABPA 3GP5A 3QWUA 4BLVA 4A7PA 1PUIA 1E7QA 4MV9A 1K63A 4I4NA 4EYEA 3RUHA 3DMGA 3H5WA 1SO8A 3DYIA 4IFTA 1VKHA 4ZZ0A 3M49A 2B87B 4FE4A 1KSGA 1M6EX 3ACCA 3FMVA 3DAOA 3FHLA 2QY6A 1ZD2P 3MWJA 3B3QA 3U16A 1UC4B 3HI6A 1Y7TA 2OYHA 4KWTA 4V1CA 2ZI7A 4LYEA 4MUFA 2QTTA 3B9PA 3ZHUA 1TUEA 3HBJA 1NJI2 4HXYA 1C0PA 3K6RA 3RJ9A 1OW8A 2AQ8A 5KHAA 1XTRA 4KH0A 5J58A 2YO3A 1G6KA 1J8MF 1HC7A 5HK9A 2GJKA 2FJUA 3UAWA 5YASA 5I7FA 2FX3A 3ENZA 3OOEA 1Q83A 3GBSA 5DBEX 4EGAA 1MOPA 3QKTA 1Z56A 4C5AA 4M6WA 2FSUA 1ODCA 3DUWA 5AVKA 5ADWA 1IK7A 4HRAA 3I9KA 5SY9A 4L57A 1PR9A 1LTIC 1RQ2A 3L0IB 3W5BA 5H8WA 5AW6A 1Y6QA 1VQO1 3TNDA 1T6BY 3RQIA 2DERA 3TLMA 3KETA 4BFCA 3U26A 4LQCA 3ABRB 5HK8A 4GGOA 1VECA 10MHA 2G40A 2SKCA 1KI7A 1PK7A 4X92A 8ADHA 4D4HA 4A82A 4MVYA 5DIZA 4WJLA 2WSSH 1Z7EA 1YU6A 3WYEA 3I5UA 5KAIH 2CWDA 3H5NA 4R5MA 4PJ0H 1EJ6A 1WXEA 2ATEA 4RZHA 4LNUB 1Y5LA 1PKEA 2QU7A 2IDBA 3IC5A 5AVZB 3LKZA 5FA6A 3D6TB 3RCBA 3DXZA 5AKEA 4F1JA 3BSFA 1T2UA 5KX5B 4H18A 3K6SB 4AJEA 2IU6A 3I61A 1HO3A 3QPAA 1R4MB 5HYVA 4GMKA 2NU8B 1OI2A 1YQUA 2XQJA 2F3SA 3A9VA 3SR4A 4KH1A 1MVNA 1NU1K 1DO2A 3R8FA 3FPFA 3SYLA 1FFEA 3F4KA 4JFRA 3GXBA 1A88A 5BMVB 4YDRA 3JAMb 1ZEMA 1VQ71 3R7FA 3KE8A 4L4RA 3VR5D 1AJYA 3BDAA 1YE3A 4CL1A 4BVFA 1SCJA 1VKOA 2PRRA 2SBTA 2VBFA 4MPTA 2H0QA 1GTSA 2GBPA 1HE3A 1SQPK 5J1SB 5LD2C 2ZIAA 5IJAA 2O8VA 4R1OA 4IVQA 4O63O 1MR3F 2COKA 4XB6B 1B00A 2H59A 3EAQA 3GUCA 2HMUA 5BP7A 1PKXA 1ICEA 3WSWA 4HOYA 1TM4E 3ZWAA 3B1WA 1BCCJ 1M6YA 3SGLA 1IW7D 2V54A 2B4RO 5E3IA 2W6JH 3I2JA 3ETDA 1CZ4A 1M0SA 3KBOA 2PGJA 1SKYB 5C39A 4X41A 3WKDA 3V80A 4HQ0A 1ZGGA 1BKDR 4CMJA 1HH4A 1RXWA 4RZQA 1JL3A 1YOVA 3SLGA 2XE4A 2NUTB 1AB5A 2C97A 4DAOA 4JBWA 1NJ2A 5B57C 1L4UA 1EYZA 4PZDA 221PA 3H11B 3FVVA 1CRLA 1P1CA 1V47A 4ZMBA 2J7PD 5IH7A 5FR2A 4HWRA 4PG5A 1Z3CA 4MROA 1P80A 2XCIA 3HR4A 2DBRA 2GPNA 4RY0A 2XTJA 4EG0A 2AXCA 2DE7A 5HFNA 2FFHA 4FIDA 4F96A 4UHCA 3DWGA 4GWLA 1DL5A 1JQ5A 1X80A 1E3SA 5TQVA 2ZBFA 2OZLB 3LUFA 4OAPA 1NU1E 1D1SA 2DHQA 5GM1A 1SOUA 1E2MA 2OARA 3T7TA 1A5TA 1HYHA 5A03A 1JHOA 3H5TA 1RZRA 3OE1A 2Q6TA 4MYSA 2C4HA 2P3OA 3K0KA 5FT9A 1OJ7A 4Y9TA 4TKZA 3NYRA 4CEHA 5EZSA 1NFRA 1RXEA 1E94E 2CE7A 3V42A 4ALLA 1MEOA 1RAEA 3D4LA 2BTQB 4EPTA 1AQNA 4DA8A 2V7QA 4R1PA 4FN4A 2BGLA 3ISTA 2ZQYA 3KWJA 1SQPE 2BFCA 3AO0B 3ONEA 3OZXA 4B81A 4XSHA 2FN3A 1ZH8A 4H13B 2K9JB 4MPPA 3QTTA 3PPVA 3K9QO 1QDUA 3PR3A 3RFUA 3VPCA 5CVCA 1NNI1 2D06A 1FBTA 1GG8A 4ZT7A 3SY8A 2PMEA 1W4RA 3EZNA 2QUJA 4QD3A 2VH2A 1NHLA 3E3OA 3PZRA 4F06A 1I1OA 2VCYA 3E23A 3P4XA 4D98A 5DHUA 4B4UA 3SKXA 1E1MA 1TWHI 1G7CA 1NTZK 3L72J 4OGQC 5KKCA 4F91B 4UMVA 3K7EA 4B75A 3VR4D 3O1IC 1ST3A 4EA8A 4LN1A 2WZQA 2OV2A 4LE0A 5ALFA 1E3JA 1V26A 2WT9A 2HXYA 4JXXA 1AGYA 2DT8A 4U2FA 2R5NA 1ULSA 3HS3A 1P4HA 5B1IA 1GL7A 3HU2A 1Z6QA 3OCCA 2ZAYA 5HIMA 3Q1LA 3DMRA 2RH0A 3CM0A 1ZXLA 3DQPA 1CNMA 5CYPA 4MAAA 1OC2A 3H9BA 2RHRA 1IONA 5B2FA 4LZLA 1XRJA 4BJ5A 4KI0A 3FAZA 4Y0VA 2QJOA 3QKUA 2YXQB 1BEEA 2AR7A 2GPSA 1KI6A 2WHEA 3G2OA 2PRYA 3EY9A 5KHOC 1XRMA 1RJFA 1Z5GA 5TVKA 1NMZA 5JH7B 1GGEA 1U2ZA 3UWDA 2EFGA 5L3QB 1B6RA 2IZZA 4FYXA 3IAM6 3AH8A 4X1KA 1S01A 1SR8A 4KYUA 4BBRI 1TCVA 3HJGA 1H4QA 3LRTA 3LLCA 5ADVA 3GLVA 3LS2A 2Q6IA 4YMWA 1WHTA 1YMQA 1YZFA 3A6DA 3BK7A 2AF3C 1XQXA 2ZREA 3H75A 3INTA 3QX8A 4XWWA 1FYEA 4R71A 4DLTA 1ADYA 1JQ3A 2NU7A 1ZIYA 3TQCA 1Z2NX 4BP1A 4Q16A 2GHTA 1SD5A 1PJZA 4TMTA 4B3JA 1Z9BA 3TMKA 3MN1A 2FWNA 1Z8FA 5HZMA 1H6DA 1UPCA 5BOVA 3ZCPA 1SFOI 4MV3A 4BVKA 1NR7A 1SFRA 4BB6A 1WXHA 3QQ8A 3DFUA 4LC1A 1YQXA 2B4KA 4XOIA 1NTZE 1EFHA 1DEHA 3C5EA 5CFQA 1KAGA 1NU1D 3OEED 1N3YA 2CJWB 2DHRA 5EL0A 3SXUA 2FPSA 1Y6RA 1EAMA 1YB4A 2XRYA 1NX9A 4OHFA 3L02A 1PQUA 4FGLA 5HKAA 3BWBA 4D41A 1V5FA 4TV9F 3AE6C 4R2IA 5K8IA 2OXCA 2HF7A 2HWYA 2O0JA 3C7CB 3ITNA 2G5CA 4CV0A 3NWPA 5IT5A 1WT6A 1FYVA 2IS2A 1SQPD 4QXMA 1YRLA 1O89A 3KB8A 4L9RA 4PPQA 2C9ZA 5AVXB 4B0OA 2VRCD 1P2VA 4TPKA 6LDHA 2EJVA 2BSXA 4FZVA 5KNBA 1CRPA 4C03A 4IQGA 2FPKA 1WCV1 5AW0A 4J9VA 2PS1A 3RR2A 5AOCA 3P9KA 1FOEB 4DN6A 5LNK6 5DWQA 4JI5B 3FYCA 4G5FA 3IA2A 2JUBA 4JJIA 3FPJA 2GCIA 3SJAA 4K6HA 1ISGA 1BSVA 1TADA 1O6GA 3L1JA 1KEVA 3SQWA 3EVNA 1JQLB 3HBAA 2GFIA 3PTLA 1G4UR 1TO6A 4B3IA 1NJ8A 1OJLA 4D9NA 3U7HB 1OIPA 2XQGA 5GOTA 4MVJH 4IHAA 3OZBA 3IE1A 3OVMA 1VQ41 2PKXA 4E5SA 1CQWA 3R2JA 3S8MA 1Q7TA 3HD7B 1YVRA 1NR5A 2CK3H 2GN9A 2JI8A 2AG6A 5E0KB 3I561 3M9WA 2ANBA 4KTVE 4KCGA 3R5SA 4TN5A 3G4SZ 3B52X 5EJAA 2JLYA 1NY5A 4D5EA 2I33A 4KJZA 4REQA 1A9XB 4WCFA 4ZAXA 2OO5A 1WPXA 1IZ8A 1V4BA 1W5SA 2OYIB 3G5MA 3SEFA 4H08A 3X43A 2BJOA 3DLHA 5TQ0B 2WHQA 3IUBA 3H83A 1TMGE 4I19A 9ATCA 3WWEA 2ODPA 4YA6A 1O3YA 1R9TI 4IDNA 3T4EA 3IEMA 1W88A 4ZM7A 5E79E 1KMIY 2JBHA 1IN7A 3BA1A 4FW9A 1G7RA 3HG7A 1PWEA 1QIMA 2P41A 3BA6A 1HDYA 2P27A 1IH8A 2HSJA 4RF3A 4X1IB 1LI7A 4KEAA 1BYIA 1KP9A 1E1NA 5HFAA 4HGQA 3C3AA 2PKQP 2MR6A 5EZYF 2II6A 1RKQA 2IEIA 3X1DA 1QWSA 3G0CA 5EE5B 1R6XA 3UJCA 3B20A 1B3BA 4Q3NA 3PP5A 1ZQ9A 3NUGA 3N2IA 5DP2A 1MDFA 1QFJA 2CLIB 2Y93A 5FWNA 2QTRA 4MI6A 2WKSA 4HCJA 1Z38A 3DAPA 5IKXA 5KYXB 3TB6A 3KAJA 1BIFA 3UV3A 5C5IA 4P08A 1CEEA 3U59A 1W19A 2E4UA 5CHYA 1SCUA 4NENA 3SBXA 1J7KA 6Q21A 2EARA 2BI4A 5G4KA 1KDOA 4D8WA 3IKLA 5KC9A 3SUMA 1JQBA 1NTZD 2XB9A 3WGTA 2D1QA 1I4EB 5E9AA 2YRXA 1QLED 3KLMX 3ZZTA 2OUIA 1WEKA 1QM5A 3GXOA 1HQDA 1IRIA 2OYHB 4V1CB 3OFSA 2IQIA 1WEHA 1IDN1 1JU9A 1PR1A 3WFIA 4G2TA 2B1JA 5BQ3A 3TRDA 2GXSA 4IGKA 2VYCA 4K6FA 5ERXA 2HWWA 4PQGA 3SHVA 5LYYA 2NVYI 3DO5A 1FVOA 2HK8A 3F0TA 4N8DA 4YR7A 4RCYA 4XLZA 1E2KA 2AVNA 1TT5A 4BX9A 3UWOA 4MQFA 3HOUI 4ALIA 3EN0A 4A3BI 3SQOA 2BHRA 4M6WB 4CIBA 2QRJA 1E4VA 1HE2A 3UYLA 1P4AA 1ZC3A 2CNWA 4IDAA 3DDWA 5AI8A 2YJTD 5AW6B 3N8HA 3C8HA 1OLUA 3R41A 2YWFA 2H2FA 3OPMA 3WGYA 3QRWA 3PQ8A 1Q7BA 4ENWA 3IFUA 3JQDA 3M5CA 3FRJA 4GW3A 4MUJA 5A7HA 3K2QA 1Q1AA 3NWEA 1IJEA 3AM5A 1VF5D 1DEXA 3PDUA 5ALVA 1B8OA 3T3HA 1E9RA 5BYBA 2QD3A 5EQJB 2C88A 5JATA 4QIHA 3JWEA 3CKLA 3U09A 4GBJA 3JQBC 4C88A 2PLRA 1IOWA 2JIZA 3VZBA 2H1FA 3JZMA 4FCVA 4ETNA 1WS6A 3A14A 1M10A 1QU2A 2YWXA 2VNKA 5ALUA 4TLEA 4IF6A 5KYTA 2FRXA 4M9UA 3W90A 2XE8A 1WW2A 2XIQA 1FVHA 3MG9A 4ETIA 1H0KA 1OYYA 3S1NI 2HNAA 5F3RA 2Y68A 4BO7A 4XR4A 4TL6A 4XARA 4M7RA 2BN4A 1EBBA 3PIRA 5FLKA 3P32A 2QA5A 1ODIA 4WFIA 2MSLA 1P9NA 3K1ZA 1EHCA 4WA8A 2X6QA 4DUGD 4DG9A 2IVFA 4NPAA 3ZWBA 2ZM6B 1KZUB 1DG1G 3MS7A 3GF4A 3CPEA 3TKYA 4UHJA 4OHPA 1QR6A 2H5LA 1DWQA 1JIVA 5DW0A 1BKSB 4X6YA 4G4SP 4H6WA 3RIYA 3DB2A 1NVEA 2JATA 2EQBA 2JJYA 3HUTA 3LOPA 2H85A 1MAVA 3BWXA 4CS0A 1IN5A 2RGNC 4KFTA 1KAOA 2IUEA 2RIRA 2J59M 3B78A 3UWMA 2ZE5A 2WQYC 2A92A 2TMYA 5CEFA 1WRGA 5KWIA 4MRVA 4YXDC 2EW2A 3M0AA 3SXJA 1IN1A 4O4JF 4D0NA 1WW3A 3A58B 3PCXA 3CRW1 4Y6QA 3ENKA 4ENTA 4YVFA 3I09A 2DHEA 2FUCA 4GLBA 2ABWA 1X80B 1TA0A 9ABPA 4NESA 1SEPA 1QCDA 1X6VA 3DDNA 4LBYA 4OKSA 2WQ7A 3RI3A 5T5QA 1ZPDA 4LK3A 4C3VA 4DM4A 4PAWA 4FHDA 3NB0A 3LE8A 4Z3OA 1X1RA 1VLJA 1SU4A 2IIVA 1XK7A 4R68A 2C5GA 4CEHB 1X9GA 1DJOA 4HAUA 2IPOA 1EWYA 4MB0A 4D6PA 4IXDA 3TLBA 3MTBA 4Q01A 1J23A 3QGMA 1MOSA 2BFCB 3ET5A 1JH8A 5T5MD 1Z03A 3HO8A 3QI2A 1DXOA 5F2OA 1Y9AA 4OATA 1JHVA 5AVQA 1T5LA 2H92A 4UBOA 2ZWMA 1NU1J 4B71A 1OTHA 1A2OA 3WKEA 3N8NA 3PUZA 4Q3KA 3UAVA 3QPWA 2HRDA 4ER7A 1ML4A 2QLBA 4M54A 4LOHA 1P1JA 3UT5A 3JQGB 4I1VA 4L1KA 5BW8A 4BN0A 3C7AA 5JECA 2JKZA 1RXIA 1Z4QA 3MIZA 4OHYA 3A11A 5A3VA 3A4NA 1I5RA 4JLAA 1WIWA 4XYBA 1QMPA 1ULHA 4FZ5A 3VMZA 1SQPJ 5DXAA 2Y0CA 2YUIA 4IDFA 2QYTA 3KJGA 3IVRA 3IP7A 4A3DI 4QJBA 5TB5A 3VPGA 3I9LA 4DG5A 5IMSA 3KZ1E 1P1IA 3FWYA 1D6NA 2HLDD 2D2CC 4Y1RA 1QAQA 1WUKS 3OCYA 1J20A 3EWIA 2R6MA 4LV5B 4P82A 5FQNA 2Y0BA 5IDXA 3OJXA 3GMSA 3VX3A 2XNSA 1FTWA 2ADOA 5FORA 4ZU6X 5AM4A 4IX1A 1M1XB 3FH0A 1EUQA 4MGEA 4FG2A 2EKLA 4NYIQ 1UZLA 2A6ED 2PT9A 5LOVA 4QTUA 4Y6LA 4NZZA 3BCUA 4B6FA 4YMHA 4OBEA 2J3KA 5BRAA 1KI6B 3LA8A 5U4XA 4EHDA 1PFWA 4PQRA 2OTLZ 1OSNA 3MQ2A 5JSQA 2KB7P 3J81A 4RYDA 3C3JA 4BTEA 4X1KB 2Q5OA 4Q9HA 1L3IA 3LKDA 5T4BA 4EVIA 1U5AA 3I2HA 2JEOA 3L1IA 3I5AA 1ZM9A 1O4WA 1N25A 3EEDA 1Y4ZA 2OD9A 1WVGA 5BVHB 4C05A 3ITKA 1AURA 3TBKA 1CJBA 5LZ5A 1GZ5A 3TWOA 4M0CA 2JGNA 1G3QA 1R8EA 1U5BA 3FPKA 4HWTA 1JTEA 4K9KA 2NU7B 5DBGA 3UJPA 4EJSA 3Q2YA 4YONB 1G8MA 5HRCA 3HN7A 3C87A 3KSMA 1FMJA 2QIWA 4V0KA 4DPKA 1DE0A 4TTJA 3LK7A 4URZR 2GEFA 3L1UA 4QM7A 1GLNA 1GR0A 1IQRA 2XUOA 4O02B 1GPAA 3L70D 1KYTA 3N8IA 3EWAA 4W63A 1CDOA 4HRXA 3HU3A 5E4FA 4JJ4A 3ZLJA 4AIIA 5SYNA 3EA4A 2R00A 3SXUB 2PKCA 1Q95A 4A6XA 2VA9A 2EW8A 3U4IA 4Q6WA 5L45A 4ZPJA 3OWXA 4YRTA 3Q6MA 1Z36A 2EFYA 2GWRA 2XKMA 2E5FA 4LY3A 4TV8A 1NW7A 1QQAA 2Y1WA 2JBWA 2FZ5A 4DLZA 1WBJB 3H1JG 2I87A 4ZHQB 2QJWA 2OVFA 1OR8A 4HD8A 4UPDA 4HNTA 1ONNA 3TNUA 5TSDA 4TWZA 1E20A 1NTZJ 4PY2A 1F7UA 5LQAA 1A50B 1ZBDA 1N2OA 2VPTA 2H0AA 1RM5A 1TQ6A 5LJIA 4JELA 1EZVG 1XTPA 1ZOSA 3ZGLA 3CN7A 3VMYA 2HWXA 4N47A 5FCDA 4RTSA 4WCVA 1KVSA 1PAUA 2JD1A 3KALA 3UGTA 3E3LA 1NRIA 3O5AA 3NBMA 3PFBA 3Q40A 3OI7A 3CUKA 3TK1A 4DQYB 2OM6A 5CJ2A 2V7BA 2VZ0A 1BDBA 3LF2A 4DLVA 4JBLA 3ND8A 5KVVA 1NATA 3SJCA 2ATCA 1N2BA 2FNAA 4DDHA 3WDLA 3T0GA 2IXTA 4R81A 2AFHA 3Q8KA 2WZCA 4BXOA 3MRXA 2OGZA 4D92A 2FPGA 2BGJA 1XK6A 2D1RA 4LVCA 4EGSA 1P4RA 3G59A 1XMSA 1TFUA 3SZGA 1QE5A 3AINA 3P5BA 2NT3A 4REQB 3NHZA 4ZOLB 1KU6A 4WCFB 4D43A 1KVRA 3ASUA 3FHTA 2XODA 3QPCA 5JFOA 4ZGGA 2HA5A 2CW0D 1VHDA 5HS6A 3QKWA 4XQGA 2SHKA 1J8FA 2QP9X 3SP1A 1MB3A 3HFGA 1XEAA 1EJ0A 2ZXXA 5HJ5A 2ZSKA 3KEFA 2DU8A 4U7FA 2ZT5A 3ZKWA 2XWSA 1SG0A 3JAWB 2QU8A 3I01M 1VQP1 5JTUA 1W88B 4DWWA 4TL8A 3W1VA 3R7BA 4NJMA 1RJEA 2MOKA 2PZAA 4C7NA 2I6QA 4NPFX 3IIJA 3QU4A 1HTBA 4M1YA 5B1DA 4MITA 2VJCA 3RVNA 5TJHA 1EXIA 1E0SA 2R7LA 1V1RA 4XD7A 2VO1A 1N86A 2Y9MB 3U9LA 4OGFA 3VPDA 3ZWOA 4RVGA 3D6WA 3ADKA 1HSZA 5AOBA 4V0MA 4D6TG 5HVNA 3HJHA 4R01A 2VXBA 1ZOYC 1A72A 2FU5C 4RHTA 1C81A 1P2DA 1VBFA 2ZGVA 3TSAA 2VDOB 1PNTA 3AUSA 3BREA 4D9MA 2XSZD 4KQ2A 1YUBA 4Q7EA 2WC1A 1P0PA 3NKVA 5K3DA 1SCUB 1C2TA 1K5DA 2HIMA 4NENB 1L4AB 5EPOA 4OLHA 2VTDA 3GVXA 4HFNA 5G4KB 4F3YA 4GA6A 1QGUA 2WM2A 2HBQA 2VPZA 2Z30A 3FUXA 5EVJA 1E3LA 2WJHA 2YV5A 3PF8A 1V6AA 3HVRA 2PLWA 3TPCA 1QAMA 3LECA 3R7SA 1R9JA 1T3LA 1KE1A 1Q2UA 2E85A 5IAAA 4X3OA 2GXAA 1UFKA 5KI6A 3GJZA 2J3JA 3RBAA 3LT5A 3WVNA 3PU6A 1GCUA 2UZ1B 5FNVA 3HLYA 1QP0A 4RJKA 4MRPA 1JMKC 3SFTA 3NUZA 4QELA 3UT0A 1W36D 1H1LA 1TT5B 3UMYA 1GG5A 4MQFB 4CV1A 1ZHOA 2NU8A 1HL3A 3GA5A 2ZPUA 5FUYA 2XDWA 3H3VJ 8LDHA 3OKAA 4P53A 2YIDA 3MJHA 3PVZA 3SYRA 4DAEA 5BMVA 3TXXA 2OE2A 1YJBA 2DFKB 4YUYA 5SYAA 3OFKA 3AXSA 1PSDA 5CU7A 4YMUA 4PGFA 2AOVA 4NBKA 1DPGA 2NLOA 1TVEA 4YAKA 2OBLA 4PYRA 3GKQA 3VFDA 4CMIB 1AF7A 2BI7A 4TYPA 1RQVA 2ZVOB 4ESOA 4Z6KA 2OT3B 1TUGA 2ZJ3A 3R7LA 1R00A 2RHHA 4FUQA 4GU5A 1XA4A 1O95C 1DAPA 2MU1A 4ZKUA 3WYDA 3NW9A 3MXOA 4UDNA 4XUEA 1KYOI 2FPXA 3D54D 1WY5A 2HLHA 4NDAA 1K66A 3FWLA 3DHWC 2RD2A 4JLBA 3R3SA 2MYPA 1WZIA 3K0AA 1HEYA 3A5TA 1K8XB 4KAXA 5JS7A 4RHXA 2YOGA 3VR2A 1ID1A 5AXBA 1WXWA 3ETCA 1PQ4A 4WLVA 3RGWS 5EMLA 2XUIA 1ADGA 2EEOB 1Q7EA 4WGFA 2J6HA 2VP5A 2H1HA 4I8DA 5LL6P 4CM8A 4E03A 3AJEA 1GA4A 2YQ4A 1TYZA 1JJVA 1P0QA 1H42A 1UAYA 4TT3D 4OA8A 3L74E 5COBA 2L5GB 2EIXA 3DNMA 5DBFA 1VMAA 5LKAA 5CVEA 3LUBA 2ORWA 3SK0A 2HK9A 2PRZA 1BH6A 2RFLA 2WSLA 5BY2A 3AEGC 4WZAB 1HGZA 3MJTA 5CAEA 3GLHB 3PUIA 3D1JA 4MKHA 2DPYA 2O0MA 1KQSZ 1T43A 2Q6VA 1B8NA 2JGRA 4J0KA 3A27A 3KTAA 4PWZA 3FOEC 2H7CA 5DX0A 2TSYB 5KNDH 4ZRDA 3TM4A 2YV1A 2GZ2A 3EDYA 4WXPA 5EE1A 3F3FC 4QOEA 4Q66C 3RSCA 2AGVA 3V4QA 4FEYA 3P8CE 9MHTA 2BTQA 2HU9A 1U5CA 2VWPA 2FFJA 1X1AA 2P78A 3TI7A 4OQLA 3ISVA 4YALA 4AP9A 1GZVA 3IQEA 3QI7A 4GS5A 2OSBA 3UJAA 1DC8A 3ORQA 1L4MA 4WRRA 4F8JA 4QUAA 2ZJ1A 1WCIA 2WFLA 2WPNA 4IXWA 4KVAA 3F49S 1G0OA 3GY0A 4NU5A 1HDEA 3ZHOA 5K05A 1FIUA 3L7BA 1AK2A 4X3CA 2C07A 2DECA 3UK0A 3ENNA 5GTIH 5IUNC 1RM3A 1LQ2A 3UHFA 4RVCA 5LMUB 4JKYA 3P27A 4WL0A 4H7KA 4MW1A 4D4JA 2B8NA 3GRRA 1C9YA 4BBJA 3CVOA 2C54A 3W9UA 2HB6A 5HE8A 3TXYA 3WHKA 1LW6E 5T4EA 3L04A 2OR3A 4TKMA 3AVYA 2QD2A 2HQSA 3COJA 3TJRA 3AFOA 2CL5A 2A69D 2GZAA 5B1HA 4N6GA 2GMWA 1MDBA 1A9YA 4TSRA 1QIGA 1X1TA 5AVQB 5CGQB 1F51E 1HDCA 1PFIA 4B40A 2P6NA 2BMFA 3QJ5A 4H60A 2PH3A 5KYUA 8OHMA 1NVWQ 1QYRA 3JWHA 3SE7A 5T8KC 1A9RA 1W48A 5F98A 3GJ0A 5DNWA 2Q1KA 4EDHA 3I2GA 4RFVA 2Q6KA 2WIBA 1KR2A 2CVPA 2V0NA 3HYSA 1QCSA 1VKRA 4QE3A 3KPUA 1WDTA 5K8CA 3H65A 5L3QA 3BFPA 2QHXA 5DYYA 4H44D 4OBWA 2RARA 3GUUA 1EC5A 1ZD1A 2I2DA 4FJ1A 3MMXA 1TCAA 2I3GA 2E76C 2W4MA 1T8ZA 3VDRA 3ONWA 4FMCB 3WR5A 3DLTA 3U17A 4C2AA 3Q7IA 5AVYB 2WWIA 1T3TA 4GI5A 1BOFA 3QVGA 4Y6RA 4I1YA 4Y1RB 2C7OA 4BO2A 4ZT4A 2HDHA 2CXUA 1NTKG 1GSHA 3L74D 1UBUS 4XLTA 1TA4A 4QWWA 4PGMA 3OPVA 1L5MA 1OXZA 5LOVB 4QTUB 4XIIA 3UXHA 1RCTE 2ZE8A 3TIFA 2X6RA 4ZKPA 1K3TA 2P69A 3TBFA 1Q17A 3WHLA 2ZSFA 4PNZA 4BLUA 1WW8A 1NQTA 5T6BA 5DLYA 3GB9A 2CJWA 2X2PA 3CCCA 2QP3A 3E53A 3M2PA 3LP8A 3RSZA 4OMCA 1C3EA 1DHRA 1ZNWA 3VNRA 1FVXA 4MQUA 4MA0A 3SZLA 2DGDA 3M6FA 1RI4A 4IZOA 4BAZA 2O6HA 4F71A 2I7DA 3LLMA 3ECCA 3KHTA 3OLYA 3ORRA 1O2DA 2X4DA 2Z83A 5AVUA 4EMUA 4UE6A 2RKLA 2VUGA 3QUQA 3IJEB 1L5SA 1R6VA 4W6QA 1EK2A 5B7QA 1U5BB 2X8LA 1ZK0A 3GEIA 2I9PA 3CHYA 1ODKA 2XGJA 5ALPA 4BMNA 4EJSB 1O77A 4MYHA 5AVXA 4H1WA 1NF3A 1EUZA 3CX5I 3DVRX 4HAVA 4KR0A 1X13A 1BWSA 1Q1EA 4ZANA 1VQ6Z 1XTSA 2KE5A 2HF8A 3E9MA 3ILHA 1KY3A 2DQKA 2Q8QA 3MD0A 3KR9A 2C2XA 3K09A 3UK1A 1QO0A 2JZCA 1YI1A 2WZ7A 3BIOA 2GYWA 2KXPB 1GYPA 3SZRA 5BNTA 4F9TA 2ZSEA 4D9EA 3SLKA 5HUQA 3LRXA 2GAOA 4F5EA 4XSVA 4TRRA 4K9SA 1FK8A 2VKQA 1UL1X 1KS9A 5BNIA 3GD5A 5FOVA 5G1NA 4M9RA 4IOJA 1PDWA 2VTEA 5G41A 2PD3A 4TV8B 4B45A 1GZ7A 3LGSA 1BX0A 2DTEA 5LR6A 3PFGA 1AGXA 3EIWA 3P5JB 2A84A 1PR3A 4QJ3A 3X2PA 2HD4A 2HK6A 3CF4A 4HS4A 5KDOA 2F1OA 1FTSA 2I22A 5TX7A 1JKFA 3X2FA 3HRKA 5KUTA 2W6ID 1RPZA 1SIOA 2EG5A 2VZ8A 4LGCA 1VE3A 1WMSA 1THZA 3GJ6A 3M9LA 4E2FA 4S12A 4IKPA 4YDSA 2HHJA 2BLNA 1IBLB 5BORA 4X9XA 3DKIA 5EGNA 1EK6A 1WKCA 4IX9A 3NIBA 1G6OA 1QC5A 4GC5A 3IDSA 1Z4NA 1V41E 3QXXA 2C04A 2J58A 2Q5EA 2AFRA 3V4PB 3D9QX 4G5XA 2J45A 4IJMA 1YB6A 2JGDA 5ITWA 4HDOB 4LRQA 1EG7A 3RF6A 2AFHB 4BXOB 1KRWA 5DI9A 4EQZA 5LMNB 2QX9A 4NQRA 4JXZA 4B85A 1ZLLA 2VF5X 5KTSA 4X7RA 2FPGB 4K6CA 1ND6A 2B1QA 3TRIA 3P1JA 1LWUC 4B3DA 3BRWD 3BXZA 3AOEA 3MJ4A 1MX5A 4FYYA 2YFKA 4RH0A 3LW5H 1NA5A 3G4S1 4ZU3A 3IAAA 3ZK9A 1BDHA 2HPZA 1Y48E 1R8SA 5BW4A 2FP4A 1F2DA 3ZCQA 4DNQA 1LPNA 5B53A 3ZKWB 4QU5A 2F1HA 2BSQA 2RAFA 1Q811 3H16A 4EHBA 1Q82Q 4E7OA 5DLPA 2QD1A 4NJMB 1R9MA 1NVDA 2IX7C 1KJWA 4C7NB 4HVTA 2PUBA 4JCWA 4RY2A 3VMAA 4WACA 3QOWA 1N8RQ 4XGQA 3MONA 2XUAA 5F7JA 4BV9A 1V1RB 4FDUA 3ICCA 5JRZA 1DKNA 2XADA 1IFNA 2EIHA 3CLVA 1R7RA 1DI0A 3OA2A 2DUMA 5AW1A 3E4DA 5IMBA 2A86A 3GWZA 3PE4A 2XH8A 2E55A 2P2YA 4ABTA 5C7OO 4QHSA 4DMCA 4GMHA 5AJUA 3PXXA 3MZWB 4WXRA 5DHRA 1WCWA 2OHVA 4FCWA 1DRUA 1YITZ 1QGUB 1EDLA 1GT91 5DOVA 1SCKA 1IYZA 2HMSA 2AKYA 4LF7B 5A0VA 1CQXA 2GEUA 3VO9A 1KK2A 3DMNA 3RL0C 5DM60 1MHPA 1E6CA 3M6VA 1UJCA 2BBOA 1XCGB 4YLYA 3F6EX 1QX3A 1H93A 3R3HA 4D44A 2ZUCA 2O4HA 3TNJA 2VYFA 3M6AA 2X9VA 4L5AA 5G02A 1MENA 4M83A 5FNVB 3EG9A 2CJFA 1CIJA 1E3WA 4AC9A 3FUUA 3HDHA 1ENPA 1H1LB 1TM2A 2Q27A 2G6GA 2AOTB 3RHTA 1XZDA 1W93A 1FDIA 4I2LC 1XKQA 3HFJA 3VH1A 3GNSA 2F64A 3B12A 4M36A 2DE6A 4LDNA 3MPUA 3ZVKA 4LSMA 2O6LA 5FOTA 4IFMA 3TIIA 1K8RA 2B4AA 2N75A 1XZBA 5CCHA 2AMYA 1C3XA 1K8A1 3H4MA 3ZK7A 3UHJA 3ESBA 4B17A 4PSVA 1FJ2A 2OD2A 4WECA 4ZCTA 5FBWB 1MO4A 1PYOA 2ZI4A 3MGKA 3OT5A 3WLTA 3A4VA 4QGAA 3OE4A 1LVUA 1HUQA 2Q51A 1YDMA 1MAWA 3OCZA 2VJKA 5IBQA 1E7MA 1NX6A 1HOXA 3ONDA 2WSIA 3AUKA 5EJMA 4JHXA 2G82A 3ZW8A 4FGJA 1ZG3A 3STTA 5FI5A 4WK2B 1KD1Q 1LS1A 5CH3A 4DPMA 2FW7A 4DJEC 4YJGA 3UJ6A 5JDCC 4GMXA 1LX6A 1K9M2 4IICA 1HZJA 2WYHA 1JYFA 3UAGA 3W8RA 3K0AB 1FVFA 3M9XA 3KB2A 3RD5A 3HDTA 3QHAA 5K6AA 2QDXA 5KSOA 1PE0A 3P19A 4ILEA 2WVAA 2XX3A 4JP3A 2RJNA 3CF4G 3ENWA 2O7NA 2FEXA 1B4DA 1T36A 3D6NB 1G4AE 2A35A 4CM8B 4KWCA 3WS7A 5DNUA 3W3AH 5M34A 1E2DA 3WA7A 2A30A 3RRFA 5FOXA 1TCCA 1THTA 3EPPA 1RM0A 4P3NA 4UHKA 1GGMA 2R6AA 2W83C 2QROA 1YXMA 4BWGA 1NC3A 5JQGF 5LQSA 3HJNA 1OFVA 1LRJA 1LTBC 2DR0A 3PPXA 4BKOA 2WM8A 5KWVA 3TLAA 3CMAZ 4ARCA 5CAEB 1M2HA 1O87A 4E32A 3O91A 2XTAA 3AUJB 2J6AA 2OCGA 2MINA 2CYAA 5I7OA 5KLIB 3G2MA 5I8WA 1MO6A 3KTAB 3VVCA 5CXQA 3I2FA 1M901 3LVBA 3F7NA 1DIGA 4D42A 1NVKA 2F8MA 1X8LA 2AYYA 4JVSB 1LDMA 1KEUA 1E9FA 2WR8A 4F3KA 3L74J 4YASA 4HSEA 2A33A 1P1KA 1X22A 4R9SA 2IHUA 1T5TA 4A3SA 2J3HA 2WSSD 1K7SN 1P91A 1KOLA 3CT6A 3GO4A 1C9MA 2QRCB 3M5DA 3V3TA 1BGXT 3M82A 1KO4A 1VMEA 3QEBZ 3B3FA 3TG8A 4V0RA 1VQMP 3J80f 4ESHA 1P6QA 5HOQA 2ZUEA 5ER9A 3D2BA 4RO0A 1NJ5A 2FW1A 3BKWA 4LK2A 2C4UA 3VPSA 1Y8CA 1PPJG 2XMBA 2C2MA 4MP8A 1WCIB 1GU7A 3ZD6A 2WFLB 5H3HA 5ICEA 5G0SA 1MRSA 4TWBA 3T7DA 3WJAA 1H5UA 2FETA 4BWFB 3JQGA 2GAEA 5I7WA 4KNYA 1IUKA 2UYOA 3FCXA 3QPVA 5BXQC 2E3JA 3DZ8A 1X1EA 4Z0TA 1O0CA 4ZKDA 2P62A 4TZ6A 3B1XA 3EOAI 2BEVB 1LBSA 5K0NA 4F60A 3FYDA 1L2TA 5DB4A 2PUFA 1HNZB 3N58A 4H27A 2ZBRA 3L93A 2W6BA 3OU7A 5FIUA 1ONSA 4KPEC 2YBEA 4Q9AA 1XO1A 3FCAA 4RMGA 2DSNA 3CW8X 1CY2A 2FEPA 2VUSA 2OORC 3D70A 4FW8A 2FLVA 3T9AA 3R75A 1J0XO 4I7EA 1BDJA 2VDRB 3HDQA 1W5CE 4L85A 1QJ4A 2QIOA 5KYUB 5JD5A 1T0BA 4PF1A 1PFKA 2RDMA 3P9IA 5JMOA 4OGWA 3DOOA 2W6JD 3UK7A 4ZTUB 3DP9A 3GJYA 2I1KA 1TMOA 1NC1A 1X2EA 1T0PA 5HOEA 4HKTA 4YCLA 3B5NC 1W9HA 3QXHA 3LM8A 3S8YA 2YXPX 1ZCFA 4GR4A 4DSUA 3G5TA 3NH9A 3QVVA 3ROMA 1SFCD 2Y0EA 2DEUA 3F3SA 3GCFA 3KUKA 3HNOA 2QREB 2XVAA 2R8BA 2FSSA 5BVHA 3KM0A 2Q5JA 1RW4A 1YS6A 1JEYA 4AWAA 4NMMA 3QVGB 4YMTA 2YHBA 1RQPA 2WLTA 2XCUA 2YZ7A 1MHTA 2GA9A 4X1YA 3HMKA 2CLHB 2ZAIA 4K0KB 3W5HA 4JI3B 1TIBA 1DG9A 4KPUA 4B6OA 4FERA 2VAVA 5JPCA 2XV5A 3GL9A 4YJFA 3OF2A 1CDEA 2IE0A 3IB3A 3LIIA 1NW4A 2Q41A 4DLSA 4QQFA 4OGGA 4P4NA 5A9TA 3V97A 5B4TA 1I2DA 3OQPA 2Z09A 2RAPA 1U7WA 2YFQA 2HYIC 3A3NA 1CS0B 3WLMA 2BFEA 3QLUA 4FHFA 4D3DA 4Q1CA 1C9JA 3M9BA 5FI3A 1YWGO 1D2GA 4ND5A 1SQ5A 1R0RE 1VP9A 4KR9A 2YQZA 4D9JA 3E9ZA 3DWEX 4R6XA 1UFQA 3TD6A 1PLJA 4I9HA 3DKVA 3SZUA 5C4XI 4UTZA 5MN6A 3I0MA 5AVUB 1V5WA 3ZQUA 1IQ0A 4ZHQA 3JQ9C 1HYBA 2P75A 2H0RA 4RE5A 3T5MA 4RPHA 4CV2A 2AWOA 2QGFA 4JVMA 4UM8B 2QPOA 5ECWA 4AXBA 2D4HA 3VNSA 5DBHX 5AOAA 5D1HA 1TMKA 3JD0A 1YJXA 6AT1A 1I5EA 2VA8A 2D2IA 5IKMA 3U9TA 5J5CA 5LPNA 5LA6F 4EUNA 3HUSC 4II2A 4URVR 2E49A 3NXSA 3MMPA 2X0IA 5C8ZA 4WXHA 3EVCA 2KBEA 3RVSA 1DP4A 3V33A 3JVVA 4JUIA 2DFVA 4AG6A 3VC7A 1NBIA 4Z4HA 3PFFA 3K9WA 2GZSA 4XRRA 4C5BA 4Y6PA 1W0KA 1I6WA 2JIOA 1DC3A 4MK4A 2C9OA 1ZIPA 3ZWMA 3JYOA 3KAKA 5DX1A 4HWKA 3IESA 2QJKC 1NAIA 2DH6A 2QM3A 2D2VA 3PGLA 4DM7A 1I10A 4ECAA 2J5XA 1RWQA 4CKZA 4JP7A 2VQ3A 4ZOLA 4DGQA 1F8GA 3RFCA 3LC1O 2M32A 1U0GA 3M3DA 4FYVA 3I34X 1P1BA 4MR8B 2FXMA 2Q28A 1IC6A 1N1DA 4JT2A 4E15A 1PR2A 3VRHA 4CLOA 5JNUA 3JAWA 4O9BA 1W4BA 1QGED 1ARZA 1VJCA 1QC5B 3IXQA 1OI4A 5A3RA 1F6WA 5FAXA 3OM0A 1W7AA 4WBAA 2Y71A 3JRXA 1Q862 4UMEA 4PCLA 4KXQA 4BYMA 3CX5H 2JGDB 4QREA 4MIOA 4YJHA 3KS9A 4NE7A 3CZCA 5EZYB 4RTPA 2YIVX 1KVUA 4JA2A 3ZU4A 4WHMA 4GM4A 1L7RA 3MK31 3CC21 1AQLA 3OUZA 1WUJS 5BQXA 1UXHA 1AIPA 2IZ1A 1DVRA 4K9RA 5AD1A 4MD9A 2G2KA 1Z7YA 4IW3B 2LIPA 1KYXA 4UZFA 3RK0A 3GPIA 5IC6A 3RKSA 2Y4OA 5IHXA 3DBIA 1UUFA 5CMZA 5GONF 2EHDA 3X1WA 4DE5A 3ER6A 2OOSA 4RELA 4HPXB 2PUHA 1L4AA 1QKKA 1ONOA 2W2PA 4IS2A 1W34A 1O6BA 3RRYA 1A5ZA 1Z4PX 4Z8YA 4U0KA 5SICE 2GERA 2FP4B 4QM6A 5APQA 1TQ2A 4AMBA 2LCFA 4B43A 5IN5A 4GKKB 3NIFB 1COZA 2XTMA 5KOJA 5KJ7A 4RHCA 1YIJP 2KW5A 4B4VA 4MS1A 2BR3A 3RK1A 5P21A 4AURA 2UZ1A 3Q8LA 2D8AA 3N4XA 3LPCA 2DPHA 5C51B 1YJ9P 5FWDA 3PCTA 1T6AA 1SXJB 4ZCMA 4ZEOA 3U13A 2PFGA 1ZN8A 4FOSA 4NFYA 3THXA 3P0HA 2E21A 4DNFA 2QEX1 5AW1B 2ZSUA 2E2IA 2JWAA 3O83A 3W4IA 1UWVA 2MJLA 3HCDA 1NY6A 1Z6AA 1V3QE 4PZCA 1SELA 2OHFA 2XWJI 1Q77A 3MS4A 5IEBA 5F7ZA 1KI1A 2HMTA 4P22A 1BVYF 4H7FA 5DSTA 4JGBA 3CCJP 3K6JA 4MVJD 4CMIA 4A3EI 3SEQA 4DC1A 3B1VA 4GOND 3U5TA 3D3JA 3WI7A 1OF1A 3MHTA 4UB6E 2CK3D 3RWOA 4KFRA 1POWA 2ODWA 4X6AI 1DC7A 3RL0g 4NH4A 3EG9B 3BTSA 2QJYB 2NM0A 4H9GA 1DU4A 4OHOA 4LWZA 1E3WB 1PNRA 3I55Z 3DT9A 4DBLE 4YRFA 5HP4A 3AP2A 3EBOA 4XX2A 3LY7A 5KJ1A 3E22B 1DAEA 2CUNA 1S7MA 2HJ9A 3WC4A 1FUUA 3VHLB 6PFKA 1M1JB 4JVOA 4FZRA 3TVDA 2JFXA 3WO0A 3U1AA 4L02A 1QVFO 3RK2B 4LJKA 2O2EA 2JJQA 1RLOA 3TUZC 2VR1A 4KRYA 2NOAA 3MGAA 5A9SB 1X1BA 3L7JA 3R3WA 4RC9A 1Z2AA 1X1CA 3E8SA 4ZZ1A 2CLEB 4OK3A 5ALZA 2FHPA 3LD9A 3RIMA 1EWKA 3QQ5A 4YXFA 1FTYA 3IP9A 4GT1A 1VFNA 1WXGA 4WZAA 3GLHA 4RHYA 4J43A 2QN6A 3OBIA 4G5OA 2P6UA 1L5QA 3BS4A 2GCNA 821PA 2VUTA 3AP1A 2ODNA 4YJGB 4BNGA 1P9OA 3D7KA 2H18A 3D8TA 3SBEA 3GFOA 1L1QA 3HXKA 2V8JA 2KLUA 3P9QA 4JOCA 2VSYA 1QVGZ 3ESAA 3UCFA 5DO9A 2FUG1 3FD8A 3LY8A 3IUEA 1B14A 3PWZA 3FZYA 1T36B 2UYYA 1QX4A 2PRJA 3LT2A 3ZNOA 2DW3A 5K5EA 3KZIE 4LDQA 5BQ5A 5IRCD 3BGWA 4IJ6A 1ETUA 4NCXA 5FTMA 3TIWA 2AD1A 3CVJA 2W2VA 3H2YA 3KU1A 4F3NA 2JH8A 4MH0R 1SHJA 5CVDA 2IF0A 3UV7A 4WKNA 1NLYA 5ER6A 1E69A 1ACLA 5E1DA 5FI0B 1P6UA 1XXHA 4GFDA 3L70E 4OFBA 2PWPA 5DBOA 1NW3A 2M1XA 4KGZA 1ZIDA 3ND9A 1T1RA 2JGKA 4NNPA 2MINB 4J0DA 2L18A 1VSTA 1ZVMA 5JWOA 2JFWA 4ACBA 1V8ZA 1BXKA 1J99A 5DNYB 1M7HA 5LB2A 1I51A 3VJRA 1YI2P 5TVGA 4CQJA 1E2UA 3CCEP 2ALJA 2W27A 2H2DA 4PPNA 5FPYA 1DEOA 2OG2A 1CUJA 2AKEA 3FVQA 3RS2A 4WOCA 3RK3C 4PYNA 3S2IA 2QXYA 2N47A 2RGWA 2GR9A 2VYND 3FYHA 3GFBA 4IGEA 3PE6A 2ZJ5A 3H8WA 4E70A 2DPGA 2ZYDA 1SOMA 1IG3A 3HCRA 3HB4X 4W9NA 4QAQA 4EEKA 2JARA 5TPZD 4K87A 4MVCA 4OXYA 1C7QA 4NX2A 3VO2A 2PMWB 3T06B 3TTYA 5APVA 3AJDA 1J8QA 3AGQA 5HIJA 4ENQA 3QVJA 1JXAA 4H7IA 4D0RA 4RVUA 5IVPA 2I1QA 1U1FA 2PUGA 4CE6A 7GPBA 4Z4EA 3N86A 3FPGA 2R1TB 2DH5A 3HC7A 1BQ4A 4PCUA 1T8WA 4JZKA 4XZ3A 4BJHB 2X0DA 2RJ3A 3ABZA 1G64A 1GTZA 1NONA 1UJBA 3MJFA 1RWMA 2NPOA 1IN8A 3LUCA 2PMFA 1Y33E 4QGSA 1Q7Y1 1X87A 3QMWA 1VL1A 1TZCA 4UHFA 5AVYA 4MUXA 1S9DA 5FO0A 3CUYA 4X64B 2RG1A 2ISQA 1E6KA 1NVVQ 3G0OA 3GIWA 3IN6A 5BWBA 3KFLA 3A6GA 5C81A 2DBVO 4Y98A 3T61A 1JJIA 3RFTA 5CCGA 7MHTA 4HVCA 3CCVZ 3W8NA 2W2KA 1BWPA 2P4HX 5CIWA 3F90A 2OLEA 4QPNA 4EPYA 1NBHA 1NTMG 1JJBA 3WMGA 2PM8A 1HZZC 2X0JA 3IDQA 1THGA 4LY0A 3KSAC 1SIBE 3QWIA 3DMFA 1P33A 1IOZA 2CXRA 2AH5A 4K46A 1Y34E 1FS0E 3ODPA 2WWRA 4ASUA 2GF2A 2HC9A 3Q9UA 4C20A 3F5MA 1CFZA 3BZUA 4LJ6A 1IBRA 3M83A 2NXJA 4WZZA 5CEJA 5KU7A 2FPOA 3FTDA 1AJEA 1JEYB 2FRVA 1JR3E 3BFVA 2G67A 1XCBA 1H3NA 1DZ3A 4X1YB 3IX0A 2WOOA 3QE4A 5BUSA 3RRBA 3R77A 5JV5A 3ZEAA 4GEGA 2PICA 4NCNA 3U9SA 2P3YA 4LOKA 3O8QB 5AHOA 3DKPA 5A6VA 2GJSA 1RJWA 2PBFA 4KPUB 2DUJA 4YJFB 1I2ZA 4JI4B 5INTA 2IYPA 3HA5A 4BVAA 4HQLA 4O4HA 1VL6A 3VOSA 1E79A 3SMQA 5A6SB 4WY2A 3CCRP 1QANA 4J7UA 4WV3A 4Y2HA 3UUFA 1GDDA 4BIMA 1GPWB 4GP7A 3U0VA 1QBKC 2ZKIA 2NYRA 1LH0A 4ALKA 4FN5A 5F77A 2H1WA 1XV5A 2BFEB 3DDCA 5C5DA 5TT0A 1ODTC 1TW3A 4P31A 4ZTZB 2ONJA 2HZ7A 1H8HA 3SEAA 1ZVVA 3P26A 3EPHA 2WJ6A 3BMQA 1QHSA 2OHXA 3E9EA 5CK5A 5EZ6B 1TKBA 4MCJA 2PUDA 4Y7DA 5D84A 3KVOA 2VUMA 1NUUA 5JBQA 2E74D 1KKMA 1Z6XA 1BVUA 3MD9A 2XF2A 2QDKA 4QEZA 2NW6A 5BUQA 3ZWPA 3VZSA 1QKIA 5BUCA 3V4WA 1E60A 4GKBA 3T1QA 2GYYA 1NDUA 1NQAO 1JEKA 1M2JA 3BCCE 3VN0A 2OTCA 4BMOB 4ZV9A 5CCXA 1JAYA 1FFCA 3CMEP 5LDHA 1U0RA 5BR4A 1G1AA 3BH7A 2H7XA 2HA7A 5CB0A 1VC2A 1ZRTE 5EMKA 5LVAA 3AW9A 2ZKLA 2ZBPA 2R6GA 4TNUA 1D6SA 1CNFA 3PUYA 3FCEA 1DKLA 2UYCA 2E0IA 4ZMDA 4Q1DA 4UBKA 3QFFA 1CLEA 2HO4A 4F8EA 3OT1A 2ZJAA 3VC2A 3GT4A 1XYGA 2IXBA 2QVBA 3AK4A 3FYTA 2K2QB 3CX3A 5CT6A 4RZIA 4JS0A 1KAEA 2P5TB 4A1FA 5F7XA 1OKKA 4N40A 1J2YA 3ZGNA 5FBRB 5LIRA 4DCOA 1Z7GA 3E1KA 1VG9B 5DT9A 4GODA 5C1IA 3WNQA 1E3EA 1WCMA 3QNMA 2D13A 3HB0A 5DW3A 5I3ZA 4F93B 1UZNA 5EQDA 3KFVA 4CI9A 2Y67A 3RC8A 3RSOA 4BJ3A 3BX1A 4Z4FA 4I1RA 4S04A 4CLOB 1GUYA 4NMLA 1ZL2A 4TMYA 3WWPA 2OQVA 4JT8A 2VT6A 2YJ4A 3U3OA 4E09A 4E0BA 1QAOA 4G8CA 3CG0A 3VDXA 2JHGA 3AKDA 4YJHB 1BDDA 1K5GA 1NW6A 2N1TC 2OC4A 1FBNA 3F3KA 4KUHA 2X3UA 3VAAA 3GTPA 1Z8DA 3G0IA 2ZIUB 4AO8A 3LCCA 2ZYVX 2C2ZA 3WQBA 1VQ1A 4G25A 4YC7A 1JR3D 2H8KA 1WD7A 3IAUA 2I2XB 5JS1A 4KSBA 2QRUA 4HWSA 2KSQA 5KO2A 3H4TA 5JYCA 1TYBE 3EFHA 4CF3A 4TTPA 2UZ4A 3LHKA 2NZ2A 2OWEA 2O2DA 4BDSA 4G5YA 3AI1A 3E48A 3L8DA 1XTQA 2NYAA 1C3OA 2HA2A 1VQ51 3PHIA 4HWPA 1M8GA 4TWIA 3LIPA 4HQRA 2G5GX 2HR1A 4AX8A 1WLSA 5HDBB 4F9FA 5IS2A 3I42A 1NASA 4NZMA 3WXBA 5HF9A 2HPCA 1IY8A 3L35A 2H1RA 1VCHA 3OZVA 3PC7A 4EKNB 2KHZA 5I6DA 3ACBA 4Z9AA 3SDSA 4EARA 5KOJB 4KB5A 2V4UA 1ZMRA 2VYQA 4MS1B 1JCDA 3FWNA 4K2HA 1KORA 3LKVA 2JDIH 1KP3A 4MTCA 4RENA 3VDMA 3C3DA 5AK0A 2Z8YM 1X9IA 4NEGA 2DR2A 5KNCH 5GGXA 3ZCSA 4E5DA 2OFPA 2AOTA 4MUMA 1F20A 2ZI6A 3THXB 2LRHA 2JRCA 2X8BA 1CSEE 4L27A 1JT2A 1TZJA 2CY0A 1RP1A 3GT0A 2PHZA 3BCCD 2M6KA 3CG4A 4LJLA 1OQAA 2ILTA 4WLEA 3U4QA 4R84A 1QXFA 1E9VA 5DLEA 5JEDA 4OQ4A 4P33A 4TTIA 1ZUWA 3GAZA 5K20A 5A62A 4NZPA 1ZRTD 2RBGA 5FFMA 4RV0A 2Z9DA 3MJSA 2Q7DA 4A3GI 1IBSA 1PIXA 1LK7A 2XEDA 3CLUC 1N10A 3E2IA 2VDQB 3LKBA 5ED4A 4IQ0A 3H2HA 5JZSA 3G1UA 5EERA 3ND5A 1ZOOA 3MERA 4QO8A 5EIFA 4F97A 2IOFK 2WILA 1G19A 2YMQA 5F7OA 3VR0A 4DZZA 2WHRA 2OCPA 5K0GA 3SSAA 2XV1A 1SVLA 3DTTA 4BFWA 3O8RA 4LF5B 1S2DA 3JQRA 3ELDA 3E1IA 2WJYA 3NJ8A 2BUCA 4YRKA 4UNNA 2QSJA 4EX6A 3U4AA 3UJDA 2EF0A 4WNIA 2A9KA 1GEEA 1GGVA 3MZ0A 4MVJP 3NRCA 3P2IA 1E1YA 4M0FA 4HXGA 2ZCUA 3WWOA 3C5VA 5B1EA 4JBYA 1IN6A 4HRVA 4OQXA 5AW7A 3AUTA 4Z99A 3EWKA 3DLAA 2F8LA 1BAPA 1RNLA 4EJ0A 2GA8A 3RADC 2FMFA 3HM9A 1QX8A 1RAHA 1KMMA 1J06A 3RT7A 4MIKA 1X9VA 4IDPA 1Y7IA 5CTAA 4I55F 1PQWA 2EZ4A 1EZVI 4PW0A 1FP6A 1KKLA 1EEXB 2JIBA 3AIMA 3GBVA 4N3CA 3VC3A 2JLBA 3WTCA 1NRJB 1M0EA 1VI5A 3DUFA 4M0LA 1CQJA 1YHNA 4H15A 5DOZA 1XIVA 3C6QA 3MEQA 2HCZX 3EC2A 2ARKA 2HRQA 3NHRA 1ADFA 3QU2A 1YRQA 3JSVC 3LQ1A 2JG3A 4ZYYA 4EZEA 1JFFA 3SJZA 6REQB 5DN9A 2XZRA 4RAQA 4O2BF 3GDWA 3FNIA 2FZ4A 3NH6A 2QSUA 4ZVTA 4DR4B 2OILA 1K3FA 4CI0B 1ZHFA 1E3DA 1O03A 1ABFA 5BSRA 4TMXA 1QONA 1SCBA 2IYUA 3IBCA 1GD1O 5JPIA 1XZGA 1W46A 3RIHA 4IIVA 4A3MI 2DF8A 1XXHB 4FR2A 4QX6A 1XROA 1IEVA 4QTYA 3ROGA 4D3FA 1BE1A 5FLEX 3F89A 5GTIE 1MO2A 2ISSD 1U31A 3PXCX 3U7QA 3P2EA 1PS8A 3GTQA 4HH0A 3BIWA 2CEKA 2ZRCA 4FOOA 1BGYG 3WU2H 4WKCA 4DNXA 2R86A 3OMLA 2WM9B 3KKPA 4Q7JB 3FMIA 3I30X 2I6UA 3Q5DA 2C3UA 4A6EA 2AMLA 3BXEA 2BEVA 4TLLB 2LKDA 3PLNA 2FWPA 4P9NA 4U3JA 1TAQA 4E7PA 2ZT7A 2G3YA 3UW3A 4HVAA 2ZRLA 2VAMA 4D0GA 1D9XA 1OMOA 4DNPA 1WXXA 3UMBA 3GFRA 2GUVA 2GKSA 3R6WA 3EVGA 4NCKA 1JIKA 2AJCA 3JD4A 3O74A 4NNOA 1OX4A 4NECA 1QVZA 4Q48A 3L70J 4H0LD 2GEVA 1CVLA 3A9UA 5FEUA 2NO9A 1DC5A 3SS9X 2XWBF 3W5SA 2P5UA 1I14A 3R4CA 2R7MA 3RQSA 4BRWA 2VTBA 2ZZMA 4CM3A 5AUQA 3LBNA 1DAKA 1N2CE 2C4WA 5IWCA 5CBNA 4EMSA 5ANRB 1MVLA 4NI5A 4EH1A 2ANCA 2B5VA 3SC6A 2A06E 4UW9A 1L9KA 3H1FA 1H9BA 2FOIA 4IUYA 4DCKA 2VN8A 1I13A 1BMFD 5LQKA 2IV7A 2DBYA 3LLVA 2NZ8A 3VU0A 4IIUA 1R0KA 1XG5A 2WTYA 2ZU6A 3CUSA 3F96A 3GWGA 2NVUA 5I9BA 4AQDA 2RGRA 2FXVA 3F3PC 4K8RB 3DHVA 3BHIA 4D9BA 1XNGA 2BDUA 4RMIA 1RABA 4AVYA 2RBLA 1KMHB 1M34A 4NABA 2QT1A 4LXYA 3BVPA 4QTTB 2AI2A 1HVVA 1SVNA 3G2PA 4XAQA 2BUBA 2A9FA 1GZUA 1QHXA 4II3A 2VK2A 4V02A 1SVOA 1DT3A 1H2RS 1IFIA 1ZINA 4ENVA 1Z2EA 4NFLA 1M54A 4U2EA 1KZ6A 2W2KB 5HNKA 4OHKA 3B4SA 2R6JA 3EZGA 3FF4A 4ZHSA 5KYVA 1OAOC 1T9CA 5KNDD 2Q6QA 3REFA 1PZGA 1N8NA 2G1KA 4DDKA 4BEWA 4Q82A 2QQEA 4J76A 2VZEA 2Z1MA 4KUGA 1QQBA 3KKKA 2QSYA 2QEQA 1SQ0A 1CS0A 1IO4A 3IMEA 4Q9IA 5KS2A 1L3CA 3DV2A 4EY6A 3KPWA 4R2LA 4TV9A 2QI9C 2YIUB 3IPXA 2OSVA 4YK7A 2WYOA 1RF0A 5FL7A 5AKGA 3S70A 5LU8A 4ENPA 4Q1FA 1PGOA 1D4AA 1SUPA 4FMBB 2ZB7A 5DULA 1I24A 2XUKA 2O20A 5EZ5A 4I46A 4MV8A 4URHA 4JHLA 4CMAA 1YA4A 4YCNA 2QR1B 4LDZA 3TE7A 1H69A 2KSEA 1USKA 1EE1A 4O4HB 1QV7A 1GTVA 4NLLA 3OO1A 1C3LA 4TYQA 4WCDA 4YT2A 4N82A 5DYIA 3YASA 2YN0A 2DVMA 5DYGA 4QU8A 3ROZA 1UCFA 1DD3A 3O4GA 2GQ0A 2TRSB 3KXKA 4KX5A 3LAWA 1CR1A 1JLHA 4FS8A 3PNKA 4DBVO 2ZIWB 3BMQB 1BA2A 1U8EA 2EP8A 1FFSA 4PTYA 2OTJZ 3IULA 2CBZA 3EDMA 1GGHA 4EPXA 1PQYA 4TMFA 4H1TA 2IHVA 2OKGA 4AW9A 2IPNA 2ZCJA 2QLVB 3SQNA 1LQUA 3R3ZA 2R1ZA 3FHCB 1T5HX 2X0KA 4X94A 2Q1XA 4PZUA 3C1OA 1V5IA 2D5LA 3ZWWA 4G1MB 2CHFA 2WWVD 2Q50A 1EFLA 1YI0A 3AJ9A 1CPYA 3ST7A 4JT4A 1O94A 5C37A 3C8DA 2VJQA 4MR8A 4M1SA 3QWZA 2VG8A 4TKLA 1RQNA 3ZOKA 4DIDA 3AKCA 3BH6A 4QDKA 2A06D 3H1HE 2F9FA 3UIAA 1PZFA 2C5HA 1E3QA 4HDNA 2Q45A 1QYXA 4JR0A 1Q0ZA 1ZNZA 1K98A 3OT1B 4Y2QA 3GARA 2GXUA 3O8OA 2A5LA 1JVSA 3KEQA 5EZYA 5A7GA 1EK1A 3E2PA 3FZGA 3CLTD 1EMDA 1YZKA 4CEJA 1ZD4A 3BCCJ 2B1GA 3EVZA 3D4IA 4FLFA 2FFRA 3FTQA 3QYJA 3ACDA 3HBLA 2C3YA 3FPHA 1J56A 4Z0PA 3IUNA 3S2GA 2WWXA 5DH9A 3M3HA 2GAFA 3TR5A 5C32A 4BPRA 3FMFA 3A7OA 3FI0A 2ZR7A 3C5WP 3JQAB 4BV2A 3VSAA 4AY4A 4RTRA 4RD3A 4UU7A 4B6RA 3ELUA 3N70A 1NP6A 3PD7A 3ZVMA 1NVAA 1PUJA 2ONKA 4IWYA 1N7IA 3A06A 3S2EA 3H1IG 1CUVA 1EG2A 1JSXA 1VHWA 3TAXA 3QXSA 4EOTA 2CGEA 1PK9A 1TPZA 3DMHA 4U2DA 4NOMA 1CUDA 1PVOA 1PW5A 4NFSA 4Q4JA 4AN0A 1OU0A 2Y77A 1FXSA 4ARVA 4QOIA 4ZYUA 3GHGA 2V4HA 4Y52I 4REOA 1LNQA 2G06A 1PQEA 2P3SA 4B73A 3HK2A 3UG6A 4D8TA 2E4WA 3RTGA 1K9SA 2ZG6A 2AYDA 1TJPB 2AW3A 3SJBA 4WK4B 3IHTA 1NG1A 3UXEA 1GPH1 1SXJA 4CFSA 2CYBA 3ZC3A 3SZ3A 1YR9A 1PS9A 2XZLA 2GBIA 4PVCA 4CJXA 1KVQA 2COUA 3EARA 4KZKA 5BT9A 4C46A 5JAHA 1C3OB 4BWNA 4NBUA 4LMAA 2E5YA 2Y92A 1Y9DA 1FNBA 5KAIE 1V8FA 3EQ6A 4PJ0E 5FI1B 2PKQO 1J70A 4PC3A 4I66A 4FYIA 2HPCB 3AZPA 5I8PA 3CSUA 3NT5A 1UQRA 1LLUA 3RVLA 3BIJA 4UQOA 4CMEA 4TWAA 2KYVA 3FXEA 3THRA 1B6SA 1XJ5A 1OYOA 2GZ3A 2JZOA 2YBDA 3CRMA 1FNDA 4OK5A 2PPLA 4EL0A 2GLXA 2G1JA 4YCMA 4UE2A 3FB4A 3OG9A 2MSNA 3E22A 5JAZA 1U0FA 1PFYA 4XCVA 1RWBA 1YDWA 1N8SA 4EJFA 1M1JA 1RWWA 1O5TA 3DBVO 3KDSE 2A78A 2W11A 3BSSA 3HZOA 4X7BA 3U4QB 4JB8A 2VYVD 2XQFA 3L01A 1ZMOA 1ZOLA 3VOBA 5BSFA 3ECAA 3AJRA 2LZ0A 5AKJA 5A9SA 3H1HD 1N7SC 3WBJA 4DZRA 3HKZA 2JLWA 1Q0LA 4MIEA 1SKBA 4PYOA 2BHTA 1OFGA 3NT2A 4CHGA 4PRZA 3HDVA 2BD0A 3LA6A 2WKRA 3CZRA 1NPDA 2ZFUA 1MABA 3FJOA 1VQKP 2VDUE 2IXAA 3QBJA 1ZK1A 3R23A 1Q0UA 5IJ9A 3JRNA 5LQJA 1MB9A 1CYDA 2ZT9D 4FOTA 1ULUA 3TKLA 3UGJA 3ICEA 2K3RA 2VNSA 5CD9A 2ZYAA 1P5JA 4R7GA 1BN7A 4DJJA 2DY1A 3FUTA 1NXSA 1FFWA 4N3GA 4UU1A 3HNRA 1YDFA 2P6MA 4PFJA 3HB5X 3I4CA 1Z2DA 1QFMA 1DGQA 4NRDA 1N2EA 4LYYA 1UANA 3EW7A 5DZSA 1J5EB 1EFRA 5C35A 5AW7B 3HJUA 2ETVA 4HN4B 4O4JA 2H48A 2VWHA 2XF8A 1J1UA 3H18A 3SWKA 2XT9A 3RM3A 5BO5A 3R0QA 2CJXA 1DJPA 2F00A 3SSUA 4QUEA 3GEBA 1IUPA 4IIJF 4M8LA 5SYMA 1B76A 3TLXA 5BYKA 2NV6A 3WUUA 5AT1A 4WX2B 1L8XA 3UOWA 2RG7A 3ZBQA 4E2ZA 2PT5A 4DW8A 4JSYA 3DUFB 3VAZA 1CQJB 3V8VA 3ZZUA 3I04M 3O1JC 1SP4A 4V0SA 1SBCA 2L42A 1DQYA 5IM4F 1KFEB 2PAJA 2PJHB 5C7YA 3OJEA 1PV2A 2GO7A 4K8OA 1YVDA 4CLDA 2WHYA 4M88A 1JFFB 1J24A 2NUBA 1TGYA 2VUHB 5CM9C 5LXTF 3QUTA 4URXR 1OH7A 5AW2B 3F7TA 4POAA 2I7XA 4YRAA 2PUEA 1KYOH 4QJIA 3B13B 5TF4A 3IO5A 2FN8A 4MWGA 2BYTA 2CV0A 3ABOB 1E1RA 3FN4A 4G4SO 2WG0A 3NHFA 4WZBA 3GAFA 2F7SA 1KSFX 3QMPA 2LBPA 1H0RA 3A1VA 3U7QB 4OSOA 1G2QA 3W6NA 4AZSA 3RWBA 3ETNA 2HHCA 3AEAC 4RXTA 4BKUA 2HMYB 2CV1A 1K97A 3FCYA 2F62A 4BNZA 3NH8A 4BAGA 4DIFA 1UOOA 2JHFA 4EI8A 3CF2A 3D81A 1YCHA 2R1TA 3UY4A 3N0TA 4U3JB 1H8EA 1JLLA 1H23A 4ZO7A 3T54A 1VPVA 2F55A 4D9IA 1ZP0C 3PX2A 1GW4A 4LYGA 2B4QA 1A8PA 4G0OA 1MC1A 3JWIA 5JZMA 2E42A 2J6BA 2NT4A 2Z5FA 4H16A 1XPOA 5C4JI 2H11A 1OX4B 4JP1A 4A92A 1FTQA 2RHJA 1YBFA 2X2OA 3RG8A 3OA7A 3PNMA 2HN9A 3HUEA 1JAIA 4BQNA 4CW7A 5AQEA 4EEXA 1LA2A 2PR7A 3H2BA 2VTBB 1NQUA 4IIHA 2RIPA 3TDNA 3GOHA 5EPPA 3N39C 2GEDA 3QEKA 4KO1S 1Z5NA 4D02A 1B1AA 4GUAA 3G9XA 2EYUA 1QU3A 2Q4RA 8ATCA 3EEOA 2BOVA 4G84A 1PX2A 5EMMA 4R69A 4TM8A 1Y6JA 2O50A 2ZS7A 4I1SA 2RHMA 3I5MA 3DZKA 1YNOA 1SQSA 3KV3O 4ZRMA 4ZVOA 3KYIB 2JLVA 2NVUB 2OGUA 3TW8B 3DTVA 3JQPA 3A9WA 2DUUA 1MH1A 1ZS9A 3JQBA 1WULS 1M34B 3WL6A 1ZGAA 1Q0TA 4YY3B 3HJTA 3P7KA 2ZUWA 3EB9A 5KVSA 2V74B 4XI9A 3NDIA 1UBEA 1RKXA 1FC2C 3RTEA 1WNTA 4OJMX 3CPSA 4JC4A 4ZRNA 4Z7QB 3O8QA 3RHSA 3AR4A 4UAGA 4LY9A 4EHLA 3BG5A 3ZGOA 3A9RA 4LZOA 1KQSY 4HB1A 5GQSA 3QFHA 1JI3A 4JJOA 5A6SA 3RIXA 5GJCA 3OTOB 1DIAA 2CXQA 5G53C 5APSA 2QTLA 2DWPA 3R3UA 1JKXA 4FEEA 3QW2A 2OTL1 4TV9B 1ZEJA 2WSFH 2QQ0A 3X2HA 1V1MB 1U1DA 2WPDD 1MZVA 1FA9A 2GBCA 2B92A 3G71P 4BXXI 2AUTA 4F04A 5A2Qf 2ZUBA 5H4HA 3L18A 4O0MA 4MI1A 2QW8A 4N4AA 1I7SB 2DKFA 1GFSA 1CIPA 4DM3A 4MO9A 5JJIA 1V5EA 5GIOE 3TJZA 4LXGA 2QXUA 4ZI2A 1FFBA 2A67A 3H99A 2FYNB 2HT1A 2GSDA 2C95A 2IYAA 1IUOA 4NHOA 2ZRMA 3CPWO 5LUBA 3DEIA 4JJGA 5SY4A 4KLCA 3DFIA 3VR6A 3K92A 2ZUSA 4S05A 5LA6B 4QYSA 1ZNYA 3OLQA 2VI5A 1MJGM 3ZXXA 3CCUP 4AF7A 1AVTA 5EKXA 2QYOA 4MVJE 1