1FDIA

Oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite
Total Genus 251
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
251
sequence length
715
structure length
715
Chain Sequence
b'MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 251
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdiA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdiA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdiA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdiA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdiA03
2JIRA 2JA7A 1E32A 1PT0A 4KDIA 1DMSA 1VC3B 4C2MA 4AYBA 2WAQA 2NYAA 3HU3A 4AONB 1FDIA 3O5AA 2G8YA 1IW7D 1WCMA 1R7RA 3CQZA 1OMIA 2NVYA 4D7ZB 3QQ7A 1Y5IA 2DMRA 5C1BA 5DYIA 5C18A 1R9TA 3OUGA 2NAPA 1DMRA 1TWCA 1PQEA 1PQHA 3QQ8A 1S3SA 2V3VA 5T5ID 1PYQA 5FTMA 2R7ZA 4KO8A 1UHEA 2NVXA 4AZDA 4KDLA 4AAYA 1EU1A 3FKIA 4GA5A 5T5MD 4RV0A 1WLFA 1AA6A 3HU2A 1CZ4A 1SFOA 1E18A 2VPXA 2JIQA 1UHDA 4CRZA 5FTNA 3GTLA 2R92A 1I3QA 1AJYA 1KQGA 3IR5A 2B63A 3HKZA 3IN6A 1WMKA 1H5NA 3GTGA 1PPYA 5FTKA 2P10A 2JA6A 1QDNA 5DYGA 1QCSA 1SIWA 2VPYA 2V45A 2JA5A 1TMOA 5FTLA 1TWHA 1Y1VA 1TWAA 1Q16A 2E2HA 2VUMA 5GLFA 1AW8B 4CS0A 1E5VA 4QIWA 1G8KA 4KODA 3GTJA 2VPWA 1CZ5A 3IR7A 1R27A 2WB1A 3GTKA 3EWKA 1E60A 3H25A 1I50A 2R93A 3QWZA 1H0HA 2JIOA 3TIWA 2E7ZA 4AOKB 3PLXB 4CRYG 2IVFA 4KLNA 1Y4ZA 1CR5A 2YU9A 1OGYA 3O6QA 1TWFA 5EPPA 5B6CA 1E61A 3GTPA 3CF2A 1PYUB 2VPZA 2C45A 1Y1WA 2IV2X 3H0GA 2JIMA 3TM7B 3GTQA 3GTMA 3QC8A 3ML1A 2PJHB 1YLEA 2PMZA 4GA6A 3GTOA 3DMRA 1ZMEC 2KI8A 4DMRA 1FDOA 1PT1A 5FTJA 1TWGA 2Y0SA 3HU1A 1K83A 1G8JA 1KQFA 2E2IA 1PQFA 2EEOB 3IR6A 2JIPA
chains in the Genus database with same CATH superfamily
1PK7A 3DKRA 3DV2A 2PUWA 5M3BA 2CW5A 2D2XA 3U4QA 1CNEA 1JL3A 2LDXA 4AMZA 2BYTA 2GPNA 1Y9EA 4OHVA 2PUVA 2X9GA 1EEXB 1FU8A 1YAHA 4GA5A 1S9KE 1MB4A 5EXTA 1VLZA 1FE8A 3MJDA 1J0EA 1CWUA 3CF4A 3A27A 2I33A 4M0LA 1JWLA 1IO4A 4KITB 3E27A 4PLGA 4L76A 4E2WA 3IALA 2BMJA 1Z16A 1ZFNA 4D1YA 1F0NA 1V5FA 2PZKA 2H9YA 5B37A 5D87A 4PVCA 4HV4A 5J1SB 4NG5A 3EWNA 4ALIA 1KNQA 1FSPA 1XVLA 3WMWA 3LUJA 2H92A 4TMTA 2C2OA 1RCFA 5KMGA 3AE4C 1Y4AE 3R0JA 4GM4A 2I29A 4L15A 4FXPA 3A36A 3AQ4A 3O6VA 1DUVG 1T6BY 2OD9A 2FHPA 4DZRA 3WLPA 4C3ZA 4O63O 4MKXA 6NULA 5FPYA 5BV7A 3ZCUA 1BSNA 3EIFA 4L0CA 3ZHYA 5DT9A 1QVWA 3AUJB 2WJAA 3RS5A 1LWOA 1L4EA 3M9XA 5GTHH 3GYGA 3LHKA 4DDTA 2VNIA 2A4KA 1G41A 5I9MA 2ZCVA 3OZEA 1G66A 3TQTA 3A9WA 1ZLLA 4HFMA 3D7RA 2VXBA 4FM9A 1IMJA 1XI2A 4DQUA 5EP4A 5EWJB 1HDGO 3FX0A 4DLXA 2WVRA 2D7CA 1JA0A 5E3JA 3EXIB 4LSMA 2ECKA 3BEOA 1T9BA 3TNDA 1N9ZA 2G9ZA 1Q812 1UWKA 2SECE 3AU8A 2OCGA 1GFIA 2HF9A 1RPTA 1S01A 3OCWA 3ZV5A 5CFZA 1M0EA 1L5LA 1J2JA 5AKLA 2WITA 3LHDA 4KIGA 1UBRS 1JR4A 1LJLA 2JFPA 2XCOA 3ND7A 2WB4A 1FRNA 4UB8E 1XJQA 3LLMA 1WVIA 2TSYB 1YBHA 2X4DA 4M1QA 3THOA 4UTVA 4YJ3B 3R75A 1H2FA 3L7DA 4RXMA 4G8CA 4KRXA 3BXZA 1U0TA 4WV3A 5LZ4A 2W98A 2RH8A 4K87A 2XOKA 3PGJA 4WBAA 4ZAWA 5JNRA 4OQLA 1DBRA 4KVFA 2O8CB 3FNBA 1ZH0A 2VHJA 3I6IA 4YYZA 4X7RA 3HD7A 1X15A 4XLLA 1WZEA 3QVKA 4KDRA 1QV9A 5JXGA 3R7FA 3VC1A 4RCZA 4YYEA 2NPSA 4CKCB 3VFDA 4GYYA 3I0ZA 2ACKA 2RBGA 2PLWA 2I6FA 1PFVA 5AW8B 5LQJA 3ZQKA 1M6VA 3LDAA 3KDPB 3IBTA 2BI4A 4ZYUA 5JHGB 4QYTA 2FWPA 3RU7A 3WG9A 3S2EA 2ZEJA 4OLJA 4R5MA 1KVRA 4ZKUA 3I5MA 3MW8A 4U3FE 5K4HA 1JQJC 1G291 1UPAA 1XAJA 1Z73A 3GB9A 3L36A 3L8DA 1OJLA 3CD6P 4RPCA 1KMQA 2AZDA 2YWGA 2REQB 1CERA 1D4FA 4O4HF 2ZJ3A 4JVLA 1XAIA 5GZ3A 1UMBB 4MDHA 1I33A 4D5EA 3F78A 4MPTA 3E22B 5I9NA 4ER5A 1LGHB 1YBAA 3FWKA 1ZX1A 5AKJA 3FMGA 3PUXA 3QWUA 1NIJA 5G4KA 3E81A 1L4LA 3IMGA 4GP7A 4AQRD 4E31A 2BFEA 3ABOB 1BMQA 3ZN2A 4ZI5A 5LPNA 2I55A 2Z8YM 4D3SA 2QN9A 2HR3A 3ZZNA 5GTHE 2OGTA 4NRDA 4EYYQ 3WIVA 4F46A 5EKSA 3N9IA 3LM8A 3PX3A 1QU3A 1JT2A 4QJ3A 5GJVC 5APUA 4O4LA 2JH9A 4Z1MH 3IDQA 5AIAA 2XQGA 4Q1BA 3F7TA 4UHKA 2WM9B 5A4DA 5EYPA 1QZUA 8ABPA 3U56A 4JI2B 3NTNA 4HGQA 4A10A 1RBMA 3AKZA 3AL2A 1WUIS 2G4VA 3VR4H 2XMRA 1Z3IX 4W1SA 4GWGA 1J09A 4RF3A 3EPPA 1D1TA 3QKTA 4U2CA 1PYGA 3CYFA 3JAMA 1X7ZA 1A4XA 4PGGA 1R10A 2FSVA 4B47A 1RT9A 3HN6A 1IZ8A 3ESCA 3OX3A 4KVGA 1U31A 4MTCA 3L37A 2A0XA 2PD6A 3TFOA 3PNVA 1COZA 1DE0A 1NRXA 4OB6A 1LW6E 3EZNA 2WJWA 4B8WA 1U8FO 2XWPA 4FFBB 3QKSB 1IQ0A 1KPIA 3BE4A 3DAYA 2FR1A 1K63A 5A4MS 1KZ7B 4YAFA 1CE8A 3VDRA 5GJBA 3PQCA 1I1QB 2EG9A 2NU7B 1OZHA 3S2ZA 3LCJA 4B7ZA 4UTPA 2ZYVX 3SDZA 3CSSA 1I9CA 3RSSA 3TDKA 4EUNA 2VYND 5EAIA 1Q0HA 4GX5A 4L8LA 4LOJA 3KTFA 3H7IA 3UK2A 3K8OE 2WYOA 3D8SA 1ITZA 3TQRA 4Q4CA 3M4OI 3TTYA 4JQOA 3TE6A 1GN9A 1PJ4A 5FLYA 1O03A 3HOXI 2X8AA 1T4CB 1RPZA 5SY4A 5IJ9A 3TGUD 3KWFA 2IYNA 2J33A 3VU1A 1J0DA 2QMYA 3R09A 3PU6A 4QTYA 4GI3A 4X20A 4RNDB 3LYLA 3B1WA 2PGDA 4MS1A 4JS7A 3II6A 2FYUG 2OBXA 3QKWA 2AB0A 2GXQA 2IDJA 3RAPR 2MINB 4BQEA 3O1HB 1K7CA 4JLWA 3WRYC 2PQ0A 3H1FA 1P17A 5JD3A 1AKMA 4Q4JA 4XASA 1JQKA 2ZSBA 5IUKC 1P8JA 4WVLA 1E6KA 2QKYA 1E7YA 1OBFO 3QBDA 3H1LG 4HDOB 4Z1OA 5H82A 4WQMA 1N8R2 2FMTA 1MOPA 5FORA 4LQ4A 1UMCB 3F7OA 3V7WA 2WUEA 1EG2A 2JCBA 1PT1A 1E2PA 3VR5D 3JRNA 1GRQA 1WU8A 4UZFA 2HIGA 1LGYA 4NQZA 4UQLA 4O4JF 1BE1A 1D2HA 2V5UA 3WLQA 5KMGB 3B9BA 3FW1A 4P2GA 3V9PA 4I9NA 2ZE8A 4WY4D 3GDWA 4MP8A 3KKEA 3E9MA 1YJW1 2H4FA 5HGJA 2B6HA 4UUOA 1V71A 4E51A 4AQYB 5G0SA 3BJMA 4IS3A 3RL0D 1PNVA 3CVJA 3JWEA 4OHKA 3MJFA 2Y27A 1B26A 4OGKA 1NOHA 2XVZA 4QTTB 1TM3E 2FCRA 5KTNA 3NO4A 1OZFA 1C9JA 1S6YA 3VKHA 3G6EZ 2XDJA 3BRCA 5AM3A 2JAUA 2YWXA 1H05A 4ZTUB 3KT6A 2V6MA 4HLUC 2WIBA 4ZOCA 4A5OA 2MU1A 2IC5A 3TIVA 2BRUA 2D54A 4Q6BA 5DN6A 5JVDB 2DUUA 1WZNA 3VU9B 1L7RA 1NJI1 1NBEA 4IIDA 5AI9A 3LGXA 5DPMA 4H0NA 2GI4A 3K0KA 4UUNA 5A0FA 1T1IA 3FZEA 1OE0A 4L6CA 2YV1A 4IDAA 5F35A 4A3LI 4D4IA 1SOWA 3PNYA 4YPFA 3DOFA 2C8JA 4BLTA 4DDKA 1VQ6Z 4DXHA 1Z26A 5H3CA 3RROA 3WIDA 4AS2A 3WLLA 3I56Z 1Q81Q 5LNK6 2DBVO 5B5EH 5J43A 2QA5A 4RENA 3G7SA 2PUEA 1KE1A 3HU5A 2W90A 2ZITA 3IVCA 3NBXX 5J5CA 4EG6A 3PKZA 4AB1A 1D6NA 3P4YA 2P2UA 5K0CA 5C44I 1QIGA 2YFQA 4E30A 3W1WA 4BL5A 1QE5A 3PJRA 4BRUA 2YRWA 3HD7B 4IEIA 4PSCA 1R5NA 2NX2A 3NIDB 2DPHA 1SN7A 1VBNA 3CA8A 2BI8A 4XA4A 3VYWA 1NLYA 4OP3A 3VX3A 1DT3A 4M0UA 3T7IA 3CURA 2YMYA 4WXEA 1M6VB 1TD9A 2N9BA 2EJBA 4EHDA 1V8OA 3HY3A 3DMDA 1YIJP 2E82A 1VSQA 1Q0LA 1R0WA 3WL5A 4QOJA 1URQA 2PJDA 2GN1A 2YJNA 2CL7X 2IBTA 1M74A 1YHQZ 5CVTA 5F1YA 5FP0A 3EGEA 2GILA 2V7GA 2H0AA 4G5SA 4DSAA 3FCEA 5I47A 3I58A 2ZZKA 4BO7A 3QXJA 3DF7A 2JEOA 4YO7A 4EJSA 3GRZA 2OKGA 3HR4A 1RZVA 5CB0A 3DVSX 1Q0PA 2PQMA 4X1KA 1KQFB 2JGMA 3VNAA 5ADHA 1KHTA 3IUJA 2H7VA 4ETNA 3GLTA 4LE1A 3VO1A 3J7A4 4DV2B 4FKMA 2N75A 5G4KB 4FC6A 4IINA 2VPWA 3P5SA 4PN7A 2QAIA 4DNQA 4K6HA 3F46A 1KQNA 1FTNA 4XGNA 1TYDE 3CGGA 3GDHA 4RKWA 3ML1A 3F5FA 1SFCD 2I6XA 3R41A 2XCTB 1E5TA 5FTJA 2ZGVA 3SS8A 4MHOA 2J85A 4O4LB 5E4YA 1H0TB 5CFNA 2PFGA 3BMOA 2ZYAA 4IRUB 4DIOA 3GMAA 2ZTSA 3TSCA 4P6VF 2AEJA 3VU0A 2AXCA 4J0KA 3MT9A 1HNZB 3OA0A 4DR7B 1GTSA 4P3PA 2PAFA 2VP2A 2OLJA 1FXUA 2ZBEA 2IYTA 3FKIA 4CEIB 3FOZA 2BEJA 1QSGA 1TKBA 1OAOA 2POHA 2XA9A 2HY7A 2A9RA 5CIQA 1LVUA 1NULA 1LTJB 5K01A 1YZFA 4JJ6A 1RXYA 2YHIA 1YUAA 1S3FA 3OKFA 1M1YB 4L08A 5B5EE 1B2LA 3F6YA 4R81A 2FXOA 4D4GA 2R93A 4P7JA 4OI2A 5F3RA 4LJSA 1CB7A 5AKZA 1V7PC 3GBVA 1VMIA 1XXHA 1J8DA 1TZMA 2FGJA 4QELA 1NRWA 4U9HS 5HTOA 4D8WA 1U2DC 4JC8A 3GGPA 3OQNA 3OQPA 4P80A 4AULA 1VHDA 3PVCA 2X9LA 3LOQA 4BGDA 1ZGCA 1B8NA 5FO1A 1NRIA 2RJNA 3ZS9A 3ESDA 4TRRA 1NBME 3NM6B 4BKRA 1Z36A 2PWYA 2TRSB 5DP1A 2P3YA 4RIHA 4BWNA 1S1CA 1NVEA 3D6UA 4YCBA 4FS8A 1U57A 5G3YA 4S1TA 1XL0A 5T57A 5D5PA 4LMRA 4RPHA 3PSHA 3WA7A 4BVEA 3TAXA 2HF8A 2OTJZ 1SZCA 3GTPI 5IW8A 4A1OA 3V4WA 5IJ9B 1IQPA 1EP9A 2GN6A 1VECA 2W22A 2O5EA 2YMLA 3GFTA 2UZAA 4HQKA 3A9UA 2ZXFA 2BD0A 4MNTA 1THZA 2WOJA 1E9AA 1Q0TA 5FB3A 4P7GA 3CLTC 1KAQA 1A95A 1QVGY 4HNGA 2VZEA 1D09A 4RVNA 2WWYA 2YIJA 1IG3A 4HH0A 5KTRA 3CISA 3X1YA 3RSLA 3A1EA 2CZCA 4UM9D 4DIEA 5DNYB 3RTDA 4GBMA 4MDYA 4DNPA 3U3KA 4A2CA 3I8OA 4IDPA 2GDZA 2E2HI 2YN4A 4WE3A 4RAQA 2BM8A 3PGLA 5ICGA 3OQ6A 4DZTA 4FFVA 4YAIA 5J4HA 3ZVMA 3A1SA 4DREA 1MH9A 1YGPA 3TG2A 2QQEA 4JSRA 3C1OA 2C4UA 3RTAA 3TEJA 5LQNA 4GX1A 3RRMA 2J6BA 4I4TA 1GL3A 1U2TA 3FWYA 2VUHB 3T4NB 1ZB9A 1AA6A 1CHNA 2WHRA 2OENG 3H1LD 4N01A 1VQOZ 5JI2E 3FZQA 5A2QA 3AI2A 5KSYA 3PICA 1K5PA 5FOVA 4QQKA 2JJLA 5A9RA 3B5JA 5IKXA 1E89A 4YAOA 3VBEA 4JI3B 4HRAA 2DFKB 1T3SA 5KWJA 1JE1A 1CXZA 2CSUA 1LBIA 4CRYG 1FS5A 1DWUA 5GONB 4L7QA 4BDTA 3CNNA 4QBIA 1EP3B 2HIHA 1R0CA 3FYTA 5IKMA 2IFMA 5FRDA 3UUFA 2IZOA 4TKLA 2OG1A 1NAHA 3EGCA 2IZ1A 1CULC 3CSUA 3Q2YA 1PQPA 4DC1A 3P0RA 2M32A 1UM9A 1QUFA 1PQWA 2FN8A 2ZVJA 3JPWA 2V6JA 4MHTA 1QWSA 4MI1A 3F6PA 4UUPA 1KI9A 1LI5A 3H17A 2DPGA 1ZSYA 2ID7A 3D6TB 2DE6A 1PV2A 3F7MA 5DXJA 1P0CA 3OQMA 1VQPP 1YQ9A 4XFKA 1SU7A 4DSZA 1RRFA 3OTGA 3VJKA 2WLTA 4I19A 2KW5A 2PNWA 3TVYA 2Q2OA 1B6TA 1G21A 3W2HA 2PEZA 3L46A 4FDMA 1RYHA 1TTPB 1SFOI 3R9IA 1PR1A 1XRQA 2FRVA 2ONJA 4B3CA 2ZE6A 3BFKA 3A10A 4JFAA 1TJ3A 3FFBA 4E7OA 4HZUA 5BUCA 2UZ4A 5DGXA 4RELA 1O4WA 2FFQA 5JQGB 1WA5A 2P0AA 3G23A 2RGGA 3F96A 4C87A 4EFKA 4H13B 1CJCA 3HGMA 2VA9A 3H8SA 4ZO4A 3OM9A 4LGMA 3VZRA 5HOEA 3M0DA 4LMAA 3W9UA 3Q8KA 4ASUA 5M29A 4GKKB 2GPSA 1GU7A 3ZE8A 5BMVB 1XF1A 3VB9A 2M2IA 1YJ9Z 2X8LA 1D04A 4IFTA 4LY6A 1URQB 3GJZA 2VJQA 3BSSA 1LNQA 3FZYA 1NW8A 4NX2A 3WO0A 1GQYA 2AK3A 1BJRE 1PK9A 2H1IA 5AI8A 1C4OA 1GTVA 1ZWKA 3BSFA 2J9RA 3YASA 1NHLA 4ZK2A 4GKAA 2VWHA 4IQGA 1NQ5A 2ZJ0A 2Z6QA 3VHXA 1K73Q 2JHFA 4IDDA 1B43A 5ALSA 4EJSB 3OZXA 3GJ6A 1ZD9A 4O1MA 2ZYTX 2A4MA 2ZJAA 3ZE0B 3PFWO 4X1KB 2V7UA 3ADKA 1NGSA 4O33A 2YWCA 3EQ6A 2VN8A 2UVPA 4CPDA 1GT6A 2H4ZA 4QEKA 5BWBA 2EW1A 2VJBA 4ZKDA 4JOSA 3HJHA 2GOYA 3AF2A 1SLQA 2XKBA 5AUOB 4WDRA 1Q3HA 3NBAA 1DEXA 5DI3A 1H8EA 2OK7A 3L0PA 3HADA 3AP1A 2NVOA 3IIMA 3BXHA 1BXRB 2WSFJ 4WZAA 3KRTA 4C88A 2G5DA 3GFSA 3I5AA 3BMOB 3C45A 3ABIA 1QNLA 5EHXA 4JLSA 1Y6RA 4XFJA 1X8YA 2MSKA 1XKLA 2D13A 4NR0A 3JQQA 3KLMX 2Y1DA 1L7XA 6REQA 1XQ6A 4EAQA 1N8NA 4QVIA 2FWRA 3S2DI 1USPA 1Q21A 2PVCA 3TLAA 3GP8A 4DSOA 4MUMA 1X6VA 2QR5A 3TIWA 4NJMB 3H1JE 3SQLA 5CNMA 2FJPA 2IZ5A 3KEQA 4JYPA 2FK8A 5E7MA 1QH1B 5JE8A 1XG5A 3MYRA 2CCJA 2OQVA 2I66A 3HY6A 2ZM5A 3E82A 2WPSA 3WNCA 3QVSA 4F1KA 1EK1A 5FYDA 1ESMA 3DE6X 3JXEA 1LT9A 2Z08A 1VQ5P 1UQTA 4M7OA 1RFGE 4R2XA 1DG1G 1DCFA 3H86A 3HE5B 1BDJA 3ESRA 1SCJA 3TCXB 5ERYA 5FBHA 1I01A 3OZAA 3IP3A 4BRZA 1USVA 1JFFA 4XEHA 2WR8A 5IVPA 2QP3A 3D7LA 3HA5A 1GAQA 4IL6H 4RVGA 3NOVA 4ZYVA 4B80A 4QDKA 4QPCA 2LXCB 1KVSA 2BDEA 1B6SA 4D4JA 1NJGA 1GUBA 2FKNA 4E32A 1AKRA 4UU0A 3L4BA 2XAAA 4UREA 4N48A 3BZBA 5CVUA 4MAFA 2VSXA 3DMNA 4YP9A 3R9XB 1SOAA 3TUZC 1FQJA 2DCMA 1FP4A 2BEUB 1TYZA 1EI9A 2CYCA 2QYOA 2WFMA 3L01A 4LECA 2XNHA 3X43A 4WOBA 4Q05A 3JAWB 4YLGA 3OG9A 2I2BA 2OYIB 4YLEA 2BGGA 2WSCH 1QK3A 3H1PA 4BB6A 4I3FA 2VK2A 2YCLA 2ZS8A 1LQTA 5I7AA 3IV7A 1JFRA 1XMXA 1RWOA 4A8JA 2Q21A 3GGSA 5MF6A 3OEWA 4A0QA 1V96A 1Q5PA 3O21A 3BC1A 1JEDA 1YB7A 2FMHA 4IHJF 2ASEA 1E6UA 1CEXA 5IN5A 1M8KA 3RU3A 4B7AA 2PX6A 1G38A 4ZAYA 2J3JA 3VGPA 2IPMA 4I4TB 1K97A 3EIOA 4ZU3A 5JLAA 1G6Q1 4IM7A 3FYDA 3AE6C 3VO8A 2LNDA 2N9YB 1L4KA 1XC7A 2LW7A 3OZRA 3MHTA 5LQCA 3HO6A 4X1YA 2O8NA 3X2MA 5KJ7D 4F93B 3EUFA 1H89A 4Z53A 4EYQA 1MHPA 1W4RA 3K94A 2AH5A 3MTQA 4TMXA 5AK0A 3K30A 1JNMA 2FPPA 4I1YA 2QB5A 2ZYSA 4OI0A 1XKQA 5JH7B 2R5BA 4DCTA 2HNBA 2CJWA 4PEVA 2WD7B 4EOGA 1LDNA 1NUUA 1X1EA 2CCKA 1YONA 5KSPA 4WECA 3D4IA 1SVNA 5C0OE 2WQ7A 2NXNA 2AX3A 2PRIA 2A3RA 2F9FA 1T5IA 2D2FA 3QX3A 1FL9A 3BE8A 4J0FA 3CC4P 5TS2A 5CLQA 1PR2A 2X5KO 4CM7A 3HDHA 1AIPA 2ABWA 1ZQ1A 4WZ6A 4C46A 1G7TA 1L3CA 2C5FA 3C6KA 1VMAA 3IV9A 3TLKA 4N0DA 4ZN6A 2PO7A 2GB4A 1P5ZB 2EFGA 1AN0A 3ZR4B 3UB4A 3LO8A 1KC81 4GRIA 4IL6E 4WXRA 2CNKA 2F4VB 1YS4A 3DMYA 4ZI2A 4YUXA 4NECA 3HU1A 2AOUA 4E70A 2IVZA 4D6PA 4HZUB 4NU6A 3OH8A 3BMXA 2IHTA 5H16A 2PL5A 3MBKA 2J3EA 3TXAA 4F4DA 2LVBA 4HWRA 2X40A 4FDAA 4BPRA 5IT9A 4BRSA 3IFSA 1GU5A 8AT1A 4BEBA 4CF3A 4W1RA 3U5ZB 3PJGA 5GGYA 1KVUA 3FXDA 2CDRA 2BZ0A 4O4IB 2YHSA 1WABA 4BMYA 2HZ7A 1RACA 1IN1A 2DT5A 3SJCA 1C1DA 2NVXI 5EIAA 4OQ4A 2O8EB 3HOZI 3GLGE 1DIPA 4F8YA 1CUDA 1ZK1A 1R8QA 2X6TA 1VIAA 2EAUA 1G18A 2YRXA 4ASVA 4INZA 1G2QA 4DADA 2VTBA 2YW9A 4MITA 3VHXB 1M6EX 2BC9A 4I2LC 1NTKG 5LL6f 2ECQA 3UWKA 1KI8A 4CF4A 4HFNA 3KHUA 2WQYC 3JYPA 4YMWA 5LZ9A 2CPSA 2EJCA 3BK2A 1MABB 4PRLA 4UCWA 3S68A 4CQMD 1LLCA 4Y6SA 2UVPB 2BOVA 4PAOA 3FOWA 3FHLA 1O89A 1O9HA 2W6MA 3GKQA 1PPJG 4H7EA 2NLOA 4TWRA 3GHHA 1T8UA 4FI3C 3RVJA 1QOPB 4BWYA 4B3SB 4BAUA 3ISTA 3DT8A 3D5QA 2VDVE 1MU0A 5HKKD 4LOKA 4BIMA 2EGHA 1UPUA 2C98A 1I0ZA 4LJKA 4DF3A 4MX8A 4M54A 4OX9Y 5CG1A 5DIFA 1F5SA 3B60A 2HLPA 5ELLA 2P2LA 3UHFA 4U7JA 1ZIOA 1JTHA 2XCUA 3C43A 3HXQA 2V4UA 1DCMA 2PX5A 4Y2JA 2JZCA 1N6PA 4ZOLF 3P9QA 1XALA 5IASA 1H8HD 3G5LA 4GUAA 2OXRA 3QZUA 2H06A 2DECA 3LS2A 3HBFA 3GUVA 3RVMA 4MRIA 2OM2A 1TA9A 2YIVX 3VMGA 3F5HA 1OQAA 1Z7WA 3GYBA 1I4OA 2BFDA 1EWKA 1LD3A 3VKWA 3MJTA 4X3PA 4PFSA 2EP5A 2FX2A 1KEPA 5BQFA 4M21A 3O8LA 3SQWA 3QF4A 4GHWA 4B3HA 4D44A 2LR0A 1JIIA 1S721 1EZ4A 4FHEA 1J2RA 4PWZA 5JYEA 4HEA1 3ZY6A 1YS1X 3C7CB 3JR7A 4I4LA 3E7DA 2ISCA 2PQ2A 5THQA 1W6UA 3BK1A 3SWFA 3UUWA 4DLLA 2C3YA 3NHRA 1LT9B 4CEHB 5JBQA 1M0WA 1SQBD 2OTCA 3R6GA 2NV6A 1XVVA 3RUDA 5LU8A 1IRIA 5EVJA 2X3FA 3E9DA 2NP6A 5FXMA 1Y37A 5CUQA 3RVDA 4AVRA 5L3SB 1DXHA 1XZKA 3P4UA 2VHCA 1P4GA 3MQ2A 2ITAA 5APYA 4QIWA 5ALFA 5CEFA 1JFFB 3Q87B 1EUDB 5HZGA 4KXYA 2IFTA 1ZOLA 2YU9A 1BE3J 4YJDA 2KOGA 4UNSA 2JIMA 1B42A 1NKZB 3ERCA 5KEIA 4K8RB 3TVDA 1C41A 2JEZA 4CETA 3QXGA 2ZQZA 2QJFA 2OTKE 5EPOA 1EVZA 3I45A 1FP4B 4ERXA 3M6MD 5KTOA 1X9VA 2V3VA 4BMVA 4RE6A 5A7GA 2EZ4A 1KQSO 2XITA 2J3LA 2ZT9C 5EZ5A 2ZJOA 2HCRA 1KYZA 3N7TA 3MC1A 3GRPA 3EBPA 1KRLA 4A8JB 1NVVQ 5CJPA 4U5QA 4HB1A 3JQRA 1WLYA 2FMKA 2XT0A 5BV8A 4FOLA 3GN2A 2WB1A 4K6MA 3F8TA 5GLYA 5G53C 1CQZA 5A71A 3RFUA 3EUWA 1W5SA 1TA4A 4GMHA 5MN5A 3QBVA 3FDFA 2IOYA 3A9VA 3COVA 5CG2A 1OR8A 2H31A 5K0EA 4FEEA 4K2HA 2KBEA 4R3NA 5FV4A 3ZU3A 3LY8A 2PLAA 2XYGA 1LLFA 1E79D 4KXMA 1P0QA 2O8FB 2G17A 3VNUA 3LDHA 3LUHA 2YNMA 4BLSA 3ICCA 1E2BA 2R2GA 4JNKA 3E3MA 1VHLA 1F8FA 1SUPA 1XQVA 2FPPB 1ZMOA 5FL7A 1DHTA 3D7NA 4KG7A 5I9TA 2WMMA 2NO7A 3B1VA 4CM5A 1JEOA 1RJWA 2VQFB 5HZKA 4ER3A 4N5NA 3B71A 2OOKA 3SMQA 2CJWB 2FZWA 4I5FA 4YRJA 4G9GA 2YYYA 5DLEA 4NK5A 1CK4A 2FKWB 2JWAA 1H5NA 1GARA 3AF5A 1A8HA 2AL7A 3H2KA 4NPEA 1RABA 3CCV1 1VG8A 3ANSA 4O2AB 1O77A 2V6GA 2DPXA 1BWRA 1W0JA 2Z5GA 4G5OA 2J9ZB 1LRKA 2P9BA 3SU8A 4NZ9A 1IZNB 2RHDA 1J24A 2QRGA 3AE7C 5E9JA 3O03A 2VATA 1B16A 2FVXA 4DOMA 3ZWOA 3I8XA 3VTAA 1KYOI 4F6RB 1MJGA 3H05A 1Z62A 2CXXA 2JIOA 1VFNA 1ZU5A 5SZIA 3C8MA 5CLHA 2G04A 1YBMA 4CIXA 4FOPA 5EVCA 4B7UA 1GCAA 3EXIA 2OZKA 3QH9A 1SC3A 4WLNA 5ED0A 4BNFA 2NVYA 1WW9A 1O6ZA 4E2YA 3ASZA 3U4IA 2REXB 1TUIA 3OZIA 1JS1X 3E48A 4I8DA 4YMUA 2O7QA 3RHSA 4LFCB 1O97D 1Z07A 3MGAA 3WV4A 4XQCA 1R5SA 1KDVA 1E18A 3R4CA 1ZI9A 1IN4A 4PU0A 1L4BA 2FN3A 4FR5A 1QLJA 4Y6OA 4TV8F 1K83I 1OH5A 3D3JA 4Z9FA 5PNTA 3DO8A 2WIAA 3O95A 4OAOA 1XU7A 4NEHB 1JKJB 2AFRA 5JNTA 4IF4A 1FYDA 2O8CA 3SHFA 3GTMA 2JCGA 3SJAA 2WBLC 3J80b 1ZR4A 3G49A 3OJAB 1XK7A 2CMGA 3WOVA 3L2OB 2CZGA 2YO2A 3K8QA 4CKCA 1NVVR 1ZINA 3T1OA 1J5EB 2FFHA 3G82C 4M9XA 5AW8A 2NMVA 2DF8A 3KDPA 3GPLA 4RJIA 2FETA 3U7JA 2VHUA 2R6MA 5IKPA 2YV3A 4KBFA 1DQSA 1KOFA 1I1NA 4EX7A 2H63A 2B21A 1ZV8A 5JATA 1EZVD 1ZWLA 3GL9A 2EP7A 3V33A 3ZBUA 1ULSA 3QV1A 1NVDA 4I3GA 1UMBA 2A86A 3A4YA 5GM9A 3V7FA 5FWYA 1T5TA 5JMPA 3WK8A 2OUIA 4L02A 3AVQA 3RC8A 2J0QA 3E22A 3ILYA 5EP2A 3UV6A 2JJ2A 3KJNA 1JDPA 4GMXA 1O5IA 1U9ZA 4JR1A 1KMMA 1MV5A 1YUNA 4I55A 5BSRA 2Z6VA 4N0MA 2VF8A 4B6JA 4CLRB 3CPJB 2IXEA 1M1K1 3E2PA 2QPLA 4KAFA 5AW9B 4D56A 2L2QA 4V0OA 2QVLA 1WDLA 5CCXA 1W48A 3VC7A 3OOSA 2VDNB 1T43A 1KR5A 2FYNB 1S8NA 3WXMA 2BFDB 3SR4A 1A02F 2RK4A 2OY0A 4KAAA 2XA2A 2C0WA 4YJ2B 1S8FA 3SOZA 4HRVA 5ALJA 3W5DA 4KRYA 2WDPA 5AI4A 3QF4B 4EQZA 2WP8J 3X2FA 4C2BA 3GG9A 4EZBA 3ROEA 2R68A 3KQLA 3FB1A 3I4LA 5IAAA 2Q8PA 4Z0PA 4YQZA 1AB6A 3V7NA 3SZGA 1LVGA 2HHCA 4R4MA 2IIQA 3ILSA 4NY1A 1RM5A 1Z6YA 2B5WA 4X45A 4F4UA 2DC1A 1N6HA 2HG5D 1F4LA 1T5DX 5J23A 4Q9LA 4RZ3A 4X9XA 1P9NA 2H2DA 4EQ6B 4ME6A 2D1SA 1G3MA 3P9IA 4BBAA 5A4FS 1YOBA 1P29A 1WXGA 1XNHA 5J47A 3H6PA 3DKVA 3KV1A 4I81A 4PYKA 4OLAA 2JKZA 4JBZA 1YZQA 4FFBA 3KQNA 3UOWA 5G1NA 3RVBA 3QKSA 3NUZA 3DB2A 1TWFI 3KYBA 1HI9A 5BVZA 2G8YA 4ZOBA 1YI1A 3ST7A 2ZW9A 2P7IA 3E8SA 1H65A 3IURA 1XPUA 4UEWA 3DSRA 2QA4P 2NU7A 3TGPA 4BNIA 5CIYA 1TAHA 4PCLA 3REOA 3TGUG 2BFMA 3T0GA 2IBZD 2GT1A 3E9NA 1L5GB 4JSYA 3HLKA 5K1ZA 1R5BA 3IR5A 5ALOA 2YINC 1ZC4A 2IZZA 4B74A 3B1ZA 4PN3A 4WNYA 5DGTA 3U7EB 2UYGA 1PQ4A 1T4CA 2XDYA 1OFHA 1JG3A 4HSEA 5ITWA 5BXYA 3G3ZA 1JR3D 1MPTA 4J4BA 1B23P 4ZOEA 1NVFA 2JR8A 3J81A 4ZTBA 3KZNA 4A16A 5ALZA 1SKAA 1GZ3A 2KI8A 1W47A 2GERA 2MINA 4ZYXA 2VT2A 4J43A 1ZIYA 5JEDA 2C2MA 1U1CA 2D0OB 2O8DA 5H0IA 1K6JA 1U65A 1QHHB 1PX2A 3GEGA 1LUAA 4JYBA 1IUPA 4AWXA 2XQIA 3ZDMA 2ZUVA 3O4JA 5LCXA 2NQ2C 4M3LA 2XJ4A 5CNIA 3EXEB 2D2VA 1UMCA 4YMIA 3GEIA 3NM4A 1VE3A 2RAPA 3UOAB 3E2MA 2OMKA 3A9TA 3BCCD 2CXOA 4Q3DA 2VJOA 4LXQA 2POQX 2H1LA 3MTBA 4QGAA 2O57A 4A3KI 5LYJA 4CM4B 3OT5A 2IHUA 1ARZA 2HCBA 1D2AA 4YEDA 5INTA 3IEVA 4QZVA 3RT1A 4ZHSA 1V8PA 3O82A 5K6TA 3G8AA 3AEFC 2ZRCA 2J7KA 3AEUB 2WNSA 4QTTA 4MGKR 1HTLC 1EXIA 3WLEA 3VMXA 1KN7A 2I3CA 3BRTB 1AUQA 1FX1A 2ATCA 4DJ5X 1DSSG 5J2UF 4ZAXA 1Y3DE 4IIEA 2VQ3A 3ZWMA 4CMGA 2YZMA 1IPEA 3K73O 1KI4A 5KOIA 5JVDA 2NVBA 1S4QA 3FG9A 5EKDA 1HDRA 3HBLA 3VU9A 2A92A 1B1AA 5B55A 1QYDA 3CX3A 1NHGA 3BE5A 5F9FA 5IBRA 1HTBA 5C32A 4AMYA 1YI0A 3FGPA 4XLTA 2XV5A 2RH9B 2PN1A 1KKUA 2X1MA 5JYBA 2IH5A 4QRIA 4BS9A 1OLOA 1E0KA 3EC1A 2AN1A 5HF8A 3LA6A 2OOXB 3HE3A 4N0QA 4ZVKA 2E5WA 2Z2KA 1Y3CE 3KS9A 3LQYA 1E1CB 1XV5A 4II7A 3CJQA 5DCWA 3FNHA 2BAGA 3CUVA 1N6KA 2BBWA 2WDZA 3ICWA 2CHVA 5AVJA 4PPFA 1X0VA 3QRWA 3WMXA 4KYUA 3DOHA 2CV1A 4U39A 1T0IA 4C7NA 5FUBA 4FEAA 4N5LA 4QJBA 3BX1A 2K5RA 3CWBE 3DT9A 3UAWA 4OP1A 2W6JH 3OX1A 3BL8A 1SZDA 1E92A 5EKTA 5JRDS 4D6TJ 3QF7A 1PV1A 1EFHA 3AJ9A 4JUBA 3R0IA 1L0LD 4BEVA 2D3TA 3GP3A 4ZVOA 5B1YA 1NJSA 3CB4A 5KVCA 1S96A 5LOVB 5C8ZA 2EJWA 1RRMA 1X2BA 2FCAA 1E64A 3PHHA 1Q3KA 1YZUA 4P2BA 3MXOA 1J8VA 4OK5A 1EAMA 4OMDA 5FWYB 4BJHB 1DVRA 2ZTMA 1TI7A 3LY7A 3VSCA 4EB8A 3L74J 4Y2VA 2V59A 4M9CA 4FYWA 1KQFA 5AVZB 3MWFA 3IE1A 5DX1A 1TVEA 1T0PA 2KMLA 3PVZA 4I55B 3OIGA 3L41A 2JKVA 2FOLA 1PNRA 4WJZA 4BV8A 3V8NA 2V8KA 1JMKC 3ER6A 1KRWA 4A8PA 2XCSB 3V2GA 5AW1B 4MV6A 3VOBA 2YZGA 1BGVA 1DFHA 2K6GA 4W1PA 4GO1A 4AMBA 1JB1A 2P9ZA 1FQKA 3ANTA 3NBZC 3IMCA 4TOIA 1PE0A 1H0TA 2QD3A 1H0SA 1GLNA 5F77A 5B7GA 4UVIA 1GZ7A 3T7RA 2PBLA 1G2CB 421PA 4JK3A 1VJTA 5LXTB 1Y6GA 4OOEA 1U7XA 2QUHA 4CEIA 2E74C 1MKYA 5JS7A 4GA6A 5DLPA 5CA1B 4QYSA 1ABEA 1LTJA 4KQ1A 3BJEA 1OI3A 2I5PO 5EP3A 5HKLA 1JY2P 3ZQUA 1W2GA 3ET4A 2QXTA 1M1YA 2XSZA 3HFSA 4OMUA 3ORFA 1E99A 2WU1A 1G59A 3KQHA 2X1HA 3E1GA 4RV0A 4Z4CA 3RM3A 3IT2A 1Q20A 3FTQA 2VEOA 3RK2D 1Z63A 1NOJA 4I50A 4NXNB 3IP7A 3ESYA 5THXA 3C4VA 1D3AA 4TWIA 4FMDB 4DMKA 5JECA 1K1EA 4KN5A 4G0OA 3ONEA 4XUEA 2CL0X 4NXMB 2WMOB 4B73A 3SLGA 3QWBA 3TB6A 4IQ0A 1JOCA 4EY6A 4R9NA 1SFRA 3E9CA 4PW0A 4D79A 5A1TA 1FNCA 3BMCA 2CE2X 1PJLA 2HBYA 3CCQP 4FFMA 1X94A 2OHHA 3O1LA 1VB5A 2IH2A 3ZDZB 2LGJA 4CMCA 1UFRA 2FKAA 3AE5C 2Q7DA 3CIFA 1W2BO 4TL7A 4BFVA 3BAZA 3EZGA 4IO0A 2FEXA 4N8DA 3Q11A 2RJ3A 3AE9C 1N6RA 5ITZA 1OA7A 1XEFA 4MTLA 1DRUA 3CTMA 2O8DB 3BDVA 3OU6A 1A5SB 3QUAA 4UE2A 1YO6A 1P3Y1 1QCZA 1FW6A 4C7MA 2BMWA 1BO6A 2ZCUA 3KOWA 2QTAA 5KJEA 3Q88A 4X1IB 4E03A 1RPNA 2VRWA 5LKRA 3QYJA 3JD2A 3T95A 1TMOA 4LJAA 2E5FA 2CLOB 3R3SA 1E2UA 2RC6A 1LFAA 3MIWA 5TPZD 4DZOA 3N7UA 3R7WB 3IXLA 3ZJVA 4ROTA 4N41A 1SU8A 3TEFA 1XAGA 1DARA 1JHZA 2PIAA 4MWGA 1SVWA 5IJWA 4PYRA 5LYJB 3AW9A 1XTGB 3K5BA 1B0AA 2LEXA 4K9PA 4MB6A 2PRZA 5EGNA 1FA9A 1WNTA 5IDQA 4URYR 3SSAA 4NEGA 3ZJ5A 2E5YA 1PT0A 4QDJA 2CJFA 1IE3A 2P0YA 3OCUA 4UB6H 4QSMA 2JANA 4HXGA 3EVDA 3T4UA 1MCZA 2YC2C 2GF0A 3PEEA 3D5EA 4URZR 2ZPAA 5JHHB 1ZD4A 3CX4A 1Y9ZA 3TBFA 2C8LA 1HKUA 5GONA 4FGUA 1Y34E 3S3TA 5EUCA 5TQ2A 1VJ1A 4Y2UA 3IJPA 3ZS8A 1TUEA 3WYBA 2DP4E 3N70A 4RMIA 4H7KA 1Z5WA 4HH4A 1Z0AA 3A37A 2WD9A 1GSIA 5FUMA 4XGIA 4HNSA 3MQ4A 4LDJA 4W7IA 3H9JA 4C0XA 3S2SA 3GCXA 2FMUA 2P69A 3QVUA 2WUDA 2IHJA 3LQ4A 4P3KA 2RMKA 2RG1A 2ADOA 2Z4EA 5J2TF 4BVKA 3L70J 2CLKB 1KOLA 2NTJA 4JV5B 2ZJBA 1ZISA 1SUIA 2QG9A 2FQWA 4MVJA 2XUOA 2QZ9A 3O3OB 1KEZA 4H31A 3OFJA 3VTZA 1T3GA 4M7PA 3SZRA 2J1LA 3HVUA 2XJ9A 1LQ2A 4F60A 4OLBA 3N8KA 1KS2A 3EYWA 1RJFA 1E4YA 1E63A 3R0QA 3HUDA 3TZKA 5JQGA 2W2MA 3I551 1F14A 4OU5A 3HBAA 1KILC 5T8KA 4C7NB 4GE3A 1S3GA 3IGFA 2Q3EA 5KJ6A 1U7DA 1HOTA 3VMZA 2E75C 1S1CX 1SA0A 4O2BA 2XBMA 2AR7A 1NJ5A 3IUMA 4P08A 3VNVA 3MLEA 5AKEA 5BMVA 4Y3UA 5HRUA 2Q49A 3U09A 3GCWA 5U4QA 2ORIA 1C7FA 4DRZA 4HF7A 1RWKA 2X86A 1YCDA 5CMLA 3MUDA 1QLED 3GCGA 4JT2A 1NURA 1FYVA 3H6HA 3H9QA 5FF9A 4ACAA 2OQ2A 3QJYA 4BMPB 1UT5A 3WK6A 2DTXA 1YI2P 2AX4A 5KNBD 5A3JA 3I2IA 4V3BA 1S4XA 5HHTA 1U7WA 3AESB 3H1HE 3LVFO 3OKPA 5DEIA 3IRVA 3ZX4A 1H2HA 3HS3A 2PUCA 5JRJA 1M2JA 5IVIA 2NZJA 1PK8A 2W37A 1YIOA 4PG8A 4UB6E 1WO8A 1NAYA 1R18A 3ZOKA 4WN3A 4M0FA 3PEFA 5IAGA 1LV8A 3T7CA 2ALJA 3PQEA 3JWGA 3R7NA 1Z2AA 4YRIA 1LI7A 1KI2A 5F2EA 1MAHA 3FXAA 4ZALA 3KDAA 1BXRA 3DR3A 2OLEA 4J94A 1JFTA 3CRW1 1GQOA 1P4SA 4Q24A 1BQ4A 5JXJA 1CC1S 1VF5B 2EATA 1NE2A 4MYRA 2N1TD 4XDHA 1KZHA 2W2LA 4Q3OA 4S1PA 3KVNA 1Q811 1H4QA 1T29A 2KS6A 4NJMA 4JXJA 3DO6A 4J90A 3RRNA 4QBHA 1Y9BA 3VO9A 1UQRA 1BX3A 5KLIB 4JLVA 1ZPDA 1OT3A 4J1TC 1RHQA 4OJKA 3IL2A 3SGLA 1HE1C 2FV8A 1QH1A 4DJAA 5JZMA 1OASA 3VMYA 4QICA 1V3QE 4X7MA 1OFVA 4ZANA 3HYCA 1UC4B 4BY1I 2JJMA 2DJIA 2R751 3OKAA 3L71E 2JAPA 3F71A 5EFOA 2Z8ZA 1G0NA 2VNKA 1GITA 1EGQA 1PBNA 1QO0D 1PVVA 3RAJA 1W2EA 5BMOA 4KR2A 2WIKA 3KZKA 2PXCA 4I50B 5CURA 4PLWA 2HC9A 5TF4A 1M67A 2J48A 4DB2A 4RQAA 3K0CA 3PFGA 4MEBA 3HE5A 4HO1X 4ABYA 4V38A 4KT0J 1JDZA 2J6HA 5CAEB 3NJ8A 1RAAA 1H9CA 5IAJA 1TYAE 5GVRA 4E1BA 3RFFA 4B75A 4AQ7A 2EEZA 3THWB 2GM9A 1ZHOA 3BMCB 4Y7DA 3OOJA 3OT4A 8ADHA 1PKEA 3QXSA 3G71P 3PFNA 5C1OA 4CV3A 4INAA 1MQ9A 1QB7A 3DZGA 3R9XA 1PI3A 2RBEA 3CCU1 4ZD6A 3LPDA 1W34A 2ADMA 2BEUA 1MX1A 4XJTA 4EMSA 1RMYA 3SXJA 4FG4A 2ZBFA 1ODKA 4JY7A 2FF7A 5D85A 1KIMA 3E70C 5ITZB 3JAWA 5EPEA 3CUYA 2HUNA 1ZGGA 1QRRA 2JLYA 2OYIA 3S2IA 4BHTA 2AK2A 1A4IA 4TMWA 4GODA 1W52X 2P1RA 1JAZA 2KB7P 4MD7A 2CXSA 2ZT7A 3ZEIA 1PFYA 3WRVA 3LT2A 4EUKA 1Y4UA 1KQGB 3I8SA 1MFZA 2C7PA 1ECPA 2O2DA 3LBAA 2Z3ZA 5D86A 3THYA 1N8RQ 1OXXK 1QC5B 4MHSA 3WWDA 2G6BA 1QX8A 4HFRA 1DIOB 3ANNA 3OQIB 4H0LD 4HQFA 4GMDA 1SQQD 3KNZA 5IHPA 5HFJA 3TMKA 3OJOA 3GLFE 1TW3A 2PA3A 2DFLA 1SBZA 4D45A 4PC1A 2FBWC 1BE0A 5AKIA 4H3VA 1QZZA 1CHDA 3TOSA 3CWCA 4B3FX 1EVLA 2ZJ7A 5TQ2B 3GCDA 2XGOA 2VQDA 2Y76A 3E9ZA 1SP4A 5HKOA 5JH7A 4PZYA 1G8KA 4G1UC 2PS0A 1Z18A 2WD7A 5L6MB 3V4FA 3M33A 2YYSA 1KFBB 1JG1A 4YY3B 5FX2A 2YJGA 5HK9A 3UT5B 4BO5A 3KYJB 1HFWA 4BNXA 1ADGA 2B7LA 3STHA 1VLQA 4Z4QA 3IODA 3EQ8A 1XZAA 1Z15A 2JK1A 2VRCD 4WINA 1C0KA 4POOA 5GLXA 1CB0A 4DM7A 3RS0A 5CCHC 2J5UA 3W3ZB 1RIFA 1R88A 5T5ID 2XMGA 3OSZA 3CCEZ 4N5HX 3ZVNA 4KYTA 5CLJA 1Y48E 3TNUA 4II2A 5J4KA 2ZWIA 2H43A 3ZW9A 4JZYA 3HU2A 2CW0D 1D2MA 4FQ7A 2C7RA 4DOJA 2XYRA 2CFTA 5IU6A 3UK1A 2CUKA 4GDOA 1AKQA 3HDVA 4AO7A 1N6OA 2V45A 4AG5A 2JA7I 4B17A 2P9TA 2PK3A 2IZ3A 2GM4A 2ZVDA 2HGSA 3PD7A 4LYEA 4S12A 4OTZA 1SQVE 2A94A 1KEKA 1N78A 2PZGA 3DP7A 1Z6XA 2OCXA 3LQRA 1LBSA 4EHJA 2CLCX 1SA0B 4O2BB 3FWNA 1JAXA 4CUKA 1E8NA 5I7RA 3ZZ0A 4O4IA 1T4MA 3NHBA 4MUXA 3K71B 3WUUA 4K9SA 2A3NA 3I92A 3TFWA 3L72J 2JDIA 2VH1A 3DMTA 1IFPA 4KQIA 3F3PC 1IZ0A 4GVLA 2O8EA 3P1JA 3RC1A 1DIHA 2IYLD 4PV7A 1A9OA 3HTKB 1PR5A 3RAEC 1ZD3A 2Q5FA 2QTWB 3CPHA 1YITP 3CLUD 2QPTA 1FTWA 2YWFA 3QENA 2R65A 4BMXA 4R31A 4FYHA 1KZGB 3U7GA 2CLMB 2J5BA 2QE7D 4TTSA 1MABA 1Y63A 4NBFA 2QP9X 4X60A 1D2CA 3O3MB 2DWUA 3X2NA 3H2HA 3M34A 1T1SA 3BD9A 1WW3A 5CEEA 1SVSA 5LDGA 4FOSA 2FOXA 2UYOA 4OG2A 3F5DA 4K86A 3PZBA 4ISCA 4BKMA 4QFBA 3U62A 3G2JA 5NULA 2HDWA 3WB0A 2MDTA 3CZ9A 3NR2A 2QSUA 3CC2P 1YL5A 1ZMTA 3S1LA 3EAQA 3CNBA 4OIMA 1A9YA 3R3ZA 3T5MA 4UUQA 5CCGC 1EC5A 4LZJA 2JW5A 2BI7A 3T9AA 2QMEA 5C51B 3MTEA 3K6SB 3QNUA 1G20B 1MB3A 4U0JA 5FWXA 2ZI6A 4PSUA 1P1FA 1BEEA 1TD1A 2R1TB 4ITRC 1IN6A 1IFMA 4UU1A 1P1RA 2VPIA 4V02A 3K4QA 4KXUA 4FDLA 3KCQA 2C1XA 3M2PA 5G0WA 1SQBG 2DETA 4BYMA 3S14I 2DHDA 5DYGA 1NTZD 3RRFA 4RADA 2RGDA 2K9JA 1ENPA 3G4S1 1CUUA 5D5HA 2EYQA 1JYEA 3FSGA 5TMEA 2XOKD 1CDOA 3U1VA 1UR5A 2HK9A 1XGKA 3ZZTA 4CEHA 4RXTA 1HRDA 5HCNA 4WOJA 1C7QA 3PRYA 3W5AA 1K5HA 4H0FA 4C7RA 4RD0A 3DCYA 4EW2A 5GZ6A 3U6BA 2NZWA 5L3SA 2NPSD 2EL7A 3S2GA 2HCZX 3MHPA 3HXMA 4TV9B 2KM1A 1U0JA 2TMYA 4FX5A 3HO8A 4EVQA 2DTEA 5DBIA 1E1MA 1TFRA 3Q87A 1EUDA 1O0BA 2BJWA 1EFKA 1I4TD 1P62B 2G82A 5AR1A 2VDUE 2B4QA 3HCRA 1IZ7A 2LUOA 2Z0MA 3QVTA 5FNVB 1Z6TA 3CX5I 1K731 2ZJZA 2PWAA 1NI4B 3Q3EA 4PZPA 4MYTA 1NO4A 3T1NA 3EXFB 3FUXA 3IH5A 3ONNA 3HO1A 3B7WA 4YREA 4UMFA 3VNRA 2BDTA 3P5BA 3WWEA 2ZRNA 3CKYA 1KAMA 5HW0A 2DHQA 3K09A 1PYOA 2AWOA 1N5OX 1H2AS 5B2EA 1QS0B 5BQPA 3CXHD 4B45A 3E1SA 4YO8A 3RGGA 5DGDA 3RLFA 4BBJA 3ELYA 1GUYA 3IUYA 1XZMA 3UPUA 1DRJA 2C7BA 3BH7A 5FI1B 1MGOA 1E7MA 4K9DA 4NBCA 2R1VB 3AWIA 1P31A 1GRRA 1RKUA 4E5MA 4ZFNA 2WHQA 4K0KB 1TIPA 2GKOA 3HJNA 4PRYA 3THYB 4BP9A 2IV3A 1L5WA 4MRMB 1UC5B 1JTEA 4TWZA 5EZSA 5F1KA 5IZ4A 1I80A 1Y0BA 1KILE 4OXIA 2Z8YA 2O8FA 3QTTA 3QLVC 2FOIA 4PGMA 5GIOE 3IDZA 4JCWA 4F1WA 4YPCA 2G1AA 3U3JA 3AUAA 1BXZA 2PRYA 5SZHB 3KC2A 3CZPA 4YXWH 4DDMA 3I72A 1F4VA 4X8MA 2SICE 3U4CA 1Z2NX 2PD4A 4EMUA 1M83A 3ZWYA 2F4NA 2VJAA 1M2VA 2JIRA 3SZ3A 2KP8A 2X7XA 3IQXA 1RMQA 5AXBA 4PYOA 4YDHB 3PIRA 4O2AA 3KKKA 4G65A 3URMA 3IOBA 4GI2A 1GA6A 3DAOA 3MINA 1A02J 4B9EA 4BZZA 4EGAA 3PXGA 3BWEA 4D9JA 3KD2A 4LSGA 1ENYA 3JQPA 5BYKA 1EK6A 5H4UA 4KRFA 2P4SA 1VQM1 1DKNA 4M0EA 3EC2A 4F6RA 4Z1MA 2J3MA 2HFJA 4TLBA 4N47A 2IYWA 1V9SA 3MB8A 4M9ZA 1V8ZA 1SAYA 3TNUB 2XEDA 2VUMA 1NU1J 4RZ2A 3C1LA 1DKQA 3PX7A 2ZUDA 1NGMB 5ADUS 1UJ4A 2WTAA 5ELXA 2G76A 3CGWA 1ODIA 2QU7A 1ILWA 1E5WA 4R8RA 5CVEA 1ESDA 4V2IA 4ZEOA 1I8TA 5C35A 3QVOA 2VDWB 2OBBA 2HJVA 2ZK7A 4B09A 5KINB 2PRSA 1WVGA 2FZ4A 4GICA 1B14A 5ELMA 2NM0A 4OK6A 3ZHTA 2BCJQ 2ZYWX 4KC0A 3ABSB 2IUSA 3E03A 1JKJA 3CRZA 3BD6A 1K89A 4HNTA 2JFWA 2BFPA 4ARAA 3C6MA 3GEDA 1PTJA 2GZAA 3X2GA 4CNQA 9MHTA 1EZVG 1WXWA 5C8XA 2B9BA 4R1NA 5M34A 2GNOA 2E89A 4JYMA 5HRCA 1PLLA 3FPHA 1W25A 4YRRA 4BE9A 5KYGA 1RWNA 1E5VA 2QK4A 1XMIA 4D41A 3ZKWB 3FRIA 4RH0A 3P9SA 1K8QA 1SS1A 1UKBA 2O7NA 3PHCA 4NSNA 1S1MA 2KPIA 3NCHA 2VDRB 4EGFA 1I4EB 1ABFA 2Z3VA 3JSAA 3HUUA 5KU7A 1WEKA 4LYJA 4HQRA 1YA4A 4MV0A 3WZLA 3VVCA 4J03A 5DZSA 1T9AA 1Y5IA 2LTAA 1GPLA 3JWJA 2FRXA 5JYDA 2B25A 1XWFA 5HM8A 1YF3A 4HC4A 3DE4X 5DN6D 1SKMA 1TFUA 5CXXA 4RY8A 2NXJA 4YAGA 2BPOA 3L0ZA 1NX9A 5FWXB 2GLTA 2RK6A 4CLRA 1L5VA 1Y6JA 2A45I 5AW9A 1L4HA 2C61A 2H7XA 3RS3A 1P9OA 1SXGA 2QNBA 3U4HA 1PWHA 1H8AA 1T9GS 1H6DA 2NQ8A 4CM9A 4RBNA 5KPDA 4JI7B 5AKGA 1KTIA 1YL7A 3OCYA 4YJ2A 1E59A 1UDRA 2WZ7A 2C99A 4XE5A 5B1EA 2NXEA 1X1BA 2K9JB 3ADPA 2P5UA 2P2CA 2IEDA 3CCR1 1YZ3A 1AKEA 2DKOA 4ZXPA 1L7QA 3MWGA 2D74A 4KVAA 2JGRA 1L7AA 4D9KA 1ZCAA 5CVCA 1DTEA 1NATA 4IWNA 3QFSA 1T8SA 3KWLA 5EY5B 2H9AA 5K03A 1CUVA 1ESEA 2X4LA 3OQBA 3ZWXA 4EQ6A 5LL6P 2WAMA 3VR0A 1IHDA 1YB4A 3FQQA 2IBZG 2EKZA 2IF0A 4NULA 4MMXB 1WG8A 4XVUA 1R0BA 4ZPJA 2QR2A 3DAPA 5ALDA 3LXUX 3RWOA 1URQD 1OWAA 4U02A 1PVDA 4GSYA 4EECA 2WB2A 5LBTA 3K0SA 3OKCA 1GWNA 4TLMB 3D6HA 1SU4A 2R7ZI 4R01A 4KX5A 1RO4A 3REQB 4KNVA 2FEMA 2FZGA 4EUHA 2Q4ZA 3O38A 4XARA 1T8WA 2QEXZ 2H2HA 5IM4A 4EUEA 3MVEA 3M6UA 1XOIA 1QF8A 3N75A 3VX4A 2EEPA 3QY9A 2KYVA 1R15A 1L0NE 2QORA 4JHXA 4E22A 2A30A 3A70A 4RVOA 5IABA 2Q9BA 3L1IA 2VF4X 1ZL2A 1BC5A 1VQ4Z 4JMLA 1P7YA 2WWVD 3R3UA 4TYMA 1ADJA 4MONA 3P8CE 1JPVA 4MV4A 3CCM1 2EP8A 1XMQB 4UOQA 3BCCG 2WOOA 4U0KA 2Z56A 3OZ7A 5K05A 1VBFA 1DB3A 1QGED 1NN5A 4V0SA 3C8HA 1QHHA 3DBOB 1PRYA 5TC4A 3LO5A 5K0LA 5E1BA 4ZVVA 4LDQA 2LKMA 2HMYB 4Q9HA 4N54A 2J4CA 1K7SN 3EXEA 4MCIA 1UBTS 3VPXA 4NFRA 2R6AA 3AR7A 1Q1ZA 4UM7A 1PG2A 1QANA 4M9RA 1RRCA 2H48A 4XQEA 3VZSA 3NTXA 1NDHA 1DV2A 1QKJA 4H4EA 1QHEA 3NRCA 2H3HA 4CM4A 4FFLA 5G02A 3I09A 2WM8A 2ZSUA 4J0CA 2PZMA 3ZG6A 2BCCD 4X63A 4PD4I 1M2VB 3OJWA 4I4IA 4C4XA 2JP3A 2NYUA 2X8WA 3RFCA 1TB4A 4L48A 2EGGA 3C5VA 1VQ81 4ZV7A 1GW4A 3AEUA 1CNMA 3MINB 2W2KB 1FZGA 3QFFA 3QI2A 2JA6A 2N1BA 2W58A 2WC1A 3ZE6A 2QTLA 3UJ9A 5HIMA 2P6UA 3ICVA 3ZBQA 4C0LA 4A23A 2WHPA 5LA6F 2ZRAA 2W03A 4ZPXA 2QRJA 1YI8A 1UBGA 2IVFA 2BZ1A 3E5MA 5CK4A 3W79A 2QRNA 1K8A2 4XZ3A 3VGJA 4Y7NI 5EJAA 1Z6PA 4NE2A 4N0PA 5AJVB 1NMEA 5E7QA 3KP1A 2ZSJA 2MSWA 3IDAA 4IIGA 5IANA 4B82A 5JR3A 3HKDB 3GELA 2V5AA 2V4ZA 2EKQA 3PEUA 2IXAA 3UCFA 1J5XA 5LB2A 3ZLVA 1ZJWA 1VBMA 2IUEA 3ACBA 2O50A 1T2KC 2BLNA 2GPAA 5ALRA 2RHJA 4IICA 3TOCA 3WGTA 2R8XA 3PGMA 2V8OA 4D4KA 1PIXA 3O4VA 1E1CA 4JBGA 1CDEA 1EBFA 1R3UA 2IXTA 1FOSF 1SXIA 3FCUB 1UBSB 2CHEA 4NMHA 3QE2A 4ZOQI 2F1HA 1UCFA 4HWOA 2CWWA 1XN1A 2VT7A 4WB4A 2AKEA 4R41A 2HLNA 2JGKA 2G25A 1L0LG 1NF3A 2YRFA 3EY4A 3A0RB 5F52A 1O0SA 3BYZA 4DQVA 5APXA 1MZ9A 1ISMA 2CDNA 4B4DA 2OAQ1 3O47A 1HNNA 1M73E 3AF3A 1N7SB 4JDPA 5CFRA 1JWBB 1KOGA 2P11A 5L6LB 2QEQA 4DA9A 5T41A 2FZVA 4TUYF 2FEKA 3RHFA 3HCNA 3OIYA 4G36A 1NMYA 4PZLA 1I3LA 3OE1A 2C2GA 4MV7A 3G9ZA 3SLKA 4DWVA 1G8GA 4DLTA 5JV5A 1TJYA 3N59A 4ZMSA 1TWCA 3Q3IA 4A1FA 2IXDA 5LOVA 1UZUA 4B34A 1DRWA 1DTWA 2X0FA 3SZMA 3IJEB 3V2UA 4L73A 2DZDA 2JCYA 3N28A 2YOGA 4PZCA 3KSZO 3WLOA 1VHJA 5EXSA 5AW5B 4L5JA 3D5TA 3MRXA 2AF3C 4DNOA 5JOQA 4RL6A 5AVZA 1VDFA 4EPXA 2IF2A 3QVJA 3HCOA 4IFEA 3RFXA 1DLIA 4KB5A 2PSEA 1Z22A 3PGA1 1EBUA 1MENA 3FCXA 2GO1A 4IFMA 1JJBA 1DX4A 4MUHA 3ZYCA 2COEA 3TECE 5IAEA 2AG5A 5CTAA 1DD3A 3WYEA 5AW1A 1BW3A 1Y1TA 4H6VA 4L5CA 1P2SA 5BNZA 3FD8A 1GLGA 5SYNA 4DIDA 4UVDA 4PAQA 4AS1A 4KXXA 1Y5RA 4QBKA 1XPRA 4YDRA 4N6JA 2QVXX 1YV9A 2W93A 4AZ0B 4UUBA 3ZUGA 1U0NA 4XE5B 4MIYA 2BUBA 3RBXA 2OCPA 4DC9A 3OLWA 3CVOA 1IH8A 1WV1A 4RFLA 1G2CA 5AT1A 4MV9A 3FWZA 3HBJA 5LXTA 5CVJA 2ZRBA 1ZU4A 2I87A 1C8KA 2XODA 2A7QA 2RJOA 5AHRA 4BO0A 2C42A 4NYJQ 4KP7A 1YIAA 3I12A 5CA1A 4MW7A 2MT9A 4JC5A 3L8MA 4H1WA 2PSDA 1GZ5A 4CR7A 4JN6B 3CKLA 1T3JA 3FTEA 4JVSB 4CM8A 1QL1A 2H0QA 5A7HA 4ZI3A 3HVKA 2VK1A 1KB9H 5AKKA 3HDQA 4ASUD 2XXBA 1ZRNA 1H42A 1PHPA 4UUMA 3RLIA 1JZTA 2B9VA 2LXBA 3SFVA 2FW7A 2QLFA 3VJLA 1CR1A 4R9SA 2VJKA 2ZVPX 4LOAA 3GJXC 3I2KA 5EQFA 5HJ7A 4FG2A 3WHPA 3WRYA 4TTRA 2VXCA 4ARIA 1W0KD 3TIIA 2ZRHA 2EXXA 3A7DA 3MGNA 4JUCA 2UUAB 4FNMA 4A2QA 1FZBA 4DABA 5HCUA 3DZBA 2OZLB 4YUVA 1PBTA 1H1DA 4NU5A 3GP5A 4UNPA 2PKEA 1TJ4A 1RQ2A 4I6GA 1S5LX 4ENGA 3I9JA 1SCAA 2GFIA 4P32A 1H8ED 2FDCA 3B7PA 2QLLA 4M8IA 3UICA 4YCCA 4BO6A 5EJ8A 4P5EA 1Q861 4LDPA 4KUGA 3UK7A 2G71A 2WSFH 4TYQA 5FR2A 2O06A 2R6GA 3H19A 3ZWAA 4A73A 3GGOA 3GNQA 4PZAA 4W7YA 2K87A 4UBNA 5APQA 5K0JA 4S0ZA 5FT9A 3ZWKA 4OHPA 4X1IA 2ZIUB 3R5SA 1GG5A 4ZYWA 5JW6A 1Y8ZA 3T3GA 5AW3B 1XTIA 3IHLA 1NNLA 4X84A 4JS0A 3QLEA 3R7WA 4H1HA 3FWPA 1BE8A 3FPJA 2ZUFA 2R8BA 1BYUA 1ZXGA 1X77A 4LTNA 1E1RA 5ILOA 1VKRA 4RE5A 4DPKA 2A9KA 5HUJA 1ONOA 3U50C 1X3ZA 2Q9AA 5GOZA 2IDKA 4W7ZA 2QGFA 4KO4S 2B4TO 2XD4A 3H9GA 1S5PA 3NHSA 2HQOA 4R7TA 2J5QA 3T0IA 1VCMA 4GFDA 1DAHA 2ECPA 4JP3A 2AFIE 5L4NA 2MYPA 3KQUA 2P9EA 3WICA 1XCJA 2Z58A 1K08A 3KKQA 5E7IA 3L6OO 2WHPB 1C3JA 5KBYA 4NYJR 2QQFA 3ZH2A 1IZ9A 4V0ME 3FF4A 1KB9E 3FNEA 1TJPB 4QGFA 4LY3A 1M5UA 1XTUA 3ETHA 3ZDDA 2BVNA 1CG6A 4P4SB 3SC2B 1YTZI 1QHFA 1YS2X 4LV5B 4B4VA 1CRWG 4PGFA 2I1WA 3ZYZA 4D3XA 4EVIA 1P7VA 3DNFA 3D3KA 2WAYA 4CIAA 1K8AQ 4LXHA 3BCUA 4KGVA 4QQNA 4YRCA 5TGTA 4IH9A 3EDQA 4WJLA 5EKUA 3BMNB 3PUWA 2P4HX 1W5TA 1W36C 3IF8A 2NT4A 5IF3A 2B92A 3ENNA 1N77A 3O84A 3BRSA 2M1XA 4NOKA 2FSFA 1XA3A 3MT8A 4QJ4A 3M4NA 2FUCA 1N33B 5JSKA 5JLJA 4ILEA 4AY4A 2X0RA 3LKBA 5IC4A 5APVA 3GTJI 1REQA 3RRJA 2I3ZA 3U0BA 4LGDE 3ESBA 4KIJA 5JZOA 5G0VA 4EFNA 1PUJA 2YBEA 2YKPA 3W3AH 2X5OA 3EEBA 2W6CX 5CLLA 4C20A 1QZXA 2NPIA 4M0DA 2ZAGA 4M1MA 3Q3CA 1ZGAA 4RS4A 4AO6A 2NV2B 4RHEA 1NXXA 1ODJA 3ZWBA 2X1LA 1JHPA 5AQEA 1TGVA 4EI7A 4L9SA 3NS7A 3R74A 1U2GC 3GVCA 3DD1A 4KJZA 4DIKA 3VKGA 4X97A 2X1VA 3TGLA 1DTWB 1QFMA 5DHTA 2OV3A 3WVNA 3II6X 4E1VA 1CZ5A 3EZ6A 3D6WA 2E74B 3AESA 4UPEA 4AS3A 2O01J 5H83A 5A05A 1YCFA 1U8XX 2W71A 3QE9Y 3MUOA 3T9DA 3PGVA 1EVIA 4W1QA 4MR8A 3USCS 1CP2A 5A6VA 5BR8B 2VOEA 1JV2B 4Q7JB 4XTRA 4B31A 5IAOA 1WCMA 4RZIA 2EU8A 4YHHB 3AUFA 1G8FA 5IH3A 1MJNA 3A4IA 3RTBA 4LDAA 3RF7A 3BH6A 2I1QA 3AHJA 4PO3X 5CHYA 2YWBA 5T4FA 1NN3A 4CIDA 3NASA 3DMHA 2VHEA 1IY2A 4R7GA 1KDZA 3G2OA 3D7SA 4ZRNA 4F96A 5EEHA 1WPGA 2BMEA 5DISB 5IT5A 3IBCA 3A31A 1A76A 5JNWA 2C92A 2EW8A 1NBAA 2BFCB 3G2LA 4QL3A 1C9KA 4PNEA 2JRCA 2A69D 1DOAA 2WHXA 4J0HA 4CM8B 1A5TA 2I6TA 1YUBA 1PU2A 4TZ6A 5K0BA 3A4LA 1TEVA 5HBRA 2WKPA 5C4IA 4BJ5A 2IS1A 2OV8A 3DOOA 3IP5A 5MDHA 1XA0A 2HDOA 3ZCQA 4KK3A 1KO8A 4YONB 2DE7A 2V98A 1GRCA 2C4NA 1KSHA 1H5QA 4CEJB 4AZSA 3QJ5A 2V9ZA 1RXVA 4CBVA 1NC3A 3L73D 1EX6A 3QUCA 1AF7A 4JL5A 5CAEA 1Y1QA 3MS7A 1UMDB 2AOWA 5K9ZA 1OIXA 3TN7A 3F4BA 2NV0A 4ZDKA 3CD6Z 2GBCA 4CHTA 3GRCA 2YMKA 2AQHA 3THWA 1VL0A 3IP1A 1LPMA 2OBLA 4BY7I 2CMHA 2BP7B 2JMOA 4MULA 2GZ1A 3NWJA 2E49A 3TL3A 1QL2A 3PKJA 1EFCA 4HEA6 2O0KA 4FHZA 2XE8A 3G5MA 1QF7A 1FFYA 2HPAA 5LZ2A 5JRZA 4J3NA 4PSKA 1VQNP 1B73A 1VPDA 3V4LA 2NADA 5JZBA 1RMTA 1L2TA 5FOTA 1KAOA 3LL7A 1JECA 1QX4A 3PC8A 3AOEA 1VQLP 2IY9A 2CY0A 1Y1KE 3FZNA 3HQ4O 3OOHA 3D3QA 1CUFA 4ZCTA 3TPZA 4CRWB 3IX0A 5C4JI 2W6ZA 2Z3WA 1SQQG 2MSDB 3NT5A 3ESQA 3WHKA 1E4OA 3K8YA 1PGJA 2FYZA 1KQGA 3CCLP 3PWSA 4TYPA 4XDGA 3HJBA 3I2HA 1L5YA 2Y92A 3HHEA 4H35A 2P6RA 1KJIA 2G4LA 4W4TA 1ZNQO 2C29D 3CRQA 4IUBS 1QC5A 2ZYHA 1R27A 3GTKA 1PHRA 3TZ6A 1ZQ9A 3EIXA 3S1NI 4K7JA 3OQIA 2ZWPA 4XVQA 3W05A 2HT1A 1QDEA 4ER0A 5HYVA 2Q3JA 2JI6A 3UNXA 3EFBA 2CVFA 3EH1A 4CW7A 2YXBA 2JRLA 4IW3B 3MB5A 3ZCVA 1UUFA 1R5LA 4LVNA 3R44A 2FMXA 3BB4A 1XMVA 3EFEA 4R8VA 3B51X 2FXPA 2RHGB 3GHGC 3MGKA 2JA5I 4B4WA 3MFYA 5KYNA 1TTTA 1C2YA 1S2EA 3AJRA 2F7SA 4P1ZA 4PO8A 3JQCA 3UT5A 3CH4B 4CXMA 1QYIA 3ZY3A 3PE6A 3AINA 4ER7A 2HYDA 4GPTA 2C4MA 3G1WA 5K0NA 4R69A 3ROKA 2FN9A 2B8NA 3FCCA 5CLFA 3ZLUA 5L53A 1A96A 4TXJA 4ZC8A 3NI2A 1BDBA 4W80A 1A50B 4S1VA 4AKGA 2GLXA 2JL1A 2P28A 5D6NA 4L1KA 3M6FA 4C0KA 2ZIAA 5HJ2A 4Z7OB 2OB2A 4IRXA 1TZ2A 3K6JA 1VP3A 2ZDHA 2E4AA 2P3SA 1L4MA 4D4MA 1M6WA 1JQDA 1BROA 2BIFA 3CF4G 1D03A 1G63A 3MEQA 1REQB 1Q7Y2 1YQWA 4BXOB 2JIZA 5BV1A 4D74A 3LUSA 5K3SA 1KOJA 5BWLA 2IUFA 2Q5JA 4J2TA 3ZIDA 1WLSA 2I7DA 1M72A 1RF0A 1CEEA 3A06A 3CH5A 1GU1A 1TADA 1PD0A 1C2TA 3AKEA 1KEEA 1HNWB 1MRZA 1D4ZA 3HTKA 2YNMD 3WC4A 2EHDA 3G8YA 3CQZI 3PDCA 1G5TA 3K7AI 3BZWA 4FQ5A 3EFFK 5FL7D 2GSWA 5TEVA 5DHFA 5B1IA 5K09A 1KORA 3H1TA 4XD7A 3BG5A 2WUWE 3U39A 2JEEA 1Z6ZA 4U9IS 4HGZA 3B3JA 4D9FA 3NALA 1GPWB 2F9LA 4GXQA 4IVPA 4FXOA 1JHQA 3C85A 3LUGA 3COZA 4I0WB 4IKEA 3FOBA 4UE3S 3U4AA 2OHXA 1U7JA 5EZYF 3KJEA 3GLGB 3CVUA 3D59A 4I4NA 3I01M 1W0JD 4MR8B 1JH9A 3N76A 1C7ZA 2G7MC 2ZXXA 3BTUA 4X8LA 3FVQA 4I36A 2Q5UA 1WUHS 4A3SA 1AVYA 5CDGA 4DGSA 1PNQA 4NV0A 1FBMA 5K3DA 2C97A 2CNDA 2Q3CA 4M4SA 3AYZB 3K6SA 1NTZG 1G20A 1BE3E 4W5JA 3I34X 2HEIA 2R1TA 1RQLA 4HATA 3P2KA 1RI3A 4RA9B 4CT5A 5DNCA 3PJDA 5TR9A 1CX9B 1JDTA 2V7EA 2GD0A 2PSJA 3P2MA 3ZWCA 2FSHA 4DG5A 4UNNA 2FG6C 1FS4A 5KLVD 1GEGA 3H97A 4BQSA 3QIAA 1SR8A 1ONPA 3K5HA 3S81A 4B4UA 1YMUA 2PLRA 1J23A 5CB4B 4Z7NB 2VJPA 4LBVA 3ISJA 2X13A 4D7ZB 3KEGA 3KWMA 3RTCA 5DTEA 3WLIA 1XA4A 2O1XA 1GAXA 3L5KA 5KSOA 4E5PA 4KO3S 4Z51A 5EEGA 3FUCA 3W67A 1DFGA 5TNXA 3WKAA 2YNYA 4NFHA 1O94A 4YMHA 4MZDA 3KO8A 3VR2A 3NHYA 3G17A 4ZVTA 3LKVA 4HPXB 4B3DA 4GVXA 1ZY2A 1W2HA 2W2QA 4H27A 4N5MA 3MMXA 1PEYA 1HURA 1I4WA 4TV9A 1XYYA 3FNGA 3QV2A 5TMDA 4WFKA 3SR0A 4XJXA 3ER8A 2Y2UA 5K5GB 3DDSA 5FLEX 1AU9A 2GTHA 4AJNA 3M5WA 1C9DB 5FNVA 3IPRA 2G88A 2D6FA 3T5PA 3IVRA 4IUCS 1NI4A 1PQFA 1BVHA 1XMSA 2NVUA 1OT5A 4URFA 4XM2A 3OZFA 4O08A 3EXFA 1O7JA 3UA3A 2QNIA 1Q92A 5BVGB 5K20A 4GX2A 4M0KA 1GZVA 3LLUA 4HWPA 1HLPA 1I3MA 2XNKA 1FNBA 2JJ2D 3AZOA 1IJFA 2YV4A 5G40A 1WCV1 1SQPG 3KLNA 3G59A 1QS0A 2VL7A 2YYAA 4TRMA 3N1UA 4BO8A 2ZE7A 5DSXA 1WPRA 4DT1B 2NPOA 3FYUC 4A3GI 1UFQA 3E5RA 4G4JA 4MH0R 2A0KA 3DWGA 2R1VA 4KLRA 3MS2A 3STYA 2GCNA 3H1BA 1NU1K 3T15A 3O2SB 1ODTC 1R5JA 1VQ71 2UXBB 5JS1A 4QOIA 4MWTA 3HYLA 4NCBA 3MF4A 1RQRA 4ROSA 1XD8A 1G8AA 4IJWA 3U9TA 4KREA 1GADO 1NNSA 4MRMA 1UXKA 2D2CC 2L18A 4AXXA 1NTRA 4Y7CA 3A6EA 4Q12A 3R23A 5JC8A 3Q4GA 4P4NA 2JFOA 3KOUA 3SXPA 3EVTA 3ZDCA 3MM4A 4PYIA 2E4XA 4G4IA 3ZK8A 1N73C 1C3EA 2QZZA 1JY3O 3HM9A 3EW9A 5CBPB 3MCVA 3FF1A 2HU9A 2F3PA 5F9HA 3WJ2A 4WASA 1Z5PA 4J1QA 4A8HA 3HCCA 3SQXA 3ICPA 3IPYA 3OLCX 1JUDA 5I9BA 5A3VA 2MIIA 1WMEA 2QJPC 5FR1A 3DEFA 3H16A 4JJOA 2JAXA 3AVVA 2BN4A 2XUDA 4R83A 5JTUA 4N7JA 5DX0A 2QVAA 5C1IA 4FEYA 1M8PA 3AW8A 1GPBA 3S70A 4YRSA 1L8XA 4LF6B 1RKQA 4B3TB 5D5QA 3F6CA 4DG8A 1NKNA 4RPIA 3D6MA 2F1RA 3NEYA 1ISGA 3TFQA 2I0FA 3VAAA 4TSRA 2XPCA 3S1RI 5E4TA 5AXCA 1AF4A 4AT1A 1VSVA 5K4GA 2IYFA 1X38A 1EBBA 1RXCA 2PBRA 2Z2XA 1NY6A 3D3EA 1GZ6A 3LD9A 2BF7A 2VDWA 3FFXA 1T6YA 4K9NA 2RKOA 3RKSA 1TPZA 4W5QA 3IOEA 4D02A 4B6EA 3ELBA 3WFIA 3QI7A 4NPAA 4LC9A 1KZYC 4F8JA 2XNCA 4DNXA 3I76A 4C08A 1Q7YQ 3UMRA 1PFGA 3PUYA 1P5HA 3A0BH 3QW2A 3P2YA 4EWLA 1KEEB 4IX1A 4EKYA 5EJ6A 4DAEA 4G8BA 2I1KA 1VRWA 1SCQA 1IYZA 1ISSA 5JMOA 5ABPA 1N8R1 3QU9A 3FGZA 4EHHA 1KXZA 2O9JA 3VPSA 2BFFA 1SCBA 4B48A 1ZVJA 3AKDA 3ZKWA 3CC7Z 2GKSA 4MDFA 1N7HA 1MVOA 1RDFA 2ZBQA 3N5KA 4HQOA 4MUBA 4DG9A 1HT1E 1TYCA 1V37A 2O2HA 1X9GA 1Q11A 2O3QA 4DV0B 3WSTA 1I3QA 2QD5A 4B1FA 1RC1A 2H8GA 3EVBA 3BDAA 2EX1A 3UOGA 2C8KA 2GMWA 1I6HI 1S89A 1VLHA 4WRRA 2UDPA 3SQNA 2PL3A 1EP1B 1NVOA 3HDJA 4R9VA 4BNDB 5HDQA 1A9PA 3DQQA 2I67A 4G6ZA 2FU5C 4KBGA 3NBYC 5ALKA 3N8HA 3CCS1 4J76A 1JHAA 1JYFA 4R1OA 4YUAA 1AHPA 2C5SA 1I2CA 1BWQA 4MVJG 1RNIA 1KYQA 1KKLA 4KXWA 1ONSA 2F1IA 3NVKI 4O8ZA 3L04A 4WOPA 4KQMA 3G5TA 2ID9A 5IJXA 4P4GA 2OGZA 4EB0A 4GPEA 3PYLA 1NXVA 2WU8A 1CETA 2ZUSA 3G2IA 3VPGA 4XWKA 2Q6IA 1H3EA 5HP4A 1VDMA 4RM2A 1JBEA 1UQUA 4QXRA 2R25B 4EI9A 4RQBA 1GQSA 2QJKC 4TMFA 1RAFA 1CZLA 4N6NA 4Q16A 4MV3A 1ZM3A 3WAKA 3VN0A 1ZCJA 4Z4GA 3R6TA 3OJCA 3HD7D 3OI7A 2C3UA 3OPYB 4M49A 1C5KA 2G36A 3LLVA 4JA0A 5JFTA 3ZNOA 4BBSI 1I4DD 4D97A 5M5BA 2X6QA 4XYBA 5HDBB 1VJGA 4QGBA 1W76A 1KV4A 4N78E 2A5JA 3GLHE 1VJDA 2VRSA 1UDXA 2RHHA 4D8TA 5F3DA 4G0MA 4ZZ0A 3FMIA 1CCWA 1Q1QA 3N2EA 3WRWA 3A0BE 3NJRA 1DAFA 4NQRA 3O75A 1SBQA 3ZHOA 3EUEA 1ZH6A 3K5WA 4H9GA 3AUUA 4WBSA 4FN4A 2NVUB 3VMFA 1RE1A 4MICA 1YZVA 3REQA 3B38A 5E79H 3Q3VA 4PYLA 2P3OA 1ZZGA 1Y3FE 2QLJA 1GN8A 1LV7A 3CLVA 1S3JA 2ZS9A 3SEZA 5C46F 5I7UA 3K53A 4HB2A 4B87A 3TM4A 4V1CB 5G41A 1LTHR 3H25A 1UH5A 5KJFA 3DDUA 3LUKA 4EP1A 4AN4A 3AM3A 3TYXA 3OLXA 1T8ZA 3IT1A 4AWBA 2QUAA 1V8BA 1OWPA 4QYMA 5KWVA 4DCUA 2WPQA 5C1PA 3W2EA 3RZOI 4C6HA 2KSQA 1CW5A 5FHRA 1U3UA 4DQ0A 4LZOA 3FLMA 1SQPD 2IK8A 3T4XA 1Z4QA 3T9FA 4GWLA 4UXJA 4IIJA 3M6AA 2W6JA 1M5TA 3ZCSA 5DHUA 1WHSA 3K96A 1OI2A 3V00A 3ONVA 4AAYA 4JITA 2BCCG 4FGWA 4UUAA 3K3PA 2A33A 4HR7A 4YASA 5T67A 1Q15A 2MJLA 4EPYA 1RD4A 2D8MA 5F12A 5LP1A 2FP4B 4G89A 1T0BA 1XCBA 2P10A 1I7QB 3A28A 1WOMA 3LUCA 2FMFA 1P80A 2FPWA 3HZZA 3PE4A 4BGUA 1FCJA 2KBFA 2XSZD 2RGNA 3PPWA 3PUZA 3QA3E 3RO7A 1PEKE 1PGOA 2WVGA 3FGAD 4EOTA 1XJWA 1ZI8A 3OJEA 2E21A 2HMUA 1U8AA 4JBWA 2F17A 2W2KA 2QTMA 1RLYA 5IKEA 4JJIA 1JQLB 2RHMA 1V3VA 2EYUA 3I37X 3K0EA 3AEGC 1BKYA 1P7WA 3O8ZA 1PR3A 1EG7A 4FMBB 2BKEA 1YB5A 3QWOC 3A7EA 5JWHA 1HBJA 4P3YA 5B7PA 5AVVB 3HC7A 4Z54A 3CLQA 1AGYA 3QJGA 4OGWA 3W8FA 4D6TE 3V1KA 1LK7A 3HYSA 1IL0A 4MKIA 3VR4A 2ATXA 3CXCZ 3DEJA 3BHJA 4GLFA 5BNWA 2VPYA 5BVHB 4FDUA 5HSGA 1EFVB 3HKDA 4LZNA 4P7BA 4AZ3B 3IQHX 5E79E 1LT1A 1YJAA 2ZKLA 1GUZA 3JAKB 3ZU2A 1Q0RA 1Q22A 1SCUA 3L74E 1C81A 4KX3A 3TLCA 1RHRA 3PYXA 3E4CA 4TYNA 6ADHA 4JB8A 1HSOA 1RW4A 4MGEA 1RYZA 5J1TB 1E0AA 3WQBA 4PBTA 1VKNA 2HDNB 1R5OA 1GNQA 5BT9A 1JPJA 4OQXA 5CFPA 1T3HA 4JI4B 3IAHA 1AKWA 3AETA 2PO5A 1GAJA 4N3GA 2HPHA 3Q15C 5B6JA 1OBOA 2PY6A 4OJNA 1QMGA 4OGQC 2BFFB 3GOHA 1N7SA 1JQ5A 3EA4A 3WBJA 1J7JA 3ZVLA 2E6UX 4GOND 4TTVA 1A2KC 3DQZA 1TWHA 4Q02A 4ZT4A 2IHKA 1S7GA 3UK6A 3ROFA 4EHNA 4NBEA 4F91B 1YFZA 4AMGA 3L93A 4QA9A 4F3YA 1C1XB 1VRCA 1U2QA 4QX6A 1AG9A 1ICIA 4JP6A 2RCYA 2GAEA 1OW7A 1YASA 4A5SA 5AW5A 5EXPA 5ARBA 3S4YA 4P0PB 2V8IA 2Z98A 4JMPA 5CYOA 1GKKA 4JX8A 1KI6B 4DLRA 4DHWA 3BQNB 4W5WA 2EQAA 5H5JA 3PRHA 4MXUA 4EDHA 3C1AA 3CEPB 1ID1A 3O8CA 3L07A 3F97A 2FAXA 4DARA 5F51A 3B6IA 3DP9A 2FEWB 1G2OA 3UIEA 1SD1A 3PR3A 1HT3A 4JX9A 2B87A 2HRQA 2CLHB 1U63A 1Z01A 1J0XO 2GA1A 3CC8A 4RZQA 3C48A 2XMQA 4QATA 2BGUA 3AIOA 2CMDA 3N2KB 1W4AA 3I73A 1QFXA 4YAJA 4YUYA 1OXSC 4AZ0A 4QVGA 2QN3A 1V39A 3UQYS 3TYYA 4QU9A 4HXFB 3GMTA 2EBWA 4MVJD 1KJQA 4WFQA 2DXIA 4Y98A 2HF2A 3DBRB 3BWDD 1R6DA 3AM4A 2OA0A 1SURA 1MC1A 5L4SA 1U1IA 4H6XA 3SYKA 1ZSNA 1HH0A 4JUFA 5CW1A 1U2PA 1AQ5A 2CUTA 2AFHE 2ECOA 2CD7A 3G68A 1T2EA 1SPXA 3V5BA 2ZT9B 2ZVNB 2QTNA 2R1UA 2WSIA 4H13D 4AONB 3HBMA 1Q0UA 4UDOA 1LX7A 3NKLA 4LEIA 4JGGA 2PKWA 1SMKA 3FB4A 3PK0A 3ZD7A 3WKBA 3BAFA 2QS9A