1FDIA

Oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite
Total Genus 251
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
251
sequence length
715
structure length
715
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE H
total genus 251
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdiA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdiA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdiA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdiA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdiA03
3HKZA 4KDLA 4GA5A 4DMRA 5EPPA 5FTLA 1Y5IA 2VUMA 3QC8A 1KQGA 2KI8A 3O5AA 2NYAA 4RV0A 1WCMA 3CQZA 1KQFA 4KODA 1FDIA 3DMRA 3GTGA 3IR7A 1AW8B 1AA6A 4CRZA 3GTQA 2VPWA 2NAPA 2NVYA 1Q16A 3IR6A 1R27A 2WB1A 1PQFA 1TMOA 1G8JA 2R92A 2VPZA 2VPXA 1TWFA 4AAYA 1PQEA 3H25A 1WMKA 1E18A 3TIWA 1IW7D 3OUGA 1PYUB 1PYQA 4KO8A 2NVXA 4GA6A 5DYGA 2V3VA 1TWCA 3EWKA 3H0GA 1PT1A 1I3QA 1R7RA 1EU1A 3GTLA 1PT0A 4QIWA 3QWZA 2B63A 1DMRA 3HU3A 1UHEA 2JIPA 2JA7A 1UHDA 5FTMA 2JIOA 3O6QA 2JIQA 1TWGA 5DYIA 1SFOA 4AONB 1I50A 3CF2A 5T5MD 1Y4ZA 2R93A 2EEOB 1FDOA 2JA5A 5B6CA 3GTMA 3GTPA 4CRYG 1OGYA 2Y0SA 3QQ7A 2IV2X 3TM7B 1PQHA 2E7ZA 3HU1A 2V45A 5C18A 1Y1WA 1E32A 4AYBA 2E2HA 1QCSA 1OMIA 2G8YA 1E61A 1AJYA 2C45A 1CZ5A 2R7ZA 1SIWA 1E5VA 1ZMEC 1PPYA 3FKIA 4AOKB 4C2MA 2IVFA 1TWAA 5FTKA 1TWHA 2VPYA 3GTKA 1K83A 4D7ZB 2DMRA 1H0HA 2WAQA 4CS0A 2JIRA 3HU2A 1DMSA 1QDNA 1G8KA 1CR5A 1S3SA 3GTJA 1WLFA 5FTNA 5FTJA 1H5NA 3IR5A 1VC3B 4KLNA 4AZDA 3GTOA 5T5ID 2YU9A 2JA6A 3IN6A 2PMZA 4KDIA 1R9TA 3QQ8A 3ML1A 2JIMA 5GLFA 2E2IA 1CZ4A 1E60A 1YLEA 5C1BA 3PLXB 1Y1VA 2PJHB 2P10A
chains in the Genus database with same CATH superfamily
1NKVA 4AVYA 3GJ5A 1JYSA 1YONA 1JZQA 2O1XA 2FPPB 1PFKA 2WE8A 3MCWA 4GR4A 2QRJA 3QU4A 3S1MI 7REQB 4CLOB 2QN8A 4LGMA 5M04A 5CDSA 2DP4E 1VHJA 2DT5A 3PNOA 4YIKA 9MHTA 1JA0A 1W36C 1R5OA 1IBMB 2C0XA 1P1RA 1WO8A 3JZAA 3T7RA 1XGKA 5AUOB 3PHBE 3HA5A 3IO5A 5K8IA 4E2WA 2P68A 1QH1A 3Q11A 3RUFA 1YB5A 3U4CA 1F1BA 4W7SA 4EA7A 4JF7A 3VR5A 4WBNF 5BV0A 1IVSA 1JSCA 1XLVA 5K8CA 3CW2A 4D6XA 5DZSA 1UBCA 4YCAA 1Q812 3I2KA 3F5QA 3KSRA 1GRCA 4MW5A 3GLGE 3G2QA 3PFWO 3QUBA 1G5IA 4FYYA 4GKVA 1MMFB 3L49A 4QWWA 5DGTA 2Y3IA 4N6JA 3JW8A 3GLKA 3O31A 1H65A 1LBIA 4PQYA 1G6HA 4XOIA 3ORQA 3R7NA 5BY2A 4R1NA 4YP6A 1XPUA 3H32A 3R3HA 3LIDA 1CRWG 4JVLA 3HVKA 4PLCA 3OJLA 3PXEA 2IZ3A 3B6ZA 5ENDA 1RO0A 3E7WA 4RK6A 1VSQA 4BEVA 4EUSA 1M6HA 2IHYA 3OE7A 4R4JA 2ONJA 4JU8A 3AFNA 4MKRA 1QH8A 2GWHA 2JFWA 3OQNA 1YI8A 2IY9A 2SKDA 1XVVA 1WS6A 2WU1A 1G5HA 4CF6A 5CGZA 3SS7X 4HGOA 1P60A 2Y0DA 3PXAA 3W6PA 3B5NC 4W5TA 1YO6A 1XC7A 3DFZA 2O3JA 1HNWB 2O8EA 2IDKA 4AYTA 1Q0SA 4EVSA 4D0GA 2OZKA 2FE1A 4EFMA 4F5ZA 4NFRA 1BSNA 1M5TA 1CSEE 2DY0A 3IHKA 5KNBA 4PNZA 1LGHB 4A3LI 3IAM1 4XD2A 3P0EA 4G9EA 4NFYA 2X8AA 3CLTC 5AJTA 3TVTA 4TTSA 4BGVA 2G72A 1Q84A 3RHZA 2XMCA 3DBLA 3L7KA 5GIPE 4L51A 3R74A 3AVVA 1KP2A 2FUKA 1PJAA 1W6UA 3EZYA 4KPUA 4O4IF 3ZDZB 3U1BA 5IJAA 3PEYA 4AF7A 4TT3A 2RN0A 1H05A 2WP8J 4F6LA 2FEXA 2PZEA 3HY4A 1RS0A 2WT7A 3L7NA 4UVIA 1F20A 3GFQA 1EUQA 4B3MB 1GPUA 2ZYIA 5D84A 1G21E 5B5EE 1R15A 3BWCA 3BIFA 1WDMA 1NVFA 2GTPA 2VT7A 5ALJA 4DXAA 3NH9A 1V16B 1VLJA 2PI8A 1U4SA 1J8VA 1GTMA 3WAKA 5DHQA 3LAWA 4ALLA 4KW7A 1VBMA 5DOZA 3RSOA 2DJ5A 5JAIA 2R5DA 3CCMZ 3L1JA 1JEQB 4DCJA 5C5DA 5CB6A 1H22A 1UBRS 2I3BA 4MV0A 1PW7A 1IN1A 3Q8LA 3J81A 3DB2A 5LMZA 2AQ8A 1Y6QA 3U6KA 3PQEA 2QXUA 1N32B 1EIZA 2NXNA 1A9RA 2PS1A 2X58A 4OLFA 5C2JB 1KFMA 1USWA 1R8SA 2XB6A 3K9HA 1S7CA 1CQZA 1RRCA 3AHDA 1L5LA 3C8ZA 2W6BA 3CXRA 3DEJA 5SZIA 1SQBG 1RWOA 3L7IA 2HYIC 4I7ZC 2E5FA 3CKMA 4AD8A 4O4IA 3WLSA 3SE0A 4DPKA 1DTSA 3A8TA 2RGWA 1OBCA 1Z6XA 3PJEA 4MPJA 3WUTA 4GE0A 4O2BB 5B3LA 3LUKA 4Y2HA 3EOZA 4KIWA 2Q0QA 1WZCA 4PGMA 1U6KA 1L4EA 3U3JA 4Y7DA 4TXNA 4KMSA 4YRCA 5EP1A 3LDHA 4U2FA 4QQNA 4U4AA 5ECYA 1P44A 5A4DA 5CPBA 1QH0A 2LIYA 2V03A 2MMCA 1GGHA 4DS3A 1TT7A 3FROA 4S24A 4OJMX 4IFTA 5DASA 2ZPAA 3EA0A 2IP4A 1SQGA 4NY1A 3DUFB 3STXA 5JZSA 3H0CA 3VAAA 4HLQB 3D4NA 6ADHA 1ZRTD 4BWYA 1NI3A 2BE7A 4ASUA 2Z3ZA 1C1DB 3TLBA 3WL7A 5HOEA 5EI5A 2H1VA 2P41A 5L3QA 5E6RB 1YTLA 4M8KA 1YJWP 3RSSA 4EB6A 1ZL2A 4Y9SA 3TECE 1EXDA 3JSVC 1NTZG 1KAMA 3IV7A 3LO5A 4EX7A 3LCRA 1UBUS 5I9IA 2ZBEA 4LWQA 2MKVA 1U1DA 1GDDA 1GO2A 5AW3A 2CDAA 4WOCA 3JD0A 2CC2A 4AJKA 4Y8VA 1D2GA 4X45A 5EHXA 1A3CA 3DL4A 1JEQA 3CF4G 3ANSA 2C1ZA 1U9IA 3SSUA 3UK2A 4K26A 3EVAA 1LC0A 1I36A 2RE8A 4G1MB 2J5UA 3TF5A 1DIGA 4ZAVA 4CL0A 4URXR 2IFMA 3PGA1 1K732 1E2EA 4LGDE 1CD5A 1T9KA 4BB5A 3IUJA 4FS8A 3RS7A 1N6RA 2O06A 5HF8A 4Z3DA 3OQMA 3OEEA 4TXMA 4B86A 4GMHA 4MULA 2P79A 1NU8A 1XNHA 5IVDA 4DKJA 1YJ91 4ZT2A 2W6MA 2L19A 1Y9BA 2P1JA 1U8CB 3KHKA 1J90A 4PSUA 3HP1A 3VR3D 2EZ8A 4ZV7A 4DQVA 1G9TA 3PENA 4GYYA 2D3WA 3WAGA 2ZJ2A 3CX5E 3K2QA 1TMYA 3W6NA 3FKII 4M49A 4MQLA 1Z13A 1JE0A 3VDMA 3WK9A 3WQSB 1E3EA 3PUKA 4IRXA 2BEZF 3OQPA 3UFBA 3PUWA 5K2OA 3LOPA 4WXRA 4BNVA 1YB6A 2JI7A 3KEGA 4NYIQ 2JBWA 3C48A 1TADA 1KY5A 1AQIA 3HKDB 2A7XA 4HX5A 3VO9A 4XYLA 5HWSA 1EEHA 2NQTA 3TE7A 1CEYA 3CCQP 1U04A 4RAQA 5DX8A 5CAEB 5FPKA 3M34A 5B1IA 3NH5A 3ZV4A 4Q1DA 2O0LA 2A59A 2RGEA 3U3RA 1V8DA 2AHRA 3L0PA 3K2EA 3N07A 1ODIA 1N7IA 3RK2C 5FLKA 1LT9B 1E61A 1NBMA 4MQ6A 4ENRA 1UKBA 5DI3A 1DQRA 5BSKA 3DE2X 1IZZA 1KAGA 1Z6YA 5K0NA 3OIDA 1B15A 3LXMA 4H7KA 4JIGA 2P5UA 2YHIA 1PV3A 1H0KA 1NJGA 1OFVA 3QOWA 1JKXA 1NR7A 2WV9A 4ZPJA 3UY4A 4F56A 3NFYA 2HRCA 4HKTA 4LZLA 2WMNB 4JJKA 3KJXA 3OFNA 4BLSA 4K35A 2R6R1 2H31A 5G3ZA 4AK9A 1V96A 1LRLA 4K9MA 1YJQA 3FDJA 4REQB 1A9XA 1XTZA 2WM9B 2ODNA 3L74G 1DNPA 1XYVA 4C30A 1K6EA 3TMAA 3O2SB 3P32A 3CGGA 1V6SA 2JH3A 3DM5A 4NEHB 3WIOA 3D2LA 1HGVA 3KOXA 4BEJA 3L70G 4BNZA 2QM3A 2OSBA 2PSFA 3KU4A 3NTVA 3QVTA 4LY3A 4EM6A 3HUTA 1S01A 4U3JB 1Q0TA 1OLUB 3DKRA 1QH1B 3GQVA 3MRSA 3AF6A 3W8DA 2Q5FA 2W2LD 2WPNA 1SWVA 2G0TA 4WMLA 3LIPA 5FD8A 3G3EA 4WK0B 2HMSA 2OFOA 2OHXA 1ZNYA 1NFRA 2I2XB 5F4BA 3ZD8A 1UWLA 4YPCA 1FYXA 3L6UA 1H2RS 1TA4A 1SA0A 1EK1A 4IL6X 2K9YA 2I0FA 2OAP1 3AR3A 2ZCVA 3IAHA 4D6TJ 2ZYUX 4JLJA 4YXFA 1LVUA 1M2JA 2FPPA 3KB1A 4MEJA 4DR1B 4TVBA 5ALPA 3EHEA 1EFUA 1IXKA 1ADJA 4ZT7A 2GK7A 1O0BA 3D6UA 2BW0A 1PNOA 1U90A 1P7VA 2AQHA 2JGKA 1YQ9A 3PTLA 2CY0A 4IKEA 1KZ9A 4DJEC 2PSDA 3KOZA 3VFDA 2Q3IA 2ZT9D 2CHUA 2QLNA 1KYQA 5IJ9A 1A27A 1SQFA 3BXGA 4K40A 4UNSA 2P6OA 3TQQA 1D1QA 3GRPA 1PTKA 3NV9A 3O47A 4ZOQI 1YJN1 1JDUA 1QDEA 3A1WA 4X7MA 3V1KA 5EIBD 4C5CA 2E4AA 4BFYA 3AE2C 2JGNA 1EQAA 1OT3A 1TZCA 2RKWA 4BN0A 1AX9A 3VPAA 5DX0A 1Z15A 4BV3A 3WISA 2NU6B 4RK4A 1TF2A 5KNDD 5CU7A 2VHUA 3MNFA 1I2CA 4HPXB 1TZKA 5KNBD 1KMQA 1IDN1 3KSDO 5EUQB 1E1YA 3OJXA 3UUGA 2FQ1A 2QJPC 2B7CA 3VMHA 2FHPA 2RHJA 4L9AA 1PEAA 4CT5A 4DE5A 3NBYC 2EV9A 1SOMA 1TU0A 3DNPA 2HM7A 3PJDA 4L4XA 3VM6A 1ADGA 2W6ZA 1E5XA 4OQFA 2QRNA 4QNMA 2V65A 2O57A 3HUSC 4OQMA 2L69A 1PLJA 1RYFA 3EARA 1DJPA 2OTL1 1TLTA 1EDEA 5FTMA 1WPXA 1KD1Q 1YBVA 2QM8A 4Y9RA 1ENZA 3M1IA 4I14A 4RHUA 2F9FA 2R1ZA 2ZUVA 5DO9A 2R9VA 3C3WA 1CDEA 3BGVA 3LC2O 3TNUA 1V43A 4EQ6B 3EDMA 1V4NA 1A95A 4I6GA 3O8NA 1E9CA 3CWCA 2DPMA 4MHOA 3QQ7A 1FL9A 1O9GA 2R0QC 3TM7B 1FMCA 2BKVA 3ZLJA 4KWIA 2G82A 1T36B 4IMPA 3N7NA 3VRHA 2X0IA 2Z2IA 4YI3A 4NBBA 4FBGA 3WBJA 2ZZKA 1M72A 4L50A 5KVAA 3OM8A 4K6MA 3I04M 4IP0A 3CUKA 1FJXA 1KP3A 3G68A 4F84A 3GD7A 2NN3C 3KYQA 4RMJA 4GDFA 3PKJA 1SIWA 2FG5A 1KJ9A 3DPIA 2C07A 3FTPA 4IIJF 4D3XA 2B1GA 1P62B 1FSZA 2R4QA 1C3OB 2QTWB 1BQEA 3EF0A 4MZXA 1R0LA 3U7QA 3E1IA 4IFIA 3Q3HA 4CGZA 5L6MB 2FSIA 1L4FA 4YNBA 2UUAB 1I01A 3AVWA 2YDYA 4YWJA 4EG5A 2BFNA 4LCJA 2GXSA 3HXLA 2YJ3A 2VYVA 4MI3A 2P6MA 4A8JA 1K66A 1R0ZA 3QXHA 5IZCA 3OPNA 1WXIA 4NJMA 1QVFZ 4O4LB 2BZ0A 3U37A 3C8VA 4H0LD 4HT3B 5BN5A 2Q3JA 5KSPA 4KRGA 2N1TA 2C99A 5C44I 1NI5A 5AI0A 4UTZA 3RDPA 2NUTA 3A6FA 1KWGA 1JQJC 4TYNA 4OU5A 4I8IA 1C41A 1AURA 2AYZA 6GPBA 3I2FA 3ZHZA 2PBFA 2XNSA 3LS2A 4KVFA 4LDZA 4ZVLA 4CKCB 4BQQA 1U1IA 1WCIB 5IARA 1NXTA 3JQQA 5ALDA 3BEOA 1YLEA 3PRJA 1CE8A 3PRKE 1EWQA 1FYEA 3H19A 1ZQ9A 2B83A 3W78A 2D74A 3HTXA 1D4OA 3WC4A 5AIBA 3UOAB 1YNSA 2CNWA 3AU9A 4IDBA 2IDZA 4A4DA 1WPGA 5JPIA 1J2TA 4Z4HA 5KHLB 2R7ZI 2ID9A 3DT8A 3EIHA 1ZK4A 5HRCA 5JD4A 2P2NA 1I50I 2XDQB 5TQ2A 2YADA 4AVRA 4XVHA 4MYRA 4BE9A 3H0KA 3QKRB 1EKXA 2IQIA 3ZE7A 4ARZB 2E5LB 4IJMA 4HK4A 1CTQA 4KV7A 1WRGA 1SKYE 1X7YB 2ZIXA 5EJFA 4LZAA 3TYYA 2NAPA 3F3PC 1OBFO 2VYNA 1JBQA 3GC6A 5IAJA 3UIEA 3ZLVA 4YJ2A 2ZFCA 1BFDA 2ATCA 2V97A 4DNPA 2Y6VA 3GLIB 2GPTA 4K2HA 4KFCA 3ZIAD 1URQB 1CZOA 3CA8A 4PYKA 1M5UA 4P54A 4FXOA 2W03A 2P1RA 2ADFA 2WLTA 3K73O 2ZBVA 1W59A 3VI4B 1VCMA 5LL6P 1M56D 3V1MA 4Z9FA 4YRPA 1G7CA 4O9BA 3FBGA 1YIDA 1N6LA 4TKVB 4WI1A 4LSWA 2C7OA 3S1KA 1LGYA 1ZN9A 2ZIUB 2QJKC 1VQ1A 2D1FA 2PX0A 2Y71A 2AEJA 1MB2A 3FKJA 1EC5A 2R6GA 3F4KA 3OPYI 1AKUA 3JQPA 3H5WA 3PV0A 4JJEA 4GMDA 2OORA 4LXYA 3HDTA 4ND3A 4EPXA 4A5OA 3HH8A 4HYTB 5CDFA 2M5AB 1B6SA 2PKRA 4IHJA 5JCOC 5AXDA 1D8AA 6YASA 4JV5B 4Q93A 4CM8A 2PUHA 3W68A 3VZQA 2RKBA 1JLKA 5CVUA 3FNGA 5CH5A 3NBAA 2AWNA 5T5MD 3R20A 1U3GA 4JL6A 4TRJA 1THMA 1NW5A 2BGKA 1Z7BA 3DLPX 4R81A 4FX5A 4Z53A 1CS0A 1M2FA 1ZJZA 2QORA 2FMIA 5JLAA 3FGPA 1M1NB 4HDMB 4NBSA 4ZI7F 1VPVA 5FUMA 4YAWA 4XM0A 2XMZA 3FNEA 3AIOA 3PQ6A 4RJLA 4G0QA 2YZGA 5KLVE 1J23A 4WSOA 1S2DA 4KHXA 3EXG2 3N8KA 3RE1A 1YNOA 2VUMI 3L8MA 5FHQA 3HVUA 1U7TA 2AOUA 3EHDA 5ALYA 3IMEA 5EE1A 4JLAA 2E1PA 4OHCA 3ZHUA 1W35A 2H29A 4LHZA 1OAOA 4HQ0A 1EFPB 4AOKB 3FUWA 1X86B 2R6ZA 4M4SA 1A88A 5FQNA 5HKKD 1OWAA 5BU8B 1D6JA 1NWHA 5LQDA 2GPBA 3CR3C 3FFXA 3HA3A 2PYDA 4JB8A 4TMFA 3SVLA 1ISIA 1UBOS 2KS1B 1E4OA 5CB4B 2B87B 5IVKA 3N86A 4N3NA 2OAGA 5BT8A 2P11A 5DW0A 2MHCA 4BNGA 3KALA 3QBJA 2QZ9A 4FTWA 4EHBA 2BZSA 5C8XA 1EIWA 5LQUA 1D5WA 2Q9CA 4NOLA 3ZGXA 3VU9A 3KLPX 3PLRA 4KLRA 5C4XI 4YCMA 3KPYA 5AVQA 3QX3A 1JA9A 1NQVA 1LK5A 1F2DA 1F38A 4L5JA 5JYBA 2ACKA 3LUDA 4J90A 4DK1A 3BAZA 3CSDA 3EGXA 3UJAA 4P4TA 5JAMA 3GP8A 4R8SA 3K0HA 4E15A 4Z4IA 3H1KD 1H4TA 1U7MA 3BXOA 1OU0A 2NPSB 3LKZA 2VP4A 5MDHA 4RE6A 3VH1A 1N2HA 4YH1A 5FTLA 2QY6A 1AUOA 1DXOA 2FRVA 4OHMA 1I4OA 1KB9E 3DZKA 3L72J 1A71A 1M8GA 3OTQA 3CWBG 3GRUA 3ENVA 3IVGA 3NVKI 4JR0A 4HXGA 2IYSA 1IY9A 3EQ8A 4RF3A 1JTFA 3E2MA 2CKDA 2VEDA 1MRZA 3MCZA 1REQB 1KBZA 4I5IA 1W5FA 3BRCA 4DJGA 1YB4A 3L8ZA 4QASA 3ZDFA 5A4MS 5CYGA 1UJ2A 1Z47A 2HPCA 2P9BA 3L37A 1RAHA 2A0UA 3CB2A 1VI6A 3HUFA 3S29A 3AY3A 3ZBTA 3Q85A 1KQLA 3CMCO 3TR5A 2IT1A 3NGLA 1KQFB 1JZTA 5EIAA 2W00A 3CZ5A 3GGDA 1ZCAA 4LEIA 3DDHA 5CCGD 3GJ4A 2JLWA 1BMFA 2HRRA 4LQ4A 4NFHA 1FS5A 2YCBA 3BTSA 1PJLA 1I6KA 5FIUA 4DBVO 3GIWA 3CLUC 1ZS9A 4KFSA 5T4HA 4YRGA 4L5IA 2CMHA 3BXPA 2EFYA 4PLHA 2EYQA 5J2TA 3MTBA 4G1EB 1FRFS 3C6ZA 3EZ6A 5CLJA 4OXQA 5JSFA 5ALZA 2LE0A 4HUJA 2VBGA 5AW5A 1SAYA 4ZHQA 2ZRCA 3VR2A 3NHLA 4ZV4A 4HC4A 1UAAA 3HJUA 1CW5A 2E75C 3ZS8A 1A9TA 3FQMA 3V6LA 4FNGA 2Z4EA 1FE8A 4E09A 1QM5A 1XU9A 1Y3DE 1OWOA 2BDUA 3IDAA 4YJ3B 3QWBA 4GPZA 1XMVA 1LTBC 3ZX4A 1RQPA 1WMSA 2CVOA 2VIIA 3HOUI 3W6OA 1Y9DA 1E6CA 1ZSNA 1AKNA 2VXOA 3HADA 1U4NA 1ZOOA 4ZRDA 4IXDA 4F06A 2VQ3A 1FMJA 1GZ7A 2VHWA 3ELYA 1KKUA 5IK2A 4AMUA 3AE8C 2OOSA 4JJGA 3ZH2A 2C2OA 3TQSA 3EVDA 1SXIA 3MTDA 2HWUA 1NVOA 5A62A 2AW5A 1FTGA 1H89A 2WKRA 1BN7A 4NRDA 1PWEA 4Q7MB 3ZDDA 1Z35A 2Q27A 3Q15C 4GP6A 4K8RB 4OMFG 4E21A 1G2CA 1XSEA 2QGZA 1IVNA 1E9SA 2GBFA 4UU7A 1YUNA 1NJI1 5CX1A 1MKYA 2PL1A 2F8TA 1AA9A 1E32A 1NIPA 4FT4A 4C22A 1NKSA 2OV8A 2MWMA 1HGXA 1XZHA 4R54A 1OLOA 2ZSKA 1KPHA 3ON5A 3T9FA 3BCCJ 4CN8A 4ISBA 1NHLA 5FL7D 2Q3FA 3OZEA 3ZYZA 4LJRA 1HT0A 2W43A 3CF4A 1KQSY 3X2MA 1JU3A 1Q7GA 3G88A 4WK4B 4X84A 1QG4A 5EHGA 4FMDB 4ZZ2A 4EMBA 3KQHA 5J1TB 4AM8A 1Y7HA 1IN5A 1S5LX 2E74D 5AVUB 3GKQA 2XUOA 1TVKB 3IESA 4KN8A 4NYMR 1L0NJ 3NVMB 4BVEA 1KI4A 3L41A 2FEPA 2YWEA 3BMOB 2AG1A 4WY4D 1VQL1 1QGZA 2BGLA 3X2FA 5A71A 4LXHA 1BE0A 2HXSA 3WMWA 3DE1X 4O2RA 3H99A 4DM7A 4UUNA 2X0NA 1MORA 5SZKB 4FR5A 1O7JA 1ZK1A 4JXJA 1SH7A 3RZOI 4YHBA 2Q7XA 5EKXA 3WL3A 3VR3A 4P0TA 1PFUA 1Q21A 1R37A 4F1WA 2QRUA 3DO6A 3HSYA 1ZVQA 1GYQA 3EZ7A 3QZUA 5C3UA 2LXNA 1Q3TA 2PJUA 4MKIA 1S9DA 1LTJC 1HEYA 3PPYA 1PI3A 1NWCA 5DIZA 3CZ9A 1ZYRD 2LUOA 1U7ZA 5I7FA 4JC8A 1NLYA 2O2SA 1IJEA 3OCJA 4QBFA 1TO6A 4QUBA 1Q7Y2 1BDMA 4HDCA 3PDHA 1N3IA 2YV5A 3PNQA 4MW9A 1JE1A 2QYHA 1HQYE 1IDOA 4J0QA 1FNCA 2DQSA 4Q48A 3VZSA 3VZDA 1HYBA 5FLXf 1DWUA 1QC5A 1TIKA 3P19A 4P3NA 3I28A 1Y1WI 4A1OA 3C3YA 1N92A 1MPTA 3EC7A 3FPEA 4FNOA 4KWCA 4X00A 5AJUA 5TQ0A 3TQOA 1N0WA 3AJ8A 4V24A 2WY2D 2PCJA 3WU2H 3ZDMA 2FR0A 3IQIX 3MJDA 4F3NA 2BGRA 3MJFA 1RE3C 1WLYA 1FX0B 1FDIA 3C5WP 3CH7A 3QV1A 5JEEA 1NN1A 3I4FA 3KEMA 1Y8QA 4CRZA 3O4HA 2XDWA 4BDSA 2I65A 2G1JA 4G1BA 1IY0A 2VK4A 1UCFA 1ZJ4A 3KVVA 3OD1A 3ZEIA 5GZ1A 2D1QA 5A1JA 1L5WA 1D7AA 4B35A 1DC8A 4WVZA 1SXHA 3IV9A 5A03A 1L1EA 2P1ZA 1ZITA 1I7PA 4NBUA 3MC1A 4DNOA 5AHRA 1MKMA 3U1AA 5AMXA 5AOVA 2XXAB 1EZVG 4RPKA 1S3FA 5G4KA 3PLNA 2VPIA 2IBZE 5E1BA 3AHGA 1X74A 3CXHE 2ZYHA 2YYYA 3JZMA 2LCIA 1USPA 4ICIA 4OQXA 5A5GA 4IIEA 4GXRA 1P3JA 1CV2A 3FPSA 3OOSA 2XZOA 1ZX1A 3KJNA 3D9QX 1QTIA 2EFGA 3RYHB 1J39A 4ASVA 1NBMD 1KC1A 3TL6A 4EG6A 2Q41A 3FB4A 2JGFA 2VAWA 4P83A 3TX2A 1DX6A 1N8KA 1JI0A 2FYUD 5COQA 4RGVA 4KBFA 5EHZA 2ODPA 3NKLA 3KQGA 4P3KA 3VC2A 1XNRB 5EUCA 1TWGA 4ZGBA 2P78A 2V8KA 1HDZA 2NZUG 5G53C 5A3QA 3HJNA 2XNDA 2JW5A 1AQTA 2H4YA 3HBJA 3JASA 2BEQD 2DPYA 1NLMA 3IT1A 3D30A 4HR7A 4R6WA 5DF1A 5HFNA 1CLUA 1Q811 1MABA 1U2DA 4FHCA 4PSKA 3TB4A 4E22A 2H89C 3O4FA 6REQB 2XUQA 2V6MA 3QQPA 5I7HA 1WJGA 2JUBA 3IP1A 1FYWA 3QPBA 4W80A 1PQHA 5LUBA 1P31A 5EY5B 3QH4A 4MIEA 3FR7A 3G1TA 4OBEA 2MU1A 3H7IA 1DHRA 1VA5A 3PKZA 3LYLA 3SYKA 5KJ7D 1C1XB 4RENA 5K8JB 5ILOA 1Q11A 3KPEA 3TAXA 5BR1A 2XZLA 3V8MA 4YQFA 4KN9S 1YI2P 1NPDA 4X44A 2P35A 1GL6A 1UXOA 1RSZA 2WIKA 3MMSA 1K7SN 4GC9A 4A3II 4E1AA 2J5QA 3DMYA 3MJTA 3WYBA 1H23A 5JQGF 4FP9A 5KSWB 3GA7A 3R9KA 3B60A 5ES3A 2ODWA 3O75A 1QX3A 4GE3A 5AVZA 4FCCA 2MMGA 3W5DA 2NVUA 1ZICA 4URUR 3WO0A 5I7OA 3IB6A 2CUKA 1IN6A 1F2VA 5FBHA 1S8NA 3NS7A 3Q5GA 1T4GA 5I8ZA 3SICE 3E6AA 3P2KA 2VQEB 1AZLA 1A9SA 1GA6A 1NAHA 1BYIA 2I8CA 2XV5A 1DEXA 2CDCA 1IZ8A 2FZ5A 1HQDA 2H08A 1TK9A 1MB9A 2Z95A 3SCZA 4KPEC 2KYVA 1FUIA 1PWZA 2FMKA 2JIDA 5JCZA 4NBDA 2CT8A 2R8BA 4X7BA 3ZHOA 4Q02A 5CCHC 1F0YA 4ARAA 4DBLE 2BMDA 3RTBA 1AJEA 4TXLA 5CDUA 3C4JA 4NBNA 1ZU4A 2GBLA 1RM5A 3AIKA 4IIHA 5IKEA 3K6SB 3ANYB 3ZHVA 3LIEA 4DR6B 1N1GA 3KXKA 3U16A 2MSKA 4IDDA 3NTOA 2VP0A 4LIPD 4OM8A 4Z2YA 3ZVRA 2I9PA 2VK8A 4ZQCB 1COWD 10MHA 1J8QA 4ZI5A 1PKXA 1GAJA 5AIAA 3E7KA 5I6DA 3VR4A 2X9VA 4DY4A 2GZ1A 4OA8A 2KLUA 5I9NA 1VJDA 4Y6SA 3UFXB 2QF7A 4HUTA 3H1TA 5IMSA 2OXFA 3V3KA 1J56A 2C4HA 1QG2A 1NA5A 3IERA 3NV7A 4Q3EA 4R1PA 4ERXA 4AJLA 4CQMB 2W6OA 2HEIA 4OG2A 5LA6F 1P8JA 3M9BA 1N5IA 2AZDA 3QUTA 3T94A 5DWQA 2UYCA 3K9NA 4DNQA 3ZGZA 2VPWA 3WLNA 4EA9A 2AC4A 4J8PA 4M7WA 4QNNA 5EYPB 3RTGA 1N8RQ 1F3LA 3VV2A 4Q9KA 2RK3A 3E3AA 3JXEA 5KAFE 1UQUA 1QHFA 4ML3A 5A9SA 2WM3A 4Y2JA 2AKAB 1BKDR 1VQ81 1HE1C 1TM1E 3PHLA 1KZ1A 5AVZB 1RMTA 2HO5A 2HU8A 3K0AA 5APXA 3P9KA 4MUEA 3LFHA 4ZJZA 3FJOA 1T2EA 5DE3A 3JSXA 1JFSA 3H25A 4MV6A 3ECAA 3MQ4A 1Z2AA 4IJQA 2Q6IA 3S2GA 1WSAA 4GNKA 1J9EA 4LJ8A 2QAGA 3DQZA 4WECA 5E4FA 1OMOA 2DC1A 2O3UA 4UQOA 3GNTA 4BBRI 3ZJ5A 1T3JA 3K9LA 4Q9LA 2VNAA 4BL5A 4OSPA 2COKA 1EWYA 1XXHA 1VF5C 3B1YA 1UHEA 4H6VA 4L22A 1TU3F 4UHJA 1UBSB 3QMPA 5LWQA 2QTZA 5BT9A 3KYCB 4UXJA 4XUCA 1YL6A 3AE7C 2D2VA 2ZE6A 3ONDA 4XCQA 3TSCA 1I6WA 3OZRA 3ASZA 3MXOA 5J2UB 1G38A 4ARIA 3VNVA 1TCBA 2FCRA 2P75A 4ENGA 5AJYA 4A2PA 3A1CA 1E9AA 5D1OB 3FOCA 1Z0FA 4Z7OB 1L7VC 3RTDA 4OGQD 1MABB 1VHQA 1CQPA 2XYRA 3FA2A 4W6ZA 1E64A 4OJTA 4QC2A 3V6IA 4OYYA 5TGTA 1USVA 5TMPA 2GTHA 1C29B 3CLTD 3DOEA 4J2OA 2RPRA 1YS2X 1XMPA 4PX2A 5KDOA 3G9TA 3GRVA 1MH1A 1JCCA 1WSBA 2HBRA 4GLFA 5CB0A 4ARCA 1SQ0A 3UWMA 1EG2A 4OBWA 3TIIA 3TZCA 3RO7A 3HUSA 1J22A 1F12A 5EEGA 4EJ0A 4Z0TA 3E35A 1ZMXA 1ZD5A 4WZBE 5L4LA 1Z56C 1BW9B 1PTJC 4EECA 1M902 5IN5A 2GBPA 3HB4X 2HF2A 5BN1A 4EEZA 4BQIA 2C9NY 3DVRX 4N54A 3AF3A 3GD5A 3JC22 1E0SA 2P9QA 3LX4A 4F45A 4CETA 5CXUA 1UBNA 3RSGA 2I6FA 1QLWA 1BFKA 1DRKA 4IJKA 1PL6A 1Y33E 4PNHA 1U3CA 1X6VA 2F1OA 3UYKA 3WLKX 3OEHA 4ZO9A 4MVWA 1K4YA 2IX9A 4JBZA 3GTJA 3IJPA 1FFGA 3JZFA 3CNNA 1S0UA 1PIXA 1IFPA 2TMGA 1T8WA 2GESA 5E8RA 5EGSA 2YWDA 2XUIA 1RI2A 3T5MA 5L7TA 4JX8A 1N2CB 4MN4C 1RQXA 4YJFB 3M3YI 1HETA 2Z30A 3T54A 4DVJA 4M1ZA 3N59A 4YCSA 2VDWB 1QHYA 4BJ6A 2M0BA 2JCVA 4TROA 5EMLA 4WPGA 4W7YA 3AEDC 3ANLA 3KLOA 4TYPA 3FTEA 1GNVA 2EYUA 3E7XA 5LWHA 3HCAA 4F3RA 6PFKA 4FGWA 1LTHR 1TEZA 4G5FA 1CUXA 1X7GA 2WPDD 1SN7A 2XNXA 1NU6A 1GRVA 4D9KA 5DYTA 3BPSA 3LT5A 1VC2A 1CZRA 2F1IA 4AB1A 1IM8A 3ASVA 3KYDB 1OVVA 1TGVA 3DD1A 2GJ4A 1SQXD 3GRZA 4M9XA 1E6LA 1Q14A 1TB4A 2MOKA 1RHRA 2W2OA 4OWFA 3EVBA 1JAHA 5JSZB 1NJ8A 2JGLA 3G7NA 3HE4A 1I3LA 1KP9A 1PSDA 3L43A 4FFOA 1WAMA 1QLJA 2VBCA 2Z2JA 3FCSB 4I81A 4RV5A 3RIGA 3ZCVA 1SHZA 5EZYB 2QJFA 4GU5A 1E79A 1OREA 3U40A 3IAS6 2A45I 4YJKA 2NU7B 3T8YA 2AJTA 3JAMA 4IG9A 3FDFA 3X2KA 5E0KB 3S2YA 4B45A 3ORFA 4C06A 3WWPA 3U1VA 1UZMA 2AFHB 1QKIA 1RCTE 2C2HA 2HQOA 4LXQA 3TN7A 1L4KA 6AT1A 3QNMA 1G8JA 5IHPA 4QRIA 4HY3A 1NYQA 3EPKA 3HO1A 4BLVA 2WJ4A 2BFWA 3IBSA 3KXPA 4ID3A 2DF8A 1DG1G 3GZNA 4ZODA 2VRWA 2IIPA 5A3SA 3MSXA 3A28A 4HGPA 3RU2A 1E1NA 1G98A 1KJIA 2OFWA 5AVUA 1OVUA 2OBNA 5AVSB 4QM6A 2I1QA 3X3HA 2KBEA 3AR2A 5IEBA 4J07A 5AM3A 3AL3A 1Z0ZA 2HA7A 1JFVA 2LKMA 4MH4A 2BHNA 2V0CA 4WZBB 2Q7DA 5H9VA 1I9GA 5ADUS 2Y1DA 4MICA 3DDOA 5DCYA 3SC4A 3HBAA 3DEAA 3TW8A 3MINA 2VH1A 4IAOA 4PLFA 4ZTBA 2ERYA 4N48A 2C2MA 4N12A 1FUYB 4ZU6X 1MO3A 2RC5A 2EFCB 2RB5A 3FAZA 3OJFA 3IE2A 4QZVA 3IEPA 5JY6A 1OXTA 2Z2XA 3BGIA 3FMVA 4HFJA 1WV1A 4KWEA 1JIXA 3HJGA 3ZZ1A 2BTQA 3BB3A 2M8RA 4JJFA 4U7JA 2BFDB 1E3LA 1JJ7A 2F62A 2PVSA 3C6YA 4KQFA 4QSHA 5IDQA 5LKRA 3AKZA 4JGBA 4UAJA 2RHRA 2QP4A 4ZDKA 5K8UA 4O4JB 1DXYA 3D5QA 4LKRA 3G79A 1BXZA 1XNJA 3DHVA 4K9QA 4RJIA 3OJOA 2FZVA 2ZSEA 1YS1X 1Z38A 4XM1A 1H85A 1H94A 1T5LA 1UPCA 2FKAA 4L76A 2X4LA 3KTAA 4YJ3A 4F8EA 4TTVA 3WA6A 4M53A 3OW2Z 3ABVC 2IYOA 1P4SA 2PM8A 2V54A 2H5LA 3P26A 4I5GA 3H11B 3KFLA 3A6KA 1SQ5A 1L7NA 2IVFA 2LXBA 3V5BA 2GN9A 3EEQA 2XE6A 3GTKA 3L1IA 1WULS 4MGZR 3QPVA 4F92B 1J1ZA 1SEPA 1XQ6A 1U9IC 4WLOA 1RM3A 2BFEA 2F8MA 2OBXA 1TTQB 2QMYA 2YXNA 4TXJA 3KXLA 5DWVA 4P7KA 2AD5A 3KAKA 3T0FA 1QDNA 4L4ZA 2ZB8A 4D0NA 4KREA 2WJHA 4B3HA 3EPRA 1OILA 3KJEA 3ST7A 3D3EA 2B3DA 4Q4HB 3V5NA 4EH1A 2FE4A 2DKOA 3GEDA 1TGYA 5AHOA 1G291 3CVXA 1AG9A 1BQ3A 3GOQA 4DYDA 2OK7A 2FYTA 2OCKA 5HF6A 1MB0A 1M7LA 3BULA 1G5RA 3AF5A 4YV2A 3N5KA 5ITWA 3P9NA 2PUBA 1S2LA 2CHVA 1BXRA 2RAFA 3LHSA 2JIMA 4WCFC 1G1IA 1QLHA 2QVZX 4BNHA 2E2JI 4M1EA 1DH3A 2VRSA 3L0SA 4KP7A 2Z2ZA 5LZ5A 3RTCA 4XVCA 2X5KO 3VI3B 2V4MA 4KVZA 4P7GA 3CCRZ 4IUDS 3USCS 2PXXA 4JYMA 2XLCA 4B3DA 2XBUA 3AE3C 3GY0A 1FSPA 4TS1A 1V5IA 4IHAA 1U2PA 1GSAA 1Z8HA 5HJ7A 3CTMA 3SJUA 5HKOA 4EYYQ 2RARA 2R86A 1DHTA 1GQQA 3W5AA 5F7OA 1PJ2A 1QH9A 1A69A 1QGKB 3MTGA 3ABZA 4PICA 2I3CA 1N6PA 4AP5A 1G59A 1BKSB 5FFNA 4CWAA 3OHPA 3G0IA 5LYJA 1OC2A 2FR8C 5LBIA 1T6NA 4RA6B 4EI8A 3NCTA 5A2Qf 3HVHA 3PP8A 4YRZA 3MCTA 3EFHA 1D09A 3AM1A 4G81A 1XD2B 1FYDA 2VYQA 4LSMA 4QG7A 3ZS9A 1BE3D 3M5PA 5GINE 2VUSA 3BD8A 3A6PC 3OSZA 3D4BA 1Z5UA 1L9KA 2R48A 5MHTA 4RJTA 3N0VA 2GBGA 4DLWA 3BWYA 4V0OA 2CW5A 5CJJA 1TD1A 2ZGVA 4BU0A 3DOIA 2IE0A 3MCUA 5JSHA 1ZK2A 3A0BE 1TC2A 1R8XA 4CF4A 4BNFA 4HOYA 3RC7A 2RCNA 4X8HA 3U5ZB 1PJRA 2Z43A 2ONKA 5IP9I 3JATA 2N1TC 3A6ZA 2IUYA 1Y47A 2ENUA 4KGZA 3PNPA 4HQKA 3I42A 4JLUA 4D3YA 2JASA 1P80A 2AG8A 2BM9A 3EG9B 3ZHCA 2F90A 3W3AD 1YVDA 2R6FA 2UV8A 4FNAA 2E4XA 1U81A 2HWWA 2W6NA 4D4IA 1ZBQA 3L7CA 4JJ7A 3OKCA 2JHAA 3R0JA 1TVMA 2QWXA 3ULKA 2E43A 2Z04A 1JEDA 1QGUB 1RI1A 2I4OA 4G1VA 4AQRD 4ITVA 1NHWA 3USZA 4CI0B 1HX7A 1MEEA 4U7PB 3ANXA 1Z6PA 3SK0A 4FFVA 2X76A 3K8QA 3EBPA 4NU8X 3SKXA 4B80A 2LD4A 1UBJS 1KILB 2HJ9A 3GLTA 3GRRA 1BIFA 5AHWA 3OP4A 3O8ZA 1XT6A 2CDNA 2EBUA 2I2CA 2IGTA 3R40A 3HD7B 2O1EA 2HHJA 4Y2PA 4LBVA 3VZPA 1G20B 2OHFA 3CC7Z 1JQEA 3CRVA 1JEYB 4OFXA 2A9RA 1HD5A 3U4MA 3CH6A 4OTZA 2JVIA 1SZCA 2QSIA 1GUYA 5FOTA 2JJ1D 2A06E 1J0XO 1FDMA 2QJWA 3AEZA 4C7MA 4AG3A 1GT91 2VP5A 3V32A 2V0GA 2UZAA 2ZR8A 4E94A 3B71A 2FJUA 4D3SA 5HJ5A 3ZDQA 3T3DA 1SFCA 3PPVA 5IAAA 4AZVA 1XZMA 3UATA 1U7PA 4DLZA 4EHHA 5ABPA 2Q5HA 1AIPA 1JJAA 2BWJA 4M1KA 1SUAA 1S1CX 4GKBA 4C2UA 1R5JA 3EVNA 1PVDA 5KNBH 1PJZA 2KHZA 1XQYA 1SEVA 2IOYA 4EPVA 1TQ6A 2YR0A 1ATZA 1MFZA 3PNMA 8AT1A 3DEFA 2QW8A 5ARBA 3IMFA 2H7VA 4LOIA 2V9PA 3CWBD 3E9QA 1PDVA 2JA6A 3ICPA 3PS9A 1C4XA 4L85A 1CRQA 1UMCB 2KNCA 4OYHA 2MR5A 3NM5A 1L9XA 3WUVA 1DVRA 2XYHA 3EJWA 3BSFA 4ZOEA 3IXQA 2VCYA 2YJTD 4V0MA 2JLUA 1SBIA 4AU1A 5JH7A 3T1TA 4HKZH 3FNFA 2JFQA 1JWBB 2W2XA 1VCIA 3S44A 4DGQA 4U6SA 1H66A 1M1JA 4PR3A 5CFZA 2Q0SA 3FNBA 1RC1A 3HR8A 1TCUA 2ZRBA 3H2BA 4S1VA 1KQGB 4UMDA 4R2IA 4DQUA 1K8A2 4L8WB 2FPXA 4PQFA 4R4MA 4RPHA 1DKQA 2D13A 3M2PA 1QIKA 2V6FA 3RGGA 1G4UR 3CCSZ 4RJJA 1RXVA 1X0XA 3KDAA 1FRQA 2BH2A 4QBTA 4EG8A 2H9YA 1KEEB 2FJPA 4GRDA 4LDJA 4D2IA 4G26A 1IPFA 2G5TA 9GPBA 1BDDA 2PKCA 4YXWD 3QVGA 5K4AA 5ULLA 2I91A 1MT0A 5B12A 4CM3A 1J2JA 3ZDXB 1QKKA 2N1TB 3VPGA 5BOSB 4TL9A 1R64A 5C3MA 3WLHA 4YC7A 2G88A 2AR9A 3M9XA 4TVKA 1YV9A 4F5WA 3QFCA 3Q87A 3UWPA 5F98A 1A72A 4A8JB 3L73G 3KWFA 3EVGA 1D1SA 2IYYA 3M9LA 2LKCA 3F9RA 1IY1A 1BJTA 1ZKMA 4NPFX 3N8NA 1O5IA 1JSZA 3ITKA 2PUDA 1M1K1 5EJEA 2O8DB 5TT1A 3BFKA 4KSBA 5D2CA 1PG0A 4GX0A 4ZARA 5AW9B 1F4PA 2ZT5A 3SAJA 1L4HA 3K53A 1JKIA 3AERA 2PIAA 3H6PA 1IZNB 1BXGA 3KM0A 3MJHA 2G08A 2HLOA 2JFBA 1BVHA 2JVKA 2OZPA 1KYYA 3ANNA 2Q9IA 3EIOA 5E1OA 1IUNA 5EMKA 5J3JA 5JO9A 3SYTA 3ZWAA 1Z16A 3W2IA 2E5WA 3PFHA 4EG4A 3IAAA 4LJ4A 2Q5IA 2XCSB 3BUSA 3G2OA 1GNTA 3WL6A 3JQAA 1LWOA 1Q0LA 1Q7Y1 2AVDA 4HB3A 1QVGZ 1EX7A 4A0FA 4WWHA 5B6CA 2G07A 3ELBA 1K04A 3JWJA 2AFIA 3EB9A 4YMSA 1M7GA 1ESMA 4EQ6A 4DCPA 4W5OA 4MQUA 4K9SA 2FEWB 3RYIB 3SHVA 4MLDA 2E7ZA 3VU0A 1MO4A 4D9MA 4O4LF 2Y9PB 1CQWA 2GOYA 2MT9A 4I1VA 4MD9A 3IPXA 3PEUA 2J3HA 1R50A 4V2UA 1SUPA 1Y34E 2WTMA 3KJQA 3WV4A 3LY9A 4J94A 1ZRHA 4TWIA 4KPGA 4OGLA 2OLJA 3PCXA 4M98A 3MJEA 2R5FA 2YY5A 4EBBA 1M0TA 3V2RA 2CCJA 3INRA 3IQDB 3WTCA 4X1YA 1OXXK 3ZOZA 1DJQA 4B6RA 3FX2A 5BMVA 1P4HA 2R3CA 1DQPA 2C94A 3K0CC 5FLEX 4CYMA 3Q0TA 2ZJAA 1AUQA 5KYNA 4X6LA 4OLAA 2HC9A 2QOEA 1E3IA 1SQQE 5FUBA 1H88A 4RZXA 3IRUA 4CIVA 1PWYE 3C4QA 3L04A 2BSAA 2DHQA 3VHQA 2E75B 1VJTA 3AR6A 3KSAC 3LA6A 1R74A 4XE5A 4CLDA 2I1WA 3SHTA 5ELXA 1IRIA 4W1PA 4D8UA 1K9MQ 1CJMA 1UUFA 1J70A 1H3NA 3W6ZA 3V2QA 3TAHA 1L0LJ 2YIUB 3FSGD 1XD2A 1OFGA 3QTBA 3BRWA 1KSFX 3SLKA 4RD4A 5DGIA 2J6CA 1NJI2 5IXYA 1XJ5A 3I56Z 1Y5LA 3AJ9A 3CX8A 3F73A 3UM9A 1XEXA 4LTNA 2B37A 2RAUA 4MYSA 4Z1MA 3SI7A 2I33A 4KQWA 2HFJA 4ZK6A 3G7SA 1I4EB 3PIRA 3TSYA 4CCAA 3T3NA 3PDCA 4KR9A 1ZMTA 1E60A 3IJ5A 1N6HA 1T25A 3GA5A 4QG3A 4AI6A 4MS3A 1LVGA 4K86A 4UUQA 2PKWA 4GDOA 4M0UA 1KJWA 3E3NA 3OQ6A 1SS1A 4BMPB 4M0LA 1RPAA 2WG1A 3HOXI 3DP9A 2VWQA 5C8ZA 3WDLA 3K9BA 1B93A 1AK2A 2O4CA 1ZG3A 1SJ9A 4G4SO 3CCEZ 4F4DA 5JOQA 2LTAA 3IEIA 3BWDD 3QV2A 2ZIAA 3DAPA 4Q21A 2HNAA 1R6XA 5H59A 2EGGA 4L5AA 1ULTA 3E27A 2DX7A 4OKIA 4DDHA 1RXIA 1SK8A 1NAIA 1EDDA 2OO5C 3A7DA 4L3WA 1ADBA 3R4CA 2VZLA 2FKWB 1GGVA 3Q5DA 3O8BA 3ZTYA 4YRAA 1KO8A 3P2YA 4QPNA 2P4HX 4M1TA 1YUAA 2H4JA 1KNXA 3P71T 1N0UA 4JB0A 5E95A 4EY3A 4Q01A 1NYHA 1OGIA 1K8A1 2EAUA 3GUYA 2NV0A 4AZSA 5MFZA 1FU4A 1N77A 5CDYA 4KN6A 1L7DA 5TLSA 3AEFC 3PFKA 2P67A 5DM1A 4EF5A 1QRSA 1I7NA 2OORC 1Y82A 1MN6A 2PJJA 3RUCA 1HTWA 1QJ4A 1STOA 2J32A 2QVBA 4OM7A 4V0SA 4F72A 3LH5A 4RVFA 1NJ5A 2IQ5A 3T35A 5MFPA 3QFTA 3OUGA 4NNPA 4QLAA 3BXXA 4XDZA 5B53A 2BGGA 4HDNA 3QLJA 1KEUA 4ZVOA 2K9JB 1NHGA 5BQ5A 5FADA 4OBXA 1KFEB 4J03A 4QIWA 4L78A 1UANA 3TG2A 4O6VA 2D5LA 3LGSA 2C03A 1IEXA 2NWQA 2GJKA 5FRDA 3UENA 2ALJA 4XCVA 3UW3A 2IXDA 3TE5B 3IAS1 5JNTA 2F3TA 2YN2A 3C97A 3KQSA 1BDJA 1JEAA 2FMXA 4X3OA 1VBKA 2BFDA 1X1BA 4UJ3A 2BTQB 3JRWA 3QKWA 3FFWA 3B5JA 1MH9A 1U3UA 2ZXEB 4XWAA 2C5FA 4BZWA 4CRYG 5TEVA 3QH9A 3VTAA 1DEHA 5KDLA 2FXIA 2BCEA 2WTEA 3KUCA 1WE2A 1WKCA 2AMYA 2XUDA 1AS0A 3CPEA 3ZU5A 4OKNA 1I1HA 4IX1A 4V03A 1H8ED 5IJXA 3TW8B 4CLHA 3DKKA 1XTBA 4LF8B 1JHZA 1FJHA 1Q0PA 1UDBA 1EVLA 1JR3A 1XVTA 4IKPA 2ZWVA 4WZBA 5CIYA 3CX5D 5JAZA 3UAYA 5KVVA 4ZKEA 1D2NA 4WOPA 2I80A 4PLTA 2UZ4A 4GOEA 4NOZA 5KLVD 5JQGB 3RRBA 3LPAA 2B88A 1PJTA 3DDZX 1GPAA 1NP3A 2PRJA 4ZVPA 3L6DA 1CFZA 1TCCA 2XGGA 3IB3A 4HH0A 3W77A 2WU0A 4HJRA 2CLKB 1AKWA 1H0HA 1V45E 4LRYA 2JF0A 1Q1ZA 2PZKA 4DUGA 4YMUA 2NUPA 1Y3IA 5F51A 4A3CI 1N8SA 3ZXSA 4EKDA 3QHPA 4KNVA 4DIEA 1UFKA 4QDJA 1SVOA 2J9FB 2C78A 4PE5B 1G8AA 4PPNA 5JS6A 3CCLP 1UIRA 2FN8A 2NPFA 3K70B 3K72B 1KI6B 3H04A 3UHJA 4E07A 3ROQA 1EWTA 2WJIA 5HUHA 2B21A 2GN8A 4JA2A 4KQIA 1ML8A 1A82A 4TKUA 2PUTA 2HCZX 5FR2A 1KY3A 3IAUA 4C6HA 1GG9A 1J5EB 1QF6A 2CVPA 4JH0A 3HRNA 1HK7A 1JHVA 1ARZA 2Y0EA 1I4DD 3RC1A 4MW1A 5ES4B 5SYMA 1NVWQ 1KE2A 2E0IA 1TD9A 2WDZA 4MUAA 1CP3A 3Q2YA 1L6IA 3KOYA 3GMIA 2R2AA 1YFZA 2WUVA 2XEXA 3TFWA 3KZOA 1BCCJ 1PFYA 2O2DA 4N3GA 3PBKA 4QYSA 4RE5A 4W7IA 3T5BA 4IIJA 4F9TA 5KTTA 3LG2A 3P0IA 1N78A 3EEDA 3JQDA 2VTKA 4C21A 3R4YA 2C5SA 4LHWA 3RS4A 1B0UA 3V4ZA 4YYEA 4W1QA 4UBJA 5F3DA 3SDZA 2WINI 4NCHA 2ZTVA 2G40A 3WKEA 2W42A 1WDKA 1ZH4A 3GLFA 4Q7LA 2FWAA 1DELA 4DJFC 4IH1A 1SHJA 2YO3A 2QX9A 3FTNA 5AR1A 2WR8A 1L0LE 2XWPA 2IITA 2QIOA 2ZKLA 5CW2A 4DY6A 3A58B 4JBWA 2QRGA 4Q3BA 3HKEB 1NUUA 3DTVD 4NZMA 1GL2C 2WSEJ 3JQAD 3UEOA 3O8DA 2NTJA 5AVVB 2PY6A 2WKWA 1QMPA 4XSHA 3ZWDA 2FSHA 1ANKA 3CY6A 4FYKA 4O59O 5F21A 4HF7A 4X92A 4M6WA 4N0MA 2RGAA 1H2EA 5B3JC 4P4GA 4DLRA 1IPEA 2JA2A 5HCIA 1R9MA 3H2JA 4P2GA 3RNOA 3ZWBA 4CDGA 4ZEXA 1RE4C 3ESDA 2KQAA 4J0IA 3AETB 4MS1A 3CWBJ 4H1WA 1I2BA 4RTLA 5KNDH 1T2UA 4FZ3A 2VSFA 1V5GA 2XUPA 3IBYA 2GZRA 3M06A 1Y81A 3SQXA 5IP7I 3A1VA 4C14A 2QI9C 4P9NA 1Z7EA 4FEGA 4GM4A 5AKZA 3RLIA 5DCWA 4ZT6A 1DO2A 1JKFA 1GTJ1 1TE2A 2JCGA 2QENA 2XOEA 3EJ6A 1M6NA 4KPUB 3NHSA 1GXSB 1KYIA 2R7KA 3AVOA 2AV6A 1F51E 1XP8A 3LWBA 4FFWA 4XAQA 2BEWA 1JIVA 1K7EB 2KE5A 4XSGA 2JCSA 4ZCQA 3DBLB 3OZFA 4PTYA 1NTZK 3K1JA 4BLQA 1ZB8A 2W2MA 3A37A 3A3NA 3FFAA 3GCWA 3M9HA 3TDMA 3GGCA 4L75A 2J45A 4B71A 4KMMA 3OHMA 1C4OA 2J58A 1W2GA 3QLEA 4DLTA 1VPDA 3LKVA 4QA9A 2GARA 1EBFA 1XZFA 4DQLA 4EIJA 2G9VA 3R5TA 4C5BA 1U5BB 2YWXA 2J4FA 3ROZA 4B40A 3BE4A 3QWOC 1VE6A 3ENWA 4K88A 5CBOA 2BGJA 2VDLB 3F4LA 4BV8A 5FAKA 2ZI5A 4N5LA 1C1YA 3QUAA 3U9TA 4DIUA 4MUBA 3W8FA 4JQOA 2A9QA 2B69A 3A7EA 3F97A 4GMGA 3RK2B 3D43A 4BMYA 3VNBA 2QJYB 5HJ2A 2GHTA 3T1HB 1VQ8P 5H3HA 3GFGA 3J80b 1T9GS 4H3VA 4FHEA 3JYHA 4UDYX 2WSFH 3CM0A 4DTIA 1CQIB 7ADHA 4XFDA 2VDRB 1PX0A 2ZATA 5D3MB 4XWKA 1T1IA 1VGQA 3ZZMA 2C7QA 2E76C 1ZGGA 3FPAA 1M76A 3IR5A 1V7PC 1V3VA 1MD9A 4N5MA 4S04A 1QIEA 4PF1A 2WSEH 3GUUA 5EYPA 3T1VA 4BKUA 1GD2E 4BZPA 1UPBA 3NETA 4YAFA 2XB9A 4OQNA 1JDVA 1J0BA 1K7XB 2IYTA 1WKVA 1MTZA 4YGXB 3T97B 1T6AA 5IBPA 4J1TA 2JHPA 2UZ3A 1W76A 5FLXA 2AF3C 3LQYA 4GMXA 4H7JA 4U39A 4CW7A 3STUA 1FVFA 3RUDA 3UFXA 4DMKA 1AM4D 2E85A 3TKYA 4A3EI 1YQXA 4PV1D 2XNHA 2PGAA 3KYBA 3QUQA 5DXFA 2AFIE 1HE5A 3FOWA 3V4VB 4F4UA 5A3RA 3SEFA 4YLEA 1X0VA 2W2NA 3EZGA 3L01A 1O97C 2JIBA 2OL4A 1KETA 3DXZA 4MO2A 1DG9A 5JMPA 4KXMA 3COZA 2VH5R 4PZZA 3QXGA 4Q3KA 3OCXA 8GPBA 1LEHA 1M34A 2FPOA 1T43A 1UJNA 2YNMD 3PKIA 3LDAA 3B5EA 4L2IA 3CHYA 3C3BA 2YWHA 3JZIA 4QPZA 3ROGA 4AJJA 1QTQA 5CFQA 3V4PB 1IOWA 2IPAB 3H2GA 2FPWA 3C3JA 3V7UA 1BS1A 2F8SA 3D7RA 1SBQA 2G5GX 4AC9A 2ANCA 1Q83A 3IODA 3K1AA 3ND7A 4MW7A 4TQAA 3U4HA 3AH8A 5IZCC 4L48A 3ZK7A 1W0KA 4AXBA 4G09A 2NVUB 4E5KA 1MAAA 2ZRLA 3EMVA 2CB0A 1NU1D 1M2OA 5LLTA 1QVWA 1EDKA 3H5NA 4AX8A 1F9AA 5GM9A 2AI1A 3KR9A 2C88A 3P9IA 1CF9A 1AB5A 5LQKA 2ZUEA 2JJLA 1MEOA 2ZBGA 3BDIA 2RHHA 3ELDA 2AMJA 3LL7A 2QP3A 1IUOA 2FZGA 1RRPA 2GJ8A 2GZSA 3C16C 1PGNA 2QV0A 3C3MA 3UV6A 3MLAA 5J40A 1EP3B 2WAXA 2WWRA 1BW4A 1XFDA 2VJKA 3RASA 4C4XA 5KU7A 3L46A 3RU7A 5K5GB 3JZDA 3R8XA 1CZKA 1VJ0A 1KRWA 2I2BA 1FZEA 1GAXA 1BXKA 2C0PA 2X8JB 3B8HA 2NSJA 3ID6C 4XGNA 2PGOA 4MNTA 5BYKA 3OSUA 3QTLA 2JNYA 3JD1A 3ZW9A 1E63A 3BG1B 1E6MA 1OTHA 4LRUA 4ZZIA 5GIOE 2VUHB 3TBHA 1TYEB 4GWLA 4BTVA 4YQEA 4KGVA 3MQFA 1VE7A 1ORWA 2NTYC 2WWGA 5BW8A 3IMKA 3LDUA 4FILA 5BOVA 3S1AA 1D2HA 2O2ZA 4IILA 2ZI4A 2NV2B 1MBZA 4MRAA 1W7AA 5EN4A 4PYLA 2BFBA 1QYXA 2ZANA 3LT4A 2FYUG 3M6FA 4BXOB 1L5YA 2W5UA 1E99A 1P19A 4I66A 3WBKA 4DEYA 2EQAA 1Q2XA 2W6IA 2WC1A 3G23A 5KQLA 1PEDA 3L0CA 4Q9IA 1PL8A 4XARA 3V4RA 2XRZA 3DL0A 3G4S1 3G2MA 2DW3A 3GEPA 4E88A 2C2GA 2H88C 1N75A 3P9XA 2O2YA 5FWXB 2ASEA 2QLTA 4EBFA 2W93A 2ZG6A 4OXYA 5CHYA 4UMVA 3FJYA 3WYNA 16PKA 3PTZA 2Z98A 3T95A 4W5WA 4M36A 2HSJA 1I3QI 3IJEB 1USPB 2C2WA 4FKZA 4BO2A 5DM70 3ERCA 2ON6A 2WPVB 4HGZA 5TX7A 5AW2B 3MHVA 2ZB7A 3CX5H 5LR6A 1GUZA 2OAQ1 3GH1A 3QVMA 3OZDA 3B3AA 1VQOP 4ZCPA 2ENWA 4RH1A 3X2NA 4UFNA 5CA0B 1VL0A 1L3BA 2BFFA 3L77A 4INZA 4QRDA 3WKBA 3ZY4A 4GXTA 3R3JA 2FSUA 4HZUB 4MVJE 3AR5A 3CPWY 3KSZO 4MAFA 3FPLA 4FSXA 1L5OA 4JLWA 2XB8A 1I0ZA 1CZLA 1W1IA 2X86A 1NASA 2XCLA 3JQEA 3UJPA 3TXAA 3KOMA 3WFZA 2D1RA 2HJRA 1E58A 1N8R1 1EXWA 1ZLLA 2W6JD 2ZVQX 2O3RA 3EPPA 4ZO6A 4K8OA 4UEWA 4N7JA 4KGXA 4OHZA 3W5SA 1V5FA 4GGOA 1UP7A 2BF7A 4KYTA 4OQZA 3HKZA 2PX8A 3NC1C 4MIKA 2L82A 5DOVA 1SQQJ 3D81A 2P2DA 4DG9A 2NSDA 1N6OA 1JCDA 4IO1A 4M0DA 1PDOA 3TCXB 3GMAA 4JP2A 1LZLA 1RHKA 1U1CA 4UM7A 3U3KA 5IBRA 2QNBA 1CUAA 3O6VA 4WESB 4D4LA 4F4IA 1IHUA 3MFQA 1J5XA 1XL0A 5DGCA 4J0JA 3X1JA 4ACAA 1FNNA 3NAQA 4CIAA 5AW6A 1EUYA 2P8SA 4F7WA 1RE3A 3FYCA 3R77A 4Y6OA 4L72A 1GTL1 5A4JA 3JCZA 2G8NA 1DFGA 1M8OB 1S2IA 3VSCA 1YNND 1WLSA 2IUSA 4BNLA 4L5YA 2C8KA 1IRXA 2PZFA 1M0WA 4PFSA 5AJZA 5HQ3B 4NDNE 1PW5A 5ALLA 3L75E 3P9QA 4YEDA 1EHIA 3L73E 3X2PA 1IFXA 1C80A 1O2DA 3D4IA 1BROA 2FPSA 4MR9B 5ED0A 4DJJA 5AKJA 1WXHA 3LVRE 2J85A 3OE5A 4NX2A 5TISH 2VDJA 4RETA 1LTJB 2ZROA 4GEKA 4U63A 4UCQA 4EI7A 4EMSA 2OGWA 2PANA 4Y1EA 3L6BA 4OI1A 1V1MB 1MQ9A 2DLDA 5CLLA 3IKMB 4FMCB 3A3YA 4MCIA 3LUHA 4MXUA 1HRDA 4DCTA 3H1IJ 1QO7A 4QLOA 2QJKB 2C97A 3V9PA 2Z0MA 3PGMA 4F7DA 2OEPA 5JY1A 4YVFA 3GG2A 4KRFA 3RBXA 3LV8A 3FG9A 4IDHA 3TSIA 4U2EA 1B3RA 1YR2A 2ZU6A 4DRXB 2BP7A 4DDUA 3BMNB 2B5WA 4ZDJA 4AONB 1VCHA 2PR2A 1FK8A 1XCGB 1FZCB 1L5ZA 2H54A 2W2PA 1XLUA 1U6IA 1GQFA 3QVUA 4HGQA 2QNIA 4MDYA 4CKEA 4EHDA 5HM6A 4E5PA 2QGNA 3HRKA 4L8VA 5CEJA 4Q4AA 3RIXA 3I09A 1L2PA 3SHOA 2H3EA 4P3YA 5BWCA 4J3JA 2PYZA 3IKJA 1C30B 3UXYA 1VYUA 3AV3A 2B30A 3B7WA 3CL3D 4K2AA 1TU3A 1FP1D 2KP8A 1LQLA 1RF1C 3COYA 4I9FA 3SEQA 3ZBUA 1U94A 1TFRA 1E79D 1GKUB 1XHEA 2X5JO 4EL0A 3PVSA 4YPFA 4DSNA 4CIXA 3Q8MA 5AW1B 2D8MA 2IYNA 3UW1A 3R5KA 5CA1B 3HD7D 2R1VB 5CT9A 3ICVA 4TTJA 2EEZA 1CR6A 3NIDB 4R98A 5IWAB 1Z03A 4M0MA 1KRXA 1BWPA 1SVKA 4QYWA 4NFSA 3VJLA 2V4ZA 1NATA 4P1ZA 4Y9UA 3BD7A 4BLWA 1H9AA 1Z4IA 1SELA 5KX5B 2F3RA 4FB4A 3DMTC 1YDEA 4AJOA 2XUAA 3L07A 3ZVMA 5F76A 2HZ7A 4ZO4A 1UOPA 5JSQA 5L51A 3BCSA 3D54D 3IX7A 4OA5A 1HJBA 4DA9A 1FPQA 3O8OB 1W8IA 1WDWB 1LD3A 4LX0A 2C9MA 1L7OA 3MAAC 3V34A 2QK4A 4CFYA 3NHBA 5JZBA 4N18A 2H8GA 5JXIA 4Z9YA 4LNAA 3OPXA 5EZQA 3EXHA 3EFOA 1NDQA 4LOHA 1H1LB 1VYVA 4MX8A 4FR0A 2XT0A 1LNQA 2F1RA 2ID7A 2Z1NA 1D0VA 3OO1A 4JOCA 1S1MA 1SQPG 3H1HD 4JIMA 3PD7A 4MRVA 5FOSA 4CIWA 3LOUA 2J3LA 3B51X 3K32A 4I9HA 3SBOA 1RLMA 3DCNA 1F6WA 1XZAA 1FDTA 1JFLA 3EXEB 3FZEA 4IOMA 1SMKA 3N2IA 2PJHB 1Z4PX 3R0QA 1XRPA 3J7TA 3RB8A 4XB1A 1NT2A 1ZMRA 1C3XA 3DGFC 3QFFA 5EPPA 3OQ1A 4XDYA 5L95A 1QK3A 4N40A 1ZGAA 3Q9LA 5EKUA 3C6MA 3OQHA 1TDJA 2NYRA 4Q1VA 4Q4CA 4H9GA 3AJAA 1EJBA 2Q4TA 3WL8A 1NZFA 2K87A 4HXFB 4WUTA 1NULA 3WMXA 4DLLA 5C80A 3LMKA 2C04A 3HL4A 3QQ5A 4HB2A 4Q7EA 3U61B 2P6RA 3EIUA 1VE9A 1DIOB 1W5CE 1SU7A 2RG7A 4MK4A 4N1AA 4QHSA 4NG4A 2FR1A 1ZRNA 4LJ6A 2OSVA 3EF1A 4MVJD 3TDNA 2OC4A 4PGGA 3VU9B 1SC1A 1G4AE 2D4AA 2RHBA 1ADCA 2F1KA 2O2XA 3H18A 3M49A 3OT4A 5CNIA 4XJXA 1CJBA 4EGQA 2ZM5A 1TMOA 2IYVA 2PJDA 3K0SA 3A4TA 2OYIB 2ESRA 3LBYA 4MKXA 4XGRA 1N4AA 3HPRA 4EGCB 1RH5B 5JNVA 4Z3OA 4EZIA 4UNQA 2Z8XA 2FX3A 2HCJB 1IW7D 3H3JA 1U28A 3DZIA 4JYPA 1EFPA 1FU8A 2Z2KA 2AYDA 2ZAMA 4OAQA 3O4RA 3SZUA 2JHGA 3OKFA 2H16A 5UKDA 3HACA 2PUCA 3CC2P 1N9GA 1XALA 1TPYA 4QXAA 1ZM7A 3S8YA 4XQ9A 1IBSA 1M1UA 5LDDC 3L71G 2OUIA 3U19A 5IM4A 3C3DA 1EUZA 4RVOA 5AK6A 1KK1A 5KMGA 3C5CA 3DOFA 1ECFA 2OQ2A 1Z36A 1BGYG 2NNLD 4UULA 1M6YA 2G63A 2E2II 3T15A 3TTWA 4L9WA 3QELB 3RC8A 5EGNA 4N5NA 1T9BA 4R2WA 5B6PA 3C1AA 2ZYAA 4G5XA 3ADKA 2RT9A 1BH6A 1PR2A 2CJFA 5CEFA 4CG2A 1F1JA 2C98A 4OJKA 4ZVRA 4JUDX 1QYRA 3AFMA 3MMNA 4H31A 3IQXA 4B3BA 4ZYZA 2RGDA 3L72D 3O9ZA 4CT0A 4D9BA 3LFUA 5EZSA 5ETJA 5FNVF 3KTFA 1Z75A 2REOA 1QANA 5FUXA 2P4UA 1H69A 3IQZA 4BJ3A 4DMFA 1JR4A 2XHZA 2WVJA 3UT0A 5HZKA 5J23A 5JYEA 1DBRA 2OK8A 2WM2A 2XA1A 2GD0A 3T3HA 2W4IA 2NXJA 3R6WA 4M8NE 3C3PA 4PAWA 3KQMA 4ENVA 3VMYA 1CVLA 1O9BA 2BV3A 4P5EA 1SLQA 2ZYTX 3CEPB 1YTZT 1XB2A 3Q1KA 1DOAA 2H1IA 2AT1A 2CDBA 5I9SA 4HNGA 4HPJB 1DBSA 1RJ9B 2R62A 1RAEA 4FXPA 4IIVA 5ICEA 5BR4A 1S3SA 3IP8A 3AR8A 4C7NB 1CEQA 3GLIA 3ORYA 1RAAA 1TZBA 3WLIA 1V9SA 3WQHA 1Y5NA 4KXWA 2JK1A 1GPMA 4JVNA 2GERA 3FOBA 1QFZA 4GQAA 2NPSD 2OTCA 1MC1A 4WZ6A 1G1MA 1XAIA 4XX1A 4MI9A 1EFLA 1DFHA 1URPA 3NEPX 4D98A 4M0KA 2BDEA 1YGPA 3AR4A 2JGJA 1J21A 1VSTA 2A9JA 2P30A 2QQEA 3PA8A 4LJAA 3EVEA 1T2AA 4IOIH 3I01A 4ROTA 1VLHA 1VCOA 1KO7A 1O89A 3PICA 4DLAA 2XAAA 5JS8A 4B46A 4QICA 3L1VA 4LKOA 3N76A 1BFUA 3N75A 3JAMf 5ICGA 3KQUA 2PMBA 5JAOA 3HYSA 5KOIA 1DTWB 1XPRA 4O3FA 3BG0B 4PV1C 2NUAB 4JI1B 1A5AB 2P40A 2F43A 1DT3A 2R84A 1JDTA 1X87A 3SKVA 4B3TB 4WXEA 2G9QA 4RSMA 3LUCA 4IWXA 1ZSYA 3SXUA 3EVFA 5FBKA 1LQ2A 1OLXA 5JARA 3CCVP 1OW3B 1P74A 1WVGA 4IPTA 2V8OA 3VTPC 1FFAA 4ZVUA 4BV9A 1SQBK 3WA7A 1WL8A 3MEQA 2VNSA 3WGKA 3QVKA 3W8EA 4WWIA 4UNPA 2XQGA 2HHLA 1IK9A 4JOQA 2G9ZA 2X1HA 4WACA 3C39A 2EEPA 1QIFA 1OI4A 3VP9A 3VMAA 3GJTA 1JHOA 3JSAA 3DLAA 3B53X 3QFHA 3KPWA 3L6CA 1HGZA 2B7LA 2X15A 1GRRA 2KW5A 1GAWA 2O0HA 4P8RA 1C9MA 2WWXA 4XD7D 3VVLA 3Q3DA 2H7HA 1VPEA 2I6TA 1BE3G 2W9XA 2X1LA 3T1OA 4G0VA 1DC3A 2MSLA 1W0JD 2BPOA 1Z2DA 7AT1A 5CYOA 3R3XA 3PDIB 3P45A 3IEMA 3LX8A 3MTEA 3WY9A 3CNLA 3CNQS 3R0VA 3N5CA 4L95C 1FFEA 3HFRA 3CRZA 4JLOA 2QJYC 3LDFA 4L0DA 3AVUA 3AVYA 1BC5A 1V7QA 2QR3A 4JP3A 3B7PA 5AVYA 4G0NA 1MJGA 1XTUA 2H7CA 2ZTUA 1N2CE 5FYDA 5HGXA 1DC7A 1LLFA 2H2IA 2VJQA 3A1UA 4PGFA 4WK6A 1XK6A 5JS1A 1EEXB 1TK2A 2PKQP 4KI0A 4O29A 4RTSA 1CIPA 3VB9A 1D03A 4NPEA 1MJFA 5KYGA 2MYUA 2W2VA 2I8DA 1WMBA 2PZLA 1YULA 3DZJA 4JJ6A 3SNHA 3D6FA 5T8KC 4KUEA 1HL3A 1Q12A 3HR7A 3O1HB 3KUDA 2R93I 4PN3A 2O01N 4G01B 2CJYA 3F6PA 2GPAA 4X63A 1T5DX 5EWMA 4JI3B 5DBOA 3QVOA 1FXWF 4X6AI 1CJCA 5AW7B 1EDZA 4V2IA 4YAOA 2R6MA 3WGNA 1PR1A 3NCHA 2HIGA 1K98A 2XODA 3Q6IA 4IEFB 3HCDA 5DEOA 1DLIA 1J97A 1M1YA 2F8LA 4BFWA 3C6KA 3KE9A 2I7CA 5FTKA 2AI3A 2RBEA 3QMMA 3EEIA 1ULAA 3WS7A 5JVDB 4OYRA 3QWFA 1L5HA 4BAUA 4FW9A 4JVMA 4RZ2A 4NZZA 4RELA 4HVAA 5M2QA 3HU2A 3W9BA 4U3FG 1I0IA 5JH7F 1FUKA 4PRZA 5CITA 5ALNA 1H5QA 2AVNA 2JVJA 4CNBA 4PY2A 2R5BA 3A3KA 2XQFA 4E7OA 3NHYA 5EKTA 2O5EA 3VTFA 4ZRNA 2Q50A 4D4JA 3TLEA 4YRTA 4QHYA 3HKBB 1S3GA 3ACDA 1IZ7A 3G5UA 3QVJA 3SC6A 5EJ7A 2V5UA 3DMTA 1GK4A 3L7OA 5DLQC 3SJCA 5IXJA 3I4MI 2GN1A 2FOXA 3F98A 4DIBA 3EAQA 3WMEA 5FV4A 1YRBA 2GXAA 3KO8A 5BURA 3BASA 2OM2A 1NXVA 3S81A 3EZ2A 3HVJA 4NJEA 1L3IA 4D92A 1JMBA 1AKTA 5AWFC 2VZ9A 4DC9A 5KLVK 1M1K2 3DCJA 3ZWXA 3OESA 1XOIA 5DHSA 4XPZA 4ZIRA 4WJKB 2L17A 1K4KA 3NHWA 3Q2IA 5K51A 4KDRA 3ESCA 1ZOYC 1K97A 2AN9A 3N70A 5CH3A 2BM0A 2IBZD 2ETXA 4FEEA 4DN6A 4FWIB 2BFCB 5KZMB 3M3GA 2EJUA 3HTKB 2C61A 3OF3A 1WMFA 4JP7A 2XIJA 3CR7A 3I2IA 3H1LE 2CL6X 2FB9A 3AU8A 5DFAA 1DWPA 4B3XA 1NTOA 3VO8A 1OLUA 4U3JA 1DQZA 2WEKA 3ED5A 3NMDA 1M901 2CSUA 5CBPA 1MX1A 3S6JA 1AHNA 1J42A 4C78A 3D59A 2VUGA 2HF7A 3DHWC 1OZAA 4K9NA 4TPKA 5I01A 1YS9A 4YONB 1L1FA 1KO1A 1AGRA 1CX9B 1E3DA 3D4OA 1RHZB 2C77A 3VNUA 5K3AA 3INGA 3WNVA 3CUTA 4KIJA 1VLZA 2X4GA 4EHFA 3KE8A 3P1JA 2WMMA 1FAVA 3R44A 4M9SA 4IVRA 1RRFA 3E81A 1AKRA 5B5EH 3LF1A 2XI4A 5FWYB 4G0UA 3W5CA 3L5OA 3MJRA 1TA9A 4OQPA 4R8MA 2GU2A 3E5MA 3I61A 4NF2A 5FXMA 2GRUA 2IBMA 3ENGA 3G4SP 2IZ1A 2CHEA 2CPBA 4WFJA 5B3KA 3DLBA 2PZAA 2VDNB 3G2LA 5DYIA 3N2EA 3QBEA 4MR7B 1KH1A 5IC5A 2CK3D 5B2EA 2HF8A 2AOVA 4JROA 1BU8A 2B2CA 2JFGA 4OP3A 2ZSJA 4UU8A 4V0KA 4WERA 5HG0A 5CHEA 5FEUA 1XHLA 1JW9B 2CHFA 1XZKA 2DG2A 3CCBA 3FUVA 4QQKA 4YRFA 4BNMA 2ZRFA 4AKTA 1HH4A 1VBNA 3AOEA 1C8VB 3RIEA 1S2OA 4MD8A 5LXTF 3OU2A 1NFQA 3WGGA 3THWB 4KFTA 1DWQA 3L1KA 4HRXA 1J0AA 4LYYA 3WL4A 1FMFA 3CZQA 1GZLA 2BI7A 1Z9BA 3CC7P 3RJ9A 3AJEA 4UW9A 3I55Z 3OMXA 3IQWA 5IAGA 2XH8A 1IATA 1CNMA 1R9JA 1Y9AA 4I2VA 2VNJA 3RQSA 1ZMBA 3TB6A 5K6RA 1YR1A 4I7EA 1EXNA 2FPGA 3V8PA 4BP8A 1P6QA 5IF3A 5KKNB 2QSUA 4JVSB 5IT0A 3GLGA 1KR5A 3UJ6A 2HT1A 3CUWA 1ETUA 2K88A 1IULA 4CLEA 1EB9A 1KYVA 2KIKA 1VCNA 3QLUA 2Q46A 4M1QA 1NOJA 4A9AA 3PNYA 3ER8A 1VIYA 2PV7A 5JBIA 4Q7QA 5B58T 1C7FA 3PO3S 1ZO8A 5FX2A 3RS9A 1A8IA 1EVIA 1IHYA 1HV8A 3AWDA 2PNJA 5AD1A 1II8B 3O6QB 3ILYA 2V59A 1U0OC 2XMGA 5JR3A 3BRWD 4XB6B 2XDJA 3NDRA 3RVKA 3FYHA 1USGA 3AF1A 3NTQA 5REQB 3U39A 1L5RA 3V4SA 3Q1MA 2P9GA 1Q862 4PC7A 5IUKC 1KJ8A 4QXPA 3D1VA 5A3VA 3TH5A 3ZU3A 3DUFA 3ONFA 4NMMA 5DM4A 3MS7A 2HBZA 4IKOA 4JVOA 3ZJUA 2CXTA 1MA0A 4N3CA 3FZGA 4HQLA 4MA4A 1S96A 4QGGA 5GADl 3DXXA 2H1CA 3AYXB 2O0MA 4MQMA 5DTRA 4DR3B 3A1EA 3HKCB 5ALGA 1Q7CA 4JHXA 1LWUC 1JIIA 4AJ2A 4BMSA 3CQ9A 1V39A 1TKRA 1RQRA 1S3IA 1KEKA 2OC9A 2PKQO 1YBHA 5DM60 3EDYA 1CUJA 3GU3A 4JCWA 4NK5A 1MX9A 3NG1A 1AV1A 4M8LA 5TGDA 4J7XA 2RJOA 4I4TA 5D51S 4ZPXA 3IVXA 4EB3A 4X20B 1T5HX 1E20A 3EWAA 1MIHA 3FYDA 3G82C 3HB9A 2EDAA 2ZJOA 1EHYA 3KB8A 4RHCA 4ECEA 4GEGA 2BMJA 4XVRA 1YQ3C 1G7TA 2EBHX 1OOEA 4RESA 3A9RA 3TL2A 5LNK1 1GTVA 4Z4FA 4RU1A 3P20A 4XB2A 1KDYA 4UHFA 2CLHB 3A9UA 3CLSC 1U2ZA 3C8HA 5DLYA 5JANA 1OLSA 5E7QA 3C7KA 2YMQA 3FOEC 5AQEA 1PSWA 3FOZA 2BCGY 3GZTB 1J9GA 4MIOA 4IQ8A 5J4YA 1QOQB 3F0TA 3ZCUA 4LGVA 2ATIA 2A4MA 2H2AA 5AICA 4RXMA 3VKHA 1K7YA 1J20A 3SN6A 4OB8A 1DT5A 4UHHA 4DB4A 1YDMA 2QB5A 3NOOA 2PIDA 4S2EA 3UK7A 2IEGA 1GKIA 1XNGA 5G1PA 4DDVA 4ZAYA 5C1OA 4L8YA 2OV2A 4HAYA 3H0GA 1O08A 3OJAB 1QQTA 2CNNA 4K6CA 2A9PA 3T0IA 2WM8A 2WT7B 4TLCA 3TQCA 5CFRA 1NUSA 3CWZA 4G8BA 4WA8A 1D4FA 5KYYB 1FW8A 4C1NA 3DHYA 2EKPA 1VQKP 3BE5A 3JQCA 5H4GA 1MQSA 4P7BA 5KVSA 1Y5RA 1OH5A 3MMZA 1F8UA 4TUYF 2QUAA 1NM5C 1RBZA 3LHFA 1Y1PA 4YUXA 4PN7A 4ERNA 1YI0A 3UMFA 3V1YA 3DTYA 5A06A 3ZXIA 2HL6A 3O84A 3LYUA 3NH4A 3OZUA 3LDGA 1YU6A 3N8GA 4WT7A 5I9TA 1D8TA 1JHUA 2NVQI 1LBEA 2YKGA 4FFBA 1CJSA 3P8CE 2PQ6A 1ZY2A 2K2WA 2WJ3A 1ZOSA 4Y7CA 2FXPA 1KZGB 4ZV9A 4LF7B 2YCLA 1Q1EA 1MVNA 4WY4A 3L75G 2R6CA 1ZH2A 3AEGC 3RVBA 4PD4I 2V5VA 3M4NA 5B7GA 4C7OB 1UT6A 5IKOA 1Q1GA 1J2EA 5IBCA 3Q7PA 1U57A 1R0WA 4XLTA 3P8ZA 3QY0A 4JQCA 1VB3A 3TNJA 4IIDA 2PXAA 2J3IA 2VFAA 2R96A 4QUDA 3WIEA 4JI8B 4TLEA 1NXQA 2OR3A 1UPUA 3BH7A 5CJ0A 3LUAA 1C2TA 4GX5A 4OI0A 2C54A 5D5QA 1LFDB 4B6JA 1Z06A 2IUTA 5IFKA 5KYWB 2KX7A 3NTRA 1YD7A 3KUXA 3PWZA 3OUUA 4NJOA 4YQYA 1RABA 3GJYA 4QT0A 3D6TB 4X66B 2PAFA 1II0A 2NZWA 2UVPA 4FEYA 1JQ5A 1H5NA 1IJDB 3OQJA 4FDLA 5LOVF 2Q2VA 2X40A 3L7AA 1AXEA 2FSFA 4KXLA 3HHEA 3U80A 1J00A 2X7XA 3OLVA 2HLDD 3A9SA 2MSNA 3SSNA 3CME1 2WKPA 4FERA 1EK5A 4PAQA 2FVXA 1J1DB 1JKJA 3B5IA 3RWOA 1E3SA 1QIIA 4WOBA 2LW7A 3OMLA 2V6BA 4H6WA 3VQTA 3S14I 1EZ4A 1DLJA 2X0JA 3OOHA 1ZAYA 4EVQA 3RAEC 4CLOA 3WWOA 3CF0A 3AVQA 3NIWA 4C43A 1E92A 7REQA 1XZNA 2A3NA 5LQMA 2W6AA 1DS6A 3Q8WA 1LRJA 4P98A 3PH0A 2R32A 3CRRA 1ID1A 1L5NA 1JHAA 2BHRA 3ZHRA 2ZTLA 5I7WA 3B3JA 4MI1A 1Q0ZA 1E3JA 4FFMA 4Q15A 3NTXA 1M8FA 1NF8A 1E0JA 4RZ3A 1OLSB 5B2ZA 4BE4A 3JD4A 1SBZA 2FUCA 1FUUA 3BA6A 4GWGA 5GGXA 2GM4A 1M2VA 4DNXA 3M5DA 2OYRA 2QM7A 1C0EA 2OVBA 5LP6C 3HXOA 1PCXA 4RESB 1VRCA 2PSHA 3G8CA 4ZNCA 1CS4C 1E1QA 2HJVA 1HDRA 1WEKA 1UKYA 1XTTA 2JAHA 2JRLA 3IPLA 1OV6A 5T67A 1XG5A 1KVSA 3COSA 3KR0A 4X20A 2GLTA 4ZC1A 2ZJ6A 2QZSA 4GIBA 3CT6A 2YRXA 3STTA 3HGQA 2O1JA 2FAXA 3QMVA 1US8A 2E76D 3CTPA 2DBYA 4MRMA 4PJ0E 2H8KA 4RK7A 2XGMA 4C03A 5GTDA 3QEJA 3VX4A 2Y1LA 1T13A 3SJ7A 3ZIAA 4BQFA 1CRPA 5DCLA 4C07A 3PX3A 4FPXA 5DHAA 4YAIA 4QYMA 3OLWA 4KRYA 4LXTA 3E22A 1U02A 1A97A 2VPTA 4V1CI 4AYXA 4OXXA 1DV2A 1RAIA 1QVFY 5FBLB 3CU5A 5FYQA 1X2BA 3DP7A 4RHEA 5LQSA 4DM4A 4RZQA 2CLDX 3HV2A 3TNLA 3DMDA 3UTCA 2XWBF 1GJRA 2FP3A 4IIYA 2F3UA 2R25B 2GA1A 1E2DA 3LXUX 4S1WA 1WUTA 4UU0A 5COAA 5FO1A 4O1IA 4IMJB 2PRRA 5B3AA 3LVQE 1N7SB 2X8BA 5L40A 2BGUA 2FRXA 4QXMA 5EJ6A 3U4QB 1JNMA 1M8PA 1XMIA 4RACA 2BHTA 4M1SA 1OX6A 4HAXA 3IXMA 1A2BA 3M4OI 2OECA 3QU5A 4UB6E 3QWAA 4WCFA 3NEAA 4MA5A 4YLYA 4MZDA 4CEJA 3WHLA 4ETWA 5BN3A 1OXSC 5K5EA 1AC5A 3BGDA 1TM5E 3HE5A 2Q28A 2H9IA 3AUJB 4I1OA 1GUFA 4GXNA 2VP3A 1VKOA 1T4CB 1W30A 2GCIA 4BO7A 5E79E 5LNK6 3B38A 1ZN5A 2QT1A 1KILC 3ZGYA 4B74A 3UOGA 1V8BA 3PQFA 2XT9A 2P90A 4JI2B 2PA0A 4ODIA 3EAFA 3RANA 4F12A 3RRNA 1EP2B 2YXDA 3JRNA 4UUOA 3ZWWA 5JD5A 4POAA 5BSMA 5FKJA 5A6SB 4B83A 5I4KA 3C3AA 4Q37A 3B89A 1BS2A 1J49A 4IXWA 2H4ZA 4TWRA 4DR5B 1KB9D 4CG3A 1Z22A 1G18A 1WQ3A 4D7ZB 4P2BA 2P2ZA 1RQNA 4P53A 4AZ0A 1NBME 1MC5A 2A4KA 2FG7C 4CKZA 1T3SA 1RVV1 4QTYA 3I561 3CVJA 2AZXA 1Y1TA 3GP3A 1GGEA 1FCJA 2ROQA