1FDIA

Oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite
Total Genus 251
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
251
sequence length
715
structure length
715
Chain Sequence
b'MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 251
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdiA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdiA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdiA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdiA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdiA03
1PQFA 1S3SA 5DYIA 1CR5A 3IR6A 1TWHA 1WCMA 4CS0A 1DMSA 3O5AA 2B63A 1QCSA 4GA6A 2NVYA 1E32A 1AW8B 2V45A 3H0GA 1CZ4A 4KDLA 1TWGA 3GTPA 1AJYA 1PYQA 2NAPA 1I3QA 5FTMA 2IVFA 4D7ZB 2E7ZA 3GTOA 1SIWA 3TIWA 3IR7A 4C2MA 4AAYA 1TWAA 1Y4ZA 3GTGA 1CZ5A 1E61A 1G8KA 1G8JA 2VUMA 2C45A 3HU1A 1Y1VA 2WAQA 5C18A 5GLFA 1OGYA 2DMRA 2JA5A 1EU1A 5B6CA 1E60A 2IV2X 2VPXA 2VPYA 5T5MD 1Y5IA 1KQFA 2G8YA 5EPPA 1OMIA 1DMRA 2JIPA 1AA6A 3QQ7A 3GTKA 5C1BA 2VPWA 3OUGA 1PYUB 1R27A 3TM7B 2JIMA 2PMZA 3QQ8A 2R92A 2JA6A 4KODA 2Y0SA 1PQEA 2P10A 3PLXB 3O6QA 2NYAA 5FTJA 1IW7D 1YLEA 3DMRA 2JA7A 1R9TA 3GTJA 1Q16A 4QIWA 2R93A 3GTLA 1Y1WA 4CRYG 3CQZA 2WB1A 1PT0A 2KI8A 2V3VA 4KLNA 3HU3A 1KQGA 1I50A 4RV0A 5DYGA 1SFOA 1PT1A 3ML1A 2JIRA 2JIOA 3HU2A 3QC8A 1K83A 2VPZA 1VC3B 2R7ZA 3CF2A 4AONB 1E18A 1FDIA 2NVXA 1TMOA 4DMRA 3H25A 4AZDA 5FTNA 1PPYA 1WMKA 1R7RA 3FKIA 3GTQA 1QDNA 4AYBA 3QWZA 4KDIA 4KO8A 5T5ID 1FDOA 1TWFA 1WLFA 1PQHA 1H0HA 1UHDA 2PJHB 3HKZA 3IR5A 4CRZA 3GTMA 2YU9A 2EEOB 1UHEA 1ZMEC 1H5NA 5FTKA 3EWKA 1TWCA 3IN6A 1E5VA 2JIQA 5FTLA 4GA5A 4AOKB 2E2IA 2E2HA
chains in the Genus database with same CATH superfamily
4XJSA 4M9RA 4R9VA 3W0LB 4AY5A 5IUKC 3T7TA 3UVEA 1H8HD 8ATCA 3C7CB 3EIWA 2WP8J 2IZOA 2RGRA 3OU2A 3HE4A 1ENOA 3F6EX 1H0TB 1SBQA 1FSSA 1EM8A 4R8KA 1QGKB 3P2IA 3AVYA 3I2JA 1US8A 1MVOA 4PG7A 4RYLA 3I07A 1SVKA 1MO3A 4QTZA 5E9AA 3VBCA 3MZLB 3WDKA 3S17I 5E4TA 3U09A 5CLGA 1WXDA 1AA0A 2J9XB 4CL8A 1TL7C 2QRMA 4KX3A 3VPAA 3U4QB 4PHHA 3LX8A 2WDPA 4DCKA 2JL1A 3CCU1 3PPVA 3KQLA 4FG4A 4OHRA 1WMEA 1M6VA 2AI1A 4PJ0H 1JIIA 4WLOA 4HDNB 2A92A 4C0SA 1NBME 2VDMB 3W5DA 3T9AA 1KAHA 1WB5A 3OT5A 3AJ9A 3AUYA 4NBDA 1TU0A 3QV2A 3P19A 2LFUA 1S6YA 4YAKA 1T2NA 4TSKA 4Z4QA 2I4RA 4NCKA 2RG7A 3A7EA 1S02A 1Q84A 2QUZA 4JLVA 5HX7A 5LYJA 1QIHA 1QVFY 2WPDD 4PZLA 3P5SA 3VJLA 1P0CA 5DLDA 4KLRA 1CZLA 1SBNE 2H7XA 1E0DA 4Q00A 1HDZA 2E74B 2HJRA 1L0LG 1NNI1 3DKRA 4E46A 2J5KA 1PNVA 1SCUB 3VMXA 3PC3A 3A3YB 3CUWA 2IBZI 2IFMA 3IE0A 3H84A 3E9EA 5FTNA 1N2BA 1USPB 3QE2A 5AW3A 2AFIE 3O47A 1QHIA 4ALLA 4DV7B 1MZ9A 4ZT3A 2VNIA 4U7TB 2I7CA 3IPLA 2JJQA 2ZS9A 3CJTA 4RMGA 4GVXA 1MQSA 2GX6A 3TSIA 3EVAA 1G1AA 1D4AA 4BQSA 4C6HA 3CCE1 3BJIC 2GF0A 2Q9CA 1Z4QA 2YYZA 5AVUB 4BO0A 4R68A 4MV5A 3H1IG 1QEXA 1CZ4A 1DTWB 4JY7A 5FOTA 2A4KA 4DB2A 3SIWA 3AHHA 1JH9A 2ZIFA 1XMSA 1JHOA 1DMRA 2ZYSA 2NU6A 1RBYA 4WNAA 2CUTA 1OX4A 4OCZA 1OR8A 5B55A 1H0SA 2P75A 2VLIA 1H2XA 5ALHA 3K6RA 4OB6A 1M2OA 1U3CA 2J87A 3ZY5A 3T5TA 5AW9A 3PEVA 2BGNA 1M5RA 2OCKA 1F8UA 2FB9A 2W2OA 1DZ3A 4GOFA 2OCLA 5CNIA 3DTVB 4DJGA 2A4MA 4DDMA 1E2BA 4BZZA 1LD3A 1MNQA 1AZSC 3O38A 3PNYA 4NBUA 3E1IA 4FOSA 1LS1A 1P61B 4P0QB 4P5EA 2OXTA 1CX9B 1YHQ1 3Q88A 2RJOA 1L7XA 1O9GA 2PWPA 4EY7A 4URXR 2OGZA 2OYRA 3P2JA 3AWDA 1TWGA 2VDWB 2ZLBA 1IFDA 4WXRA 1RE3A 3I56P 2ZT8A 1YWGO 3TOVA 3AEZA 4W6QA 5J23A 1NUQA 3HLYA 2WSFJ 1C1YA 5AJXA 3DZIA 1LGYA 1JY2N 2Q6VA 3Q6MA 3GNSA 3TDKA 1G2QA 1IJDB 3P71T 3V7YA 2IX9A 4Z8YA 3QX3A 3OX4A 3LZ6A 3KUUA 2ZXEB 4F84A 3CCLZ 3NIFB 4A3FI 2JLRA 2HXSA 3BTSA 3NJRA 3RS4A 4NBWA 2XWJI 4KDFA 5EFOA 5KINB 1P1HA 1KYTA 4BWVA 3H6GA 5DYTA 2QR3A 3NGMA 4TS9A 4UAJA 3KQVA 4DC1A 3HVKA 2VC2B 4H0NA 1T35A 5JATA 1NMQA 5JAMA 3MTIA 1USIA 2ACWA 4BLVA 4XR4A 1MRNA 3FVVA 4JT4A 5BQ3A 4C4OA 1E60A 1WETA 1SQPG 2NZJA 1KE1A 3FBGA 3V34A 4BB0A 1LTKA 5HK8A 1QYIA 1XZIA 4QHSA 4BBAA 3LBHA 1Q16A 2O3JA 3PNPA 2H54A 1KWGA 4I1UA 3NNNA 4BNNA 4US1R 4HNUA 3KE8A 3M5DA 1ETUA 5F3WB 3PQ7A 5CA1A 3H25A 2Q8QA 1ESMA 1KKLA 2HQOA 2ZRIA 3U4IA 2DJIA 1R6VA 4RA9A 3A0HH 2PL5A 1VGQA 2E2JI 1U0SY 4UUPA 4JP8A 1Y34E 1LZKA 2NQTA 3G13A 3KLPX 2VYCA 1R5NA 2P40A 2VEOA 3NATA 3LYUA 4DXAA 1XRQA 5IM4F 3I72A 2E1PA 1F8YA 4RABA 3IVGA 4RANA 1T9HA 2Z6AA 1ZH8A 1AT1A 1TFRA 1URQD 1RZRA 4I9FA 2CE2X 1FFSA 4C2MA 3K8ZA 1RRCA 2B7BA 3CX8A 3FWHA 4QE3A 3QGMA 3AE2C 2VK1A 4J2TA 1V48A 1EFHA 3CBGA 1OBVA 3OE7A 2OHGA 3RU9A 4XDYA 5AESA 3MBIA 4OBWA 1QFMA 1U7DA 2ODQA 3BTVA 4LHWA 4FYKA 3ULKA 1OAAA 3DXZA 4EHFA 2P9TA 4HTFB 1Z7WA 2JFWA 3T7JA 1W34A 4HL6A 4IX1A 4AO6A 5IEJA 1N57A 4R7TA 1P3JA 1VQ6P 3HO8A 4KLCA 4FILA 4FI3F 2IA5A 3O74A 1OQAA 2ONZA 3V9AA 3IAAA 1GCIA 2H9IA 3P4XA 4A27A 5LDGA 4UPVA 1ZCZA 1PL5A 1E2GA 1RJWA 5GAJA 1GKIA 2BHLA 2QTZA 4R31A 3GDFA 1R50A 1NP7A 5AW4B 1GUBA 5TPWA 1Z4NA 4JLOA 4PQFA 5A5DA 3NVMB 1RLYA 3UK2A 3V3TA 4RO0A 1D03A 4Z9AA 2PQ2A 3VU9B 5JZ9A 4HVCA 4A6XA 4KVAA 4KAAA 1I7DA 1RF0C 4NMXB 1THZA 1Z7GA 2OO5A 1PW7A 2OSVA 5EQFA 4ZDIA 1IY1A 5DSXA 2RFLA 1KTMA 1T6YA 2WIJA 1YITP 5DBOA 4MCJA 3HD7B 3D4BA 4ER0A 2DU8A 1A2OA 3SVLA 3KZIH 5LKRA 4PBRA 4K2HA 2CVHA 3USSA 3MJ4A 1J8MF 1T0PA 2YIJA 4C7JA 2E75C 5DCYA 2B5OA 2GFQA 3H65A 1M1JA 2HIAA 1GV0A 2BCJQ 3HA5A 1YJ9P 3JATA 2DMRA 4EVIA 1ZW1A 4G2NA 1JSRA 1R9NA 4OSPA 1P6UA 1BFKA 2FBWC 1M2FA 3ZDDA 1VKNA 1G5PA 4ZYYA 1BU8A 2J30A 3VMHA 4JJ8A 4TS3A 3PLNA 4XA4A 2Q3MA 3AQ4A 3T1VA 1ZVJA 3VHLB 3GUVA 3DV9A 5CJ4A 1JKMA 3HZHA 3PGVA 3EF1A 4OP2A 4UNSA 3ZI4A 5KDLA 5CT8A 1XB2A 4ZJUA 1GL2C 2LBPA 5LUAA 4KIFA 1GCGA 5E6UA 4Q4AA 2BKXA 1FMJA 3E1KA 1P0PA 4L8VA 3I6YA 1X7WB 1SA0B 4TVSA 2L19A 2HCRA 1O6BA 2FFDB 3FRHA 3Q8WA 5D1HA 2YZKA 2Q7CA 2AD5A 2YH2A 3FKJA 3BL5A 3LMKA 5LYYA 2D5AA 1KILE 4IJMA 2OQQA 2ZKIA 4IQFA 3D0QA 2BTQA 4I1RA 4HXEB 3ECAA 3A0UA 4KKVA 2VWGA 2JGLA 3FPCA 3A4TA 3T7RA 4MQMA 2Q4DA 1OB2A 4OM8A 4LXHA 1KYQA 1N8SA 5DLEA 2VHUA 1VKHA 4QDZA 4ARCA 3AEQB 1WUHS 1D2NA 4RPKA 2EGHA 3ZE2B 1PGQA 1OLSB 2PO7A 2HWXA 3VYIA 1I0IA 3MT8A 4W7SA 4C21A 4BNJA 3PXUA 5JV5A 2OTL1 1YIAA 4PAWA 1EFKA 2YS7A 1KMNA 1VQLZ 3W5CA 5L40A 1NXXA 3HUSA 1JQDA 5BSWA 2HG5D 1EWVA 2ZBFA 1NLZA 5B3JA 3CCBA 3TL6A 2H4XA 2R2GA 3AG6A 2OOSA 4TKVB 4Y9RA 3JAMf 5LQRA 5JNLA 1PW5A 1TQ8A 5H9WA 3UIEA 4KSBA 2QJFA 3QUCA 1IN1A 3C3XA 4L16A 3U16A 3V8MA 4U3FG 2VJLA 1OVUA 2WAQA 4RWEA 5TEWA 3F71A 5ALQA 2VPYA 1LFDB 4I5EA 1SPXA 2DUMA 1FTNA 2PUJA 2IYYA 2Y92A 1R4AA 1U94A 1SAYA 5HGXA 1SD2A 1ONNA 3AVUA 1YMUA 2YY6A 2ZB2A 3ROTA 4CMHA 3K5PA 2FX5A 1BS9A 4DIKA 1KFBB 4F9FA 1NASA 5K3OA 1S1CX 2EF1A 3KFLA 3FUTA 3RABA 3L7JA 4A6EA 1H4QA 3BCCE 1Q7CA 4YCSA 2NXJA 5I8WA 1Z7BA 3ZY2A 3NEYA 1CY7A 2AA3A 5JMTA 5LA6A 3FDIA 3LC0A 3R3JA 4X8LA 1XD2B 1AKQA 2YHUA 3WFJA 3NGXA 1IOLA 1ZMBA 1XNQB 4XIYA 1BVRA 4ZNCA 2OB1A 5FOVA 3RU2A 3L7IA 1C1HA 2UAGA 2ZUDA 3E0QA 4ZZIA 4JLUA 1YU9A 4F2HA 5D3QA 2QD2A 4FFTA 4ZI5A 2JGMA 3CWCA 4Q1FA 4UUNA 4PAQA 3M70A 2OUIA 2ZP1A 4HFNA 2PXAA 1QIIA 4MR9B 1NG1A 3KEMA 3PK0A 3HVIA 4Z9BA 2PMZA 4CU2A 5BURA 1YI1A 1LV7A 2NPIA 2WBLC 2ZIXB 1NI5A 3TO5A 3OM8A 1KK1A 2WK1A 1OI4A 2N0SA 3WWCA 4BRWA 1OX6A 4S1VA 5LN1A 3H83A 1GGMA 4Y99C 4OXXA 1WXXA 1O7JA 2VUSA 5KU1A 1CZQA 3GJ7A 1ZI6A 4UOEA 1Y8QB 4AWAA 1HQYE 1GZUA 2LEXA 1PR6A 5D2CA 1OXMA 4CIXA 2PM9A 5A05A 2SCUA 3NMDA 3B5NA 1NR7A 1UWKA 2QTVB 1ZK4A 1CY0A 1T2FA 2H92A 1PFTA 4P5PA 2AEMA 1OFHA 4M8IA 2VJNA 5EZ6B 5A6VA 5KJ7A 1DSSG 3JYOA 1XG5A 5FWXB 1VMKA 2QZSA 4FFOA 4NK4A 1P5JA 1N2OA 1ZW0A 4ZQHA 2RKWA 3WHLA 3T95A 4HV4A 3SIPA 4Y2YA 4DC9A 3DEJA 4C4YA 3D6VA 2OYHC 4K6MA 3N6XA 3GELA 1H5QA 3CZBA 3PHHA 5JECA 3FTCA 2WVHA 3PT5A 3NFRA 2ONJA 4KGZA 4B6EA 3WL7A 2D7JA 2AD1A 1N6OA 2YJGA 1PIXA 3WMGA 5E2IA 4DARA 3L06A 3GTLI 3OQOA 3V3KA 1HE1C 3SHFA 5IT5A 4P83A 2A33A 3IEKA 3L70E 2G17A 4MS3A 1FZAA 2BVNA 1OI7A 3Q98A 3I12A 4B76A 4BYMA 1QL1A 5J2UB 4FGUA 2RPRA 4UUAA 1YNND 2OBXA 1GK4A 3QA9A 5EMKA 4E5YA 3SZOA 4DYDA 5DF1A 4ZFNA 2CNOA 4MD8A 4US2R 1OW7A 4GW3A 2YHBA 1J00A 4QAQA 4KPUB 1PJAA 4ZVUA 3IX7A 4JIMA 2H85A 2J0VA 3GLFA 4UZEA 3IODA 1RI2A 4KWEA 3GCGA 3QPAA 5CDFE 4AJIA 1K3UB 4D79A 5FNVB 2VPWA 4PC6A 3M9BA 3A05A 3IOCA 1O6ZA 4AS3A 1M7BA 3UMBA 2P65A 3OLWA 4DS3A 1QSGA 1E5XA 2PNFA 4QJ4A 4X61A 1IBLB 3F9IA 5C8YF 2CB0A 1X0XA 4E7OA 4KRGA 1FFYA 3KAPA 5AVSA 2F9MA 1L8OA 4LE0A 2C0WA 4KP7A 3UT6A 4X71A 1EA5A 3I4NI 3WLEA 5FT9A 5LXTB 3CYFA 1CDOA 5KTSA 3RNLA 1MO6A 2A8YA 2B6HA 5TQ0A 4L7QA 5EXEA 3MTDA 2G76A 1S8AA 2YZGA 3NBFA 3HACA 1RFGE 2A94A 3FWZA 5ALNA 3EXEA 1A4RA 2B63I 2FEOA 1GPNA 1Q7BA 3Q2IA 2PWAA 5ULLA 1EP3B 2KYRA 4I81A 3OQIB 7GPBA 1FDWA 1XKQA 1K7SN 2WOOA 4KLZA 3SDSA 3KZKA 4RE5A 5C1IA 2UYOA 5GTHE 2FQYA 1K9SA 3CCQ1 3R6WA 5U1PA 2BGRA 5G53C 1NY6A 2K9JB 2W27A 2P1RA 5C4JI 1DADA 1TMGE 1G2CA 3KTFA 1P9RA 4BKQA 4GPAA 3THWB 2GEBA 3H6HA 3EPHA 3RZDI 2JAXA 4JL5A 1NQWA 2W6BA 1IPHA 4BIIA 4OBEA 2BASA 1BCSA 2I71A 3OHPA 4Q02A 5F35A 3K0SA 1ZR4A 4HYTB 3K0BA 3P2EA 2GI4A 2R7NA 4P84A 1H66A 4HEA6 5IBCA 3WTCA 4TWIA 2YMKA 5AW6B 1C3LA 3WL3A 4C7XA 1K05A 3ZJUA 2AOTB 1KVRA 4XWKA 3QE3A 1K8A1 4C6TB 1RKXA 1P9LA 4YJGB 5M7EA 1LPMA 4U8HA 1JJBA 4DLSA 5JD3A 2XT0A 5C7OO 3R7NA 2I8LA 2EFEB 2VDVE 1AA6A 2DLCX 2HFKA 2PO5A 3R7SA 3K53A 4D3XA 1L4HA 3E23A 1FYXA 1WDKA 4BWFB 2V6BA 5JI3E 2AQ8A 5FULA 2B4AA 2I87A 5K0ZA 3I5MA 3BMQA 4JELA 2GCOA 1Q74A 1XXHE 5CT6A 1Y1WI 2IQIA 1U0RA 1M7LA 2QTWB 3K70C 4TSFA 2RK6A 3DCYA 2WD7B 1CUCA 1R10A 4M21A 4CGZA 3KPWA 1BWPA 1MUUA 3QY0A 2OPBA 4IINA 4NEQA 3X1WA 3UOWA 1PFUA 3PQFA 4OL0A 1U11A 4RFSA 1BOOA 3BHJA 3I55Z 1EDOA 2GN4A 3OHSX 2PUGA 2NZVG 1VQNZ 4EZBA 1XF9A 1U9YA 2JA5A 1J2TA 4JBHA 1WMFA 1LI5A 3KVOA 1J5XA 1FRNA 3AB3A 3FPJA 4QVIA 1K08A 2HHAA 1V0JA 2VDNB 4CV1A 3WNZA 5TX7A 3ZDBA 1BCCG 3WA6A 1RWMA 4EY8A 1Y42X 2GPBA 2XZDA 1PZEA 1MGOA 3LGAA 3DOCA 1KORA 4XCQA 1RKVA 4J43A 2YS6A 3ZCVA 1YL5A 1U81A 3HB1A 3VR2A 1F6BA 1SCNE 1TMOA 4NFHA 4L22A 3UA4A 4BQOA 4D42A 1ENYA 3HKEA 2XUOA 3MOSA 4OB7A 4R8LA 5DK4A 4JJIA 5CLHA 3PNKA 4TXLA 1YJXA 2YJ6A 5F76A 4R3NA 3LBAA 1OXTA 1UHEA 1M34A 3AI3A 4KPGA 2GEFA 1Y9DA 4RZUA 1DINA 2XSZD 1MV5A 3A25A 5FF9A 3VTAA 4CDNA 4JI8B 2PRYA 5E7QA 4A5OA 3VPCA 1P1IA 2IVZA 2DHEA 3KKKA 1T9CA 5DYWA 4ZVRA 1PJRA 2EDCA 5CVJA 4KTTE 3W5UA 2PKQO 5KS2A 1FZBA 3KKQA 2XGJA 4PX9A 2FE4A 4KQJA 4L4ZA 4D5GA 1OZGA 3GHGA 1DXOA 2BR5A 3KR2A 1N9GB 1JE0A 3H7AA 4DGLA 1PNTA 1EQUA 1TZ2A 2X5JO 3LXMA 3ESXA 3AJ8A 5I8PA 1GT91 1CE8A 5DBHX 3EPLA 2X5OA 3JRNA 3B1KA 4P2GA 4D3YA 1P45A 3VJKA 5CJ2A 4AD8A 3DW1X 3R6DA 5HJEA 3ZGOA 1C8LA 1E8DA 1KXZA 2RAPA 2NSYA 4MCHA 1C2YA 2O5CA 1M33A 1CS0B 1SN7A 4ITRC 1AS0A 1C41A 1FMFA 3BE6A 1V8BA 3GROA 1KJ9A 4FS8A 3BSSA 1QJCA 5ALSA 1P1CA 3W5HA 3N0WA 4OQZA 2GGSA 5D1PA 3HB4X 4D9EA 1NIJA 2AI3A 3L07A 2DWOA 1IN6A 4HN2A 4LFBB 3WI7A 4NU6A 3ZHYA 4PF1A 3ETLA 5AUNB 4JUBA 1NTOA 3KT3A 2YKPA 4DZZA 5I3CA 1BGVA 1WW8A 3C6XA 3HMQA 1W59A 1X8XA 3FWLA 4LVNA 5LQMA 2QVLA 3K31A 4PZDA 3DDSA 4BNDA 4RLHA 5GIPE 2G88A 5DN6A 4H1WA 3C1TA 4KT0J 3E7FA 3ZWVA 4EEXA 3C1OA 1EVQA 1VQPP 4BHTA 3L0IB 5C51B 4BBZA 1PR4A 2XIJA 1G20B 5TPZA 4CRYG 5FPTA 1RYNA 2VAVA 1GGJA 2XMBA 2PNWA 1QH8A 4KFUA 5A5EA 5SYMA 3MRXA 3OOSA 5HRAA 1G21E 4Q1VA 1BGXT 1UKZA 4F5ZA 4IOMA 5AKEA 4A2WA 4UXHA 2AVNA 2AYDA 4TWBA 4ZAFA 3N6RA 2XXAB 5CAEA 5AKJA 4BNHA 4M76B 4Q24A 4O4JF 1NFQA 5KJFA 2ZYAA 4M1ZA 1RABA 2WSYB 4QEDA 3CMEP 2XE4A 3H9JA 4IEFB 4JQOA 3B4SA 1PFIA 2JRCA 3CXRA 1EFPA 4LOAA 1OA0A 2DBQA 3DVSX 4FGZA 2R48A 1C1XB 4WSOA 1B76A 3IP9A 3PFNA 1AM4D 1J2YA 5FHRA 5C44I 3CW9A 1U31A 3N8GA 1ZP0C 4PM4A 5EXXA 5FP0A 3FNFA 3L71E 4ZXFA 2IUSA 3NWJA 1Z2AA 3B9BA 1AGNA 4UATA 2IXTA 1ZCFA 3NB0A 2YL2A 4M38A 4JEIA 2R6JA 4B4KA 1KMIY 4UW9A 1FYVA 3W4IA 4CG0A 1JPNA 5DOZA 4IFBA 1H6BA 3WL8A 3MG9A 4ZYWA 2GZ2A 3E5NA 3E61A 3ELYA 4DLVA 1PLKA 3DLTA 1EWTA 3Q5GA 3RVDA 4D46A 3PHCA 1Y1VA 3AF4A 3GT0A 3MMXA 4BU1A 3G3EA 3KL2A 3BB3A 3L75J 5AVZA 4PRZA 3W6PA 2ZUFA 1JW9B 4G26A 4D8VA 4HDAA 3GTKA 1TUBB 5DX8A 1DGQA 4E22A 1WHSA 2HF9A 1Q77A 4A3GI 3B8EB 5JG7A 1NJ8A 4NXMB 1U1EA 4E03A 2V96A 4JBNA 3U7RA 2ZJ0A 4M8LA 5DLQC 4WQMA 1I50A 5ED4A 4XYBA 4DSZA 4J2HA 3V1TC 2WWGA 4BFXA 1VDFA 1PYOA 2GA9A 3D8NA 2Y4OA 1GKYA 4NICA 1E7MA 1Z6XA 4RY8A 1NVDA 5EKSA 1JA9A 4DLLA 2G36A 4GG1A 5CDGA 1RVDA 2HR1A 3A6KA 1Q17A 3BA1A 4QUIA 3UK1A 3KJZA 4BMYA 2WHPB 1P75A 1BD4A 3FROA 2AHRA 3AY6A 2QTHA 5BVHB 1GLGA 4P35A 3N86A 2O2DA 3R6GA 2FWMX 3LQQA 1OYWA 1ODCA 1KMMA 4M86A 3H0KA 3EUAA 3HP1A 1P4SA 4L5IA 4ER6A 3MP7B 4TT3H 1PJBA 4ZT7A 2REBA 5HQTA 1Z4JA 1T3SA 5BQFA 2N47A 7MHTA 3JTMA 1PYDA 1R6TA 3MCVA 1IZ9A 1KQSY 4WTOA 3FAKA 2B6NA 4J94A 3FD8A 1YOVA 5DHUA 3B1FA 3WRYA 4OPMA 1JY3P 1EUCB 4JD5A 2BFEA 2AC2A 1TD1A 10MHA 4ZKEA 3ESWA 4FOOA 5FNZA 3DL7A 2WKQA 1X79B 4J0KA 3QVOA 4IV5A 1W4CA 1CIJA 2JEEA 3EWKA 2FKWB 4BB9A 2PGDA 9ABPA 4RF5A 3E15A 1CS4C 4LCBA 2PY6A 2QRVB 1IC2A 2CLHB 3T4XA 1S5LX 3U7GA 4MW5A 1XU4A 4LMPA 3HSKA 4LBYA 3P7MA 2O4HA 3EIHA 1VQK1 3H5AA 3NFQA 1R1DA 5IASA 1KMHA 3L75D 1A71A 3TFWA 4NDNE 2V5AA 1TKBA 4ENTA 5CK5A 4UHJA 2V65A 1EFDN 1AVYA 3FM9A 2H43A 2IC5A 1II9A 2HDNB 3TLKA 4HB2A 3H1FA 1BHO1 3DCNA 1RXYA 3AMVA 3C87A 3C98A 3TTYA 1JR3D 2Y1DA 5CX1B 4UEWA 3FWKA 4G1VA 5KSWB 3MN1A 4LSGA 4CFYA 3NTVA 2AN4A 4RHFA 2ATIA 3UWSA 3PLRA 2UUCB 3ORYA 1DXYA 2B5VA 3KQUA 4HCJA 3FHCB 2JEOA 1CQXA 1ST3A 1SXJB 1WMKA 3DH0A 5EP4A 5AKLA 4ME6A 2YX1A 4FX5A 4RQBA 4INAA 3DE5X 1U6IA 3PFWO 4Y9TA 3UANA 1N3YA 1KB9D 4R0VA 4KACA 3USES 1SQ0A 3IDSA 1PP4A 3AESB 4IOJA 4MTCA 3MD0A 1ZSYA 3FXEA 1UWVA 3EEDA 4UEOA 2RJ3A 1GKKA 2IYEA 4P86A 3E3MA 3E35A 5JJBA 2PANA 3CNNA 5GONA 1QUEA 2FUCA 4DIOA 1XZFA 3TVDA 2GU2A 3RL0C 3EEOA 2R92A 3L73J 5DP2A 2F4VB 4LXQA 3PC6A 1FZCB 5CPBA 2NYAA 4TOIA 4X94A 1B8PA 2D0PB 5L4SA 3SZUA 4H7EA 1T9ZA 1F0KA 1W2GA 4R2MA 5JTUA 3RARA 1PFQA 5FL7D 2DHCA 2DXIA 4KRFA 4AX4A 3KQHA 3QFFA 1WG8A 2NU9B 3AERA 1CTQA 4KO8A 4GL4A 2CL7X 2Q46A 3W06A 2J0EA 1RQ7A 3BHIA 3KYQA 3KJEA 3V1UA 5AKHA 1JHQA 1M83A 3EVFA 2IHUA 1HKUA 3Q15C 3P9SA 3CO0S 5FEUA 5C3MA 4LXGA 4LWPA 4XQ0A 1ZGJA 2OYIC 5EE9A 3JALA 3CJRA 4RVGA 3AUJB 1UJ5A 1CQIB 3K5BA 1JB9A 1TM5E 4P7BA 2JJLA 1UOPA 2YV4A 2XMRA 2DW3A 1C7IA 4HMOA 2QJWA 1GYRA 4ILEA 1ZKMA 5ADHA 4NEGA 5AW1A 4IIVA 4CR6A 4K9RA 2VDLB 2APJA 3ZW8A 3NM5A 5I7FA 2OECA 2JW5A 4NBFA 2HBQA 5CYGA 1DDOA 2BHTA 3KZOA 3D8SA 4DSOA 4ND8A 1AVOA 3W8NA 1RHQA 5AHWA 5JARA 4WEQA 5IG2A 2X8JB 1ZGZA 4DJFC 2W03A 3ZOKA 2KB0A 5CVTA 3VYUB 4Z2YA 3L05A 5J9FA 4C0KA 3GLQA 2WM2A 3OZVA 4D82A 1G2PA 3SU8A 1N6IA 2PX2A 1LT9B 4N0PA 1KJ8A 3RF6A 2V6IA 1E3LA 3W9YA 4MUHA 3WMM0 3MTGA 2ZTSA 3EDYA 2P2YA 4Z8XA 2PUAA 1JVBA 3DM5A 1E3DA 3SF0A 1YIDA 4UD6A 3L73D 4HNAB 2Z4RA 1ZC1A 5HF8A 5CW1A 4DMMA 2J07A 3TNDA 3EVBA 2H63A 4UBMA 1SC6A 1TT5A 2GRJA 1SWWA 1W2BO 3O1JC 1PGOA 2JA7A 4TS4A 4ZV7A 3AUFA 5BN3B 3VKVA 1Q7GA 3HR7A 3ZGXA 4U2DA 2ZCVA 3EVDA 3TE6A 2YADA 3SJUA 3PDUA 3V42A 4HLUA 2DTDA 5M04A 2WWVD 2PX4A 1QDUA 2C54A 1OH6A 3DZ8A 2HJHA 2O8CA 2DWQA 4QICA 2Y0DA 4MKXA 4AY2A 2YDYA 2NXEA 3K73O 2AMJA 4C7NB 3OEED 3RC7A 1EK2A 2B4RO 1MABB 3D2BA 5TT0A 4O2RA 1W75A 5C39A 2JS7A 1DARA 3AEDC 2ZBUA 1LSJA 1A8QA 2J3DA 4AJ2A 1H6AA 2FZ4A 5KWEA 1UK8A 4NZYA 3UWPA 2V7GA 4P34A 3UAVA 1T43A 3EOBI 1EI9A 4O4LB 2XODA 2CE7A 4ZOEA 5AOVA 2BFAA 1FBTA 1ZJWA 3D7MA 4NECA 3CKMA 3W2HA 1KS2A 1Y89A 3RVQA 4KXWA 4CZ2A 5EE1A 1LJ2A 3FCAA 4OLFA 3NHJA 1SCBA 1YJ5A 2AUMA 3B60A 2HO5A 2HPZA 2QVBA 4MW7A 1IK4A 2ASVA 4RQAA 1FCJA 3I3SR 1OXBB 3ADKA 5GM2A 1O08A 3FPHA 4CMKA 4CMEC 4YAFA 3HUTA 3KYJB 1UP4A 1C4KA 2EQAA 1QH1A 5CFQA 1HJ0A 2VYQA 3FI0A 2RGXA 3TQCA 1SIOA 1DJLA 3BK1A 2C57A 2ZCUA 4NOMA 2HU8A 3L02A 5B1DA 2CZQA 2B2NA 1Z4IA 3TCXB 5BR7A 1NYLA 1YTZI 5I7VA 3T7SA 4QAJA 1B0UA 2OOYB 3M34A 4XVQA 4FBMA 1J1DB 4Z1MA 4WEOA 4R9RA 3UA3A 3Q9SA 2B25A 1HDIA 1E5LA 3PF8A 3ZK7A 1NUAA 4AQYB 4Y1RA 4AROA 4EOTA 3T52A 2NYUA 1RQVA 4BP9A 4NFRA 4QYTA 3RVSA 3HUDA 4HVLA 1L4AA 3SUMA 4AJ4A 1NW6A 1JWAB 4QUJA 1PBNA 5B3AA 4ASUA 2NADA 1JDNA 3O8CA 2AF4C 2ATXA 4R3UC 4AKGA 3HYTA 2K2WA 5F77A 3FSEA 5F7ZA 4ZYVA 5IF3A 1L5OA 3RB8A 1KI1A 1NTRA 1YIJP 3AI2A 1J4AA 3TPCA 2PEZA 2P0YA 1QYWA 1IZ0A 4MLZA 3F6SA 2D1QA 3N2ZB 4GDFA 2VJQA 5BW6B 5KAFH 4G2TA 2ERCA 2DT5A 3TB6A 2OESA 4D8XA 4D9MA 3DDNA 1I1QB 4LOHA 5A4FS 3FQQA 1L1RA 1DHTA 2GBGA 3KAJA 3FCSB 2NAPA 4BO4A 2GRAA 1PFKA 2QQFA 2VT6A 1RKUA 3HJAA 1SEVA 5KYWA 1A88A 3O1LA 1NDQA 2ZYTX 4TWJA 4L5CA 2I1JA 2WSMA 3DCIA 4M0MA 3R5TA 3D6AA 3R5KA 2ZJZA 5A4IS 1K6XA 4S1OA 2HRRA 4EW1A 1MQ8B 3ZE0B 2Q5OA 1NU8A 1CXZA 1AQLA 2FOLA 2QPAA 2IQ5A 5BSFA 4JVOA 2QNBA 4EKEA 2XWPA 4YJDA 4R8VA 3S68A 3V4ZA 1QF9A 3VHQA 2HODA 1YJBA 3JRWA 2ODPA 4E94A 3QTBA 1ZOOA 3DAYA 2R6DA 2ZJOA 3EEFA 4ZAVA 1HJBA 1EDLA 2IHJA 2QT9A 2JF0A 2WIFA 5SV2A 2OQRA 4LJ9A 3Q0TA 3CCJP 1SG0A 3ND6A 1MJNA 3CPEA 1O5OA 2JFOA 3U49A 4N49A 2IW3A 3V8VA 5FUYA 1P31A 3CUEF 4ZAZA 1PR9A 4RKFA 1GP2A 1IUOA 3G6KA 1JMBA 4LHXA 1JG1A 5A3VA 2PUCA 4N4AA 4EY5A 2FPRA 2P9EA 1Z0ZA 3R76A 1RE4C 1EDIA 2JIZA 3RVLA 3HJNA 1L3BA 1E6EA 3SHOA 3E9RA 3M6FA 4MW9A 1HDRA 1F5NA 4KCGA 2C4HA 1GRRA 4TT3D 3JQPA 1SFOA 3EGDB 5LQCA 2HFJA 2Z0MA 1U7XA 1HNZB 2JKYA 1GNQA 2WU8A 3S2DI 3LYLA 1VLQA 5FBLB 1NW7A 2VZ8A 3UPDA 3IEIA 4LV8B 3TBFA 1QKIA 1JQAA 3RYHB 3EYWA 3V9PA 3CLRC 1UFKA 3JVDA 1UPBA 5CVVA 4DCUA 5FO1A 2LDXA 2RIRA 1K04A 3SHVA 3KVVA 3OICA 4Q16A 3L4FA 4HH2A 3P9QA 2WIGA 3CLTD 3LPNA 2A9JA 1ACMA 2VSQA 2J3HA 1A5AB 4OFXA 4RV5A 5APSA 1NRXA 1MJGA 3AC0A 4UMDA 4ZCQA 5CM2M 1SKBA 2VRNA 3WAGA 1QC5B 3HI6A 2EJBA 2YVLA 3AECC 1Q1ZA 1CYDA 3WYBA 5ALIA 4MQEB 3FMFA 1F1BA 1ZL0A 4PE5B 5AKXA 4MW6A 2KI8A 3H1JE 4IHJA 3EMKA 3KB8A 1FFDA 1JLLB 4NU0A 2X4DA 5A3JA 3LLVA 3NEPX 1V47A 3VA7A 4G41A 3TWOA 4J9UE 1HNXB 1NXPA 2AFRA 4QUEA 3KKPA 4DCCA 1FE6A 3AXTA 5C31A 2F43A 3IUJA 4ARUA 2W2KA 3URKA 1WZCA 2PZFA 3DXYA 2I33A 3PQ8A 1YS6A 5BQPA 3EXAA 3C8UA 1R9GA 3NNDA 3H1EA 4NPHA 2YFQA 3NWPA 5BPHA 2I2WA 5C5DA 5FTMA 2ZJ3A 5E8RA 3VOPA 4YX9A 2OHXA 1KYOD 3HBAA 2IUUA 1XK7A 4PZEA 1QOZA 5E4JA 4XSHA 2O6HA 4PO9A 4RV4A 5ETJA 1N8KA 1BQEA 4MUYA 4IDQA 2JWDA 4PRLA 1JT9A 2E48A 3W9SA 5D6NA 5M1BA 5EIEA 3TGPA 2H4HA 2YJ4A 1MJFA 4WBNA 1RXEA 3UTDA 1IY9A 1GDDA 4W9RA 4G0UA 1R0CA 1DCTA 3UOAB 3F6RA 3ICOA 1EFRA 2DLNA 3PNMA 4AJHA 4UM7A 1KOJA 1DRJA 1P62B 1XPRA 3HNRA 3EYAA 3LGSA 5DNUA 3FY4A 1WPRA 1SCDA 1XTKA 3DHNA 4BAUA 2QTRA 3M2PA 3EDMA 1VLLA 2W4IA 2R6MA 4AUMA 4MS1A 3T3HA 1N36B 1GT6A 1TCVA 4M83A 3CW2A 1ZM2A 3AIMA 1GPKA 4J9VA 1RRFA 4HJRA 1HE4A 4N0MA 4LJLA 3P97A 4BP8A 1BW9B 2F8MA 1A72A 3M1LA 4KZPA 1EGAA 3PGMA 2VJDA 1FZEA 1P29A 5CCDA 1PFVA 2C7VA 1AX9A 2F3PA 1K73Q 1JE1A 2A84A 1VQ7Z 3HCFA 1OYVA 4WOCA 4FEGA 1F9EA 1ZWKA 5FL3A 2FMUA 4U7PB 1KO1A 2HLHA 4N39A 2YXRB 1QTRA 3QVUA 4GVPA 3QXHA 4G5OA 4D9KA 1I3MA 1PDOA 1JZTA 1ZLXA 2AXEA 2Q5EA 2Q4ZA 3GJQA 3V33A 4WRRA 3ZGYA 4PPNA 1BHSA 3RRMA 4PNEA 1Z5OA 1ADJA 1NYTA 3P0FA 3CNEA 2GD2A 4IIDA 1EUZA 3KWFA 2WAYA 1E2DA 2PZBA 1ETHA 2YFKA 1E7WA 2P62A 1LK0A 4RSMA 2QT0A 3LDAA 3GHYA 2GJ8A 2IPMA 3C24A 1GD1O 5KJ1A 2IHKA 4PV1B 1PN3A 2HF1A 3NYRA 4YAEA 4HEJA 4Z9YA 3S2HI 3NXSA 5IAGA 1R27A 1P18A 1MC8A 3TUJC 3OA0A 4K3VA 2G40A 1VHLA 3Q6NA 2MMCA 1G6Q1 5JD4A 3UHJA 1U9ZA 2JAHA 3E3LA 2LDBA 4I6MC 1HE3A 4PX2A 1NJ6A 2QD4A 3JQAB 1RJEA 4R2IA 2N9BA 1YI2Z 3TRIA 1FJPA 2GCIA 3D7RA 1GYPA 4FGWA 5FNVF 3G68A 1O94D 1F0NA 3PHJA 4J3NA 4D9FA 4O4HB 1NZDA 5DRTA 1S3GA 2V8KA 3RUIA 3H9BA 1SVNA 2C2MA 1PS8A 3PD7A 2P3YA 3O0DA 3JYLA 3VX3A 1VHWA 1XZCA 3CVYA 1QNLA 4XYEA 1KKUA 3PDJA 1KF0A 3KSUA 3L77A 1RCUA 1OYOA 2QLFA 3BCSA 2CSXA 1Z0JA 3PPWA 4JCOA 5EQDA 2VNSA 3RAEC 1EVEA 3H0GI 4TMFA 4YREA 5LXTF 2NU8A 1XXHB 3UJAA 1PT7A 3AVOA 1J33A 2QEXP 3I76A 3AILA 5DTEA 5KVCA 4OHWA 4KWIA 3H11A 4HFMA 4ZPJA 1NW3A 1BSHA 3MIIA 4DCVA 3QBTA 5J63A 1FIUA 3T8YA 4Y2VA 1QIKA 2R8BA 3K0AA 3HOVI 2YOGA 2W2XA 2OILA 3NDIA 3IE2A 1MBZA 5K3BA 2A67A 4JI1B 3ZWMA 4QSHA 5IJ9B 4NBKA 1MH9A 3TRFA 3QFHA 3OD5A 5CR9A 3WP1B 4M8NE 1H8EA 3MSXA 1M73E 1MGPA 4TKUA 4R16A 2X8BA 3EVCA 2VT3A 4G4GA 1NTME 1T9BA 1UZMA 1IXSB 2WUEA 4IL5A 2QL9A 1QQ6A 1CR2A 1W36C 2V7EA 1JR2A 16PKA 3IP5A 3GTGA 4TGLA 3QFCA 5HUHA 3TR5A 3AR2A 1B6GA 2Z04A 1FUUA 5DKFA 2OOXB 3TQOA 2HHJA 1OXXK 1X2EA 1N6NA 4WKPA 1JI3A 3STUA 2VAXA 1AK2A 2GK4A 4FC7A 4FX2A 2H16A 4O63O 1X0VA 4EBFA 2UVPA 1QU3A 3WHKA 1ODFA 4B6JA 4CFSA 1A77A 3DAOA 4TQUS 2H6EA 4KQ2A 5IRCD 3BCCG 2ZB7A 1PG2A 1WPGA 1L5WA 2R6CA 1W9HA 4KMOA 1QTNA 1ZJZA 1H0HA 5LQNA 1NMYA 3D1VA 3W5VA 3W6ZA 5CCHD 4TL9A 1Z5GA 4PGMA 4FQ5A 4OXRA 2J08A 2CLLB 3BIOA 1ULBA 3MF4A 5JS8A 2GEKA 3PYXA 2YRWA 4PN3A 3IVCA 2QDKA 1TLTA 2YNMA 1Z6PA 2WWHA 4XYMA 3D6JA 5CYOA 4RETA 5AVXA 2I2BA 2NOAA 5LMUB 4I55B 1XCJA 1Z22A 2FLKA 3L4BC 3VNBA 1ZH2A 2BJVA 4PD4I 2IXBA 3C1UA 2P9JA 5EXTA 2PS0A 3MUEA 1FX0B 1ZAKA 3O94A 1S2EA 1X3ZA 3VAZA 1ZGHA 1EDDA 4JVSB 3KT6A 1GLVA 4QU9A 3R2PA 1YVEI 3V2RA 4N6NA 3FOZA 4CF5A 2IDMA 3Q1LA 1Z15A 3NOVA 4RORA 2YINC 2ILTA 3ZWOA 4HF7A 2XTNA 2AZDA 5NLLA 2OTJ1 4QDJA 1XCBA 3GZJA 3I28A 4YCNA 4G9GA 3IALA 4NG4A 1A02F 3BZWA 3OX1A 4ZCMA 3QFRA 3QU7A 3INNA 2JLWA 1IONA 4HVAA 2NO5A 3AETA 4ZYTA 4YMHA 1UOEA 4MVJI 2OM2A 1TTHA 1G8KA 4Q05A 2ZI4A 4ZOLB 1XWWA 3GGCA 4Y3UA 2Z1MA 4HDKA 4X6XA 3KOWA 3CCVZ 1K92A 1WC2A 2VZ0A 5HTKA 1TLFA 4FT4A 5I9SA 4HAWA 4PSVA 4L8WB 1VPLA 4O6VA 3A0RB 2CYAA 2YCLA 2PZEA 5A0TA 3PVSA 1U8ZA 2REQB 4KBYA 5CUQA 3QU9A 4BKPA 1PTKA 4EEZA 4TTPA 1JNXX 4O2BB 3IAOA 3OZDA 4HNVA 4DVGA 4AULA 2R3SA 1EK1A 3ZZTA 3ZJ5A 2HN9A 4AJPA 1C3OB 1HLDA 1B7GO 1NSFA 5D01A 4DAOA 5L8RJ 1G8SA 3F0TA 4YAOA 2CVQA 4ZQIA 1Z0KA 4B3IA 1FNNA 5AR1A 3JQ8B 3GLTA 3GY0A 1ZJ6A 4ZVPA 4G37A 3U80A 1N6KA 5GINE 3N5KA 4C7OA 4FDMA 2AWOA 3W3AA 1GPJA 2CVOA 4X1YB 2C83A 3ZHZA 3HA7A 3UPUA 1A9TA 1XTTA 4PCLA 1KZ4A 1CC1S 3T4PA 2GPTA 1QVFO 2A0FA 3IJ5A 2YWHA 2Z2JA 3I6IA 1OHHD 1NGMB 1DB3A 5HPYB 2IODA 1PS9A 1Z01A 4NYIR 2XMGA 3RF7A 4JL8A 3L37A 4URZR 3EMVA 4LRXA 1R5BA 3A14A 2W2VA 2D4AA 1UBNA 1NXQA 3HYSA 3T3IA 3ESRA 1WZIA 1AKVA 1EFVB 2F55A 1WCXA 2QRGA 3N2KA 4KPEC 1Y3BE 4M46A 2A58A 2IKQA 1U9CA 3KDSE 1VQ41 4I2LC 1NTKG 1B2RA 2W6OA 3M6MD 2JEYA 3JVUA 1E6UA 1VE3A 2QM8A 1E5VA 4J3JA 3EF0A 1S3JA 1GZ7A 1LBSA 1S5LE 2C9LY 3NX4A 4QSMA 5GTIH 3C8MA 5E0KB 1G5RA 2ETVA 1MOPA 2J6IA 1JXOA 4QU8A 4OK3A 3LUHA 2C45A 4C07A 1QVAA 5B7PA 4NEHB 3ANSA 1NRIA 2X2PA 4QPJC 4P6VF 3RC9A 3REQB 5IKPA 1S5PA 1HX7A 4FD2A 1E2MA 3PRJA 4WOJA 4OJQA 4E21A 1J2JA 4YS6A 1CF4A 2Y99A 3DFZA 4LF8B 2C5EA 4G6ZA 1VLMA 3OF2A 5JVDB 4F5YA 3GQBB 3T4EA 3SKVA 4C89A 1SUPA 5BVGA 1AKTA 4L6IA 2FEKA 3VTNA 2WT7B 1IZNB 4DIMA 2VF1A 3LY9A 4QEZA 3OZCA 3STYA 1PD0A 2ZZNA 4N3BA 2R5BA 2WD9A 3GLFE 2EWVA 4KDRA 3PUKA 1V7PC 3A1UA 2WUWE 5MF6A 3FXAA 2ACVA 5H82A 2KZIA 3C3WA 1JPVA 4YDRA 5EIAA 3MQFA 1HMYA 2P6PA 5BYJA 4EY3A 3HRNA 4OYHA 2YICA 2OO3A 2D13A 2YUIA 5KPDA 4XUEA 1LDEA 4MVYA 4QXRA 1NRJB 1P7ZA 2RHLA 4IICA 4Q9AA 2I5PO 2I1QA 1IK7A 2X7JA 4ZEWA 4JEUA 1XROA 2ORWA 1CUVA 3U3XA 4I19A 2FEXA 3LWDA 2VFAA 1PT1A 1NQXA 2RGNA 3BK2A 2HZ7A 1E18A 2CVZA 1UBEA 4ZVVA 1SFCC 2I2AA 3ONFA 2QA4Z 2Y77A 1T5TA 4ITUA 4D45A 1UJNA 4UB6H 3EDQA 4LY3A 2W6AA 2KLUA 2ZJ8A 5AVVB 5AHOA 1BE6A 2AVDA 4F8YA 2PNJA 3FHJA 1FQWA 5KTNA 3HP4A 1WOYA 4G0MA 1FZFA 3B2QA 4R51A 4XX2A 1I4DD 4KYTA 4RK1A 1H8HA 1KJZA 3CCFA 2V5VA 4UE2A 4KIUA 3GN2A 5FLKA 1Q7Y2 1RCTE 4G67A 3WJ7A 2G28A 2C29D 1KB9H 2G2KA 1T4GA 1HDOA 2N1MA 4XX0B 4B3MB 4GWGA 4S05A 4RF2A 3O3MB 4LXYA 4F7WA 1UKVY 3ZOZA 5IZ4A 3BL6A 1JWLA 3M0DC 3HZRA 1QK5A 1WDMA 4A3MI 5CA0B 4B85A 5FDFA 4G0YA 3WUTA 3U44B 4K6KA 1A4UA 2DG2A 4HAZA 1QDEA 3K2QA 3KVNA 4BO9A 2QP4A 1KOGA 3BWBA 3CE6A 3MK31 3MQ2A 5LZ2A 3MGCA 1XJ5A 4N5DA 1Y1LA 1XVIA 4QQFA 4WADA 1WTCA 3UWKA 2PBFA 4GA6A 3ZWWA 3WX0A 1AW8B 1PK7A 3PXDA 5ALDA 5ALLA 4RXMA 3Q5DA 4BC0A 4CIBA 3C48A 3DT8A 5FPYA 1G7SA 2WPDA 2D2CD 1KYWA 3L7AA 3OJ0A 4GC9A 4YA6A 2JLXA 2CCGA 3KWLA 2QYSA 4R9SA 2X7XA 5E1MA 1YNSA 3DUFA 1T6NA 2HCTA 1EYZA 3S55A 2DCMA 4MGZR 1G0OA 1K98A 3PDIA 3ASZA 5HCUA 1IUKA 1WAMA 4AZ0B 1X1BA 2L91A 3WK7A 2EJVA 2ZT9B 1QCZA 3GFQA 2F4OA 4NY1A 3NOXA 4F3NA 1M1NB 1T1RA 3NXKA 4EI8A 4F46A 3PHGA 2KHZA 1SUCA 1RBZA 1LK7A 1CZRA 2YZMA 3HYRA 2OB2A 3D9QX 2N1TB 1CSBA 1TWFI 4G5FA 2BJHA 5F78A 4LJ5A 1PEKE 2I3AA 4H0LB 2H1VA 5GVSA 4XLZA 4JJOA 4FTWA 1L4KA 2C2OA 1K86A 5CCXA 1HWTC 3CEHA 3A31A 2Q0HA 1J56A 3V8PA 2QBYA 2VWQA 2X0IA 4GS5A 2FDRA 4LV6A 4M0EA 4POAA 5KAIE 4TQGA 3W2EA 3A0BH 2C96A 1XTVA 2Z56A 3GIDA 2F9FA 3VMZA 3GLHA 3FHTA 1LW7A 1IAVA 2Q1TA 2H1SA 2XTMA 3VVLA 4BVJA 4R2LA 2NU7B 4QUGA 1CHNA 2J9FB 1D4ZA 2IUTA 5E7JA 4B79A 3L43A 4XFDA 1VJRA 4CMBA 1NMXA 1P84I 3CQ9A 2GA8A 3HY3A 4PC3A 3H1LE 4F6LA 1UMBB 5CB6A 1VCHA 3OZRA 3C3BA 3S4YA 1Q14A 5FCDA 4DJDC 1POXA 1C1DA 2GHQA 3IJRA 4RIHA 4DUGD 4S1TA 1EXMA 2O5RA 1QZTA 3NYWA 3JVIA 1OVGA 2JVIA 2FZGA 3U4HA 2G06A 2OWDA 2YXDA 3ZDXB 1E1QD 4A1FA 4PLVA 3OJAB 1U2GC 1NW8A 1VI2A 5JFTA 1QAQA 3UWMA 5I9LA 2Q5HA 1HM5A 3OO1A 1YZKA 3ZLTA 4AY4A 1FW6A 1J1IA 2PT7A 2Q3JA 3CMMA 1N2CE 2QEQA 1XZMA 4MVXA 3F4LA 4QM6A 1Y3CE 1V8PA 3GC6A 1MB2A 4TTJA 4B3JA 3LT5A 4DBLE 2A1UA 3JQEA 1K7XB 1QZ3A 3WP0A 3IX0A 1Z8NA 1CQZA 3IBYA 4EPVA 4MB0A 3CPWZ 1VZ3A 2GTIA 3QUQA 3ANMA 3IUSA 3U3DA 4DR2B 1BEZA 3M6UA 3R40A 4LZPA 2OKGA 4DNXA 2IXGA 4R84A 2XRMA 3W1EA 2GAIA 3SP1A 4KO1S 3MWKA 1W47A 3GTOI 1EFCA 2Q3FA 3CSUA 1NDUA 4C0WA 1QHFA 1OOEA 4XTCS 4DCGA 4C30A 4MRNA 1GCAA 4RUKA 1E61A 3V2GA 3HFGA 1V71A 3B70A 1LLDA 3DO8A 1RE0A 2EIHA 5KTBA 4XIFA 2I2DA 1W5FA 3PYLA 1P5HA 2YO3A 3ZDQA 1QUFA 1S2OA 2MMGA 2JBHA 3MNFA 1D9XA 1WS6A 1W73A 3TLZA 1EZVI 2CZGA 4Y6OA 3CCLP 3NHPA 5ALUA 1U65A 4P2BA 2Z9DA 1S8NA 1X39A 1Y9EA 3E03A 2IEYA 1ZV8A 3OO0A 3A2MA 3T34A 4O1MA 4RADA 3WLAA 2GERA 4DHEA 3VSDA 3LL7A 5EVCA 4IKPA 3FCEA 1KD1Q 1E2IA 1REQB 4EY6A 2IW1A 3ROGA 1M6HA 2PG3A 4PX5A 2WC1A 2X0KA 3GTMI 2MCFA 1S7CA 4ZCRA 1BE3E 4B8WA 5AO9A 4M9CA 4AJEA 2CDBA 2OOKA 3AEFC 2NT4A 1PU2A 4OYRA 2GVDC 3OECA 4L3WA 3DZGA 2IOFK 2GVNA 4KPFC 2DRIA 3ZC3A 2G9ZA 3W9UA 5CM8B 3BXFA 1URQA 4PU0A 3ZW9A 3SUJA 4K9LA 3Q3DA 3LYHA 5TISH 4HEQA 4JC5A 1I32A 1KEPA 1N77A 4YJ3A 1Q0ZA 2NZ8A 1GADO 5EJMA 4MV9A 4PZ0A 2Q8NA 1W5TA 4M8SA 2O48X 2C4KA 2QXYA 4O4LF 5LP6B 1U57A 2JZCA 3MWEA 1DQZA 4R2JA 2RCNA 1E1LA 2FYNB 4DM7A 4BNWA 1L0NK 5D51S 1PZNA 3PJGA 4LF7B 1F48A 4GFDA 1NNUA 3EDCA 4Z7JA 4HRVA 5DE3A 4ESEA 4Z0PA 3EWIA 4K6HA 4YQFA 2ID4A 5FV4A 3PDWA 4M9QA 5ES4B 4YHHB 4YI5A 1KBQA 2QTAA 4MX8A 1N0IA 3TRDA 4EYEA 3GTPA 5CK4A 4JGIA 2A45G 4Q21A 2P9CA 1WCMI 3LM8A 4ND4A 1QK3A 4DQUA 1NBIA 5AVWA 3DFMA 3SJZA 1EEXB 1D1SA 5AOCA 2X23A 4Y98A 1P77A 4NBGA 3WNQA 3QKTA 4KW7A 3QVSA 4JBLA 3PTZA 3DBLA 3DUWA 3F8TA 4XGIA 5IK2D 4MQUA 2GNOA 3ZH9B 3IS3A 3RK0A 2YUTA 1P2GA 4HZGA 2AX3A 4OQPA 3OE4A 5HKKD 2EFHB 1WVMA 2BMAA 4RD4A 3F73A 3LF1A 4XEUA 4FFLA 1Z9BA 3O8RA 1YR7A 1MH1A 1XZLA 2YY7A 4DIUA 1LDNA 2CEAA 2VPTA 3L1IA 4DNOA 4MDHA 4K2AA 3VNRA 2QIWA 1ZUWA 4KGVA 3WHIA 1HL7A 3SC2B 3CIOA 3GJZA 8AT1A 2IFTA 2A2ZA 3FJ1A 3GA5A 3NT5A 5JBIA 4X64B 1SRRA 1DOAA 4UVDA 4XB1A 1MVLA 4OQXA 1YHYA 2XUZA 2AFIB 1PYQA 4GMKA 3BJRA 4JQ0D 1HOTA 5BRJA 3KQWA 5AVTB 1ONPA 1WQ1R 5ESRA 2XNSA 1A96A 4ER7A 1R15A 1VPDA 2XZPA 4KV9A 3GRCA 1VJDA 1HE8B 1ISJA 121PA 1SQBK 1L9XA 1QHXA 1ECPA 3SZ3A 4MRMB 2PH5A 3EAQA 3I6MA 4FERA 3QKRB 3H9CA 4QHTA 1DX9A 2O8DB 2XVAA 3O6QB 3LW7A 5K51A 3OKFA 3C8DA 1GL9B 3UB4A 1GRQA 5K3CA 3CPHA 4DRZA 1KQGB 5KKCA 1CF2O 3DOOA 2NVXI 4YRAA 1T3GA 1PP9J 4OIFA 2BZSA 1ZI8A 5JWHA 1NNLA 4AOKB 1WXIA 2EYUA 3R9WA 1N8RQ 3WQHA 4IVNA 3M89A 4HYQA 1WKCA 3GMSA 4DDTA 1Y9BA 2ZSDA 5H4UA 2ZSKA 1LTJC 3Q72A 4CL1A 3E2PA 3K6KA 4HGOA 2RCYA 5C34B 4GMGA 1UJ6A 3SXUA 4MI1A 2IWRA 3DWGA 4RGYA 1EE9A 4ALJA 4GAEA 2R1VA 1N73C 3QI2A 5T57A 2OFOA 1MO4A 5JJLA 3CCCA 2F3SA 3KQKA 4II7A 4UKDA 4H18A 2AMLA 2FFHA 3DKPA 2KSEA 5HSGA 4RULA 2OYCA 1R9TI 4EWCA 4NH0A 1DIBA 3VZSA 1KYOH 1GW4A 2ZS8A 1GKUB 5JDCA 4HNRA 5KVVA 3I58A 3ZK9A 1KN7A 2HPCA 1EB9A 3I2IA 3OSZA 5J4LA 3NJ4A 2JLVA 1TKCA 3D8TA 1A7KA 1YJ8A 4L95C 5EIFA 1QP4A 1KDPA 2DQ4A 4LTDA 1XJQA 3FVQA 4HX9A 3ED5A 3IV6A 1Q812 4EHNA 1XK6A 3QV1A 1ZCJA 4QUHA 1ABEA 3SE0A 1S4MA 1DOZA 4JP6A 3AR6A 1UBFA 3CKYA 3PD0A 3U1BA 4CMJA 5FEMA 2DKFA 4P4SA 4NDZA 1GL3A 3T4NB 2EG9A 2A9RA 1RBQA 1ACLA 2WT8A 4JLAA 4EHBA 3HXLA 1KYIA 2V9CA 4CCAA 3VPHA 5CFLA 1HFJA 1Q20A 2HMSA 3U2QA 3OAAA 1GFIA 4HOYA 5EZSA 4KR0A 4PANA 2XYPA 3UMVA 3X3HA 1PP9D 3M3PA 4KQ1A 2QM7A 1VQLP 4WZZA 4X44A 2WSIA 3E58A 2E4VA 2G4CA 2O0KA 2ZXUA 4DMCA 4D9HA 1HBWA 3OOWA 2KBEA 4OEHA 1QYXA 2CLKB 4LN1A 3D3KA 3ZCXA 1XJWA 2I4MA 4J2OA 1YE5A 4C0AC 5BV1A 3AM5A 2GH1A 3PL5A 1RFLA 1PR3A 2WJ4A 1BO6A 1BVYF 1VL1A 1FEZA 3B7GA 4CCYB 1OIVA 1J20A 4AXXA 5IMSA 1NKZB 4NJEB 4ZHSA 1RNIA 2WM8A 3DYBA 1EDBA 1JEYB 4C3VA 2GN6A 3F49S 4ZARA 3INRA 1EFAA 2QUIA 3LU1A 5KYXB 3N87A 3ZDAA 4PPFA 2FCAA 1CZUA 1P4AA 1BS2A 1QRUA 1YI0A 4Y18A 1LA2A 1NN0A 2IPXA 2ZVDA 4C14A 1U1IA 1T2UA 3QMMA 2ZFCA 2PT5A 1QDNA 5MFZA 2LP4Y 4IGIA 2RBKA 4F8EA 4RSGA 4B3FX 4GLJA 1C3EA 2GJ4A 5I7AA 1R88A 2HA2A 2AW3A 4JR2A 4LZZA 1GARA 5C7YA 4YRLA 1RXWA 1NJI2 2GYVA 1O8CA 4LJKA 1AU9A 1BRTA 3K2EA 4PFSA 1VQ9Z 5IBRA 4YCMA 4BTLA 4OQEA 5APQA 3BG0B 3ME5A 1T4BA 5D7NA 1E5WA 1V5EA 4EUSA 3KEGA 2XX3A 1PK9A 5K5EA 2BSAA 1J24A 3DVAA 2WTBA 4U2EA 1ZVQA 2F4NA 5FXMA 5HZMA 3ENQA 3MRVA 3FOWA 1V4NA 3OQBA 3QYJA 3OA2A 4GX5A 4YAJA 2NO4A 3AFMA 2I66A 3ST7A 1RAGA 4BWYA 2OORC 1LVGA 3ML1A 3AE5C 6REQA 1IVSA 2KW5A 2ODAA 2VNKA 5TGTA 1QOPB 3KAKA 3OZBA 4MYCA 3LUDA 2B4KA 1TYZA 1KU0A 4ZGBA 1XRJA 4JU8A 1I9GA 1D0IA 1SQXK 1UXGA 1IIRA 3M6AA 3CTMA 1USDA 1NJ2A 2B21A 1P8JA 3QENA 2P7IA 3IPCA 2M9MA 2AK3A 3OJOA 1G7TA 3AV0B 4NJMB 3CLUC 4TV9A 3T0GA 1SQQJ 4E6PA 3C6MA 2XH8A 2FKAA 1NTZE 4U3JA 5GGYA 5IHXA 1VIAA 2EQBA 4E7PA 2EX1A 2JFZA 4EPYA 3OUUA 3CPJB 4BLUA 5KOHA 1Y5LA 4YMTA 1PT0A 4FGLA 1K88A 1LCIA 5ILGA 1ADYA 1VBFA 4TM7A 1HTBA 4C87A 1Z26A 3NBMA 2NZ2A 2FOIA 2VNHA 3N76A 1M6YA 1DEKA 5I9NA 4I8XA 4JUDX 2OCXA 3ZWDA 3E8XA 4YPFA 3IT2A 3R44A 1U6KA 4B71A 2ZR0A 3LSYA 3GLRA 1OIWA 1PJ3A 3O2JA 5F9MA 4YMGA 4PWZA 2W2LD 3DT9A 1ZD5A 4NAUA 2AOWA 4QBHA 1OFVA 2VRSA 5G3YA 1Z74A 2BWJA 4Q7QA 4O4HF 5BSTA 4HH4A 3UAXA 4Z3DA 1UFRA 1ULHA 2YIUC 4LY0A 1RWBA 2XYVA 3RJZA 1SQFA 4GBED 4LNUA 3HZZA 2FSPA 2ON6A 4R98A 3ZTYA 4A92A 4WECA 1CK4A 2X42A 1VP9A 4YV7A 1IK9A 1OTXA 5BR8B 1KILB 1UZNA 3GVXA 2HIGA 2VXCA 1R74A 1GMJA 1D6SA 3ERCA 3PVZA 3R0QA 2VL7A 3TJRA 1IXYA 1QV7A 4NBAA 3VGPA 4W9NA 3R2JA 1JF8A 4P31A 5HJ7A 1Z39A 3MGBA 5I8ZA 1QG0A 2PXXA 2XE8A 5AUQA 2A0XA 3L18A 4TM8A 2VVTA 1VB3A 1IXZA 5JU6A 3CMCO 1ZA2A 1D6MA 1SQQD 4LVUA 2OR3A 5FLYA 1LI7A 1TJYA 3E9YA 3A7DA 4IBOA 2Q4OA 3O6VA 2FPIB 2VUMI 2XA9A 4GXTA 4D3FA 4DWJA 2SHKA 3C6YA 2ZZMA 1VGRA 3OCJA 4V1CI 1KEEA 2Y2UA 3IUMA 3H1KE 3JS5A 1FFCA 2BMWA 3L72J 4A8JA 2HTEA 3RC8A 2BR4A 1QHHA 3ROQA 1VRWA 3WLOA 4AKEA 2QPOA 2OV1A 2GMWA 2ES4A 3ZVMA 1ZRTE 5K4GA 4TQAA 3QKUA 4CUZA 3S27A 3H1JG 3L1JA 4M1KA 3W1WA 4YUWA 2RGEA 3GD5A 2A3NA 4YR9A 5KYKA 3U31A 4FDVA 1OFTA 3EXHB 2NYRA 2ZR9A 1RRGA 4EATA 4MDEA 3ZS8A 4RVDA 5K0EA 4KH1A 3NVAA 3RD5A 3WGGA 3A6EA 3PQ6A 1TTPB 4GLFA 1M1K2 4Q9JA 2Z9BA 4K8RB 1E32A 1FDUA 3QSGA 3N7NA 3NETA 4TLCA 1L4FA 4ZAYA 1E3QA 4RTPA 4R71A 2EFDB 2BKUA 3DPUA 5KNDH 4FINA 3JCUH 1AUQA 1AQJA 4FSDA 4UQLA 4EI9A 1K9M1 3GZTB 4XFJA 1ULSA 3WQRA 5IJAA 4WVZA 1MD9A 3HCRA 4L4UA 3CRVA 4BKMA 1VZ2A 1Q862 3PZRA 3UG7A 5KSZA 4I55F 4IIJB 1WUKS 3K7AI 2PU5A 1BX3A 3K9CA 2QVZX 3SS7X 5A2QA 3GCFA 3E82A 3LY5A 3NHBA 2AEEA 3W7AA 4N65A 4EQ6A 3A1NA 3F6CA 5JQGB 5EPOA 4OJYA 5B5EH 3PQCA 2VHEA 1HEUA 3GTQI 4IXDA 4CMCA 2CCJA 5DB4A 1UT5A 2F8LA 5KCMA 2GBLA 3TG8A 1N7HA 2P78A 5L6LB 2XSZA 4PLHA 1GU1A 4YAGA 3Q2OA 1J25A 3DTYA 2XB8A 2EW8A 2OHOA 3F89A 3I55P 3VHXB 2WT4A 1AGXA 5CEFA 1FB5A 3CCSZ 1G3UA 5A04A 4JLNA 4ND2A 4D4KA 2BGIA 5LZ8A 3NBAA 2YOFA 1PPJE 5DM4A 1VQNP 3L72D 4BFZA 4N76A 1DE0A 4IMPA 3ZQ6A 1W2WB 3H2YA 3O2QB 1AIPA 2DPHA 2ZI3A 2XY4A 4CEHA 2HLDD 3S2UA 1KQSO 4Z7QB 2IDKA 3EPRA 4EOGA 3G4SZ 2GSWA 4NBSA 5DMXA 3JQFA 3PXGA 3FE2A 4FPXA 4Q4JA 4DPLA 2B3DA 3BGIA 1QANA 1K7EB 4CW7A 2G80A 3HB9A 4D8YA 4B17A 1K68A 5H4GA 4ZOLF 4Y30A 1SZJG 5F98A 3BVHA 3PR1A 3UZUA 2Z1DA 3DKVA 2VNAA 2IS4A 1JAHA 3ZVLA 3OOYA 1MOQA 5LMZA 1FFXB 4CM8B 2X5XA 3L84A 1BXKA 1ELOA 2FNAA 1Q95A 4IF4A 4DYHA 2CN1A 3GUYA 1NVXQ 4J0DA 4C7KA 1OXVA 4MQ4A 4RVFA 1KI6B 1EWYA 4FWBA 1U28C 4O2BF 3CLVA 1NP3A 2FYUJ 1RNLA 2B83A 5BYBA 1RXVA 3AI1A 2QG4A 6PFKA 2W6CX 5DXJA 3Q6IA 5FOWA 4UHBA 4EGQA 3OCCA 5JOQA 3AM4A 4JQZA 4BO3A 1R5JA 1JCDA 1ZVKA 4MITA 2WICA 3CUUA 2Q29A 5MN4A 2DECA 1HK7A 4HKTA 4WJKB 1JQ3A 2P5UA 3T94A 3F7NA 4RLQA 2VXOA 2Q1SA 3BMCB 3EBLA 1U3DA 4RYDA 1D8AA 4BBSI 3WR5A 5IT0A 1E1KA 3BULA 2XUJA 3IQWA 5F5LA 1G8HA 1GAQA 1ISPA 4GSYA 3WIDA 1J1UA 2PKYX 3GR6A 3UW1A 4TMXA 3JCZA 3ZE7A 1INLA 1F8FA 2OG2A 3X2OA 2QA5A 2WA2A 3ELUA 5IBPA 2VSFA 3DL2A 2C7QA 4XQCA 2JFNA 3FNGA 1AG9A 1NX9A 2AOUA 3V2NA 5L3SA 1FOSE 1VIMA 5BWLA 4ZK6A 4AO7A 3O4RA 4JBYA 3C8VA 3EGVA 3T9EA 2EL7A 5AQ1A 4WPGA 1T0JB 4PLYA 3QXGA 3KEQA 1EESA 1XA3A 3G02A 2GTHA 1GGKA 4G09A 1FVXA 1QB8A 2NV6A 1VKRA 5AHRA 1I3KA 5ALTA 3RW9A 2H11A 3K70D 4G1CA 5F1PA 3QLVC 3H1PA 3M9QA 2YIDA 5IJ0B 4A3BI 4NOHA 3D8BA 3O82A 2GEDA 1WEKA 2CLCX 1CIPA 4L4SA 3IIEA 3KTAA 4E4TA 3PCXA 2YJTD 2Z5FA 2XYHA 3BGVA 4ZZ0A 5K03A 2QAGB 3T97B 1G17A 5J2UF 2K7ZA 4L4XA 1ITZA 7REQB 3TI9A 1NTMG 2FYUD 2KJQA 4QNNA 1NU1K 1LB1B 2C8LA 5D86A 3KWMA 4BTEA 1Z0IA 3OMWA 3CE9A 1X7YB 2JJMA 3WK6A 4KTVE 4QU0A 3C4JA 2HGZA 5TQ2A 3NH5A 3CGGA 1NVFA 2FXOA 3AF0A 4ZI7B 3O7WA 4B5KA 5C8DA 1RSZA 4WINA 2WUFA 2PX5A 4L0CA 4CIDA 3ZHCA 4KRXA 4I4TB 4GPBA 1W85B 3ZE8A 3LDGA 2JVKA 3W68A 2I6XA 3W3ZB 4DN6A 3RK3E 2CHEA 3VU3A 4Z54A 4KQFA 5EHXA 2R65A 1KJJA 2I1KA 3FTEA 2ST1A 3TDNA 1FSPA 3IAEA 1CUIA 5LOVA 1XMVA 2IHVA 2OCAA 3BHMA 1S9KE 2NUPB 4O59O 5D3MB 1PJQA 4H44D 3EOAI 4URHA 5AJWA 1AGPA 4GRIA 2J9ZB 1RH5B 4P38A 1TEHA 2WDZA 3EZGA 5G40A 3WRVA 4HUQA 3H32B 2UUPA 4NRDA 4CM6A 3VNQA 4NBVA 3HSYA 1Z02A 4Y52I 1L1EA 3I4CA 2AJLI 2PVCA 1EDZA 4YYZA 3WFZA 5JD5A 4LISA 2JGJA 1KY4A 4YWJA 1Q3HA 4EHKA 2FMTA 3TW0A 1NRWA 2XNKA 4YBZA 1OTYA 2CMKA 1KXJA 4G8DA 3OCWA 2A5LA 4KVFA 3MT0A 2I65A 3KCNA 4DSNA 1Q7RA 4PO1A 4REMA 4G0XA 1IC6A 3CZ5A 4KG7A 5IXYA 3V6IA 1NOHA 2FSSA 4IUBS 4LPKA 3EN0A 4LK3A 1H3EA 3HJFA 1FDOA 1D2MA 2IYOA 5KLVK 3IUYA 4KR2A 3FCYA 2F8TA 5KQMA 2DH5A 1L8QA 4K9KA 1KI9A 3R6TA 1C5KA 2QN1A 4L9SA 5CA0F 2NVYA 2ZB3A 1DIPA 3SX0A 4G5HA 4DQ0A 3AE9C 4INZA 4PG8A 1RAEA 1M2VB 3O2NA 5ICGA 4N5NA 4UTOA 3NHAA 4XJXA 1HQDA 3O8OA 2M5AB 4K6OA 3K09C 4KX5A 1XMIA 5GP1A 1KH2A 1TK3A 3BRCA 4Q01A 2XQJA 5LQKA 5A4AA 3AEKA 3EVZA 2X7HA 1Y7HA 2O3RA 3GEHA 1ZH4A 1XTSA 1OYYA 3RH0A 4MEBA 2O53A 1JR3A 3KOYA 4R41A 4BRYA 2WP0A 3N4XA 4DCJA 4TUYB 4BTVA 3GEIA 1IM5A 4WDRA 3RGGA 1ISIA 2P91A 1U3TA 1U2DA 2VKQA 3SSOA 4DL9A 1VHJA 1QNFA 2YVKA 2WRZA 5ITZB 2A5YB 2DETA 4BQEA 4KNYA 2ENWA 3THYB 4ERXA 3B8HA 3JY6A 5ELLA 4FKMA 4QTTB 2H5EA 1XLUA 3FZYA 4Q03A 3PU6A 2YYAA 1N2CB 4PYLA 5IULC 4EHJA 5FBZA 1YBHA 3HCCA 4B47A 2H4YA 3URMA 1F2TA 4XB2A 4K86A 1Y0BA 1DKUA 3R24A 4EJMA 4URFA 2JI9A 3FYUB 4Z0TA 1RO0A 1Y5IA 3VR5D 3LKBA 1Y4DE 1YIOA 3A1VA 5K6RA 4RPJA 5C81A 3DHYA 2H2FA 4AUEA 2ZANA 3ROKA 1XFDA 4RDXA 3OLCX 4NABA 2UZ4A 3IMFA 2Q7OE 3F5SA 1K8RA 2EW1A 2B1RA 5KOJB 3VX4A 2CEKA 4BN4A 2Z57A 2QIPA 4Y67A 5FL7A 3WRXC 2P4QA 4K9DA 3RK4A 1RMYA 4P22A 3GEEA 3ZLUA 2D5BA 3EWSA 1PT8A 3NO4A 3ZJ4A 1ATZA 1X13A 4UUMA 1KI2A 3VZCA 3Q8MA 1FJGB 2PMCA 4CM1A 3OZIA 4BV2A 3RG8A 1SUEA 3HXTA 4HTAA 3RUEA 3WK8A 3JQ7A 4U7JA 1G21B 5HDQA 4P0PB 3QXCA 1X14A 2UYCA 4EG8A 3L4JA 2GA1A 2V1XA 5AM2A 5FB3A 3SEZA 2CFCA 3D1JA 1GTZA 3I9LA 2XKKA 2DT8A 1UANA 1NI4A 5FYDA 1DG1G 1IY0A 3B36A 2D1RA 2CV2A 3L70G 1OH5A 2H59A 1EVLA 1L4YA 4IJUA 2C5HA 4CE6A 1DC6A 2JB9A 3W8RA 3A6PC 4FWTA 5KNDD 2BR3A 4QPDA 1Z08A 2IUYA 2DSNA 5AW8A 1FSFA 2UWJE 3LW5J 4XGQA 1K97A 4JOCA 4PPQA 2PFKA 3AYZB 3P8CE 1JDBB 1P1JA 1DOHA 2EEOB 4MA4A 3LT0A 3UXEA 1KC1A 3MUNA 2PYIA 3SLKA 4AS1A 3S29A 3KBOA 1WUJS 1LXCA 3A3PA 4M0DA 2IFNA 4DXHA 1H23A 1Z82A 4GP6A 2XOXA 4X91A 4GICA 4LDRA 5DJTB 4WUVA 3WOHA 1E3MA 3WGZA 4IL6H 1T0HB 5JFOA 1L4GA 4DWVA 1Y9JA 4GPD1 3ICWA 3U1VA 3QEJA 3V2IA 1ML8A 3FBTA 4FGSA 1W0KD 3UOGA 1NP6A 3GWGA 1T1SA 1EHIA 4AX8A 4C08A 3T1QA 1L0LK 3U60B 1LDGA 2P1DA 4ZC8A 2C88A 1H5UA 2FLVA 2X9VA 4MMXB 2Q6KA 3LCUA 4RA6A 4LXUA 1K4MA 3PE3A 5AI0A 5BSMA 2H1IA 1O97C 4L08A 4IR7A 4D9CA 3V2PA 2XNCA 1PLLA 3GRAA 3WICA 4V0LA 2X6TA 1I7PA 1VP3A 5CH5A 1E2UA 4Q1BA 4MDFA 1UKCA 1KNXA 3N7AA 4UFPA 2PVSA 5FTLA 3KHUA 1E64A 1W88B 3WMEA 3DAHA 2ONKA 4LDQA 5CP8A 4KL8S 4AXBA 3CW8X 1H88A 1U1CA 3CC41 4XDZA 3TQHA 1WT6A 2IEBA 4JJAA 1EP1B 3UKOA 2OP0A 2G9RA 1GCUA 3WO1A 3DE2X 4A0GA 5A5GA 3O8BA 3GO4A 2YKGA 1J49A 4XZ3A 4BJ6A 3JQ6A 3HV0A 3U1AA 4U2KA 4NV1A 2ZVQX 4OKSA 4MV1A 3RQSA 1HDGO 2IY9A 3S2ZA 5JW6A 5BMVA 1K83A 4QQ8A 2O4UX 2JANA 4CT0A 4TROA 1XZJA 3F74A 5CG2A 2H17A 1ML4A 3EH2A 4Q4LA 4YP6A 1UBHS 1XA0A 4WESB 3A1TA 3COVA 3PEEA 1R8QA 3T1HB 3DSRA 1V16A 3VHRA 2XGSA 4ZCSA 3L0ZA 4PGFA 1BWQA 3OPYA 1VYHA 1KAQA 3O21A 1CVIA 1NQTA 4R69A 2M1ZA 4KWTA 1VPWA 3I5CA 1SKYE 3L74J 1NV8A 1XAHA 2IZ4A 1QWOA 3FGPA 4D97A 1UJMA 1BJKA 1G8JA 2FP3A 1CB7A 1E3TA 4YCLA 3I01M 1ZK0A 4ARSA 2I2CA 1D7AA 3W2GA 2P67A 3VI3B 2JMOA 1CY2A 2HUPA 1NXOA 5ITSA 2IF2A 3KYBA 4D43A 4XR9A 5LR6A 1KO4A 2YWRA 4REQA 1D2HA 1YJWZ 1WO8A 4OGQB 3N07A 3SBOA 1IZ8A 3KSMA 4I2VA 1NKSA 2WZCA 4ENUA 4BX2A 3SZLA 3I1FA 3G6EZ 1PVVA 2FVYA 3L4EA 4B74A 3NWEA 4NENA 2HNKA 3Q7RA 4XWWA 4B3XA 1OX5A 2QU8A 1V1MA 3VYSB 3AKZA 2R9VA 5ICEA 3PC2A 2FOXA 4A0HA 2WLSA 2IXDA 3DB1A 1IU9A 2QTFA 4IFMA 2I91A 5BYKA 4CFZA 4P81A 1OLOA 3DZDA 3KTOA 2HHHB 3JQGB 3H2BA 4ZDKA 4CWAA 1G2IA 3QLUA 2VF2A 4J6EA 1SQPK 5GMOA 1LU9A 1L5LA 4M1MA 4B0OA 4G24A 1AQYA 1M8FA 2JLSA 2R4TA 4IDCA 5K45A 2J6BA 3A26A 3LUKA 1TQHA 2OFFA 1UXHA 2NYVA 3AW9A 2V74B 3PNSA 3CX5I 1VPCA 1KHHA 2JD2A 3F4KA 2JGDA 4G8JA 2VS1A 1SVOA 3AE7C 3E8MA 2NVUA 4EHLA 3SQXA 1IXRC 2NUTA 4EX7A 1FU8A 1G4AE 1BRMA 3JAMA 4AJNA 4V0NA 2VAPA 3T9DA 4M55A 4AM8A 4PYMA 1WTAA 3ZGLA 4WCFA 3NT4A 3L74D 3RUHA 4QIHA 2VJAA 4D3SA 2Y3IA 3ABQB 4JNKA 4NULA 2V58A 3BC1A 1TA0A 4F12A 4G56A 3FYHA 2O2ZA 2Z8YM 4UOZA 1QGUA 2VIIA 2KNCA 3M3YI 4A7PA 3C5VA 1W0JD 3EQ6A 2IBMA 3FTPA 2IBZD 2OZKA 1GY8A 3MELA 4K9OA 4AQRD 3K9HA 2H5JA 3KR9A 1CRWG 3UFXB 2HD4A 1POWA 1UCFA 2ZCJA 2ZREA 4TT3A 3ZDZB 2BSQA 1PZMA 3KKLA 4NE7A 3KLOA 1YVDA 2F67A 3RSQA 4MCAA 2QD1A 4IZ6A 1ZM4A 5FIUA 4OA8A 2NV2B 3UCEA 2O2HA 4W1RA 2PDAA 3HE5B 2UUBB 1KEUA 3K35A 1FXWA 1T3TA 4I4NA 4CPDA 1GPH1 4I9HA 1B16A 3CC71 2Q4EA 1SVSA 4B6QA 1UC9A 4TZTA 3LRXA 1CYEA 2QI9F 2V7QD 3ESBA 2VI5A 4HX2A 2VPQA 4WZ6A 3WG9A 2AW5A 4X5OA 5CXQA 2NPSC 2QENA 1M34E 3LNTA 1JOCA 2IBTA 1BMDA 2HHLA 4PGHA 1ZQ1A 3RTEA 2VG8A 2DYKA 3JWPA 3WJ1A 3S1AA 4JT2A 2RGGA 3P1JA 1DQSA 3IQEA 3FZGA 2AZXA 4KE7A 4N8EA 1MF7A 1DAPA 3QBEA 1KC82 3ENWA 4BWGA 5DV9A 4JUIA 3PXEA 3CF4G 2YZNA 1XU7A 3FLMA 1B93A 4QYIA 2Q6QA 3BRSA 5B3LA 2YZ2A 3OC6A 3I9MA 4EB6B 1LTHR 4LGMA 4NFSA 3AY3A 3H5VA 1Y5RA 1BE3G 1GG8A 5CYPA 4E31A 1VDMA 4AF7A 1USVA 1CT9A 5JYEA 3NH6A 1DFIA 3ITDA 1QYPA 3HN6A 3VYWA 5H9VA 3OE5A 4RAOA 2OHJA 4XJTA 4KR7A 1G4UR 2CNLA 3JC22 1JJAA 5AH0A 3L71G 2GBCA 4PYKA 4M0LA 2GZDA 3SOZA 4D74A 4O25A 2ZK7A 4O2AB 2VHQA 1I6LA 4GKVA 3B12A 3W77A 2V8JA 1M66A 2Q1XA 2HF2A 3D59A 2BI7A 3HOXI 4TXNA 1MX9A 4F4JA 4NLLA 1LPNA 4L0MA 5B2ZA 3OC0A 1YZQA 5FA8A 3K6JA 4JWTA 5CB4B 3PQ4A 2QL6A 3T0IA 5HS6A 4EG4A 3K9NA 2GQ0A 3A4IA 2W8BB 3B1YA 1YD7A 4WKNA 1TEVA 1A76A 1BJRE 1SHKA 2YN2A 1MW8X 2BGMA 4LRUA 3SS9X 1SUBA 2XGGA 4YP1A 3D2LA 1LWUC 1XCOA 1IJEA 1QP7A 4BLOA 1TNDA 1ZICA 3ZBUA 5THKA 3QNMA 1KJYA 3M6LA 3G5UA 1GA4A 3NV7A 3DD1A 3UV3A 1N7SC 3JARA 1GQOA 4MZDA 4LC9A 2H1HA 1WR8A 3CVXA 5BUQA 4CKYA 3CY6A 1R9MA 2D3WA 2RGCA 1NKNA 2AF3C 4B6RA 2GN0A 3LCVB 3BMOB 5DXAA 1SBTA 3TFQA 1JU9A 4BEBA 2R7ZA 3IKJA 1PGPA 3V2HA 4R3WA 2PZMA 2O2EA 4N6OA 1NHLA 1ST2A 1YK1A 3UHPA 1YB7A 1UC5B 2QE7D 2QLBA 2Q3IA 2QZ9A 1ZWLA 1CUAA 3DONA 1DU4A 3KS9A 4BEJA 1G291 1EQ2A 4JKYA 1T5SA 3LUSA 1TRKA 1XO1A 3BXEA 5K3FB 4PYJA 3DMFA 4AKTA 4Y2QA 4OH7A 3BRVB 4NNPA 5T41A 3G0DA 1AV7A 5A5FA 1HT3A 1NVVR 1G6KA 1GTWA 3UM9A 4MKFA 1MKYA 4FR0A 5SY9A 3KNZA 4UE3S 4L74A 1VLAA 4GL2A 3FX0A 2ZITA 3DHEA 1F38A 3HE4B 4RTRA 3CUSA 4K0RA 2M98A 1LRLA 4RZXA 3CCR1 2VH1A 5IAKA 1MAVA 5KQRA 2IYNA 3RTAA 1US8B 2RKLA 2OBNA 1VQ7P 4IV0A 3UMCA 3SX2A 4X65B 1ZP6A 4TXHA 1XQVA 4ERNA 4ZEMA 1ZN2A 2CHVA 3NUQA 3L7NA 5UKDA 3ZWQA 3NTQA 3OFSA 2YWFA 2QJYB 1HL3A 3UAZA 1O94A 3L3BA 1D0VA 5KLIC 4CBVA 1YS9A 4AMUA 1J7KA 5EAIA 4R1PA 1LWOA 1NMEA 3LX6A 5JZBA 1EAYA 2XTZA 4F8JA 4Q7LA 1M6VB 2EVWX 1DC7A 5F3RA 4P3XA 2A69D 1KPHA 3MJDA 2FGKA 4GXQA 1XKXA 1MOZA 3QPUA 2VQFB 1X42A 2MSNA 2BFBA 5COQA 2XE7A 3D4LA 4WY4C 3BASA 4I7ZB 1KMQA 2W0MA 3M9LA 3B3AA 4AF6A 3G5MA 3S1LA 2O2GA 4LGVA 4RIFA 3G9UA 1YDMA 4FR2A 5ARBA 3RAJA 1JJ2Z 4ZYXA 2BBSA 4XVHA 5LYJB 2FRVA 5HZGA 3MEQA 2JJ1D 5ADUS 5JEDA 2B7LA 1XFAA 4BYGA 3ZUGA 1UIXA 3CU5A 1MC5A 3BBLA 4CLOA 4RW0A 1BG6A 1ZW6A 2A78A 4N40A 5KJCA 3ZZUA 4XVUA 2NACA 3HUEA 2WV9A 3CZMA 4FJ2A 1YI2P 2HM7A 3AOGA 3DXXA 2IX7C 3NRCA 2AN1A 2EZ8A 3QI7A 1PVOA 2XVMA 3ZU2A 5A2GA 2WQYC 3LC1O 3OZXA 2O8VA 2A6ED 1HG1A 1T2KC 1E1NA 2GD1O 4WZBA 4LYAA 1KZ7B 5AW3B 1VQ51 5H59A 2II6A 2I9KA 5JUWA 3TD9A 5T4HA 3EERA 3JWJA 5FBQB 4KHPB 2Z4EA 3RVJA 2H8KA 2ECOA 4EGFA 3U3KA 2G1UA 3GEGA 1J8YF 2F17A 3N59A 1RWWA 2BLNA 2TYSB 2J46A 3Q5PA 4IIBA 3N39C 3O3CA 4RKYA 1A2BA 1UPCA 1E9CA 1HTTA 1Z4MA 3VNVA 4LVOA 4I99A 1QHYA 2I3CA 3OP4A 2FUKA 1FS5A 3N9IA 1HDCA 1QCCA 2E74C 4HAYA 1RF1A 3FR8A 3RHTA 2XAAA 2NU6B 4WNAB 2YW2A 1OX4B 4L7VA 2AUTA 2DJ5A 3OZUA 2AJ8A 2GPWA 2H2WA 2CNKA 1M2OB 4R8RA 2X15A 2YWGA 2GD0A 3AE6C 5AW9B 3M5PA 3U6BA 4NS1A 5FAXA 3Q3GE 4W82A 2ZAGA 1PR1A 4YQEA