1FDIA

Oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite
Total Genus 251
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
251
sequence length
715
structure length
715
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
total genus 251
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdiA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdiA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdiA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdiA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdiA03
2NYAA 2EEOB 5T5MD 1I50A 3OUGA 2WAQA 2JA6A 1PT0A 1UHEA 1E5VA 1PYUB 1YLEA 1WCMA 2NAPA 5C18A 1KQFA 1AW8B 2DMRA 2Y0SA 4GA6A 3O6QA 4KO8A 2IV2X 1TMOA 5GLFA 1PQHA 4AOKB 5EPPA 4AAYA 2JIOA 1I3QA 1K83A 1WLFA 3GTQA 1FDOA 1ZMEC 5B6CA 3GTPA 4AZDA 4KDLA 1PQFA 1SFOA 4KDIA 2C45A 4C2MA 1WMKA 3FKIA 3O5AA 3HKZA 4D7ZB 3PLXB 3IN6A 3HU3A 5FTLA 4AYBA 3IR5A 1QCSA 1E32A 1E18A 3IR6A 1OMIA 1FDIA 1H0HA 1TWCA 1PT1A 4CRZA 2V3VA 4QIWA 2R93A 1SIWA 3HU1A 1G8JA 1TWHA 5T5ID 2IVFA 5FTKA 2E2IA 2PJHB 2NVYA 1R27A 2E2HA 1CZ4A 1KQGA 2JA5A 3QWZA 2V45A 1PPYA 3QQ7A 4CS0A 3GTLA 2JIRA 3GTMA 1VC3B 1Q16A 3ML1A 2VUMA 3EWKA 3GTOA 1Y5IA 5C1BA 1Y1WA 1E61A 1TWAA 1AA6A 2WB1A 2G8YA 2E7ZA 3H0GA 1CR5A 4KODA 3CF2A 1AJYA 1PQEA 2JIMA 3DMRA 5DYIA 1DMRA 1EU1A 2JA7A 1G8KA 3H25A 5FTJA 1E60A 3HU2A 4DMRA 1CZ5A 3GTGA 4RV0A 2JIPA 3GTKA 2VPYA 1PYQA 5DYGA 1TWFA 1R9TA 1DMSA 1TWGA 1S3SA 2KI8A 3TIWA 4AONB 2NVXA 4KLNA 1UHDA 2B63A 3IR7A 2R92A 2P10A 1H5NA 4CRYG 1Y4ZA 2VPWA 3GTJA 1Y1VA 2R7ZA 5FTMA 3TM7B 1R7RA 2YU9A 5FTNA 3CQZA 2PMZA 1QDNA 3QC8A 2VPZA 2VPXA 1IW7D 1OGYA 3QQ8A 4GA5A 2JIQA
chains in the Genus database with same CATH superfamily
2DTDA 1DLIA 3SSOA 4B73A 2ZXFA 2JI8A 1KAGA 4UPVA 2QJKB 5IUNC 1N92A 1X14A 4C2BA 4HNSA 5SY9A 5IMSA 3ORQA 1PV3A 2NUBA 4R81A 1IK4A 5EIFA 4R2MA 1EDOA 4G6ZA 3AEEC 2HNAA 4R9VA 1AG9A 3IIEA 2QSZA 1NAIA 1BKYA 3AT1A 4YCDA 4A3LI 4LE2A 4EIWA 1UOOA 1Z18A 3RQIA 2QU7A 1NTMK 2YOFA 2N47A 4F8YA 4G23A 3MOIA 1II8A 5LXTF 4RSMA 5ALQA 4KWTA 4LZPA 3Q15C 3FPGA 3AHGA 1JYEA 4PIVA 2IOHA 2CE2X 3SZGA 4RHTA 2UZAA 3R9IA 3C2QA 4RU1A 3EHEA 1ZMRA 1YS7A 3UOAB 1N2GA 3SM3A 5GZ6A 3BGIA 5L3RA 2BEUA 1LBHA 4Q9KA 1X7GA 1X80A 1LLDA 4HNTA 1XHFA 4RA6A 1JHXA 1W4ZA 1S2GA 2X4IA 4JENA 4F4FA 5JADA 2ZT9B 4MTCA 1ZKDA 3DKKA 3H83A 3H5NA 2HSZA 3GJ7A 3GPLA 5DW3A 3FE2A 3AHCA 3TLJA 4HRXA 5FLYA 1CEXA 4YJGA 4PYJA 3UW3A 1XTGB 3T3OA 1JN0A 3MCVA 4CN8A 1L3BA 3A1FA 2JLRA 1FTYA 1OFIA 5DJ5A 4ARSA 4KN6A 3TVDA 3TW4A 4AJNA 1T9GS 4XZ3A 4DV5B 1AMUA 3EMKA 4Z49A 3VAZA 4BC1A 1QH1B 1KO1A 3TTTA 2C61A 2BFDB 4BP9A 2M6SA 4BAUA 1XROA 4J0GA 2HLHA 4KHZA 2OHGA 1EHYA 3QEMB 2QA5A 1LTHR 4YFYA 1JIVA 1SHZA 5EZQA 3RADC 5I7WA 1VQ9P 5KMGA 5BSVA 5L4SA 1WRGA 3NOQA 1RACA 5ULLA 3EGIA 1TK2A 3B53X 3FGNA 3HOWI 3GTPA 5TPZA 4GPIB 3KTOA 1QLHA 2RT9A 4J90A 4RWZA 2P91A 4PYMA 3JQBC 3K9FC 2A4KA 4OFXA 1XYVA 4HLCA 3UWKA 2ERXA 3Q7EA 4EYGA 1EDLA 4J0JA 4CT5A 2JBWA 3AB8A 1GYRA 3GJ8A 2YYZA 2OFPA 2Y99A 2QTRA 4MD9A 4OHRA 1VPVA 5HHTA 4MW5A 2GXUA 2X0IA 3TTYA 2P9FA 2ZIWB 2FPRA 1MKYA 3IUPA 2W2PA 1WLSA 3CG0A 1Q0PA 2M9MA 3QOYA 3NHLA 5IEJA 4HFJA 3FXAA 3EIXA 1CSEE 2AHRA 2ECOA 1PD0A 4B46A 2IZ6A 4KHPB 3A6ZA 1NXSA 1FYFA 5C4XI 4XUDA 3NASA 2JHCA 1Z2OX 1M1KQ 4BX9A 1KJWA 1CQIB 1ISGA 4J07A 4LVNA 3FYSA 2KBEA 3BD7A 1AGYA 2CL0X 4A0HA 3LQFA 4H1VA 4E5NA 4D6YA 3PITA 5GLFA 3M6AA 4UU1A 5LUBA 2R87A 1DOZA 1W35A 5JXHA 2A9FA 2HF1A 2QEXZ 1ULZA 1XN1A 3BMCB 3O8OB 1GNLA 4B2IA 3B8EA 4PS1A 3HA5A 2DB3A 4EY8A 1P5JA 3I62A 1WMEA 4FX5A 4QWWA 4BY1I 4UPDA 2X2OA 5I9NA 2KMLA 2ZT5A 3CC4Z 3QHPA 1SVOA 2O2XA 4ZDKA 2RG1A 2G5DA 5CDUA 2P2UA 3N3BC 1R15A 3FOWA 4ES6A 3M0DC 1IM5A 5DEOA 4M54A 5H2FE 3N2YA 2R1TB 3SHWA 3H1HG 3AIIA 1K27A 3L6BA 2W27A 4ZALA 3QVXA 2RBLA 4YAWA 4LYJA 3WQHA 4K9SA 2X6QA 1CD5A 2SKCA 5HSGA 4AD8A 3MS2A 4DFDA 1JH9A 2X9NA 1YTLA 1Z2PX 4OGLA 3T5TA 4L6IA 4KMSA 4U3FE 2Q27A 1O96B 5FAKA 5G1PA 3FX0A 2QTLA 3S40A 2YX1A 3ZD6A 4D81A 5TISH 2KX7A 1NRJB 2V7BA 1Z36A 4Z5XA 4AVYA 3K0FB 1L7XA 4KEAA 3BDIA 2ZRPA 4FMCB 4GOJA 5GPBA 5KLVG 1JEYB 4M1OA 2CEKA 2QTTA 2FVXA 4ZCIA 2KZJA 3KYIB 3QPUA 3THWB 1ZSVA 1SQSA 3VJLA 1BGXT 3JR7A 2CF6A 4RTKA 2DAPA 1T9GR 2PT5A 1NX9A 4EYSA 4U3JB 1JE0A 1RHRA 4PZDA 1E0KA 2QVYX 4REOA 2CNWD 5IXSA 1L7PA 4IQ8A 3FPHA 2RH4A 1IWOA 1XI2A 1WC2A 2ZIFA 1I7DA 5A04A 1FMCA 4D4MA 4CMHA 5C39A 1NTZE 2EEOB 5EXXA 5C5IA 1QHHB 2J0UA 3ZY6A 1U8FO 5IXJA 5K2OA 4ER6A 1XTUA 4ASVA 3HKDB 4NHOA 2HFJA 4ND8A 4MWSA 3OKFA 1LD3A 4E2YA 3OW2Y 4YN3A 2I0FA 3Q7PA 5C0OE 1W73A 1T26A 1Q57A 1H2WA 3U4AA 4KH0A 4FGJA 3Q5GA 4BQFA 1PEYA 3E84A 4U7FA 1RZUA 4U8HA 3SEAA 1N0IA 2O8BA 1AGXA 4KJZA 1FUYB 1A9TA 2P6PA 2WR8A 4HUJA 1EFVA 2XZDA 1P3Y1 2XUQA 3II6A 4DDWA 1UMCA 7ABPA 4D4IA 3LCMA 2CL6X 5HJ7A 5BSHA 2NUTA 3JX9A 3DB1A 3RKRA 4WOCA 1ECGA 4MRRA 4KRGA 4Z7OB 4FS8A 3NIDB 4PX2A 2ZS9A 3N0RA 4IV5A 1TUBB 2Z3WA 3T7SA 3RRJA 4DGLA 1RHZB 2GSWA 4MJXA 4X20B 4TROA 2VXYA 3S1LA 2QSUA 3D2LA 1XQYA 5T4EA 3EH2A 2R3SA 2VSXA 1NJGA 3LYUA 3KJEA 5T3UA 1KVSA 4QTTA 1I14A 3SYTA 1JPUA 3UHPA 3BMXA 4N49A 2ZP1A 3MGKA 3HCEA 1I4WA 3RL0D 4M6WA 3KCQA 2YV1A 3H1HJ 1UBGA 1XXHB 2EIXA 4MS1B 1SZCA 4NPFX 4JLKA 2VCEA 2PZMA 4E2FA 5A05A 2QVAA 1FP4B 3GJSA 3W2EA 1ZQ9A 3IPAA 3THXB 1VLAA 1II0A 2HC9A 1G7RA 2ZRCA 2QNIA 2VK1A 5L51A 1A72A 3LQ2A 2EFEB 3GW8A 4A03A 1K8A2 3TE5B 1N2FA 3FA2A 2MSCB 5D5PA 2AXNA 2WKPA 4L75A 2VHCA 4W9NC 1AB5A 5K3OA 1CUUA 5KLVJ 4AJIA 2FKAA 4JA0A 1R4MB 2Q2OA 1XXLA 2HRDA 4B76A 4PYOA 5G4KB 4MXDA 4PYKA 3Q8LA 2P2YA 1MDFA 3FSGA 4WCFC 5I9BA 3EXG2 5E79E 2PWBA 2GEVA 1U3TA 1RWMA 2V8JA 2UV8A 1WXWA 3ZWYA 1USEA 1FVXA 5B64A 3V2GA 1QONA 3WZMA 1AIPA 1OXMA 1NVAA 3LOUA 4KLZA 4M8IA 1G1JA 4ZV9A 2W43A 2VJPA 1W59A 1NN0A 4K81B 5GIOE 4C7NA 1X1SA 3UG6A 4NENB 4R31A 3IAOA 1CJVC 3OVMA 821PA 1USKA 4HDNA 2HCBA 2ZANA 3EXFB 3HU2A 2ORED 4JL5A 3SYLA 1X39A 4BVKA 4RPGA 2IBZI 1M6HA 1ZU5A 5FBRB 5JANA 3D2BA 2OTJZ 4BNMA 1Q1NA 1JR6A 2WP8J 3CW2A 4XB1A 5EJFA 4ZMSA 3WAGA 4UTOA 1OLXB 1GGJA 4FT4A 1EFTA 3EFFK 4YAUA 3NGXA 3V4QA 1NR7A 2GEKA 2HODA 2CVOA 1K92A 4OYHA 2O7RA 3OKPA 4ZOLB 4X91A 2AZTA 3ELUA 1U8UA 4B48A 5LQKA 3IIIA 4G5QA 1C7QA 1MMFB 1KZUB 4URUR 3BC1A 3CCJZ 2KZIA 1V25A 3NYRA 2HA2A 2Y3IA 4IIFA 4ZO6A 3JC22 1COWD 4PX3A 2YWXA 3OTGA 5AW8B 1E1KA 2JFHA 1APBA 3H32A 2CXUA 5HVNA 4S3MA 3M83A 1HOTA 3N0WA 1Q90D 5GTHE 1SU6A 5GY7A 1HE5A 1SC1A 2OO3A 3K72B 3LH5A 3H19A 4YTEA 3E5NA 2R2AA 1TVMA 3UBMA 2IUFA 1WU8A 1XFDA 3SNKA 1EUCB 4D1YA 1KI6A 5LUAA 4BGEA 1C4OA 3E22B 1BWSA 4NCXA 2V0GA 1K3UB 4XM1A 1K731 2CLHB 1WLFA 4B7CA 5BYKA 5PGMA 1NI4A 4XOUA 4G5XA 3IAS1 4EUNA 1VLMA 2I3ZA 4QUHA 1AKRA 1XHLA 5K4AA 2J3QA 4CM6A 3EWSA 1L8AA 1P72A 2KWIA 4KIUA 5IS2A 2AXEA 5EJ8A 1OBOA 2VG8A 3QWHA 4ZT7A 2A1TS 2HUPA 4QFMA 1OH6A 2XYRA 5E6SA 4KLAA 4NQZA 4IO1A 1D6MA 1QOZA 3IQHX 1TZ2A 2XVAA 4A3BI 1DBSA 4WJZA 3H0GI 3AE9C 3ZJUA 3GCDA 2HYNA 1EESA 4WOPA 3AR9A 1IRXA 3PNKA 3HKCA 1OIWA 1XZQA 3GP8A 3BWBA 4MA5A 1U11A 4ZU3A 3S1MI 3ANLA 3CLUC 1TEZA 1RS0A 1Z15A 1I1OA 3I09A 1AFOA 4UQLA 1WZNA 5FF9A 2GK6A 3LP8A 3GC6A 4HWPA 4C46A 3EVGA 4CDNA 3CIOA 3N87A 1XU9A 3TR0A 3VKFA 1KYTA 3AW9A 1XD9A 1MP0A 4HAZA 1BX0A 1JIQA 3ZZTA 1QM5A 4QFCA 4BO3A 4RK4A 2CXTA 1GOTA 4OIFA 2QXTA 5E6UA 4BQNA 1V4NA 4QQ8A 4G5SA 3FWLA 1MABA 1K5DA 1X1EA 2MMGA 1WP9A 1KQGA 3DE4X 1MNAA 5I7RA 4U2EA 1ZZGA 3L5KA 3QXGA 4ASUA 3V4RA 2OHHA 4CKYA 1Z12A 4J16C 2VQFB 2AT1A 4NYMQ 2QTWB 1LQ2A 2WT7A 1DMRA 1R0XA 2H18A 2WM8A 3SIPA 1CZOA 4LJSA 4UNIA 4YUZA 1IFDA 3LK7A 3TN7A 4F9GA 3JU3A 2JFNA 4FDAA 4NLLA 4LOAA 1RE3A 4KLNA 4EEXA 1KMIY 2GA1A 1LT1A 1IOLA 1HXHA 2AF3C 4KXUA 2ZRIA 3NEYA 3C4JA 3KOOA 4PWZA 1ENYA 1ODJA 5EZSA 4L7QA 1OMOA 5L3SB 1VRCA 2YMLA 2RB5A 3S70A 2RGRA 1XQ6A 3ASYA 2D5CA 1KOJA 3X1MA 1WMKA 2NZXA 2OTLP 3W5JA 1HV8A 4DUPA 3I5AA 1N9KA 4IHJA 3ZLBA 2V54A 4BZZA 2E5LB 3W8DA 4PZLA 3BE8A 5AESA 3BGSA 1R16A 2H4JA 2B1RA 1KTVA 4RQAA 3PYLA 3LZ6A 2PX2A 3RIEA 2C7QA 4O2LA 4LSWA 1JCCA 2Q45A 2G09A 2D2EA 2KSQA 2C0CA 2FQQA 4PO9A 121PA 2B4QA 4U9IS 3LQYA 1FBMA 2HJ9A 3N39C 3A3YB 2BW0A 1PJCA 3DLCA 4IZIA 5ED0A 4B4WA 1URQD 1R5BA 4DA6A 4FI3C 4O4JB 5JCXA 1RR6A 3WSTA 2R5BA 2JBAA 4JLWA 5TJHA 3UC9A 1MC4A 5JSZA 2W58A 3LIPA 6YASA 1DUSA 5AOAA 4ND7A 3EOBI 1UMKA 4GXTA 4NNOA 5FUVA 5BXQC 1E5DA 3H2JA 3GJ4A 4UM9D 3UWPA 3IR6A 2XB8A 5KX5B 2YXNA 5GM9A 4G0NA 3DV2A 2X8JB 4I4LA 4Z0TA 4ZU1X 2B1GA 1AKQA 2A1TR 4N6GA 1D04A 2BUCA 1SQBE 5D3MA 4EOTA 4RABA 1AGPA 1Q7TA 4DZOA 3UJ6A 1MAVA 1TAHA 4W5QA 1T36B 3LECA 1G7CA 2TMKA 4DGSA 4BVAA 5K0ZA 1RXIA 3B1KA 4YCCA 3CXHD 2OGWA 3MXTA 1TA4A 1VQ7P 2IHYA 3DEJA 3AHIA 3R0QA 3R0XA 3LGSA 5K3EA 3WYBA 4HKZH 4OHFA 1LY1A 1N77A 1OF1A 2W9XA 4HYQA 3G3EA 3NYWA 5CD9A 3UN1A 2NAPA 2ISCA 4LHZA 5AW3B 3CVJA 3CMMA 5JCOA 4PPQA 2JO1A 3LW7A 1PEAA 1K6XA 3E3MA 3S1AB 4WLFA 3KHUA 4CQLB 3L79A 3H2KA 2GUWA 3CTPA 4PXYA 1LXCA 5E8JA 4K9DA 5DGCA 4XPIB 4E70A 1MKMA 1P7WA 4ZAGA 4H7IA 4RMJA 2JR6A 1C2TA 4CMEC 2ORIA 1CTQA 1I6HI 3X1YA 2G83A 1JLLA 1I4DD 1V47A 5K4HA 1I13A 4NEGA 4KR3A 2E9SA 4QFBA 3PNLA 4P5DA 3IRUA 5CM9C 3SNHA 2ZXEA 5IMBA 1ZI6A 5JJKA 1M3SA 2EG9A 1TJPB 4Z1MD 4KQ6A 4AWBA 3QVWA 1EM8B 4Y2SA 2I3AA 2Y05A 4AYWA 4M8NE 4CF5A 5I8PA 1VQL1 1HE4A 1FZEA 1JJ2Z 3V46A 2WC1A 2LXNA 4QHSA 3EA4A 3P2KA 4HH4A 3OH8A 3WXMA 1NHGA 2QVZX 4NOMA 2I7VA 3F4BA 1H2BA 2BGRA 2IBSA 3NETA 2D3TA 2JKZA 4GYKA 5F78A 5DE3A 3PT9A 1GQSA 4DJJA 4WASA 4PC3A 3RPEA 3D30A 3RUPA 5DM60 3S2IA 5EWJB 1CUVA 2OLKA 2QD1A 3DBRB 1NC3A 2DSNA 3SSMA 1SKYE 3FVVA 2VUGA 2SKDA 3QKSB 3FI9A 1S9KD 1ZI8A 3NWOA 2VDUE 5FDFA 4IF4A 3O75A 1UKEA 4JMLA 1UHDA 3RHSA 3PKIA 1DQSA 4BMCA 2DPGA 2V7QD 5F23A 3K3PA 1CY6A 4XQCA 1ZH0A 3HVKA 3PICA 4WY2A 1JMBA 2RK4A 1DAGA 4DDVA 5T4HA 1AZWA 3G2MA 1QHFA 3GXBA 5CT5A 1WXDA 4KQEA 3DPIA 4DNOA 1GZVA 2FCAA 3CCQP 1XP5A 1THTA 1WG8A 1DEOA 3LIEA 2QEX1 1SXHA 3TLGB 3T1YB 1BGWA 5CLQA 3FTFA 2P0EA 6NULA 3N53A 1AA6A 3VOBA 1WL8A 2I4MA 2JG3A 1N2OA 3KQWA 1LSSA 4FYMA 2ZR8A 3PC2A 3KHKA 3ABVC 4F9FA 2PUWA 4ITUA 4QOSA 5LA6A 5THKA 4GP7A 2IOQA 1O6ZA 5M29A 3K96A 3KXDA 3BATA 5FUYA 3A27A 3INGA 3HYLA 3AJRA 1ZD2P 3UAVA 3K6SB 2ODBA 1ST2A 2ZRQA 5CLHA 1VFPA 2NU6A 2PSEA 4C07A 3EE6A 3AB3A 3H9UA 3F3SA 3LJKA 5TT1A 3AKZA 2IYSA 4HOYA 4I4TA 2DCMA 5B6PA 3HCDA 4LRUA 4RLQA 3GFTA 1T5TA 3K6RA 4EX7A 4Z0PA 3SFTA 1DJNA 4DQXA 3PTLA 1YFJA 1PZEA 1DWPA 4HX5A 3BMNA 4BYMA 1Q15A 5BR1A 2JIMA 2XNXA 1JYFA 4V0LA 5E3IA 5KPJA 5ENDA 2J07A 1QZUA 1NW6A 2Q07A 4W5HA 3EG9A 4M1SA 1RRPA 1GTRA 1EZVE 1K8A1 1KB9D 4DCKA 3W1VA 4BC0A 2W6OA 3CNBA 1R1DA 1XO1A 5IBPA 4HF7A 3CY6A 1GUAA 4HDAA 4LSZA 1FTGA 4Y2GA 4EUKA 1K5HA 5JALA 2WYHA 2KLVA 1QHNA 3I2IA 4MGHA 4UJ3A 2DMRA 4BO7A 1TO1E 4WK6A 3GLFE 3JQQA 5KU7A 2PNFA 3RV3A 3EMVA 2CZQA 3JQ7A 5D1OA 1F9AA 2R9VA 3VJMA 4IXNA 2CLSA 5KJ7C 3A14A 5KOJB 2GBPA 4AG5A 1DELA 2VF5X 4CETA 1SUEA 3EXG1 5H4GA 3IB6A 3RK1A 1T5SA 4BMDA 1Y6FA 1PV4A 1KBQA 3BK1A 2BBSA 1X92A 5CCHD 1OFGA 3RLIA 3KDSE 2VHUA 4WV3A 5EHIA 1MF7A 5JS2A 3C0KA 4I5EA 1IUNA 4DA7A 3C8MA 5EJ6A 2FAXA 3TD2A 5ALRA 2G72A 4R68A 4PGAA 1XTIA 3EDQA 2NPSC 3ZWXA 4XQ0A 2UXCB 2MYPA 4WWIA 3TSAA 3D0RA 3D2CA 3MK31 1P31A 3IOEA 3NTOA 2FBWC 1QF7A 1Y8RA 3SBDA 3HDTA 3SVTA 1Z5UA 1EHCA 3SZRA 1BE1A 2MYNA 4CKWB 1NM5C 2R6MA 1E5WA 2RGGA 3GI1A 5IPFA 2GN6A 2JI6A 3ZQ6A 2QE7A 3V8EA 4CF6A 2W11A 4AXBA 4MVJP 3SE7A 2WU3A 3QUSA 5AVXB 3JCZA 2X3UA 1IFIA 5LMCA 4C0LA 4YO7A 1H05A 4C0BA 2F1IA 4B40A 3IX7A 4AKHA 1BYIA 1DQZA 3T12A 4NYMR 5DYIA 3IKVA 721PA 5ELMA 5FR2A 1D4ZA 3GFQA 4DS3A 3EEQA 3KQKA 3ZY3A 4GWKA 4A6XA 1F48A 1ZJ6A 3AESB 3AM3A 5EXEA 4V0QA 1CJSA 3CZ9A 2ATCA 1J2JB 4OGFA 3QX3A 4YHBA 4OXIA 1KKUA 1DC5A 2H1SA 3L7DA 3BIFA 3DTVA 1XMQB 4FGUA 3SJBA 2IY7A 3WE7A 1KARA 3DBHA 3AL0C 2Z83A 1XA4A 2WSCJ 4FIDA 1GZUA 4UFNA 4ZXPA 4ND1A 2WMDA 1ZIOA 2OSVA 4NJEB 4LBWA 4DBLE 2Z58A 2GAFA 2OQRA 1GHTA 4ID9A 1ENZA 3QVTA 4TT3A 4C7RA 2RGDA 5IT9f 2VPTA 2EU8A 1MX9A 1GCGA 1IHPA 3RU9A 3CB4A 1OZGA 4AVRA 3ADPA 4X97A 3GZ4A 3JAKA 4Q3NA 1VPTA 5ANRB 2YYYA 1YFZA 1DMSA 1H3NA 1BGVA 2AOTA 1ONOA 5DO9A 4QRHA 1JDNA 3EDCA 5LSAA 4M4SA 4A2QA 4DT1A 2H17A 3MCWA 3WGHA 1DBQA 1V0JA 1F1JA 2OTJ1 5DTJA 3KD2A 3WOHA 2X5NA 4MR9B 1X6VA 1WNFA 4C03A 4QDTA 3WGNA 4FDVA 3LUDA 1M54A 2CUKA 5AI9A 2BGUA 1M5RA 4EGAA 4H15A 1LKZA 4GX5A 4QO8A 5K5GB 1D2EA 2PJHB 3UFXB 2YQ5A 4KPUA 1E9VA 5FRDA 2CVPA 4OGGA 5EXPA 1VLLA 3MZLB 4W1SA 2OM6A 3N28A 2RGEA 1DRUA 3OOSA 5KKZC 5JRDS 1DKLA 5TQ2A 4RGBA 1MAUA 5F77A 2WTYA 1KFJB 2YY5A 4W5JA 4D80A 4E0BA 2CK3D 2GK7A 1KVTA 3P2MA 4BZXA 3AM1A 1W36B 1V7CA 4MRSA 1DEXA 1IEVA 1QGUA 2R68A 2C4TA 5ITVA 1N7IA 1ZS9A 4ZEXA 1U0JA 5JQGB 5KWIA 5EFWB 3TLCA 5LQSA 4NK4A 2FG7C 4CV1A 4R8RA 4F97A 5CNMA 4KBFA 3CU5A 3VJRA 1X3LA 5I9MA 2FR0A 1YONA 1WO8A 2C1ZA 3GU3A 2YNMA 4QTUA 2A0XA 5CEFA 3W3ZB 1PNTA 3A25A 3MT8A 1LVHA 1PR0A 2RGWA 5AVUB 3LDGA 3OM8A 1F12A 2IVFA 2VP4A 3QBEA 2YUIA 1UKAA 2BFCA 5A6VA 3FWKA 2LV8A 3OQ6A 2B4YA 2OILA 2VJMB 3AZOA 1XZKA 1CIJA 1P84D 1JV2B 4Z8YA 1IZ7A 1QIHA 4IKEA 3KU4A 4GGOA 1PFYA 2BGLA 2GXSA 3GZTB 5DNAA 1CVLA 5KBYA 4KK3A 1L4HA 3MINB 3UT0A 2ZWMA 4GOMD 1C1YA 3R0IA 1EQ7A 4HS9A 2JUBA 1GLVA 3CEMA 4PIMA 4Y7NI 4ZQCB 1L4MA 5AVRA 4L9AA 1J1EB 2DPYA 1XZPA 3S8EA 3T61A 3WA7A 3BN3A 4NCKA 4WDQA 4PLWA 3ZWPA 4OP2A 3T5CA 1ZNWA 3GJQA 3E5HA 1BMFA 4C9BA 2VOEA 3C6YA 4F3KA 3OA7A 2JGJA 3L6CA 3LVBA 2GZRA 4H44B 2PLFA 2IEBA 3RVOA 5G1OA 4BFWA 2O8VA 5L8RJ 2XGMA 2A7XA 1WCV1 2HCRA 2AN3A 4KR9A 3E1SA 4Z9YA 4OGKA 1FZAA 1N25A 8OHMA 2IYYA 4RZSA 1SMYD 5BMOA 1FFBA 4KJMA 3V7UA 2BEUB 4KNYA 2QRDB 4HFMA 2NRGA 4HGPA 1X80B 3ABZA 4PQRA 2FW9A 1E20A 4JASB 1HC7A 1WB5A 4RA6B 3GDFA 2Q6TA 4PFJA 1U0SY 2WIGA 1QH8A 1S5LH 4KWCA 3QGMA 5SZHB 3HCPA 4UE3S 4YRKA 5CYOA 4YJ2F 3TQTA 5B3JC 1NFQA 4YJGB 3V2UA 1Y48E 3RC8A 3GHGC 2Y0SA 4UHCA 4JYAB 3FAZA 3KL4A 5CLIA 2C2KA 3V7YA 1Q1GA 4CE6A 2KLHA 4DMLA 2YKPA 2VJNA 4INZA 4KK4A 2FR8A 2D7JA 2O1JA 3BERA 1D2CA 4BZQA 1R9JA 5AW6A 3DOJA 2XXJA 4Y2PA 1SURA 3TQRA 4GD3Q 1TWHA 5J23A 3DLHA 1UDXA 3U48A 1PPYA 4Q1DA 3VMXA 1H89A 4Q4HA 3VZRA 4O4LF 2FF5A 2XNSA 1Z7WA 1DOHA 4LTNA 3AG6A 1PW7A 3S2UA 2QLFA 2FSUA 1FU1A 1ADJA 2AIRA 3BGVA 4MLCA 1I6MA 1LV8A 5DB4A 1YA8A 2YMYA 3K5HA 3CV3A 3IAHA 4YJFB 2ZU6A 2DHRA 4E51A 1Y3FE 3IEKA 4UUBA 1F4PA 5SY6A 3RW9A 1HDOA 4D4HA 1CS4C 2J41A 4KITB 1YLEA 2WICA 3V1UA 2WF5A 3O6QA 5J2TA 4OL9A 2C4HA 1Q0HA 1DDIA 5I9IA 5I5GA 1M34E 4HQNA 4MEBA 3JQ9A 3AFNA 4KN5A 1F5SA 3KT0A 2WJZB 1K9MQ 3OHPA 4ZU6X 4D9KA 4IFTA 2X1MA 3AU9A 4G89A 2I4TA 4K8OA 3RS7A 2M3EA 3I561 2WVAA 2INGX 1T2EA 4C0SA 5M34A 3OIWA 4YJ3F 2VP6A 2KS1A 3LDHA 3FXDA 3CJQA 4ZYWA 1YJWP 5JECA 3Q9NA 3JQCA 2JJQA 4YRAA 4KQKA 4TTJA 3GLFA 1P45A 4OY3A 1L4GA 3OTQA 4FHGA 1X7ZA 1SQPD 3B8EB 3EGWA 1X3ZA 3CYFA 4Q9JA 4W5WA 1ZM7A 3E05A 5E7IA 3SZMA 3RH0A 1C9EA 3OHSX 4MROA 4A82A 4G8JA 1P4RA 3TSYA 3O4JA 2B61A 1HDRA 3SJCA 4C4TA 5CX4A 5EPUA 3DHNA 4ML3A 1Q0RA 1U3FA 4QU0A 4UKDA 3NBZC 1SCDA 1RY3A 4EGFA 3HEMA 2PV7A 4JQCA 5K8LA 2BHSA 4J1NA 4Y9DA 2ZGVA 5FLMI 2VZ0A 5REQA 3W4KA 3IT1A 2FSSA 4M9CA 1V48A 3FOEC 3BIXA 1DJLA 1P1KA 5TVGA 2X1LA 3ZGXA 4IS3A 2ZDGA 1ODLA 3MWEA 1FLNA 1K732 2FX3A 3WRVA 3RAJA 3H1HD 1EINA 4YUXA 1QGYA 1FOSE 3BZWA 3C4VA 3CCL1 3W4IA 3HM9A 3Q8KA 4RELA 1ULTA 2Q7XA 1JG6A 1X22A 1VP9A 2Q9UA 3Q0TA 3R44A 2MIIA 3NVAA 1JQAA 4U5XA 1KFKB 4F72A 1RLIA 5KYXB 3HUEA 1HDEA 1OIVA 3VHXA 1J0DA 2WTUA 3N2GB 5CJ0A 1L5RA 2BH2A 4HLQB 3H1AA 1XMJA 2IYAA 2CHQA 3CCFA 4V3CA 1GK4A 3A1DA 4I81A 2XCOA 3DH0A 2Q49A 2VJOA 2ODNA 1ZL0A 2DETA 4CTNA 2BONA 1DX9A 5FLXA 2BZGA 3VTZA 4BVEA 1AHNA 5KLVD 2E1RA 5CFNA 3IUMA 4OB7A 3G8AA 1Y5IA 1QE5A 1AN0A 2QTNA 3W1WA 2JJ1A 3CCSP 4LCBA 1IZ0A 3V6MA 1PAUA 1FMLA 1AXEA 2WSFH 4AF6A 2Y8EA 2J0UB 3QI2A 1ZOSA 2PT6A 3QVMA 1KYOD 3N2IA 4Z51A 5C7OO 2G0NA 1PT7A 4ND8B 3X2OA 1BDJA 5AXAA 3P9CA 4MVJI 1E6WA 4CL2A 2JGAA 4FN4A 1LDGA 1CY4A 3NB0A 2Z6AA 3EZYA 3ER9A 5IUJC 3OESA 2X8AA 1IHDA 5I47A 1JHYA 4PGMA 3UHJA 1QR2A 2Q7OE 2XXBA 2O8BB 4FOTA 1N8TA 4GODA 1HETA 2LKDA 4N12A 5KNCA 1CUEA 4O9BA 1YUKA 4Y2UA 1ELOA 1EFVB 2RKOA 1UFOA 4H0CA 1UMCB 4ID3A 3EQ8A 3DF7A 4IMPA 3TIFA 4AQYB 2NUTB 4N5IX 4JI2B 5L7WA 4V0KA 3FHLA 1GRRA 4QSMA 2WKQA 1KU6A 4L72A 2UYYA 2P65A 1X7HA 2B98A 1N1MA 1P1CA 1Z07A 2XE7A 3D70A 3KYBA 5D3KA 1TWAA 4GP6A 1BCCD 4RZ2A 3RTBA 4GZMA 5DGTA 1BE3E 5C9ZA 3HACA 2ZJ7A 5DI9A 4DCUA 1UDWA 5AK0A 1ABEA 1LPAB 1Z4NA 4C22A 3PH0A 3I2HA 5JISA 2JI9A 3SU8A 5GJBA 4M6WB 1N34B 2QS9A 4OJKA 4R2HA 3QUQA 4E6PA 2PUFA 3WRXA 1D9XA 4EMTA 4ZK6A 1UUFA 1YI1A 4Z9AA 4N3AA 4QBIA 5LDGA 2I1KA 3K1YA 3DYBA 4YJDA 2HF7A 3HZRA 5HKLA 2BFEB 2I62A 1XR3A 4HP8A 3IDSA 2QDKA 1BMQA 3L1HA 3WJ2A 1GO2A 2JH8A 5GOTA 4MTLA 2OQQA 1AUPA 1A9YA 1EDBA 4KR6A 3FNBA 1Y3BE 1N7SC 2PYIA 1B43A 4CDGA 3N2EA 2HTEA 1VQLZ 3ZDRA 5E2AA 2CJYA 3ZXYA 2WYOA 5EZ5A 2E82A 3OQOA 3T9DA 2PV0A 4I9HA 5C53B 2L18A 4TWAA 4LFAB 1TECE 2E87A 3LMKA 3TRDA 2ZB8A 3EBOA 3F2IA 3CQZA 1LFDB 3VR5D 1Z6AA 4Y2YA 3TNYA 1U2QA 3DEYX 2VT2A 2OYHA 1SC6A 3HPRA 4RD2A 3X2GA 4HATA 3EJ6A 1I3KA 4FOOA 1U2EA 4C7NB 5BSMA 4NYIQ 2XMBA 4DNXA 4HDNB 5DTQA 3R77A 3UIEA 1RLMA 4LJYA 1WY7A 3EOZA 2J9RA 4II2A 4OXQA 4EFMA 3N75A 2YO3A 2IDMA 4O2RA 1DDGA 5J58A 2QUHA 2Q4TA 4CCWA 1LBEA 1NH4A 3P20A 3H1TA 3PHLA 5BSUA 3SOZA 3ID6C 1SQPG 5DTEA 3VZCA 1IQPA 1OROA 3NKVA 1R0WA 1LPMA 3SFDC 1NMEA 4FNAA 4YCBA 3AE4C 2FGJA 2CVZA 4KXLA 2QZ9A 3PNOA 4RPJA 3WK5A 2HODB 4KQXA 1WJGA 3B5IA 1RE4A 2CNWA 4E5PA 2ZIXA 1KORA 5JBNA 4YONB 3N8IA 3MOGA 1TPZA 1J1IA 3KJXA 2PS1A 3PT5A 1NZJA 2L82A 2HBRA 3ESDA 1Q74A 1Z6QA 1I30A 2JA6I 3CXHE 3AHEA 1YJ91 2DQZA 1MG0A 3W78A 4FHFA 1OIXA 4TMVA 7MDHA 2QZZA 5APXA 1QIJA 3BWVA 3OC6A 1YAJA 4C88A 4YCLA 5HJEA 1YJBA 2Y4NA 1GFIA 2HEGA 2Y92A 4P4LA 4ENSA 1YE3A 3WK7A 5CA1F 3OBBA 4MITA 1D07A 3GNQA 3I9V6 5AVWA 1QIFA 1SXJB 3GG2A 5KLIC 4V02A 2RAVA 3HBNA 1C7RA 1A02J 2F1RA 4KQFA 4GBMA 1UC9A 1YJXA 1KI6B 4OOFA 1CUSA 5ECWA 4C0KA 4BNZA 1P5FA 4ERXA 1NI4B 4OQNA 1ONPA 2ZLBA 1VG8A 5BV1A 3MC1A 1KNXA 2RHMA 1ZRSA 4ZOAA 3K9GA 1U2TA 3WO0A 4P92A 1TK9A 4RANA 3EERA 1V35A 3VR4D 4WBNF 4P4TA 1C14A 2LZ0A 1YZVA 1GU0A 4AZSA 1KEPA 4RVOA 1DAOA 4X94A 5E6SB 1PJ2A 3CUTA 2ISSD 5JC1A 5AVQA 5TSDA 2OBFA 1GL2D 1S721 1ZCAA 1Y7TA 3CC7P 4ZO7A 2NXJA 4E1VA 3NTNA 1K05A 1KJYA 5IFKA 3HMQA 2G6TA 2W4MA 1CUFA 3HKCB 1ND5A 5EZ6B 1X1DA 3OBIA 4FYIA 4HLUA 4B75A 3HFJA 3HZOA 3ND7A 2GEUA 3N6VA 4B2PA 1QFXA 3AVXA 3EIWA 3ELDA 3U61B 5EHGA 4I08A 1EQAA 2IW1A 2LRHA 2C8LA 3JWEA 2FSVC 1VXRA 3ZHTA 3MELA 5KSOA 1TUGA 3KZIE 1JHVA 1ZK2A 1NOJA 2XKAA 1WHTA 2A4MA 2GM5A 2ZRKA 1CCWA 4L76A 3CRQA 1FJPA 1M34A 4KRYA 2RHTA 2JIQA 3IFSA 3TOZA 1ZM9A 4NH0A 4BQOA 1S9KE 1BVUA 1KQGB 1X13A 3PXDA 4NJOA 4NBAA 2C0WA 2IIBA 3AFGA 4LDJA 1BCCG 2A9KA 3SSUA 1SQPJ 4CM9D 3JWPA 2CVHA 6GPBA 2EFGA 1UJBA 4N0PA 5ALOA 3B1WA 2WT7B 3G0HA 2XWBF 4F21A 2ZDQA 4NB8A 1CZLA 3ZR4B 1Y0BA 3QHQA 4DAOA 5AVKA 1OC2A 3D43A 4DR1B 2I1VB 4UMVA 3AI7A 4OMUA 3KUUA 2Y1CA 5F7XA 3ICQB 1XF9A 3OFKA 3S1RI 1NI3A 1SVFA 2JA7I 1M75A 3R5SA 2N0SA 2NV2B 4YRZA 5JCJA 2VPYA 4KSBA 3CKKA 2UVDA 5EMNA 1ZJWA 1Z63A 3A4VA 1NWHA 8ABPA 1O03A 1Q1AA 3IMKA 3IPLA 5C5DA 1FZFA 4C0JA 1NW9B 2H1CA 4XWOA 2KB0A 1OGYA 4O8CA 1F06A 5KO2A 5ESRA 1KC3A 2E4UA 4IHJB 3RNOA 1EP3B 1ZGHA 2SECE 4HNRA 2Q7DA 3OLQA 2FH5B 1UBCA 4FZVA 5CJ2A 2XIJA 3FUVA 1P6QA 5GQSA 1UC8A 2DQSA 1SD2A 4CR7A 3VO2A 3UKJA 1D6JA 3E3LA 5ABPA 3QVOA 1TM4E 5F5NA 2VPQA 1AXRA 2PO5A 2YXLA 1KZGB 1SQFA 3UJ7A 3PUKA 1CHNA 1N0HA 1I4EB 1W85A 1COWA 1G4HA 3EGVA 1QCZA 1YU6A 1UBNA 5B4UA 1A5AB 2WIJA 5JSZB 4CEHA 5J4LA 4MUXA 2PGIA 4ZVTA 3H9CA 2BOVA 2R5WA 4B3SB 5E0OA 2YKOA 3NXKA 2GHIA 2OTLZ 5IRCD 2AUMA 1G3UA 4XEHA 4KDCA 3KQHA 2JCVA 4JLNA 3KAKA 3QW2A 1NN5A 4XEUA 1W30A 4UDYX 4EQ6B 1HZZC 4AUMA 1K98A 2UDPA 3J81f 4U39A 1KB9E 5D3MB 3CZBA 2EQAA 1V16A 4TRMA 2O19A 3GN1A 4A3SA 4KVZA 1O8CA 4AS3A 4W7SA 1WS6A 3INYA 3C3BA 2ZJ1A 5FO0A 4RESA 3RJMA 5SYMA 1NURA 5DVZA 3M2TA 1PLJA 2FTKE 2WTMA 1GL6A 3DVSX 3GTLI 2GCEA 2P6NA 3MMPA 3I5CA 5LP1A 1AD2A 5E7MA 3H2HA 1UQUA 4QTYA 1ONBA 4INOA 4IDDA 4W5OA 1I5RA 3AOEA 2WF7A 3BL5A 1MB9A 1NKTA 4Y18A 3U5ZB 3UAOA 1NJ8A 4MUJA 2G67A 1BCCJ 4AXXA 5TR9A 4MMXB 1IONA 2DGDA 2G1KA 3WA6A 1E2PA 1E1QA 3PHBE 3TD9A 3M8KA 2BFMA 2F1KA 5FEMA 3MT0A 3OWHA 3HRKA 1HE2A 1HFEL 3GF7A 2NADA 3VA7A 3PIRA 1O57A 1NUQA 4RVCA 2DLCX 1E96A 5LYJB 2XE6A 2OCXA 1JLLB 3F5FA 1R27A 1FXWA 3QYFA 2GX6A 2WZCA 3D7KA 3EQ9A 1VQ7Z 3K6KA 5HUQA 3ZWWA 1F7VA 2IC5A 4D25A 2VZ9A 3G5TA 2NTJA 4G37A 4S1OA 4AO7A 3HXMA 3EFOA 4MKGA 4RTLA 1J24A 3KX2A 3I05A 2AS0A 2HRCA 1HT3A 4JITA 3U7GA 3KOXA 1WY5A 3REFA 3ZK9A 3V42A 4FBMA 4E22A 1SQXE 3RK2C 4Q21A 3F9RA 3AE3C 4DJTA 4R1NA 1OVUA 1I2ZA 4PU0A 1TOAA 3FLBA 2B63I 5M7EA 1S3FA 1E58A 4BB0A 1Z7YA 5LZ8A 3TVTA 2I34A 2JWAA 4CM8B 1BZYA 4ALNA 1XTJA 1VKZA 4FEEA 1ORIA 4HNQA 1KMMA 4DIFA 3W67A 5JMTA 1KQFA 3WJ7A 3CNQS 3LXUX 3I1FA 4O59O 3LW5H 3TPZA 1SNYA 4MRMA 3VZPA 4CV3A 1CP3A 5FOVA 2VSYA 3KIFA 2Z0MA 5H83A 4R2LA 4TTIA 2PU7A 4F46A 1WXFA 4PLGA 4FMDF 3VH3A 4PNZA 1S2EA 1DCMA 1G3RA 2XVYA 2LCFA 3BEOA 5FL3A 2JI4A 1J0XO 2PGAA 2FPIA 4BWFB 1WBDA 1YZYA 4HPXB 3B5ND 1Q822 1UBMS 4PANA 4DE5A 1OXZA 4D44A 3MJDA 3F6CA 3AJEA 4LJ6A 4KC0A 2R62A 3EFGA 5C34B 2AW3A 3PUHA 2P9YA 4Q02A 8MHTA 1VQ91 4N76A 2RKBA 5JW6A 4QECA 2B6NA 3CPWO 4ND2A 3R7BA 1BVRA 3SPXA 4K6OA 1LSUA 5D6OA 5HIKA 4DV4B 4I5FA 5F1OA 4C7BA 3UV6A 1D7AA 4MRAA 2NVUA 3LHDA 4IIYA 5L95A 5ALJA 2PQMA 3ESRA 2KSJA 1HGXA 3FFWA 3LZDA 2HIMA 1RMQA 3NHRA 3JQRA 4ZAXA 1IQRA 4FFNA 2V6FA 3QTBA 5EPEA 2FEMA 1HVVA 4NYIR 1M0WA 3WB1A 2VYVD 4QUKA 5C3MA 1DT3A 1OOEA 3AG5A 5B30A 2DC1A 4FGWA 1JLKA 5LA6B 3T3NA 3SLGA 4C6HA 4MZDA 3QY0A 4M9QA 4PZZA 4UC0A 3I72A 4H17A 1XTVA 2PJJA 4GYWA 1CR0A 4Q00A 4YWHA 4INJA 3MBKA 3NR2A 2FUG1 2AJLI 4RSRA 3BK7A 3DEAA 3DP9A 1JJVA 2NU6B 5EG5A 2NU7B 5EMHA 1R64A 3A0RB 4W1QA 1TU3F 3RZDI 3U6BA 4EI2A 2FUKA 2CCKA 3CCQZ 4QLOA 3TQHA 1WULS 2JZNA 3NM5A 1AGNA 3PHGA 2YUJA 3LT0A 2EFHB 4FNGA 1TM3E 4B79A 5KDOA 4L8FA 3X2MA 4NBSA 6CHYA 4TSFA 2R5FA 4ZKPA 2E76C 1YZQA 2OQIA 1LTAC 3AE6C 2WOJA 3MYYA 1JQKA 1HBWA 2ZXUA 2DKFA 1BFKA 5DYYA 3EG9B 3SHFA 4KXQA 2QGZA 3MB5A 4PSAA 5TS3A 5K20A 2E18A 4LHVA 3ORSA 5JMWA 4WBAA 2PUBA 3Q41A 3OCJA 4CIWA 3WLKX 4BO9A 2M32A 2PZEA 2P7JA 1GL3A 4ZAVA 4ALLA 5K05A 2D2CD 4UHDA 5H3LA 1BU5A 2ZI3A 2IBMA 1LFAA 4ARZA 3KEQA 3LKDA 2O2ZA 1U1GA 4HEJA 1CE8B 2ZROA 3IAM1 2X86A 4MS4A 1U3WA 4IXWA 3JQ7B 5D1OB 3FROA 2C98A 2Q9BA 2OO5C 1P84E 4H2DA 5BOSB 4K87A 1BX3A 3JWIA 1Q81Q 3AF1A 4I1OA 2WITA 4EB6A 5EE5B 4UB8E 5F5XA 2V9ZA 3WNBA 1IRIA 3CX8A 3I56Z 3UGKA 4F7DA 3WYFA 4CKZA 4E3WA 3I8OA 4LNUB 5AJTA 2GBGA 3MP7B 1W19A 3LPAA 2ZSIA 1E9BA 2AW5A 1TU0A 4DIKA 3L9XA 1A2BA 3PUXA 4ZYTA 5B53A 2C58A 3AB7A 2GAIA 3BJMA 4A3KI 1F2TA 1P0QA 1RXYA 5HKBA 4J76A 1GFSA 4P0PB 2KPIA 3HCFA 2CNDA 4BVBA 3G2JA 2HU5A 2K88A 1BS2A 5T4BA 3WS7A 1Y8RB 5LR6A 3L77A 1S4XA 4GI1A 4P4GA 3IJEB 1QH9A 1HFWA 1DAIA 3N3AC 3PKJA 4LK2A 1O0CA 1L0NG 2V7QA 1NVXQ 2FE4A 5IASA 1CFJA 4BXOA 4N82A 3K9LA 1P77A 3FKSA 3LWZA 3QXXA 5FO1A 1IBLB 2OCYC 4B85A 4NOHA 3NGMA 3GZNA 3ZQUA 1JQEA 4ALKA 2QVXX 3HOYI 2RCYA 1HJBA 1POWA 4V2IA 1U98A 4FYVA 2MU1A 3O8RA 1GY8A 1O0SA 3RVBA 3WYCA 2IZ4A 1M2HA 2G7MC 4ZVPA 1YCHA 2DE6A 3CCLZ 1FFWA 3C3EA 4G3XA 2O8EB 1EZZA 4PJ0H 3A0UA 1G8AA 4CL0A 3TD6A 1U99A 4GWLA 1GSOA 5E3HA 2NPFA 4H1UA 3WMFA 3QUTA 3W34A 5KREA 3EEFA 4LWQA 1K8RA 6Q21A 1NJFA 4HNVA 3DTVB 1RQFA 4CRYG 3F1KA 2GZSA 3JAMb 1J8YF 4TNUA 4JKIA 2OV6A 1S4MA 3DBHB 4UHHA 2OXFA 2VBGA 3NYQA 5AJHA 3RYIA 2NMVA 3K0CC 5BMVA 3ESZA 4MUEA 1NTMD 2Q28A 3OU2A 4P5EA 4KPEC 3WDLA 3ZBQA 4JLPA 3QVVA 5HM6A 1ZUNA 4FKBA 1LI4A 3TL6A 2H8PD 2RHHA 3BXEA 3K92A 1K83I 3TLAA 1XP8A 3ILHA 5IHPA 4KN9S 4ETNA 2FPMA 3P5JB 1W4BA 2ZBUA 4F96A 5ALFA 4MV9A 2G0TA 3JAKB 1RQPA 3QQ7A 2AOTB 5KTYA 4LTDA 1FQJA 3QPDA 1KEKA 4DT1B 2EWMA 4G67A 4R51A 4RJIA 2G36A 3F89A 5LKRA 3PNQA 4Y2XA 2I5PO 3UJ8A 4K9NA 1RIFA 5CLGA 1V8DA 2VWHA 1Z56A 5EXDA 1YR2A 4OQXA 3VKGA 1J6UA 1AA0A 3ZDDA 3RE1A 5I7OA 2OK7A 4LZJA 4OKNA 4HDRA 3ZU5A 4KQGA 1U81A 1RJFA 1TRKA 1XD2A 4KPUB 3EIEA 3QWIA 2X0EA 4L5BA 1V5IA 2CFIA 4F2DA 2XCRB 1KHTA 5FBVB 3GEEA 5KWJA 4V1CA 3OQ1A 4YPOA 1FFGA 5EJGA 1R5SA 3MERA 3TZEA 5SZKB 4RF5A 5TQ2B 3C24A 3PFWO 4BFVA 1Z39A 5AW0A 4NF2A 3X1JA 2CXHA 1Q6ZA 5IZCC 4FXPA 4II3A 1L0NJ 2XU6A 3EPKA 3IUEA 4ZCMA 2VXCA 3V3KA 5EI5A 3TX2A 3QPVA 5CCHA 1I0IA 1XRQA 4D0SA 3QIVA 4Y9SA 1OBVA 2HT1A 2X9QA 5KYTA 3IR7A 5E38A 5JG7A 3A0HE 3QLUA 3QSYA 1PZQA 3JQAA 4QTUB 2A45G 1BN6A 2PZBA 4EB3A 3W5VA 4JBXA 3T7RA 3B2EA 1RTKA 3UXMA 1I50A 1HSOA 3ZGOA 1GRVA 2QRQA 2WUEA 2BFCB 3WQBA 4RF2A 3KAQA 2PMCA 4M76B 3H1HE 3AFMA 4PD4E 5BVGB 4YRGA 2P28A 1YUMA 4IV0A 4N54A 2BJOA 1EP2B 4BMPB 1BXGA 2ZS8A 1QHSA 5FOXA 1TM1E 4IDCA 3TRHA 2VAPA 2Q51A 4KFSA 3VGPA 3Q0EA 5GIPE 1WW3A 2QP3A 4QATA 3HABA 4XE5B 3HXLA 2GEDA 3L7AA 1OI7A 3RNLA 1KH3A 4J7CA 1LTGC 4BRZA 4GM1A 3AYXB 5A3RA 3EGOA 5AVRB 1V37A 1VIAA 1N6KA 5KLVE 4YAOA 4MQ5A 1G8SA 2O1SA 4BNJA 1YITP 1DKOA 3JSAA 1ATIA 9ABPA 1NVBA 4P3OA 4AUWA 3WICA 4ACBA 1CW5A 4U2KA 1YR1A 1IHYA 1FJ2A 1SKYB 3A04A 5IYZB 4LJ8A 4PAMA 3RSCA 3SBXA 2LIVA 4E03A 2BCCD 1RO4A 2OZLA 1VA5A 3LQRA 1MN6A 2PANA 3EZFA 2RC5A 4K3VA 4ZEOA 2EV9A 3TL3A 2UVPA 3EVNA 2ONZA 3DWGA 3E27A 4YQZA 5L45A 2FLWA 4WUVA 3A1WA 4WNYA 3E0XA 4EJ2A 1L1QA 2JRCA 4YGXB 2CLOB 4I1UA 2QY9A 2I7XA 1QH8B 1AY0A 1XEWY 1EFKA 1GU7A 4YO8A 2C0PA 4LMAA 1OI3A 2Q3MA 1ZICA 3HE3A 1YJ9Z 4AB1A 2CDRA 3BYZA 3L8CA 4H7HA 1EJ6A 4BO8A 5CGQB 3LX4A 4R7ZA 4NG4A 3PBKA 2A0KA 1JQLB 4U0JA 2ZTVA 4RKRA 5AW6B 2PWPA 3EXIB 3PGXA 2V03A 3QE2A 2XLCA 2QGNA 4FDMA 4EJFA 3MBOA 4W8HA 1J1DB 4Q4HB 3TGPA 3E9RA 1UODA 2H4WA 1SOWA 1GEEA 4HNAB 1IVNA 2CMGA 2D5LA 5LMNB 2XGSA 1X9VA 2WYUA 2AXTE 3COSA 4EAQA 1EG7A 1D1PA 2WPDD 3G2QA 1F14A 3DMHA 3EPRA 3IRVA 4IG4A 3I4MI 3LUHA 2X0NA 2AR7A 3FVQA 2J0QA 3EN0A 2IIVA 3FIUA 1GARA 3E4CA 1XTQA 4NCNA 1PJ3A 3AMVA 4OXNA 1NTMG 4PFSA 1VRVA 2J4DA 4K1XA 1Z22A 1A96A 5AT1A 3UMBA 1YE5A 1DC3A 2MT9A 4YIKA 5T5QA 3O6QB 4KQ9A 1U31A 5J2TB 3C8HA 5CBNA 1S72Z 4XSHA 5B7GA 3H1IJ 2JJ2D 3UJDA 2HLDD 3NIFB 1XN4A 1NQ5A 4HYTA 4KKXB 2X5KO 4JELA 3ONVA 3VHRA 2OTL1 3UYLA 3HO1A 3WDKA 3KSRA 2BFBA 3NDPA 2ES4A 1WPXA 2F3PA 4NBEA 1FNDA 2FZGA 3C6BA 3VFDA 1P2VA 4Q4JA 1UKCA 2H4XA 4E4RA 4CRZA 2HNKA 4N7MA 1ZRMA 3BB1A 3NHZA 4GZ6A 9ATCA 3IMFA 1N9GA 3DC2A 2W22A 5A9SA 1DEKA 1QFYA 4V03A 3LC7O 4DJEC 5C52B 4JOBA 2GCOA 4EAAA 3GLFB 5KS2A 2Z08A 2VZEA 3B60A 4Z4FA 1Y6ZA 1X7ZB 3QVGB 1IOWA 3KKZA 5C8ZA 4P1ZA 1Q821 1YBFA 4ER7A 2Y1DA 4DMCA 2ZKIA 5BV8A 3OG9A 1HGZA 2AN4A 2M8RA 5KKNB 1P73A 3HFSA 1C1DA 4TKZA 4YRQA 5CBPA 1ABBA 4BKPA 4Q6WA 1NKNA 2YVQA 2R6GA 4Y6PA 1KFMA 3L84A 3A4MA 3PO3S 1N1DA 3WWZA 4ZNCA 3TMYA 2Q4DA 3G4SP 4BNFA 4ISBA 4AMUA 1OI2A 4YQEA 4HQKA 2CPBA 5TE9A 3K0KA 5REQB 3OU6A 4A16A 2Z9CA 4GQIA 1M1ZA 1QK4A 1PNQA 1T2VA 1XELA 5GLXA 1FZTA 3PR1A 3L40A 1IC6A 3W5BA 2JA5I 1SCJA 3MQ4A 2MSEB 3ML1A 1KYQA 1MDBA 1NATA 3ZY4A 3G8DA 1R6AA 3T4PA 5LBIA 1POXA 2GHTA 1H4SA 5AVZA 1VQ71 2EFYA 2C96A 3KDPA 4X62B 4IR7A 5HKAA 3NIGB 1KL7A 4QHTA 3VYTB 3N8NA 3MFQA 4BY7I 3VHXB 3HO6A 4LJ4A 2R92A 5TQVA 4RHFA 4EHFA 1VDMA 2NXCA 4FI3F 1G8HA 5G0TA 3CH7A 2JGEA 5AVJA 2F3RA 3IBFA 2CMDA 4JBNA 2WD9A 1W2EA 3RGGA 4AKGA 3N2ZB 3BD9A 2JJLA 4U2BA 5LVAA 2IV3A 1QPGA 3A4NA 5IEBA 3Q6IA 1U28C 2E5FA 5BVHA 4HFRA 4F60A 1UBJS 2WJGA 1NTMJ 3K9WA 1L0LK 2XDWA 1NVFA 3TDKA 1AZSC 3IBGA 3DTYA 3MWYW 2FMHA 3GMDA 5TB5A 4Q1FA 1OYOA 3VU8A 1Y98A 1N10A 4OXXA 3FOBA 1M6WA 3QG5A 4V0RA 2FHSA 1TCAA 3TJZA 3K09C 3GCGA 1SG9A 3D4NA 3T5BA 2GU2A 3AP2A 3R2PA 2Y6VA 2AXPA 4MVYA 1QWOA 3ESCA 3TZQA 1E94E 3HVRA 1WUTA 3KELA 3E8MA 2BCCG 3Q5DA 4R9NA 3D6AA 1P19A 1II8B 1PKXA 5BSEA 4FWBA 5HQ3A 3EB9A 1YQUA 4I3GA 3IVMA 4LYFA 1HD5A 3SXJA 2NLOA 4B9AA 5JZOA 5CXSA 3ADCA 1ZN5A 5K0EA 3KQPA 3FOAA 1JR4A 4CLOA 4LHYA 3RBXA 1ZIDA 3HRHA 4B3IA 4ETWA 5HCIA 4L85A 7AT1A 4BFUA 1BDBA 2X8WA 1NBMD 3AEYA 2JARA 4FR2A 4BNIA 1T3ZA 2VEOA 2E2HI 1WVGA 5H02A 4LXQA 1KKMA 4NATA 1DBIA 4Y99B 1X19A 1K8YB 2FPKA 2QRKA 3I83A 1FRZA 4MI1A 4LYGA 5F3RA 3FETA 3PD7A 2AEJA 2VBCA 3QOFA 4YI5A 1SHUX 3NJ4A 2R65A 4LXIA 3O4IA 3RJZA 2VK8A 4GP9A 3EOAI 3L49A 3GGOA 5HWSA 4LNHA 1NXOA 5EEHA 5H2FH 4NBKA 1WXXA 3ZTWA 3JVIA 3UY4A 4L22A 4EG3A 2QRXA 3HKBA 4FOSA 1M0TA 1XDDA 1KILC 1VQPP 3QPCA 1N2DC 2WU4A 5C7IO 4HWTA 1K0FA 4DIEA 3HCAA 3CH5A 2HO4A 2YN0A 4J0FA 3ZV4A 1PYUB 1FSFA 4TTSA 3I64A 3ROKA 3CCQ1 4PQGA 1NUTA 3I6QA 1UC4B 1FDOA 4NBFA 1A8IA 4HNUA 2HREA 1P1JA 1LLQA 3RFXA 1G8FA 1N9ZA 5KMGB 1JVNA 3JQGA 3DKRA 3H05A 4BBJA 2X8BA 3N6RA 2HQBA 4YXFA 2M6KA 4EDFA 1DD4A 4S1VA 3V8NA 3BHJA 4QGAA 3OPQA 2L17A 4KB5A 1K88A 5LDHA 3S9OA 2OYHB 4DRZA 1R74A 4E5VA 2IU4A 3T6KA 1DC8A 1W47A 4JB8A 1L4FA 4MQLA 2G1AA 2G1UA 2Q8PA 4FTWA 1N1EA 5EIWA 3EQZA 2WHXA 5CDHA 3MUDA 5BUSA 1E7QA 1SEVA 1MC1A 3MJHA 3LLVA 2AMJA 1NF2A 3SDZA 1PX2A 4A5SA 4O1MA 3U16A 2QD5A 1GUBA 1KHHA 4ZAYA 4JLSA 5LOVF 3RG8A 2H4ZA 5JAOA 1GPH1 1N5RA 3QMPA 3L8FA 2FPLA 3MCAA 1VQ9Z 4NJMA 2JGNA 2BCCJ 3VNVA 1VQ8P 1F6DA 1BH6A 1JFFA 5IK2D 3GUYA 1Q16A 2GPNA 4H35A 2V8IA 4BPRA 3OKCA 2ZIXB 4PR0A 1CR5A 2PH3A 3WGIA 2Q3LA 2Q5JA 4Y1EA 5CK5A 4CIDA 4JOSA 4HQOA 3MVEA 3OJWA 1VI2A 1DRJA 1HE3A 3GWZA 1UPFA 2O1KA 3ZE6A 1LK0A 2RH9B 1RYDA 5CB0A 4RHXA 4HS4A 4CIBA 2NGRA 1PFIA 4QXQA 4LZLA 4C1BA 2Q2QA 3I58A 4RH0A 3F96A 4CFYA 1OFTA 5K0SA 3MS7A 4IM7A 2BGTA 5CCGD 5AVWB 4R1UA 4NPEA 4B5LA 5IKOA 5SY4A 2DFLA 1WETA 3E7XA 1P2DA 5KAIE 4LYYA 3ZD8A 4PLHA 5JZSA 1ETUA 1VF5C 1B14A 1DIBA 2ZR0A 3FBWA 5A1TA 4CL1A 1M1K2 3H8SA 2VAVA 3SQMA 1FTNA 1P6UA 4DARA 1IEWA 3HCRA 4YGYA 3PTAA 1IN4A 1RU3A 4LHXA 3F5MA 2W0MA 2COKA 2VYFA 5BURA 2GUVA 1AVYA 2Q6IA 4ENWA 3D6VA 2HRBA 5EERA 2YO2A 4PV7A 3U49A 2VH5R 2M6LA 4TLCA 1XRLA 3T7IA 3IEXA 1F8YA 1DXQA 2VPZA 2XUIA 4AN0A 3A0BE 3DLTA 3UTCA 3OT5A 4HMPA 3RL0B 2YY7A 1QG4A 3KZ1E 3DLAA 5LMZA 1GQRA 1ML3A 5LLDA 3V4WA 4MWTA 2WSYB 3LPNA 1L5LA 4CKEA 2PSJA 4DLRA 1W0KD 3X2EA 4R0MA 3HRIA 5F52A 4H44C 2NT3A 2QR1B 4Y1FA 5FPYA 3AFHA 4L4XA 2M1XA 2RSLA 2EAUA 5E79H 3LVFO 3BS4A 2OM2A 3TFOA 4PLVA 3MCTA 1FYXA 4D9BA 1YDEA 3H65A 5FUBA 2WHPA 3TQCA 3KT8A 2IFNA 5B4VA 1WHTB 5CTJA 4MUKA 1U2GC 2P58A 1FZQA 2Q3FA 1ZVMA 4WSOA 3HCNA 1SOVA 2A0YA 3NTUA 2GXQA 2EQ5A 2IUTA 4MGKR 3ELBA 4ERNA 3T0IA 1E59A 3MUFA 1VHJA 4OGQD 1O6GA 1J8MF 4FFWA 1T91A 1JFSA 5H1YA 1RMTA 2FB9A 2B8EA 2FETA 2BMDA 1PSDA 3VNSA 3A1TA 1W2WB 4DLVA 4ZT6A 3QUCA 3VR5A 4DTCA 1V71A 5CXXA 1U9YA 3ICPA 4OLJA 3IQIX 3HNPA 3ONEA 4DG9A 1UH5A 1U1DA 3PQ3A 2WLSA 4AJLA 4S1PA 1RTTA 1EK6A 2V8BA 3UXYA 3HYTA 4FD2A 1IPHA 4GX1A 1VJ1A 1XWFA 4HH1A 1W4AA 3LA8A 4QTTB 4MUIA 3JALA 2D6FA 5I3CA 1J1UA 4KXXA 1WUIS 2QX9A 1IBSA 3TW6A 2HLOA 1L7EA 1BDMA 4MCAA 1J56A 4ZKDA 1YSCA 5KTRA 3P32A 5DTIA 3R9XA 1A0OA 2REOA 1EX7A 1C9NA 4LOHA 1PJSA 4Q9AA 1J0BA 5AVTA 2P6OA 1CY2A 5GTHH 1K6JA 3OO0A 3RO7A 4LOJA 3AECC 5DNCA 2XGJA 4CM4A 4EFDA 4LK3A 1QP8A 1IIRA 1DNPA 1OYYA 1JF8A 3RK3D 1J22A 2CLEB 2FDRA 3MCZA 2FY8A 4XFKA 2EBFX 2ZSUA 3QBDA 2OE2A 5BXYA 4Y6OA 4XTRA 1GAEO 2CSUA 3FHCB 1YKGA 1U8EA 1F8GA 1W85B 3EC2A 5CH8A 5AWFC 3CVXA 1SFCC 1P29A 1ZVVA 3HJTA 1JGTA 3S44A 1R6TA 4GZLA 5LWHA 2J08A 4C3ZA 2NT4A 4ZQBA 1HNXB 4CEHB 2HZBA 4Y1RA 5IUKC 2YWHA 4U7GA 2X77A 2O5VA 2Q41A 3WIOA 1LWOA 2HFED 1PNOA 1UWLA 3DZJA 3KK0A 4QDJA 2PLAA 3DV0A 4EHJA 2PT7A 3HCCA 5FNZA 1T35A 2EZ8A 3NIBA 2ZT7A 3WKDA 2XT6A 1ZXGA 5IBQA 1PGJA 4CQNA 3WGJA 4NBTA 1QYXA 4L78A 3K5PA 3NFRA 2GJ8A 1C7EA 5CXUA 1QE0A 4YR7A 3NHKA 1T5DX 4IJWA 4NS4A 3AJDA 4P3KA 1CK4A 3ZDFA 2AZ4A 2C8VA 2BE5D 1JZTA 3VR4A 1AKVA 1E3LA 1LDBA 1YB2A 4IRMA 5DT2A 3CZPA 2CD7A 1GL2A 3E61A 4NVRA 1NRWA 4F12A 1FU4A 3MHVA 2N1TD 1E2UA 1ZAYA 1BHQ1 5D87A 5MHTA 1V6AA 3GMIA 1LNQA 3RGWS 1G5TA 3W6UA 1W2BO 4LAFA 4EYKA 4CVNA 4KRFA 4LCEA 4BNKA 4GU5A 2QE7H 4JQOA 4OXYA 2O0JA 5IDXA 3TNUA 2G06A 3DEKA 3NZEA 2Q1YA 1LPOA 3S1KA 5E1DA 1SAYA 4UNSA 2COEA 4ZGBA 4JHLA 2AG1A 3A9VA 2POHA 2X1VA 3H32B 4D7AA 2BC9A 4A0FA 3LBNA 3V5NA 4J0EA 3T7TA 5A6SA 5LP6A 2H29A 2I7TA 4D9FA 3T41A 4H0LC 4LECA 3Q40A 1F3LA 1FC0A 2VHTA 3EISA 1EDIA 1VB3A 3R24A 1TW3A 4CM9A 5IAEA 4JL6A 5DSTA 4HEA6 2QNBA 3MT7A 3P0RA 4WVZA 4NU5A 1V11A 2FU5C 1IG0A 3V32A 3ENVA 2W37A 4RLHA 2NVWA 4P31A 2C9YA 3M9WA 3S1SA 3B85A 1XZHA 4B3XA 3VX3A 3A9SA 4LF7B 1BSHA 2VF1A 5G3YA 3HTXA 4E88A 4W4TA 2QJKC 2XMQA 1EP9A 1RQLA 1KQFB 5JS6A 1B6RA 2RJNA 2W00A 3EZXA 1D4OA 4ZVLA 3TM7B 1IDOA 2KPOA 1P2TA 4TT3H 4JLUA 1IW7D 4GA5A 3CMAP 1PW5A 2Z3ZA 2FEKA 1IL0A 1RHQA 2IPMA 4F4CA 3URKA 1T29A 4ABTA 1F8UA 1GDTA 1QBGA 2UZIR 3KOMA 2IS6A 1FBNA 4RETA 4LF4B 4G1FA 2FPIB 4DQLA 5HUJA 3A2NA 1K08A 2B4TO 3G68A 4DMMA 1RJEA 4LZNA 2AE0X 3BZUA 1Q12A 2ZB2A 4CPGA 2QI9C 2OXEA 4LRXA 2EZ4A 1Z06A 2NNWB 3MA0A 1NUIA 2I3GA 3Q98A 5HE8A 1Q2NA 4ZPJA 2O4CA 4XIYA 1YR7A 2JLAA 2R8RA 3NT4A 3UMSA 5AK5A 2QLJA 5E6UB 4XW2A 3CZRA 3QNUA 5TNXA 1QFMA 2NVUB 1MABB 4U7WA 5ERXA 4L07A 1VE3A 3QFHA 4C43A 2ZT9C 3JD2A 4F06A 3C8ZA 4P6VF 5E6RA 3FHJA 2B94A 3R5KA 1CT9A 1WXIA 1CF2O 5EC8A 5CURA 1FSSA 4IVPA 4UM9B 2XZOA 1B0PA 1GPWB 2LBPA 3IT0A 5CNIA 3PLAE 4IJKA 3TX6A 1Q6YA 1XWIA 4POOA 1XLWA 3UWDA 3QE3A 1U0BB 4W7IA 1V1JA 5KQPA 2JEOA 3BMQA 3H1EA 3RF6A 3C7TA 2WINI 3T3DA 2P11A 4BGDA 4I55F 3BCCD 5FI3A 1B2RA 1H6BA 1T3GA 1X94A 3HJHA 2GA9A 5HA5A 3IBCA 1YJW1 4TTPA 1W44A 1J20A 3WUTA 2YYSA 4XWWA 5TMDA 4FYXA 4L4RA 5CFMA 4PS0A 4RK7A 2PMDA 3M4YA 3NT2A 3L73J 1GRQA 3LUSA 1JS1X 4FEAA 5JJBA 3M06A 1GSIA 2JGKA 2R6R1 3HV2A 2JIZD 3CXCZ 3BH0A 1VB5A 4EARA 4E46A 4J3NA 1DJQA 1E79D 2I1LA 3VPCA 2O01H 5NULA 2P4EA 3T54A 3LNCA 3ZW9A 3DFZA 1TK3A 3NDJA 4KT0J 3CPWY 2GILA 5JRZA 4XSGA 2PSFA 2C4NA 1ZGCA 4GFDA 4MCIA 3CJTA 2W5UA 3L70J 3GEHA 2Q8NA 1UQTA 5JXIA 1YASA 5I7HA 5DOVA 2JBAB 4OK3A 3WI7A 2VQEB 2Q3JA 4DY4A 4ARZB 1SQVK 4NU6A 3P8MC 1H0RA 1OIPA 3L06A 1CDZA 1E9CA 2HY7A 4MS4B 1NMQA 1UC5B 3AQ4A 3COVA 2WWIA 2PLWA 1XKQA 2VXOA 4JJ6A 1YGPA 4EB6B 3OF3A 4HAOA 1KQLA 2NOAA 2VJAA 4FWIB 1YAHA 3RVLA 1T43A 4EIJA 4TRRA 3EGCA 3N5CA 4JR1A 5ICFA 1K97A 1NU1K 1G7TA 4OI0A 4MV0A 1OCEA 5DJTB 4JWKA 4BE4A 3HC7A 3DEZA 4FFMA 1SWWA 5I7FA 1OW3B 1ZYRD 5ARBA 4AJ2A 2FSIA 1VJ0A 2Q4ZA 2G9RA 4F5WA 4X44A 4IY1A 5CT4A 3ON5A 1AHHA 2QHXA 4O2BA 4OL0A 4JEIA 3RSOA 4YRBA 2ZT8A 2DQ4A 1YDMA 4G4IA 1B4DA 5C1DA 4Z9XA 4G36A 2F4VB 4AYXA 3CCS1 2Q5OA 4LJ7A 1WMAA 2UWJE 2G5GX 3KP1A 3KV1A 1T6XA 1YZ3A 5KC9A 1SXJC 3CLTC 2IKQA 1HYBA 3VTNA 3HGMA 4IJVA 3OZEA 3VPDA 3EUEA 2GCPA 2PL5A 4MJ3A 1SUDA 5DM0A 2GO7A 2PKCA 2AQKA 4LGVA 3B5NA 2BVNA 2PAAA 1XTPA 1E7WA 4KDRA 2O7VA 5AVSA 1I7PA 3KLBA 2WRZA 2RHWA 2QKDA 3S7ZA 3GZNB 4ZYXA 3B1JA 4PCVA 4JP3A 3L7MA 3KJZA 3EVDA 3K2BA 3VZBA 4HMOA 1L0ND 1SEPA 1VGRA 2NO4A 1WCIA 2CHUA 1Y4UA 4LY0A 4BNHA 3JQDA 3DVRX 2ZIAA 4YBRA 3I73A 4LBYA 1L7VC 5IVIA 1T5OA 2B36A 2ZI7A 1AQTA 2ZXEB 5FFMA 5EIBD 2HG5D 3CH4B 3ODGA 1OZHA 4LZAA 3N7UA 4II7A 5IU6A 3SC4A 4R2JA 1DWOA 4RF4A 3DNPA 1NUSA 2JIRA 1V7QA 2OBXA 3EIUA 3O2JA 4EDHA 3RYTC 1H8AA 3FDZA 1XJ0A 2G8YA 4PD4H 3DD5A 3VYUB 1BYUA 3RYIB 2Z09A 4UQPA 2FXVA 1M1K1 4CW7A 5BMVB 3S7TA 3HP4A 1QOQB 1G6OA 1ISIA 2ZBGA 3L8YA 2GDJA 2LGJA 1AS2A 4UTRA 1YTUA 3L8EA 4K9LA 3ITDA 1T1IA 1NN3A 2JIBA 4GNKA 4TTVA 2H1LA 3FR8A 4OAOA 1IY2A 5GTDA 3QEAZ 4L4UA 2Q8QA 1I3QA 3ZUPA 2HCJB 4R54A 1QKJA 1EXIA 2HA5A 4C4SA 4B4DA 3H9QA 2AR9A 2PBZA 1CFZA 3LWDA 4ZYLA 1EFUA 4KYVA 5FAXA 2DF8A 2FFRA 4D26A 2KI5A 9GPBA 4YMLA 3FOZA 5C1BA 1KO4A 4QBHA 2VDOB 4JJIA 2DR3A 4RD0A 3WHLA 1IJDB 2PWYA 2J7PD 4TXJA 4NWIA 3L1KA 4XJSA 4HDRB 1Q7RA 2QUAA 4FC7A 3A6DA 1H4QA 4S05A 3IUJA 1M8GA 4RV0A 3X3HA 1URQA 4NH1C 2FR1A 1XD2B 1NUHA 1T3TA 1QPZA 3ANTA 1EZVI 3KPEA 3D31A 4PLFA 2RH5A 4KOAA 1FSGA 1Y9EA 1WBBA 4F3CA 4DVGA 3AEQA 5FR1A 4V1CB 2EW8A 4DWWA 2HLNA 4UDOA 3OEED 1S3IA 1HMYA 4PZYA 2P9ZA 3GH1A 2EIHA 3D64A 1HLPA 5AW0B 1GA1A 3BCCG 3PC7A 1ZMEC 1GCAA 3KETA 1MR3F 2XADA 1U7HA 1V8BA 5B57C 2PU5A 1T3SA 6PFKA 1R6BX 1T15A 5EY5B 4O5AA 1H4TA 8ADHA 1IN5A 1Z7GA 4MQ4A 4LGCA 3MYRA 2IHVA 1YK1A 3L4BA 2CXNA 3IE2A 2C92A 1X8YA 3DMPA 3JQAB 2VUTA 2CWWA 4RWEA 1Z5PA 5EKDA 4I4TB 2A9VA 3G0OA 4U5QA 2J3DA 4DYHA 3HA2A 3TRIA 1DV1A 2G8NA 2IL1A 4H13D 1O5TA 4ZMBA 4IIHA 4YRRA 1YI0A 1V9CA 3L74G 1IBRA 3RSSA 3A6PC 1F3OA 1FLDA 1PL7A 1MB0A 1GZ7A 4EPYA 1JAZA 1NQAO 1GPBA 1DC4A 2RHRA 1I0ZA 3W2HA 4EZEA 1FSZA 3BMNB 3H97A 2R66A 2HDHA 2B2CA 3UJNA 1BXGB 2C2MA 1J33A 3FRJA 2DE5A 3K2EA 2FWAA 1M1NA 2GMWA 3LZCA 3ZLUA 4CNBA 1G4AE 2CDNA 3D6FA 3ZE8A 1Y3DE 2QPOA 3CLKA 2X2PA 2OBLA 2ZJYA 3NRBA 3LT5A 1T0IA 4N47A 3JD4A 4TZ6A 3E1KA 1R4NA 2QIPA 1YHZA 2I54A 3S2DI 5KNBD 4R8KA 1ZRNA 4QPNA 3H1ID 3CR3C 4RO0A 3LGAA 2R6ZA 3AVQA 4ZT3A 2A69D 4UZSA 1NI5A 4RTQA 1QIGA 2PS0A 5KNCH 1RE0A 4DV7B 2BEKA 1PT6A 3HCOA 3P9XA 3TPCA 1QTIA 7YASA 4CLDA 4ZTUB 1WKBA 2YMQA 2ZI5A 4Z1MA 4XCVA 1YQDA 4X7MA 2OZLB 2VTBA 1MQ8B 3GFBA 3ADDA 4XXHA 2GBIA 4RLSA 4YAKA 3SVLA 1MORA 2OCKA 2GF2A 2XB9A 2W6BA 1CQPA 2YS6A 3FUXA 3KQSA 4AM8A 3F4KA 2RI0A 1VE5A 1E2LA 3FCSB 1WZUA 1JQDA 2QPLA 3RUAA 1EE2A 2D5AA 4WLEA 4I1YA 1E5TA 3CC71 3WGTA 1O2DA 2V59A 3TAXA 4JHXA 3M3GA 4Q01A 2OEPA 3G88A 4PYIA 2GNOA 4NBRA 4QUGA 2Z5GA 5K99A 3OTWA 3ORFA 3DL0A 3DMNA 4W7HA 4QT4A 4DSNA 2E74B 4R4LA 3QXCA 3FXEA 3BAZA 3OETA 5AKXA 1JSRA 2P8JA 2HLPA 1RZVA 2QL9A 3CGGA 3V6LA 2XUHA 1G6HA 1JHDA 5ILGA 1A95A 3BCCJ 1Y7LA 2GD6A 1M2NA 5KHAA 2NVXA 5E4YA 3BPSA 3IYLW 1TWAI 1SGWA 3VSBA 1Z82A 3AR5A 3I28A 2BN4A 4HB3A 2DBZA 4DG5A 5HF8A 3CZMA 4HY3A 3SC6A 1EFRD 5KSZA 4YWJA 5DX0A 5KZMB 2UZ4A 1TB4A 5DGHA 1RXEA 2G17A 2GJ4A 4FYYA 4I0WB 4LY9A 3BQMB 2GM3A 4OU5A 3AKDA 3GJ6A 1T1JA 4C0HA 5FBKA 5CVUA 2W6AA 4MULA 4QPZA 2CKMA 2IDBA 5IXYA 2FSFA 3L74J 1USPA 2FW6A 3TCKA 5HRAA 2Y9ZA 3PQDA 3B1VA 4I50A 1Z4LA 1YD7A 1YMUA 4Q34A 3MONA 4F0JA 4A93I 2FRXA 4OEHA 4HYTB 6AT1A 4B83A 3TWOA 1QQAA 3C3PA 1OXVA 1Z0IA 5A3VA 4W5RA 1J8VA 1PQ4A 4XGRA 4MD8A 3FYHA 2BFBB 2FEXA 4UM7A 3V2PA 2XY4A 4OATA 3ZVRA 1QFZA 1HDXA 4BFXA 5GLYA 3RI3A 2EKPA 4CUZA 1P0MA 2X0FA 1N9GB 1OAOC 3ER6A 4ZCRA 3SFVA 3JYHA 5A9SB 1P39A 3HBJA 2VQDA 3H9GA 2XB6A 5JS7A 5A4MS 2W6MA 3BF8A 1AUQA 1M0SA 4M88A 2HUNA 2YRFA 3CQZI 3G85A 2GCOB 3GTPI 1N73A 4EHLA 2VCHA 3RIGA 3WK4A 1M2EA 3RWOA 1C0PA 1LVGA 3WJAA 1S2NA 2IPXA 4NDZA 3JTMA 1DC6A 5H8WA 4D0GA 2I6TA 3I6YA 1C1DB 5CBPB 2ZRBA 4UD2A 5CR9A 1E62A 4J6EA 2GWHA 3ZZMA 1H6AA 4Z1OA 2PN1A 3KZXA 2Q0SA 2LCIA 1BFUA 1Z68A 2I8LA 3S1NI 3KO8A 4WFQA 3ZJVA 3TFWA 1U8CB 4GMFA 5CLFA 4U2FA 5KHOC 1AH2A 2C88A 1QZZA 2R7AA 2P41A 4WFKA 4O4IF 5I48A 3IUNA 1P9RA 4IBOA 2IITA 5E4TA 3R7SA 3ZHBA 1SQPE 1L5KA 4QAQA 2JHPA 2ZYUX 4C87A 4NB9A 5CM8B 1HA3A 3VRHA 3F9IA 2EARA 4B31A 1T0HB 5BUCA 1IHOA 4RL4A 1ZWKA 1QGUB 4D02A 5AVZB 2PKQP 1O95D 4MUAA 1EXJA 3KDPB 3ENQA 3K32A 3W5IA 4TLLB 1I80A 1OFUA 2ZAIA 1L0LJ 3PIDA 4C78A 2WSBA 4KPFC 1NTKK 1PWXA 2ZCUA 3E3OA 1ZB9A 2AX3A 3W9UA 1PHPA 3VHQA 3BA1A 2EFCB 3N8KA 3ZCTA 1JB0J 4AC9A 4FPXA 3B3QA 1VHWA 3ADKA 1FFXA 4MDYA 5J47A 3VJKA 5FKJA 2PBFA 4X84A 4FOPA 3T3PB 4W99A 3H1IG 5DHUA 3BD8A 3UICA 2G9QA 3QF7A 3WIVA 2QQFA 1R8YA 4KL8S 4Y6QA 2GLUA 4PX9A 4MV6A 2POQX 3F5DA 3MGCA 5JDIC 2Z8YM 3KEGA 1B16A 4K3AA 1KIFA 3W8NA 1CUWA 1TYZA 3NC4A 4ME6A 3RYCA 5JU6A 4V39A 1BD4A 3OD1A 5DMHA 4D6TD 1W48A 3GD5A 2WPDA 4LGDE 3ZWQA 1X3SA 5AYVA 3WB2A 2VH2A 1E0JA 2V96A 2HDNB 2WWXA 5HQ3B 4MPDA 5JVDA 1MO2A 4LE1A 1C0KA 5ESXA 4B34A 3D6HA 3HE4A 3GQBA 1KAMA 1PWZA 1KYOE 1E1YA 1K4KA 2E2WA 1A5ZA 1C50A 1TYAE 4CLOB 3ICEA 3H3VJ 2AHOA 1UZUA 4EHNA 4QBKA 2VTEA 3QH9A 2CDBA 5AP9A 3PDWA 2H2IA 5DCWA 3OP4A 4RS3A 2ZPAA 1PQHA 3AOGA 3DWIA 1IEXA 4RDIA 4UOQA 1RBMA 2GJSA 3OP1A 3FNGA 2A0UA 3HN7A 5KTKA 3QX8A 3VZSA 5JPCA 3R8XA 3BREA 3AR4A 4HWSA 5L3QA 1JMVA 3AUKA 3C4QA 1C9MA 3HWWA 3DO5A 4OK6A 4KI0A 3FCAA 4XGIA 1GZSA 1ZV8A 2WFZA 3R0VA 1MOSA 2WIFA 4OQPA 1EJBA 3HKBB 4AY4A 1PQEA 1MVLA 1BCCE 1XMOB 1Y1PA 1U4SA 1J8QA 4P7KA 1TW2A 3TIWA 4ZARA 2C0QA 1S1MA 4GGMX 3UK7A 2JLXA 3NXSA 4M1QA 3R5FA 2VNIA 5ERYA 4BYGA 2Y76A 4ZHQF 4NK5A 5LZ5A 3I39X 5M2QA 3GW6A 1YBKA 1TVKA 1CI6A 1IULA 3TTVA 4TXHA 1TFRA 3JQGB 4NV1A 3LXRA 2DWUA 3ZLVA 4LZOA 4LFBB 1E0AA 2JRLA 4QGBA 1SUBA 4HWKA 2N9UA 5HP4A 2HQRA 5ITSA 3LC1O 3AY7A 2A78A 4J3JA 4IIUA 2XITA 1AKWA 1SBNE 1J39A 1L7MA 4X93A 3AF2A 3V4FA 5HGJA 4GX2A 1D0IA 4P7FA 4K35A 4BMSA 4J94A 2P0YA 3F7OA 2F8LA 4HSEA 5K01A 2CK3A 2GXAA 2CNNA 3V7FA 2R1VA 3ABIA 1GGFA 5CG1A 4F3NA 5LQMA 2QV0A 4CPDA 4AK9A 1UK8A 1TXGA 3BD6A 5CVDA 4K9RA 1H5NA 1LX6A 2QUZA 2XKMA 1WEKA 2ZJ5A 2KQAA 4PPNA 3B3AA 2NQ2C 1K9VF 3PGKA 3DE1X 3BHMA 4NJMB 4ZFNA 4NPDA 3DYVA 2KS1B 1KOGA 4H59A 1XDZA 1N3LA 4NPAA 1JFFB 4GC5A 3QLTA 5BW6B 2B2XA 1WAMA 2XAUA 1HM5A 3QVUA 3JRWA 1GTVA 3JRNA 3NM4A 5HFNA 4IDBA 5J4VA 1YCGA 1TWCA 2W6QA 3FFBA 1JO5A 2ZWPA 4I7ZB 4HUTA 1T9DA 1TC2A 4PBTA 3S6JA 2J3MA 1P7CA 2QTVA 3ZDAA 5GTIE 3CUVA 3O4HA 4YLGA 1V5WA 3TGUJ 4WZBE 1TJ5A 2V97A 4ARVA 3EVBA 5KIAA 5BR4A 3VISA 2QXUA 2VDKB 4UAUA 2ZWOA 2FPOA 1N86A 2ZJAA 5I6DA 1PL6A 1NXQA 3PP5A 4DMRA 5HF6A 2Q1WA 3ZWMA 2F4MA 2F8TA 1R5NA 2JLCA 2Y9MB 4WLUA 4AX4A 4IRXA 3REGA 1XF1A 3GRFA 1PTJC 2O2IA 2P62A 2ZUBA 3GGGA 5A7GA 2GN4A 1CC1S 1GRCA 2K87A 3E23A 2P35A 4I66A 3OZBA 3KUKA 5EIAA 1ZSNA 2I03A 3FNRA 3F0TA 1SBYA 1F51E 4Q1CA 1HPLA 4ECEA 1NZDA 1PLLA 2ZUUA 2XIQA 3MWEB 5EWMA 1IG3A 2I6FA 1GT91 2P2DA 1SFOA 2FRDC 1YJWZ 3FTQA 3EYAA 2V7GA 2XE4A 4G9EA 3RWMB 2HBYA 3HQ4O 3IC5A 3FYDA 4NBLA 2ZZNA 3LQKA 2OY0A 1ODCA 2E21A 4B32A 1Z4KA 4U7PB 2XJ9A 1TAQA 1HEIA 3D7NA 1I10A 3ZIDA 2Q9IA 1HDIA 3NLLA 1IE3A 2OARA 3N2KA 3UMCA 1YQGA 4I14A 1SU8A 5C3UA 4CKEB 3C3WA 4D46A 5B1DA 1XD8A 2K6GA 3NHWA 521PA 3AE8C 4BO5A 1B1AA 2H88C 2Y0CA 3CRMA 1ZX1A 2I4LA 3UMFA 1NJ2A 3CLRC 4D6TG 3ZWBA 1JMYA 3WKBA 2FMFA 2WHPB 3KR0A 3PO3I 1EAMA 2QORA 1Q1EA 3CM0A 1ODTC 1Q2XA 2PMBA 4CMKA 5FORA 3IIKA 2YH2A 1LU9A 2WSCH 5FHQA 1JHUA 2J4CA 4LI3X 4B43A