4AOKB

Conformational dynamics of aspartate alpha-decarboxylase active site revealed by protein-ligand complexes: 1-methyl-l-aspartate complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Dynamics of Aspartate Alpha Decarboxylase Active Site Revealed by Protein-Ligand Complexes
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ASPARTATE 1-DECARBOXYLASE BETA CHAIN
total genus 24
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4aokB00
1UHDA 5GLFA 4KODA 2V3VA 1Y5IA 3H0GA 5DYIA 5FTJA 2E7ZA 1Y1VA 3IR5A 2NAPA 1I50A 1DMSA 1R27A 3GTQA 3GTGA 4AZDA 1TWCA 1Q16A 1PQFA 2VPXA 1IW7D 1AW8B 4CRYG 2JIOA 1OGYA 1PT1A 4GA6A 2VUMA 1FDOA 3TIWA 2C45A 2B63A 1SIWA 1PYUB 4KDLA 1G8JA 4AOKB 2JIPA 1FDIA 2PJHB 1SFOA 1EU1A 3GTPA 2DMRA 1Y4ZA 2JA6A 2EEOB 2V45A 5C18A 3QQ7A 2R92A 1I3QA 2VPYA 5FTLA 5B6CA 3QWZA 3ML1A 4RV0A 1PQEA 1G8KA 4KO8A 3HU3A 1E61A 3HU2A 1CZ4A 3HU1A 4CS0A 1YLEA 3GTKA 1E60A 1CZ5A 2IV2X 5FTKA 5T5MD 3QC8A 4AAYA 2R93A 1H0HA 3CQZA 1UHEA 4QIWA 4D7ZB 2R7ZA 2PMZA 4KLNA 4CRZA 4DMRA 1PYQA 1TWHA 3FKIA 1R9TA 1KQGA 1PQHA 2JIQA 5C1BA 2E2IA 1PT0A 3IR7A 1WCMA 4AYBA 1K83A 1Y1WA 2NYAA 3CF2A 2NVYA 3DMRA 3GTMA 2JIRA 4AONB 2YU9A 5EPPA 1TWAA 1R7RA 3QQ8A 5FTNA 4GA5A 2JA7A 1TWFA 1AA6A 4C2MA 3GTJA 1TWGA 1PPYA 2Y0SA 5DYGA 2WAQA 3O5AA 1VC3B 1E18A 1WLFA 2JIMA 2WB1A 2JA5A 5FTMA 3OUGA 1QDNA 2VPZA 3TM7B 1DMRA 1KQFA 1CR5A 1TMOA 4KDIA 2KI8A 1H5NA 3PLXB 1E5VA 1QCSA 2NVXA 3GTLA 3IR6A 3GTOA 5T5ID 1S3SA 2VPWA 3HKZA 2E2HA 1E32A
chains in the Genus database with same CATH superfamily
1UHDA 2PJJA 2A6ED 5GLFA 5GM9A 4KODA 2V3VA 1Y5IA 3H0GA 4L48A 5DYIA 4JCWA 5FTJA 2E7ZA 1Y1VA 3IR5A 2NAPA 1I50A 1DMSA 1R27A 2BH0A 1YNJD 3GTQA 2GAEA 4JP7A 3GTGA 1SMYD 1TWCA 3ENGA 4AZDA 3D30A 2PNWA 4ZM7A 1Q16A 1PQFA 2VPXA 1IW7D 1AW8B 4CRYG 2JIOA 4FG2A 1OGYA 1PT1A 4GA6A 4FFTA 2O5JD 2VUMA 1FDOA 2KQAA 3CZBA 2C45A 3TIWA 2B63A 1SIWA 2YUJA 2A6HD 5GLYA 1PYUB 4KDLA 3X2GA 2CW0D 1G8JA 4AOKB 2JIPA 1FDIA 3X2LA 2PJHB 4JJOA 1YNND 2ENGA 3SUMA 1SFOA 1EU1A 3GTPA 2DMRA 1Y4ZA 2JA6A 2HCZX 2EEOB 2V45A 4ENGA 5C18A 3QQ7A 2R92A 1I3QA 2G5DA 2VPYA 5FTLA 5B6CA 3QWZA 3ML1A 4RV0A 1PQEA 1G8KA 4KO8A 3HU3A 1E61A 3HU2A 1CZ4A 1L8FA 3HU1A 1YLEA 3SULA 1E60A 4CS0A 1HD5A 2A68D 1CZ5A 2IV2X 5FTKA 5T5MD 3QC8A 4AAYA 1OA7A 2R93A 1H0HA 3CQZA 1UHEA 4QIWA 3X2NA 4D7ZB 2R7ZA 2PMZA 4KLNA 4CRZA 4DMRA 1PYQA 2A69D 1TWHA 3FKIA 1ZC1A 1R9TA 1KQGA 1N10A 1PQHA 2JIQA 5C1BA 2E2IA 1PT0A 3SUKA 3IR7A 3SUJA 1WCMA 2PICA 4AYBA 1K83A 3GTKA 1Y1WA 1BW4A 2NYAA 2NVYA 3CF2A 3DMRA 3GTMA 2JIRA 4AONB 2YU9A 3X2MA 5EPPA 1TWAA 2PI8A 1R7RA 3QQ8A 4JS7A 1WC2A 5FTNA 1OA9A 4GA5A 2JA7A 1BW3A 1TWFA 1AA6A 3M3GA 4C2MA 3GTJA 2AE0X 1TWGA 1PPYA 2Y0SA 5DYGA 3X2HA 2G6GA 2WAQA 3O5AA 1VC3B 4AVRA 1E18A 1WLFA 2JIMA 2WB1A 1ZYRD 2JA5A 5FTMA 2BE5D 3X2KA 3OUGA 1QDNA 2VPZA 5H4UA 1DMRA 3TM7B 1KQFA 1CR5A 1TMOA 4JP6A 4KDIA 2KI8A 1H5NA 3X2IA 5GLXA 3PLXB 3X2PA 1E5VA 1QCSA 4NOHA 2NVXA 3GTLA 4FG4A 3IR6A 3GTOA 3X2JA 4FERA 5T5ID 3X2OA 1S3SA 2VPWA 3HKZA 2E2HA 1E32A
chains in the Genus database with same CATH topology
1UHDA 2PJJA 2A6ED 5GLFA 4KODA 2V3VA 1Y5IA 3H0GA 5DYIA 5FTJA 2E7ZA 1Y1VA 3IR5A 2NAPA 1I50A 1DMSA 1R27A 1YNJD 3GTQA 2GAEA 3GTGA 1SMYD 1TWCA 4AZDA 2PNWA 1Q16A 1PQFA 2VPXA 1IW7D 1AW8B 4CRYG 2JIOA 1OGYA 1PT1A 4GA6A 2O5JD 2VUMA 1FDOA 3CZBA 3TIWA 2C45A 2B63A 1SIWA 2YUJA 2A6HD 1PYUB 4KDLA 2CW0D 1G8JA 4AOKB 2JIPA 1FDIA 2PJHB 1YNND 1SFOA 1EU1A 3GTPA 2DMRA 1Y4ZA 2JA6A 2EEOB 2V45A 5C18A 3QQ7A 2R92A 1I3QA 2G5DA 2VPYA 5FTLA 5B6CA 3QWZA 3ML1A 4RV0A 1PQEA 1G8KA 4KO8A 3HU3A 1E61A 3HU2A 1CZ4A 3HU1A 4CS0A 1YLEA 3GTKA 1E60A 2A68D 1CZ5A 2IV2X 5FTKA 5T5MD 3QC8A 4AAYA 2R93A 1H0HA 3CQZA 1UHEA 4QIWA 4D7ZB 2R7ZA 2PMZA 4KLNA 4CRZA 4DMRA 1PYQA 2A69D 1TWHA 3FKIA 1ZC1A 1R9TA 1KQGA 1PQHA 2JIQA 5C1BA 2E2IA 1PT0A 3IR7A 1WCMA 2PICA 4AYBA 1K83A 1Y1WA 2NYAA 2NVYA 3CF2A 3DMRA 3GTMA 2JIRA 4AONB 2YU9A 5EPPA 1TWAA 2PI8A 1R7RA 3QQ8A 5FTNA 4GA5A 2JA7A 1TWFA 1AA6A 4C2MA 3GTJA 2AE0X 1TWGA 1PPYA 2Y0SA 5DYGA 2G6GA 2WAQA 3O5AA 1VC3B 1E18A 1WLFA 2JIMA 2WB1A 1ZYRD 2JA5A 5FTMA 2BE5D 3OUGA 1QDNA 2VPZA 3TM7B 1DMRA 1KQFA 1CR5A 1TMOA 4KDIA 2KI8A 1H5NA 3PLXB 1E5VA 1QCSA 4NOHA 2NVXA 3GTLA 3IR6A 3GTOA 5T5ID 1S3SA 2VPWA 3HKZA 2E2HA 1E32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHD A;  5GLF A;  4KOD A;  2V3V A;  1Y5I A;  3H0G A;  5DYI A;  5FTJ A;  2E7Z A;  1Y1V A;  3IR5 A;  2NAP A;  1I50 A;  1DMS A;  1R27 A;  3GTQ A;  3GTG A;  4AZD A;  1TWC A;  1Q16 A;  1PQF A;  2VPX A;  1IW7 D;  1AW8 B;  4CRY G;  2JIO A;  1OGY A;  1PT1 A;  4GA6 A;  2VUM A;  1FDO A;  3TIW A;  2C45 A;  2B63 A;  1SIW A;  1PYU B;  4KDL A;  1G8J A;  4AOK B;  2JIP A;  1FDI A;  2PJH B;  1SFO A;  1EU1 A;  3GTP A;  2DMR A;  1Y4Z A;  2JA6 A;  2EEO B;  2V45 A;  5C18 A;  3QQ7 A;  2R92 A;  1I3Q A;  2VPY A;  5FTL A;  5B6C A;  3QWZ A;  3ML1 A;  4RV0 A;  1PQE A;  1G8K A;  4KO8 A;  3HU3 A;  1E61 A;  3HU2 A;  1CZ4 A;  3HU1 A;  4CS0 A;  1YLE A;  3GTK A;  1E60 A;  1CZ5 A;  2IV2 X;  5FTK A;  5T5M D;  3QC8 A;  4AAY A;  2R93 A;  1H0H A;  3CQZ A;  1UHE A;  4QIW A;  4D7Z B;  2R7Z A;  2PMZ A;  4KLN A;  4CRZ A;  4DMR A;  1PYQ A;  1TWH A;  3FKI A;  1R9T A;  1KQG A;  1PQH A;  2JIQ A;  5C1B A;  2E2I A;  1PT0 A;  3IR7 A;  1WCM A;  4AYB A;  1K83 A;  1Y1W A;  2NYA A;  3CF2 A;  2NVY A;  3DMR A;  3GTM A;  2JIR A;  4AON B;  2YU9 A;  5EPP A;  1TWA A;  1R7R A;  3QQ8 A;  5FTN A;  4GA5 A;  2JA7 A;  1TWF A;  1AA6 A;  4C2M A;  3GTJ A;  1TWG A;  1PPY A;  2Y0S A;  5DYG A;  2WAQ A;  3O5A A;  1VC3 B;  1E18 A;  1WLF A;  2JIM A;  2WB1 A;  2JA5 A;  5FTM A;  3OUG A;  1QDN A;  2VPZ A;  3TM7 B;  1DMR A;  1KQF A;  1CR5 A;  1TMO A;  4KDI A;  2KI8 A;  1H5N A;  3PLX B;  1E5V A;  1QCS A;  2NVX A;  3GTL A;  3IR6 A;  3GTO A;  5T5I D;  1S3S A;  2VPW A;  3HKZ A;  2E2H A;  1E32 A; 
#chains in the Genus database with same CATH topology
 1UHD A;  2PJJ A;  2A6E D;  5GLF A;  5GM9 A;  4KOD A;  2V3V A;  1Y5I A;  3H0G A;  4L48 A;  5DYI A;  4JCW A;  5FTJ A;  2E7Z A;  1Y1V A;  3IR5 A;  2NAP A;  1I50 A;  1DMS A;  1R27 A;  2BH0 A;  1YNJ D;  3GTQ A;  2GAE A;  4JP7 A;  3GTG A;  1SMY D;  1TWC A;  3ENG A;  4AZD A;  3D30 A;  2PNW A;  4ZM7 A;  1Q16 A;  1PQF A;  2VPX A;  1IW7 D;  1AW8 B;  4CRY G;  2JIO A;  4FG2 A;  1OGY A;  1PT1 A;  4GA6 A;  4FFT A;  2O5J D;  2VUM A;  1FDO A;  2KQA A;  3CZB A;  2C45 A;  3TIW A;  2B63 A;  1SIW A;  2YUJ A;  2A6H D;  5GLY A;  1PYU B;  4KDL A;  3X2G A;  2CW0 D;  1G8J A;  4AOK B;  2JIP A;  1FDI A;  3X2L A;  2PJH B;  4JJO A;  1YNN D;  2ENG A;  3SUM A;  1SFO A;  1EU1 A;  3GTP A;  2DMR A;  1Y4Z A;  2JA6 A;  2HCZ X;  2EEO B;  2V45 A;  4ENG A;  5C18 A;  3QQ7 A;  2R92 A;  1I3Q A;  2G5D A;  2VPY A;  5FTL A;  5B6C A;  3QWZ A;  3ML1 A;  4RV0 A;  1PQE A;  1G8K A;  4KO8 A;  3HU3 A;  1E61 A;  3HU2 A;  1CZ4 A;  1L8F A;  3HU1 A;  1YLE A;  3SUL A;  1E60 A;  4CS0 A;  1HD5 A;  2A68 D;  1CZ5 A;  2IV2 X;  5FTK A;  5T5M D;  3QC8 A;  4AAY A;  1OA7 A;  2R93 A;  1H0H A;  3CQZ A;  1UHE A;  4QIW A;  3X2N A;  4D7Z B;  2R7Z A;  2PMZ A;  4KLN A;  4CRZ A;  4DMR A;  1PYQ A;  2A69 D;  1TWH A;  3FKI A;  1ZC1 A;  1R9T A;  1KQG A;  1N10 A;  1PQH A;  2JIQ A;  5C1B A;  2E2I A;  1PT0 A;  3SUK A;  3IR7 A;  3SUJ A;  1WCM A;  2PIC A;  4AYB A;  1K83 A;  3GTK A;  1Y1W A;  1BW4 A;  2NYA A;  2NVY A;  3CF2 A;  3DMR A;  3GTM A;  2JIR A;  4AON B;  2YU9 A;  3X2M A;  5EPP A;  1TWA A;  2PI8 A;  1R7R A;  3QQ8 A;  4JS7 A;  1WC2 A;  5FTN A;  1OA9 A;  4GA5 A;  2JA7 A;  1BW3 A;  1TWF A;  1AA6 A;  3M3G A;  4C2M A;  3GTJ A;  2AE0 X;  1TWG A;  1PPY A;  2Y0S A;  5DYG A;  3X2H A;  2G6G A;  2WAQ A;  3O5A A;  1VC3 B;  4AVR A;  1E18 A;  1WLF A;  2JIM A;  2WB1 A;  1ZYR D;  2JA5 A;  5FTM A;  2BE5 D;  3X2K A;  3OUG A;  1QDN A;  2VPZ A;  5H4U A;  1DMR A;  3TM7 B;  1KQF A;  1CR5 A;  1TMO A;  4JP6 A;  4KDI A;  2KI8 A;  1H5N A;  3X2I A;  5GLX A;  3PLX B;  3X2P A;  1E5V A;  1QCS A;  4NOH A;  2NVX A;  3GTL A;  4FG4 A;  3IR6 A;  3GTO A;  3X2J A;  4FER A;  5T5I D;  3X2O A;  1S3S A;  2VPW A;  3HKZ A;  2E2H A;  1E32 A; 
#chains in the Genus database with same CATH homology
 1UHD A;  2PJJ A;  2A6E D;  5GLF A;  4KOD A;  2V3V A;  1Y5I A;  3H0G A;  5DYI A;  5FTJ A;  2E7Z A;  1Y1V A;  3IR5 A;  2NAP A;  1I50 A;  1DMS A;  1R27 A;  1YNJ D;  3GTQ A;  2GAE A;  3GTG A;  1SMY D;  1TWC A;  4AZD A;  2PNW A;  1Q16 A;  1PQF A;  2VPX A;  1IW7 D;  1AW8 B;  4CRY G;  2JIO A;  1OGY A;  1PT1 A;  4GA6 A;  2O5J D;  2VUM A;  1FDO A;  3CZB A;  3TIW A;  2C45 A;  2B63 A;  1SIW A;  2YUJ A;  2A6H D;  1PYU B;  4KDL A;  2CW0 D;  1G8J A;  4AOK B;  2JIP A;  1FDI A;  2PJH B;  1YNN D;  1SFO A;  1EU1 A;  3GTP A;  2DMR A;  1Y4Z A;  2JA6 A;  2EEO B;  2V45 A;  5C18 A;  3QQ7 A;  2R92 A;  1I3Q A;  2G5D A;  2VPY A;  5FTL A;  5B6C A;  3QWZ A;  3ML1 A;  4RV0 A;  1PQE A;  1G8K A;  4KO8 A;  3HU3 A;  1E61 A;  3HU2 A;  1CZ4 A;  3HU1 A;  4CS0 A;  1YLE A;  3GTK A;  1E60 A;  2A68 D;  1CZ5 A;  2IV2 X;  5FTK A;  5T5M D;  3QC8 A;  4AAY A;  2R93 A;  1H0H A;  3CQZ A;  1UHE A;  4QIW A;  4D7Z B;  2R7Z A;  2PMZ A;  4KLN A;  4CRZ A;  4DMR A;  1PYQ A;  2A69 D;  1TWH A;  3FKI A;  1ZC1 A;  1R9T A;  1KQG A;  1PQH A;  2JIQ A;  5C1B A;  2E2I A;  1PT0 A;  3IR7 A;  1WCM A;  2PIC A;  4AYB A;  1K83 A;  1Y1W A;  2NYA A;  2NVY A;  3CF2 A;  3DMR A;  3GTM A;  2JIR A;  4AON B;  2YU9 A;  5EPP A;  1TWA A;  2PI8 A;  1R7R A;  3QQ8 A;  5FTN A;  4GA5 A;  2JA7 A;  1TWF A;  1AA6 A;  4C2M A;  3GTJ A;  2AE0 X;  1TWG A;  1PPY A;  2Y0S A;  5DYG A;  2G6G A;  2WAQ A;  3O5A A;  1VC3 B;  1E18 A;  1WLF A;  2JIM A;  2WB1 A;  1ZYR D;  2JA5 A;  5FTM A;  2BE5 D;  3OUG A;  1QDN A;  2VPZ A;  3TM7 B;  1DMR A;  1KQF A;  1CR5 A;  1TMO A;  4KDI A;  2KI8 A;  1H5N A;  3PLX B;  1E5V A;  1QCS A;  4NOH A;  2NVX A;  3GTL A;  3IR6 A;  3GTO A;  5T5I D;  1S3S A;  2VPW A;  3HKZ A;  2E2H A;  1E32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...