4AOKB

Conformational dynamics of aspartate alpha-decarboxylase active site revealed by protein-ligand complexes: 1-methyl-l-aspartate complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
b'CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE BETA CHAIN
molecule tags Hydrolase
source organism Escherichia coli
publication title Conformational Dynamics of Aspartate Alpha Decarboxylase Active Site Revealed by Protein-Ligand Complexes
rcsb
total genus 24
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4aokB00
1CZ4A 1PQEA 3GTJA 1R7RA 1TWHA 1UHEA 1KQFA 2NYAA 5FTMA 2JA5A 5DYIA 2R92A 1FDIA 1I3QA 2B63A 1AA6A 1CR5A 2VPXA 3DMRA 5FTKA 2R7ZA 2JA6A 2VPZA 1H0HA 4CRYG 4DMRA 3TIWA 4AZDA 1SIWA 2JIOA 3CF2A 1E32A 4KO8A 4GA6A 5FTJA 2IV2X 2NVXA 2Y0SA 2VPWA 1QDNA 1AW8B 1UHDA 1YLEA 1H5NA 1Y1VA 2PJHB 1QCSA 3QQ7A 4AYBA 4CS0A 5C18A 1Y4ZA 2EEOB 3FKIA 5T5MD 3GTOA 3O5AA 4C2MA 1WCMA 3HU3A 2V45A 2JIQA 3GTGA 5FTLA 2E2IA 3HU2A 4GA5A 2VPYA 5C1BA 1K83A 3GTKA 2KI8A 1OGYA 1PPYA 1TWGA 3GTPA 3IR5A 2YU9A 4AOKB 2JA7A 2E7ZA 3IR6A 3OUGA 3IR7A 2NVYA 1DMRA 1PQFA 2JIPA 3GTQA 1DMSA 4CRZA 3CQZA 5DYGA 2E2HA 1E5VA 4KDLA 1WLFA 1Y5IA 2JIMA 1Q16A 3H0GA 1TWAA 1E60A 4D7ZB 4KDIA 5B6CA 1G8KA 2WB1A 4KLNA 3ML1A 1KQGA 1Y1WA 1E61A 1TWCA 5GLFA 1E18A 3HU1A 1CZ5A 4AONB 1SFOA 1PYQA 3QWZA 3TM7B 1R27A 1I50A 1PYUB 1VC3B 4KODA 1S3SA 4QIWA 1IW7D 1TWFA 5EPPA 5T5ID 2WAQA 3GTMA 3QQ8A 3GTLA 2C45A 4AAYA 1EU1A 4RV0A 2DMRA 2JIRA 2PMZA 1TMOA 2VUMA 5FTNA 1PT0A 2NAPA 2R93A 3QC8A 2V3VA 1R9TA 1G8JA 1FDOA 3PLXB 1PQHA 1PT1A 3HKZA
chains in the Genus database with same CATH superfamily
1CZ4A 2GAEA 3X2KA 1PQEA 1ZC1A 3GTJA 1R7RA 4JCWA 1TWHA 2YUJA 1UHEA 1KQFA 2NYAA 5FTMA 2JA5A 5DYIA 1WC2A 1FDIA 1I3QA 2R92A 3SUMA 2B63A 4NOHA 1AA6A 1CR5A 2VPXA 3DMRA 5FTKA 2R7ZA 2JA6A 2VPZA 1H0HA 4CRYG 4DMRA 5H4UA 2A6ED 3TIWA 4AZDA 1SIWA 1L8FA 5GLYA 1OA7A 2JIOA 3CF2A 2BH0A 1E32A 4KO8A 1BW3A 4GA6A 5FTJA 2IV2X 2NVXA 2Y0SA 2PI8A 2VPWA 1QDNA 4JJOA 1AW8B 1UHDA 1YLEA 3M3GA 1H5NA 1Y1VA 2PJHB 1QCSA 3QQ7A 4AYBA 4CS0A 5C18A 2A6HD 1Y4ZA 2EEOB 1N10A 3FKIA 5T5MD 3O5AA 3GTOA 4C2MA 1WCMA 3HU3A 2V45A 2JIQA 3SUKA 5FTLA 3GTGA 2E2IA 3HU2A 2ENGA 4GA5A 3SULA 2VPYA 3X2IA 5C1BA 2O5JD 1K83A 4FERA 2BE5D 3GTKA 2KI8A 1OGYA 1PPYA 1TWGA 4FG4A 3GTPA 1HD5A 3IR5A 2YU9A 4AOKB 2JA7A 2E7ZA 2CW0D 3IR6A 3OUGA 3IR7A 2NVYA 1DMRA 1PQFA 4JS7A 2JIPA 3GTQA 1DMSA 2G5DA 4CRZA 3CQZA 3SUJA 3X2OA 1ZYRD 5DYGA 2E2HA 1YNJD 4FG2A 1E5VA 4KDLA 4JP7A 2A69D 2AE0X 1WLFA 1Y5IA 3X2NA 2JIMA 3X2MA 4ENGA 1Q16A 3H0GA 1TWAA 1E60A 4D7ZB 4KDIA 4JP6A 1G8KA 5B6CA 2WB1A 4KLNA 3ML1A 1BW4A 4FFTA 1KQGA 5GLXA 1Y1WA 1E61A 1TWCA 5GLFA 1E18A 3HU1A 1CZ5A 4AONB 1YNND 1SFOA 1PYQA 3QWZA 3TM7B 1R27A 4L48A 1I50A 3X2HA 1PYUB 1VC3B 4KODA 1S3SA 4QIWA 1IW7D 1TWFA 4AVRA 5EPPA 5GM9A 5T5ID 2WAQA 3GTMA 3QQ8A 3GTLA 3X2GA 2C45A 3CZBA 2G6GA 3X2PA 1SMYD 4AAYA 1EU1A 3X2LA 2HCZX 2KQAA 2DMRA 2JIRA 2PMZA 1TMOA 3HKZA 4RV0A 5FTNA 2VUMA 1PT0A 2NAPA 3X2JA 2R93A 3QC8A 2PNWA 2V3VA 1R9TA 1G8JA 1FDOA 3PLXB 2PICA 1PQHA 4ZM7A 1OA9A 2PJJA 1PT1A 3ENGA 3D30A 2A68D
chains in the Genus database with same CATH topology
1CZ4A 2GAEA 1PQEA 1ZC1A 3GTJA 1R7RA 1TWHA 2YUJA 1UHEA 1KQFA 2NYAA 5FTMA 2JA5A 5DYIA 2R92A 1FDIA 1I3QA 2B63A 4NOHA 1AA6A 1CR5A 2VPXA 3DMRA 5FTKA 2R7ZA 2JA6A 2VPZA 1H0HA 4CRYG 4DMRA 2A6ED 3TIWA 4AZDA 1SIWA 2JIOA 3CF2A 1E32A 4KO8A 4GA6A 5FTJA 2IV2X 2NVXA 2Y0SA 2PI8A 2VPWA 1QDNA 1AW8B 1UHDA 1YLEA 1H5NA 1Y1VA 2PJHB 1QCSA 3QQ7A 4AYBA 4CS0A 5C18A 2A6HD 1Y4ZA 2EEOB 3FKIA 5T5MD 3GTOA 3O5AA 4C2MA 1WCMA 3HU3A 2V45A 2JIQA 3GTGA 5FTLA 2E2IA 3HU2A 4GA5A 2VPYA 5C1BA 2O5JD 1K83A 2BE5D 3GTKA 2KI8A 1OGYA 1PPYA 1TWGA 3GTPA 3IR5A 2YU9A 4AOKB 2JA7A 2E7ZA 2CW0D 3IR6A 3OUGA 3IR7A 2NVYA 1DMRA 1PQFA 2JIPA 3GTQA 1DMSA 2G5DA 4CRZA 3CQZA 1ZYRD 5DYGA 2E2HA 1YNJD 1E5VA 4KDLA 2A69D 2AE0X 1WLFA 1Y5IA 2JIMA 1Q16A 3H0GA 1TWAA 1E60A 4D7ZB 4KDIA 5B6CA 1G8KA 2WB1A 4KLNA 3ML1A 1KQGA 1Y1WA 1E61A 1TWCA 5GLFA 1E18A 3HU1A 1CZ5A 4AONB 1YNND 1SFOA 1PYQA 3QWZA 3TM7B 1R27A 1I50A 1PYUB 1VC3B 4KODA 1S3SA 4QIWA 1IW7D 1TWFA 5EPPA 5T5ID 2WAQA 3GTMA 3QQ8A 3GTLA 2C45A 3CZBA 2G6GA 1SMYD 4AAYA 1EU1A 4RV0A 2DMRA 2JIRA 2PMZA 1TMOA 3HKZA 2VUMA 5FTNA 1PT0A 2NAPA 2R93A 3QC8A 2PNWA 2V3VA 1R9TA 1G8JA 1FDOA 3PLXB 2PICA 1PQHA 2PJJA 1PT1A 2A68D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZ4 A;  1PQE A;  3GTJ A;  1R7R A;  1TWH A;  1UHE A;  1KQF A;  2NYA A;  5FTM A;  2JA5 A;  5DYI A;  2R92 A;  1FDI A;  1I3Q A;  2B63 A;  1AA6 A;  1CR5 A;  2VPX A;  3DMR A;  5FTK A;  2R7Z A;  2JA6 A;  2VPZ A;  1H0H A;  4CRY G;  4DMR A;  3TIW A;  4AZD A;  1SIW A;  2JIO A;  3CF2 A;  1E32 A;  4KO8 A;  4GA6 A;  5FTJ A;  2IV2 X;  2NVX A;  2Y0S A;  2VPW A;  1QDN A;  1AW8 B;  1UHD A;  1YLE A;  1H5N A;  1Y1V A;  2PJH B;  1QCS A;  3QQ7 A;  4AYB A;  4CS0 A;  5C18 A;  1Y4Z A;  2EEO B;  3FKI A;  5T5M D;  3GTO A;  3O5A A;  4C2M A;  1WCM A;  3HU3 A;  2V45 A;  2JIQ A;  3GTG A;  5FTL A;  2E2I A;  3HU2 A;  4GA5 A;  2VPY A;  5C1B A;  1K83 A;  3GTK A;  2KI8 A;  1OGY A;  1PPY A;  1TWG A;  3GTP A;  3IR5 A;  2YU9 A;  4AOK B;  2JA7 A;  2E7Z A;  3IR6 A;  3OUG A;  3IR7 A;  2NVY A;  1DMR A;  1PQF A;  2JIP A;  3GTQ A;  1DMS A;  4CRZ A;  3CQZ A;  5DYG A;  2E2H A;  1E5V A;  4KDL A;  1WLF A;  1Y5I A;  2JIM A;  1Q16 A;  3H0G A;  1TWA A;  1E60 A;  4D7Z B;  4KDI A;  5B6C A;  1G8K A;  2WB1 A;  4KLN A;  3ML1 A;  1KQG A;  1Y1W A;  1E61 A;  1TWC A;  5GLF A;  1E18 A;  3HU1 A;  1CZ5 A;  4AON B;  1SFO A;  1PYQ A;  3QWZ A;  3TM7 B;  1R27 A;  1I50 A;  1PYU B;  1VC3 B;  4KOD A;  1S3S A;  4QIW A;  1IW7 D;  1TWF A;  5EPP A;  5T5I D;  2WAQ A;  3GTM A;  3QQ8 A;  3GTL A;  2C45 A;  4AAY A;  1EU1 A;  4RV0 A;  2DMR A;  2JIR A;  2PMZ A;  1TMO A;  2VUM A;  5FTN A;  1PT0 A;  2NAP A;  2R93 A;  3QC8 A;  2V3V A;  1R9T A;  1G8J A;  1FDO A;  3PLX B;  1PQH A;  1PT1 A;  3HKZ A; 
#chains in the Genus database with same CATH topology
 1CZ4 A;  2GAE A;  3X2K A;  1PQE A;  1ZC1 A;  3GTJ A;  1R7R A;  4JCW A;  1TWH A;  2YUJ A;  1UHE A;  1KQF A;  2NYA A;  5FTM A;  2JA5 A;  5DYI A;  1WC2 A;  1FDI A;  1I3Q A;  2R92 A;  3SUM A;  2B63 A;  4NOH A;  1AA6 A;  1CR5 A;  2VPX A;  3DMR A;  5FTK A;  2R7Z A;  2JA6 A;  2VPZ A;  1H0H A;  4CRY G;  4DMR A;  5H4U A;  2A6E D;  3TIW A;  4AZD A;  1SIW A;  1L8F A;  5GLY A;  1OA7 A;  2JIO A;  3CF2 A;  2BH0 A;  1E32 A;  4KO8 A;  1BW3 A;  4GA6 A;  5FTJ A;  2IV2 X;  2NVX A;  2Y0S A;  2PI8 A;  2VPW A;  1QDN A;  4JJO A;  1AW8 B;  1UHD A;  1YLE A;  3M3G A;  1H5N A;  1Y1V A;  2PJH B;  1QCS A;  3QQ7 A;  4AYB A;  4CS0 A;  5C18 A;  2A6H D;  1Y4Z A;  2EEO B;  1N10 A;  3FKI A;  5T5M D;  3O5A A;  3GTO A;  4C2M A;  1WCM A;  3HU3 A;  2V45 A;  2JIQ A;  3SUK A;  5FTL A;  3GTG A;  2E2I A;  3HU2 A;  2ENG A;  4GA5 A;  3SUL A;  2VPY A;  3X2I A;  5C1B A;  2O5J D;  1K83 A;  4FER A;  2BE5 D;  3GTK A;  2KI8 A;  1OGY A;  1PPY A;  1TWG A;  4FG4 A;  3GTP A;  1HD5 A;  3IR5 A;  2YU9 A;  4AOK B;  2JA7 A;  2E7Z A;  2CW0 D;  3IR6 A;  3OUG A;  3IR7 A;  2NVY A;  1DMR A;  1PQF A;  4JS7 A;  2JIP A;  3GTQ A;  1DMS A;  2G5D A;  4CRZ A;  3CQZ A;  3SUJ A;  3X2O A;  1ZYR D;  5DYG A;  2E2H A;  1YNJ D;  4FG2 A;  1E5V A;  4KDL A;  4JP7 A;  2A69 D;  2AE0 X;  1WLF A;  1Y5I A;  3X2N A;  2JIM A;  3X2M A;  4ENG A;  1Q16 A;  3H0G A;  1TWA A;  1E60 A;  4D7Z B;  4KDI A;  4JP6 A;  1G8K A;  5B6C A;  2WB1 A;  4KLN A;  3ML1 A;  1BW4 A;  4FFT A;  1KQG A;  5GLX A;  1Y1W A;  1E61 A;  1TWC A;  5GLF A;  1E18 A;  3HU1 A;  1CZ5 A;  4AON B;  1YNN D;  1SFO A;  1PYQ A;  3QWZ A;  3TM7 B;  1R27 A;  4L48 A;  1I50 A;  3X2H A;  1PYU B;  1VC3 B;  4KOD A;  1S3S A;  4QIW A;  1IW7 D;  1TWF A;  4AVR A;  5EPP A;  5GM9 A;  5T5I D;  2WAQ A;  3GTM A;  3QQ8 A;  3GTL A;  3X2G A;  2C45 A;  3CZB A;  2G6G A;  3X2P A;  1SMY D;  4AAY A;  1EU1 A;  3X2L A;  2HCZ X;  2KQA A;  2DMR A;  2JIR A;  2PMZ A;  1TMO A;  3HKZ A;  4RV0 A;  5FTN A;  2VUM A;  1PT0 A;  2NAP A;  3X2J A;  2R93 A;  3QC8 A;  2PNW A;  2V3V A;  1R9T A;  1G8J A;  1FDO A;  3PLX B;  2PIC A;  1PQH A;  4ZM7 A;  1OA9 A;  2PJJ A;  1PT1 A;  3ENG A;  3D30 A;  2A68 D; 
#chains in the Genus database with same CATH homology
 1CZ4 A;  2GAE A;  1PQE A;  1ZC1 A;  3GTJ A;  1R7R A;  1TWH A;  2YUJ A;  1UHE A;  1KQF A;  2NYA A;  5FTM A;  2JA5 A;  5DYI A;  2R92 A;  1FDI A;  1I3Q A;  2B63 A;  4NOH A;  1AA6 A;  1CR5 A;  2VPX A;  3DMR A;  5FTK A;  2R7Z A;  2JA6 A;  2VPZ A;  1H0H A;  4CRY G;  4DMR A;  2A6E D;  3TIW A;  4AZD A;  1SIW A;  2JIO A;  3CF2 A;  1E32 A;  4KO8 A;  4GA6 A;  5FTJ A;  2IV2 X;  2NVX A;  2Y0S A;  2PI8 A;  2VPW A;  1QDN A;  1AW8 B;  1UHD A;  1YLE A;  1H5N A;  1Y1V A;  2PJH B;  1QCS A;  3QQ7 A;  4AYB A;  4CS0 A;  5C18 A;  2A6H D;  1Y4Z A;  2EEO B;  3FKI A;  5T5M D;  3GTO A;  3O5A A;  4C2M A;  1WCM A;  3HU3 A;  2V45 A;  2JIQ A;  3GTG A;  5FTL A;  2E2I A;  3HU2 A;  4GA5 A;  2VPY A;  5C1B A;  2O5J D;  1K83 A;  2BE5 D;  3GTK A;  2KI8 A;  1OGY A;  1PPY A;  1TWG A;  3GTP A;  3IR5 A;  2YU9 A;  4AOK B;  2JA7 A;  2E7Z A;  2CW0 D;  3IR6 A;  3OUG A;  3IR7 A;  2NVY A;  1DMR A;  1PQF A;  2JIP A;  3GTQ A;  1DMS A;  2G5D A;  4CRZ A;  3CQZ A;  1ZYR D;  5DYG A;  2E2H A;  1YNJ D;  1E5V A;  4KDL A;  2A69 D;  2AE0 X;  1WLF A;  1Y5I A;  2JIM A;  1Q16 A;  3H0G A;  1TWA A;  1E60 A;  4D7Z B;  4KDI A;  5B6C A;  1G8K A;  2WB1 A;  4KLN A;  3ML1 A;  1KQG A;  1Y1W A;  1E61 A;  1TWC A;  5GLF A;  1E18 A;  3HU1 A;  1CZ5 A;  4AON B;  1YNN D;  1SFO A;  1PYQ A;  3QWZ A;  3TM7 B;  1R27 A;  1I50 A;  1PYU B;  1VC3 B;  4KOD A;  1S3S A;  4QIW A;  1IW7 D;  1TWF A;  5EPP A;  5T5I D;  2WAQ A;  3GTM A;  3QQ8 A;  3GTL A;  2C45 A;  3CZB A;  2G6G A;  1SMY D;  4AAY A;  1EU1 A;  4RV0 A;  2DMR A;  2JIR A;  2PMZ A;  1TMO A;  3HKZ A;  2VUM A;  5FTN A;  1PT0 A;  2NAP A;  2R93 A;  3QC8 A;  2PNW A;  2V3V A;  1R9T A;  1G8J A;  1FDO A;  3PLX B;  2PIC A;  1PQH A;  2PJJ A;  1PT1 A;  2A68 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...