4AOKB

Conformational dynamics of aspartate alpha-decarboxylase active site revealed by protein-ligand complexes: 1-methyl-l-aspartate complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Dynamics of Aspartate Alpha Decarboxylase Active Site Revealed by Protein-Ligand Complexes
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ASPARTATE 1-DECARBOXYLASE BETA CHAIN
total genus 24
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4aokB00
1KQGA 3GTLA 2V3VA 5T5MD 1IW7D 3FKIA 3QQ8A 1TWHA 5DYGA 2VUMA 1QDNA 4AOKB 1H0HA 3QQ7A 2R7ZA 3GTGA 2C45A 5DYIA 2YU9A 5FTNA 1DMRA 1E5VA 4AAYA 1CZ5A 4QIWA 1UHDA 3HU3A 1PPYA 1PQHA 4DMRA 1R7RA 1Y4ZA 4CS0A 3GTMA 2JIMA 2VPYA 3IR5A 1TMOA 2JIOA 1H5NA 5EPPA 1E61A 2NYAA 1E18A 1TWCA 3PLXB 1FDOA 3IR6A 3HKZA 1AA6A 5FTJA 1E32A 1UHEA 4AZDA 4RV0A 2JIPA 1AW8B 4CRYG 3H0GA 1KQFA 2PMZA 3TM7B 5B6CA 1S3SA 1PYQA 2KI8A 2VPZA 3GTOA 3QWZA 1FDIA 1Y1VA 4KO8A 3IR7A 2JA7A 1VC3B 2WB1A 1DMSA 4GA6A 2PJHB 1G8KA 1Q16A 4KLNA 3QC8A 3HU1A 1OGYA 5FTLA 4AYBA 1TWAA 2JA6A 4GA5A 2IV2X 1I50A 2WAQA 3HU2A 1PQEA 2NVYA 2E7ZA 3CQZA 1SFOA 1CR5A 5C1BA 4D7ZB 1I3QA 1PYUB 4CRZA 1SIWA 5FTMA 1R27A 1Y1WA 1QCSA 2R93A 1YLEA 2JIQA 3GTKA 4AONB 2V45A 3TIWA 1WCMA 3GTJA 3CF2A 2JIRA 4KODA 1TWGA 5FTKA 1EU1A 2E2HA 1G8JA 1PQFA 1TWFA 1Y5IA 4KDIA 2VPXA 1R9TA 2JA5A 3GTPA 3OUGA 3O5AA 2Y0SA 5GLFA 1PT1A 2EEOB 3ML1A 5T5ID 1CZ4A 3DMRA 2DMRA 2B63A 1E60A 5C18A 2R92A 2NAPA 2VPWA 4C2MA 2NVXA 4KDLA 2E2IA 3GTQA 1K83A 1WLFA 1PT0A
chains in the Genus database with same CATH superfamily
1KQGA 3GTLA 2V3VA 5T5MD 4JJOA 1IW7D 3FKIA 3QQ8A 3X2IA 3CZBA 1TWHA 5DYGA 2VUMA 1QDNA 3X2OA 4AOKB 1H0HA 3QQ7A 4JP6A 5GLYA 2R7ZA 3GTGA 2C45A 5DYIA 2YU9A 2A68D 4JS7A 5FTNA 1DMRA 1E5VA 2A69D 4AAYA 1CZ5A 4QIWA 1UHDA 1PPYA 3HU3A 1PQHA 1L8FA 4DMRA 1R7RA 1Y4ZA 3X2LA 4CS0A 3X2KA 2YUJA 4NOHA 3GTMA 2JIMA 2VPYA 3IR5A 2CW0D 1TMOA 2JIOA 1H5NA 5EPPA 1E61A 2NYAA 1E18A 1TWCA 3PLXB 3SUMA 1FDOA 3IR6A 3HKZA 1AA6A 2PICA 5FTJA 1E32A 1ZYRD 2PI8A 2KQAA 3SULA 3X2GA 1UHEA 4AZDA 2BE5D 4RV0A 2JIPA 1AW8B 4CRYG 3H0GA 1KQFA 2GAEA 2PMZA 3SUKA 3TM7B 5B6CA 1S3SA 1ZC1A 2G5DA 1PYQA 2KI8A 2VPZA 3GTOA 3QWZA 1FDIA 1Y1VA 4KO8A 3IR7A 4JP7A 5H4UA 2JA7A 1VC3B 2WB1A 4ZM7A 1DMSA 4GA6A 2PJHB 1G8KA 1Q16A 4KLNA 4FERA 3QC8A 2AE0X 3HU1A 1OGYA 1OA7A 2O5JD 5FTLA 4AYBA 1TWAA 2JA6A 4GA5A 2IV2X 1I50A 2WAQA 3X2NA 3HU2A 1PQEA 2NVYA 4AVRA 4ENGA 2E7ZA 3CQZA 1SFOA 1CR5A 5C1BA 4D7ZB 1I3QA 1PYUB 4CRZA 1SIWA 2HCZX 5FTMA 1R27A 1Y1WA 1QCSA 2R93A 1YLEA 3ENGA 2JIQA 3SUJA 4AONB 3GTKA 2V45A 4FG2A 1SMYD 3TIWA 1WCMA 3GTJA 3CF2A 2JIRA 3X2HA 4KODA 1YNJD 1TWGA 1EU1A 5FTKA 2PNWA 2A6HD 2E2HA 1G8JA 1BW4A 1PQFA 4L48A 1TWFA 1Y5IA 1OA9A 4KDIA 4FFTA 1YNND 2VPXA 4FG4A 1R9TA 2A6ED 2JA5A 3X2PA 3X2MA 3GTPA 3OUGA 3O5AA 2ENGA 1N10A 5GLXA 2Y0SA 5GLFA 1BW3A 1PT1A 2EEOB 2PJJA 3D30A 3ML1A 5T5ID 1CZ4A 3DMRA 2DMRA 3M3GA 1E60A 5C18A 1HD5A 1WC2A 2B63A 2R92A 2NAPA 2VPWA 2G6GA 3X2JA 4C2MA 5GM9A 4JCWA 2NVXA 4KDLA 2E2IA 2BH0A 3GTQA 1K83A 1WLFA 1PT0A
chains in the Genus database with same CATH topology
1KQGA 3GTLA 2V3VA 5T5MD 1IW7D 3FKIA 3QQ8A 3CZBA 1TWHA 5DYGA 2VUMA 1QDNA 4AOKB 1H0HA 3QQ7A 2R7ZA 3GTGA 2C45A 5DYIA 2YU9A 2A68D 5FTNA 1DMRA 1E5VA 2A69D 4AAYA 1CZ5A 4QIWA 1UHDA 1PPYA 3HU3A 1PQHA 4DMRA 1R7RA 1Y4ZA 4CS0A 2YUJA 4NOHA 3GTMA 2JIMA 2VPYA 3IR5A 2CW0D 1TMOA 2JIOA 1H5NA 5EPPA 1E61A 2NYAA 1E18A 1TWCA 3PLXB 1FDOA 3IR6A 3HKZA 1AA6A 2PICA 5FTJA 1E32A 1ZYRD 2PI8A 1UHEA 4AZDA 2BE5D 4RV0A 2JIPA 1AW8B 4CRYG 3H0GA 1KQFA 2GAEA 2PMZA 3TM7B 5B6CA 1S3SA 1ZC1A 2G5DA 1PYQA 2KI8A 2VPZA 3GTOA 3QWZA 1FDIA 1Y1VA 4KO8A 3IR7A 2JA7A 1VC3B 2WB1A 1DMSA 4GA6A 2PJHB 1G8KA 1Q16A 4KLNA 3QC8A 2AE0X 3HU1A 1OGYA 2O5JD 5FTLA 4AYBA 1TWAA 2JA6A 4GA5A 2IV2X 1I50A 2WAQA 3HU2A 1PQEA 2NVYA 2E7ZA 3CQZA 1SFOA 1CR5A 5C1BA 4D7ZB 1I3QA 1PYUB 4CRZA 1SIWA 5FTMA 1R27A 1Y1WA 1QCSA 2R93A 1YLEA 2JIQA 3GTKA 4AONB 2V45A 1SMYD 3TIWA 1WCMA 3GTJA 3CF2A 2JIRA 4KODA 1YNJD 1TWGA 1EU1A 5FTKA 2PNWA 2A6HD 2E2HA 1G8JA 1PQFA 1TWFA 1Y5IA 4KDIA 1YNND 2VPXA 1R9TA 2A6ED 2JA5A 3GTPA 3OUGA 3O5AA 2Y0SA 5GLFA 1PT1A 2EEOB 2PJJA 3ML1A 5T5ID 1CZ4A 3DMRA 2DMRA 2B63A 1E60A 5C18A 2R92A 2NAPA 2VPWA 2G6GA 4C2MA 2NVXA 4KDLA 2E2IA 3GTQA 1K83A 1WLFA 1PT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQG A;  3GTL A;  2V3V A;  5T5M D;  1IW7 D;  3FKI A;  3QQ8 A;  1TWH A;  5DYG A;  2VUM A;  1QDN A;  4AOK B;  1H0H A;  3QQ7 A;  2R7Z A;  3GTG A;  2C45 A;  5DYI A;  2YU9 A;  5FTN A;  1DMR A;  1E5V A;  4AAY A;  1CZ5 A;  4QIW A;  1UHD A;  3HU3 A;  1PPY A;  1PQH A;  4DMR A;  1R7R A;  1Y4Z A;  4CS0 A;  3GTM A;  2JIM A;  2VPY A;  3IR5 A;  1TMO A;  2JIO A;  1H5N A;  5EPP A;  1E61 A;  2NYA A;  1E18 A;  1TWC A;  3PLX B;  1FDO A;  3IR6 A;  3HKZ A;  1AA6 A;  5FTJ A;  1E32 A;  1UHE A;  4AZD A;  4RV0 A;  2JIP A;  1AW8 B;  4CRY G;  3H0G A;  1KQF A;  2PMZ A;  3TM7 B;  5B6C A;  1S3S A;  1PYQ A;  2KI8 A;  2VPZ A;  3GTO A;  3QWZ A;  1FDI A;  1Y1V A;  4KO8 A;  3IR7 A;  2JA7 A;  1VC3 B;  2WB1 A;  1DMS A;  4GA6 A;  2PJH B;  1G8K A;  1Q16 A;  4KLN A;  3QC8 A;  3HU1 A;  1OGY A;  5FTL A;  4AYB A;  1TWA A;  2JA6 A;  4GA5 A;  2IV2 X;  1I50 A;  2WAQ A;  3HU2 A;  1PQE A;  2NVY A;  2E7Z A;  3CQZ A;  1SFO A;  1CR5 A;  5C1B A;  4D7Z B;  1I3Q A;  1PYU B;  4CRZ A;  1SIW A;  5FTM A;  1R27 A;  1Y1W A;  1QCS A;  2R93 A;  1YLE A;  2JIQ A;  3GTK A;  4AON B;  2V45 A;  3TIW A;  1WCM A;  3GTJ A;  3CF2 A;  2JIR A;  4KOD A;  1TWG A;  5FTK A;  1EU1 A;  2E2H A;  1G8J A;  1PQF A;  1TWF A;  1Y5I A;  4KDI A;  2VPX A;  1R9T A;  2JA5 A;  3GTP A;  3OUG A;  3O5A A;  2Y0S A;  5GLF A;  1PT1 A;  2EEO B;  3ML1 A;  5T5I D;  1CZ4 A;  3DMR A;  2DMR A;  2B63 A;  1E60 A;  5C18 A;  2R92 A;  2NAP A;  2VPW A;  4C2M A;  2NVX A;  4KDL A;  2E2I A;  3GTQ A;  1K83 A;  1WLF A;  1PT0 A; 
#chains in the Genus database with same CATH topology
 1KQG A;  3GTL A;  2V3V A;  5T5M D;  4JJO A;  1IW7 D;  3FKI A;  3QQ8 A;  3X2I A;  3CZB A;  1TWH A;  5DYG A;  2VUM A;  1QDN A;  3X2O A;  4AOK B;  1H0H A;  3QQ7 A;  4JP6 A;  5GLY A;  2R7Z A;  3GTG A;  2C45 A;  5DYI A;  2YU9 A;  2A68 D;  4JS7 A;  5FTN A;  1DMR A;  1E5V A;  2A69 D;  4AAY A;  1CZ5 A;  4QIW A;  1UHD A;  1PPY A;  3HU3 A;  1PQH A;  1L8F A;  4DMR A;  1R7R A;  1Y4Z A;  3X2L A;  4CS0 A;  3X2K A;  2YUJ A;  4NOH A;  3GTM A;  2JIM A;  2VPY A;  3IR5 A;  2CW0 D;  1TMO A;  2JIO A;  1H5N A;  5EPP A;  1E61 A;  2NYA A;  1E18 A;  1TWC A;  3PLX B;  3SUM A;  1FDO A;  3IR6 A;  3HKZ A;  1AA6 A;  2PIC A;  5FTJ A;  1E32 A;  1ZYR D;  2PI8 A;  2KQA A;  3SUL A;  3X2G A;  1UHE A;  4AZD A;  2BE5 D;  4RV0 A;  2JIP A;  1AW8 B;  4CRY G;  3H0G A;  1KQF A;  2GAE A;  2PMZ A;  3SUK A;  3TM7 B;  5B6C A;  1S3S A;  1ZC1 A;  2G5D A;  1PYQ A;  2KI8 A;  2VPZ A;  3GTO A;  3QWZ A;  1FDI A;  1Y1V A;  4KO8 A;  3IR7 A;  4JP7 A;  5H4U A;  2JA7 A;  1VC3 B;  2WB1 A;  4ZM7 A;  1DMS A;  4GA6 A;  2PJH B;  1G8K A;  1Q16 A;  4KLN A;  4FER A;  3QC8 A;  2AE0 X;  3HU1 A;  1OGY A;  1OA7 A;  2O5J D;  5FTL A;  4AYB A;  1TWA A;  2JA6 A;  4GA5 A;  2IV2 X;  1I50 A;  2WAQ A;  3X2N A;  3HU2 A;  1PQE A;  2NVY A;  4AVR A;  4ENG A;  2E7Z A;  3CQZ A;  1SFO A;  1CR5 A;  5C1B A;  4D7Z B;  1I3Q A;  1PYU B;  4CRZ A;  1SIW A;  2HCZ X;  5FTM A;  1R27 A;  1Y1W A;  1QCS A;  2R93 A;  1YLE A;  3ENG A;  2JIQ A;  3SUJ A;  4AON B;  3GTK A;  2V45 A;  4FG2 A;  1SMY D;  3TIW A;  1WCM A;  3GTJ A;  3CF2 A;  2JIR A;  3X2H A;  4KOD A;  1YNJ D;  1TWG A;  1EU1 A;  5FTK A;  2PNW A;  2A6H D;  2E2H A;  1G8J A;  1BW4 A;  1PQF A;  4L48 A;  1TWF A;  1Y5I A;  1OA9 A;  4KDI A;  4FFT A;  1YNN D;  2VPX A;  4FG4 A;  1R9T A;  2A6E D;  2JA5 A;  3X2P A;  3X2M A;  3GTP A;  3OUG A;  3O5A A;  2ENG A;  1N10 A;  5GLX A;  2Y0S A;  5GLF A;  1BW3 A;  1PT1 A;  2EEO B;  2PJJ A;  3D30 A;  3ML1 A;  5T5I D;  1CZ4 A;  3DMR A;  2DMR A;  3M3G A;  1E60 A;  5C18 A;  1HD5 A;  1WC2 A;  2B63 A;  2R92 A;  2NAP A;  2VPW A;  2G6G A;  3X2J A;  4C2M A;  5GM9 A;  4JCW A;  2NVX A;  4KDL A;  2E2I A;  2BH0 A;  3GTQ A;  1K83 A;  1WLF A;  1PT0 A; 
#chains in the Genus database with same CATH homology
 1KQG A;  3GTL A;  2V3V A;  5T5M D;  1IW7 D;  3FKI A;  3QQ8 A;  3CZB A;  1TWH A;  5DYG A;  2VUM A;  1QDN A;  4AOK B;  1H0H A;  3QQ7 A;  2R7Z A;  3GTG A;  2C45 A;  5DYI A;  2YU9 A;  2A68 D;  5FTN A;  1DMR A;  1E5V A;  2A69 D;  4AAY A;  1CZ5 A;  4QIW A;  1UHD A;  1PPY A;  3HU3 A;  1PQH A;  4DMR A;  1R7R A;  1Y4Z A;  4CS0 A;  2YUJ A;  4NOH A;  3GTM A;  2JIM A;  2VPY A;  3IR5 A;  2CW0 D;  1TMO A;  2JIO A;  1H5N A;  5EPP A;  1E61 A;  2NYA A;  1E18 A;  1TWC A;  3PLX B;  1FDO A;  3IR6 A;  3HKZ A;  1AA6 A;  2PIC A;  5FTJ A;  1E32 A;  1ZYR D;  2PI8 A;  1UHE A;  4AZD A;  2BE5 D;  4RV0 A;  2JIP A;  1AW8 B;  4CRY G;  3H0G A;  1KQF A;  2GAE A;  2PMZ A;  3TM7 B;  5B6C A;  1S3S A;  1ZC1 A;  2G5D A;  1PYQ A;  2KI8 A;  2VPZ A;  3GTO A;  3QWZ A;  1FDI A;  1Y1V A;  4KO8 A;  3IR7 A;  2JA7 A;  1VC3 B;  2WB1 A;  1DMS A;  4GA6 A;  2PJH B;  1G8K A;  1Q16 A;  4KLN A;  3QC8 A;  2AE0 X;  3HU1 A;  1OGY A;  2O5J D;  5FTL A;  4AYB A;  1TWA A;  2JA6 A;  4GA5 A;  2IV2 X;  1I50 A;  2WAQ A;  3HU2 A;  1PQE A;  2NVY A;  2E7Z A;  3CQZ A;  1SFO A;  1CR5 A;  5C1B A;  4D7Z B;  1I3Q A;  1PYU B;  4CRZ A;  1SIW A;  5FTM A;  1R27 A;  1Y1W A;  1QCS A;  2R93 A;  1YLE A;  2JIQ A;  3GTK A;  4AON B;  2V45 A;  1SMY D;  3TIW A;  1WCM A;  3GTJ A;  3CF2 A;  2JIR A;  4KOD A;  1YNJ D;  1TWG A;  1EU1 A;  5FTK A;  2PNW A;  2A6H D;  2E2H A;  1G8J A;  1PQF A;  1TWF A;  1Y5I A;  4KDI A;  1YNN D;  2VPX A;  1R9T A;  2A6E D;  2JA5 A;  3GTP A;  3OUG A;  3O5A A;  2Y0S A;  5GLF A;  1PT1 A;  2EEO B;  2PJJ A;  3ML1 A;  5T5I D;  1CZ4 A;  3DMR A;  2DMR A;  2B63 A;  1E60 A;  5C18 A;  2R92 A;  2NAP A;  2VPW A;  2G6G A;  4C2M A;  2NVX A;  4KDL A;  2E2I A;  3GTQ A;  1K83 A;  1WLF A;  1PT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...