3M3GA

Crystal structure of sm1, an elicitor of plant defence responses from trichoderma virens.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
DTVSYDTGYDNGSRSLNDVSCSDGPNGLETRYHWSTQGQIPRFPYIGGAAAVAGWNSASCGTCWKLQYSGHTIYVLAVDHAASGFNIALDAMNALTGGQAVQLGRVSATATQVPVKNCGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sm1, an elicitor of plant defence responses from Trichoderma virens.
rcsb
molecule tags Polysaccharide-binding protein
molecule keywords Epl1 protein
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3m3gA00
3X2GA 1BW3A 4JP6A 2PJJA 3X2OA 3X2HA 4FERA 5H4UA 2HCZX 2PNWA 4L48A 3D30A 3ENGA 1OA9A 3M3GA 2PICA 3X2NA 2G6GA 3X2MA 4AVRA 4ENGA 5GLXA 3X2KA 4FG4A 3SUJA 1BW4A 4JP7A 4FG2A 3X2IA 2KQAA 3SULA 3SUKA 3X2LA 5GM9A 3CZBA 1OA7A 2ENGA 4JJOA 4JS7A 4ZM7A 2AE0X 2GAEA 3X2PA 1HD5A 1L8FA 3X2JA 2PI8A 4FFTA 3SUMA 1N10A 5GLYA 4JCWA 2G5DA 2BH0A 1WC2A
chains in the Genus database with same CATH superfamily
1R27A 2E2IA 5T5ID 5FTMA 1G8JA 5FTNA 2NVXA 2NVYA 1SMYD 1PPYA 3IR7A 2G6GA 4AVRA 2R93A 2EEOB 3GTQA 1PT0A 1BW4A 3QQ8A 1WLFA 2IV2X 4KO8A 5C18A 1TWCA 4AOKB 4GA6A 4CS0A 1ZYRD 2VPZA 4KODA 2GAEA 5DYGA 3X2JA 3HU3A 2B63A 1TWFA 4GA5A 1PYUB 2BH0A 1WC2A 3X2MA 1BW3A 1CZ5A 1WCMA 2PJJA 1AW8B 1SIWA 1H0HA 1OGYA 3OUGA 1UHEA 2PNWA 1CZ4A 1E18A 3HKZA 3QQ7A 1R7RA 4FERA 4L48A 4CRYG 3GTKA 1Y1VA 3ENGA 2JA5A 3M3GA 2JIRA 3GTLA 3FKIA 3IR5A 2JIQA 2A6HD 2VPXA 2V3VA 1E32A 3HU1A 4AAYA 1KQGA 4RV0A 1DMSA 4FG2A 3X2IA 1Y1WA 3X2LA 4DMRA 5GLFA 2A69D 3CF2A 1OA7A 2KI8A 3TM7B 4JS7A 4ZM7A 1K83A 1TWGA 2AE0X 5FTLA 2JIMA 3X2PA 2JIPA 2JA7A 3O5AA 2JIOA 5C1BA 1AA6A 2E2HA 2PI8A 2R92A 1N10A 2E7ZA 2VPWA 2WB1A 1DMRA 1R9TA 2NAPA 1PQEA 2V45A 3X2GA 1PQHA 1S3SA 4D7ZB 2DMRA 3H0GA 1EU1A 3QWZA 2PJHB 4AONB 5B6CA 5H4UA 3GTPA 1E5VA 2Y0SA 2CW0D 4C2MA 1SFOA 3DMRA 4ENGA 1Q16A 5GLXA 3X2KA 4AYBA 1TWHA 3ML1A 1H5NA 4JP7A 3IR6A 3SULA 3SUKA 3TIWA 3CZBA 1I50A 4JJOA 1FDIA 3GTGA 2YUJA 1PQFA 2VPYA 1Y4ZA 4NOHA 1HD5A 1PYQA 1ZC1A 2A68D 2VUMA 1FDOA 1UHDA 4FFTA 3SUMA 2R7ZA 1TWAA 5GLYA 4JCWA 2G5DA 1YNND 3GTOA 2JA6A 2NYAA 4JP6A 5T5MD 4KLNA 1PT1A 3X2HA 1I3QA 1E61A 2HCZX 1KQFA 3D30A 1IW7D 1E60A 2O5JD 2C45A 1OA9A 1CR5A 2PICA 5EPPA 5FTKA 3X2NA 1Y5IA 1VC3B 3HU2A 4KDIA 4FG4A 3GTJA 4AZDA 2WAQA 3GTMA 1YNJD 4QIWA 5FTJA 2KQAA 3CQZA 2PMZA 4KDLA 5GM9A 2ENGA 1QDNA 2A6ED 2BE5D 4CRZA 2YU9A 3PLXB 1L8FA 3QC8A 5DYIA 1YLEA 1G8KA 3X2OA 1QCSA 3SUJA 1TMOA
chains in the Genus database with same CATH topology
3X2GA 1BW3A 4JP6A 2PJJA 3X2OA 3X2HA 4FERA 5H4UA 2HCZX 2PNWA 4L48A 3D30A 3ENGA 1OA9A 3M3GA 2PICA 3X2NA 2G6GA 3X2MA 4AVRA 4ENGA 5GLXA 3X2KA 4FG4A 3SUJA 1BW4A 4JP7A 4FG2A 3X2IA 2KQAA 3SULA 3SUKA 3X2LA 5GM9A 3CZBA 1OA7A 2ENGA 4JJOA 4JS7A 4ZM7A 2AE0X 2GAEA 3X2PA 1HD5A 1L8FA 3X2JA 2PI8A 4FFTA 3SUMA 1N10A 5GLYA 4JCWA 2G5DA 2BH0A 1WC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2G A;  1BW3 A;  4JP6 A;  2PJJ A;  3X2O A;  3X2H A;  4FER A;  5H4U A;  2HCZ X;  2PNW A;  4L48 A;  3D30 A;  3ENG A;  1OA9 A;  3M3G A;  2PIC A;  3X2N A;  2G6G A;  3X2M A;  4AVR A;  4ENG A;  5GLX A;  3X2K A;  4FG4 A;  3SUJ A;  1BW4 A;  4JP7 A;  4FG2 A;  3X2I A;  2KQA A;  3SUL A;  3SUK A;  3X2L A;  5GM9 A;  3CZB A;  1OA7 A;  2ENG A;  4JJO A;  4JS7 A;  4ZM7 A;  2AE0 X;  2GAE A;  3X2P A;  1HD5 A;  1L8F A;  3X2J A;  2PI8 A;  4FFT A;  3SUM A;  1N10 A;  5GLY A;  4JCW A;  2G5D A;  2BH0 A;  1WC2 A; 
#chains in the Genus database with same CATH topology
 1R27 A;  2E2I A;  5T5I D;  5FTM A;  1G8J A;  5FTN A;  2NVX A;  2NVY A;  1SMY D;  1PPY A;  3IR7 A;  2G6G A;  4AVR A;  2R93 A;  2EEO B;  3GTQ A;  1PT0 A;  1BW4 A;  3QQ8 A;  1WLF A;  2IV2 X;  4KO8 A;  5C18 A;  1TWC A;  4AOK B;  4GA6 A;  4CS0 A;  1ZYR D;  2VPZ A;  4KOD A;  2GAE A;  5DYG A;  3X2J A;  3HU3 A;  2B63 A;  1TWF A;  4GA5 A;  1PYU B;  2BH0 A;  1WC2 A;  3X2M A;  1BW3 A;  1CZ5 A;  1WCM A;  2PJJ A;  1AW8 B;  1SIW A;  1H0H A;  1OGY A;  3OUG A;  1UHE A;  2PNW A;  1CZ4 A;  1E18 A;  3HKZ A;  3QQ7 A;  1R7R A;  4FER A;  4L48 A;  4CRY G;  3GTK A;  1Y1V A;  3ENG A;  2JA5 A;  3M3G A;  2JIR A;  3GTL A;  3FKI A;  3IR5 A;  2JIQ A;  2A6H D;  2VPX A;  2V3V A;  1E32 A;  3HU1 A;  4AAY A;  1KQG A;  4RV0 A;  1DMS A;  4FG2 A;  3X2I A;  1Y1W A;  3X2L A;  4DMR A;  5GLF A;  2A69 D;  3CF2 A;  1OA7 A;  2KI8 A;  3TM7 B;  4JS7 A;  4ZM7 A;  1K83 A;  1TWG A;  2AE0 X;  5FTL A;  2JIM A;  3X2P A;  2JIP A;  2JA7 A;  3O5A A;  2JIO A;  5C1B A;  1AA6 A;  2E2H A;  2PI8 A;  2R92 A;  1N10 A;  2E7Z A;  2VPW A;  2WB1 A;  1DMR A;  1R9T A;  2NAP A;  1PQE A;  2V45 A;  3X2G A;  1PQH A;  1S3S A;  4D7Z B;  2DMR A;  3H0G A;  1EU1 A;  3QWZ A;  2PJH B;  4AON B;  5B6C A;  5H4U A;  3GTP A;  1E5V A;  2Y0S A;  2CW0 D;  4C2M A;  1SFO A;  3DMR A;  4ENG A;  1Q16 A;  5GLX A;  3X2K A;  4AYB A;  1TWH A;  3ML1 A;  1H5N A;  4JP7 A;  3IR6 A;  3SUL A;  3SUK A;  3TIW A;  3CZB A;  1I50 A;  4JJO A;  1FDI A;  3GTG A;  2YUJ A;  1PQF A;  2VPY A;  1Y4Z A;  4NOH A;  1HD5 A;  1PYQ A;  1ZC1 A;  2A68 D;  2VUM A;  1FDO A;  1UHD A;  4FFT A;  3SUM A;  2R7Z A;  1TWA A;  5GLY A;  4JCW A;  2G5D A;  1YNN D;  3GTO A;  2JA6 A;  2NYA A;  4JP6 A;  5T5M D;  4KLN A;  1PT1 A;  3X2H A;  1I3Q A;  1E61 A;  2HCZ X;  1KQF A;  3D30 A;  1IW7 D;  1E60 A;  2O5J D;  2C45 A;  1OA9 A;  1CR5 A;  2PIC A;  5EPP A;  5FTK A;  3X2N A;  1Y5I A;  1VC3 B;  3HU2 A;  4KDI A;  4FG4 A;  3GTJ A;  4AZD A;  2WAQ A;  3GTM A;  1YNJ D;  4QIW A;  5FTJ A;  2KQA A;  3CQZ A;  2PMZ A;  4KDL A;  5GM9 A;  2ENG A;  1QDN A;  2A6E D;  2BE5 D;  4CRZ A;  2YU9 A;  3PLX B;  1L8F A;  3QC8 A;  5DYI A;  1YLE A;  1G8K A;  3X2O A;  1QCS A;  3SUJ A;  1TMO A; 
#chains in the Genus database with same CATH homology
 3X2G A;  1BW3 A;  4JP6 A;  2PJJ A;  3X2O A;  3X2H A;  4FER A;  5H4U A;  2HCZ X;  2PNW A;  4L48 A;  3D30 A;  3ENG A;  1OA9 A;  3M3G A;  2PIC A;  3X2N A;  2G6G A;  3X2M A;  4AVR A;  4ENG A;  5GLX A;  3X2K A;  4FG4 A;  3SUJ A;  1BW4 A;  4JP7 A;  4FG2 A;  3X2I A;  2KQA A;  3SUL A;  3SUK A;  3X2L A;  5GM9 A;  3CZB A;  1OA7 A;  2ENG A;  4JJO A;  4JS7 A;  4ZM7 A;  2AE0 X;  2GAE A;  3X2P A;  1HD5 A;  1L8F A;  3X2J A;  2PI8 A;  4FFT A;  3SUM A;  1N10 A;  5GLY A;  4JCW A;  2G5D A;  2BH0 A;  1WC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...