3M3GA

Crystal structure of sm1, an elicitor of plant defence responses from trichoderma virens.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
DTVSYDTGYDNGSRSLNDVSCSDGPNGLETRYHWSTQGQIPRFPYIGGAAAVAGWNSASCGTCWKLQYSGHTIYVLAVDHAASGFNIALDAMNALTGGQAVQLGRVSATATQVPVKNCGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epl1 protein
publication title Crystal structure of Sm1, an elicitor of plant defence responses from Trichoderma virens.
rcsb
molecule tags Polysaccharide-binding protein
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3m3gA00
4JP6A 3X2GA 2PICA 2PNWA 3X2LA 1BW4A 3X2PA 3X2IA 3D30A 1L8FA 3M3GA 2ENGA 4JP7A 4JS7A 4JCWA 1N10A 3X2NA 1BW3A 1OA7A 5GLXA 4FFTA 2HCZX 3ENGA 3SUJA 4ZM7A 3X2KA 3X2JA 3X2HA 5H4UA 2G6GA 2GAEA 4JJOA 3SUKA 2AE0X 3SUMA 2G5DA 2PJJA 3CZBA 5GLYA 4ENGA 1OA9A 2KQAA 1WC2A 4AVRA 4L48A 2PI8A 5GM9A 2BH0A 3SULA 4FG4A 3X2OA 1HD5A 4FG2A 4FERA 3X2MA
chains in the Genus database with same CATH superfamily
3DMRA 1E5VA 1PQEA 1E61A 1H5NA 1UHDA 4AZDA 1L8FA 3GTGA 2VPWA 4JCWA 3CF2A 1BW3A 2V45A 1CR5A 3GTLA 3TIWA 2E2HA 4FFTA 1CZ4A 3ENGA 1PYUB 1R7RA 1EU1A 2VPXA 3HU3A 1S3SA 2A68D 2GAEA 2EEOB 3HU2A 4RV0A 5DYGA 1SMYD 4NOHA 1G8JA 1I50A 2IV2X 1UHEA 1DMSA 2KQAA 2VPYA 5T5ID 3TM7B 3IR7A 4AONB 3H0GA 4AYBA 3SULA 1E60A 2Y0SA 1YNND 4FG4A 3X2OA 4CS0A 5GLFA 2A69D 1OGYA 1Y4ZA 2JA6A 1PT0A 2B63A 2PICA 5FTNA 1SFOA 2PJHB 1FDIA 3CQZA 4QIWA 1BW4A 2WB1A 4KLNA 1Y1WA 2DMRA 2ENGA 2A6ED 3IR5A 4GA6A 5GLXA 1ZC1A 2R93A 1E18A 1SIWA 4ZM7A 3X2JA 3X2HA 2G6GA 4JJOA 3SUKA 3GTJA 2AE0X 2JIQA 4AAYA 2G5DA 2KI8A 2PJJA 2NAPA 1ZYRD 1FDOA 5DYIA 1Y5IA 1AW8B 5FTJA 5C18A 1QDNA 3QC8A 4AVRA 2JIRA 2PI8A 1TMOA 1TWGA 1I3QA 2YUJA 2VUMA 5FTMA 3X2MA 1E32A 1Q16A 4JP6A 1WLFA 2R7ZA 2PNWA 2NVYA 3X2LA 2YU9A 3HKZA 4D7ZB 2VPZA 1IW7D 3X2IA 3D30A 2JA7A 2PMZA 4JP7A 3M3GA 1PT1A 2E7ZA 1N10A 1G8KA 4KDLA 3SUJA 3IR6A 3X2KA 3QQ8A 2C45A 3HU1A 2WAQA 2JIMA 1KQFA 1YNJD 4KO8A 5GLYA 3CZBA 1TWHA 2A6HD 1YLEA 2O5JD 1TWFA 5C1BA 1Y1VA 3QQ7A 3GTPA 5T5MD 1WC2A 1H0HA 5GM9A 1AA6A 3GTQA 4KODA 2JA5A 2R92A 5B6CA 5FTLA 1HD5A 4CRZA 2CW0D 3ML1A 3PLXB 4FERA 4C2MA 4CRYG 3X2GA 4DMRA 3QWZA 3X2PA 1TWAA 1CZ5A 4JS7A 3OUGA 1K83A 3GTKA 3X2NA 1OA7A 5FTKA 4GA5A 2NYAA 3GTMA 1DMRA 2HCZX 1VC3B 1PYQA 2E2IA 5H4UA 2JIOA 2V3VA 3SUMA 1R27A 1KQGA 4ENGA 1OA9A 4AOKB 1PPYA 1QCSA 3FKIA 3GTOA 1PQHA 1PQFA 1WCMA 2JIPA 4KDIA 2BE5D 2BH0A 4L48A 2NVXA 1R9TA 3O5AA 1TWCA 4FG2A 5EPPA
chains in the Genus database with same CATH topology
4JP6A 3X2GA 2PICA 2PNWA 3X2LA 1BW4A 3X2PA 3X2IA 3D30A 1L8FA 3M3GA 2ENGA 4JP7A 4JS7A 4JCWA 1N10A 3X2NA 1BW3A 1OA7A 5GLXA 4FFTA 2HCZX 3ENGA 3SUJA 4ZM7A 3X2KA 3X2JA 3X2HA 5H4UA 2G6GA 2GAEA 4JJOA 3SUKA 2AE0X 3SUMA 2G5DA 2PJJA 3CZBA 5GLYA 4ENGA 1OA9A 2KQAA 1WC2A 4AVRA 4L48A 2PI8A 5GM9A 2BH0A 3SULA 4FG4A 3X2OA 1HD5A 4FG2A 4FERA 3X2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JP6 A;  3X2G A;  2PIC A;  2PNW A;  3X2L A;  1BW4 A;  3X2P A;  3X2I A;  3D30 A;  1L8F A;  3M3G A;  2ENG A;  4JP7 A;  4JS7 A;  4JCW A;  1N10 A;  3X2N A;  1BW3 A;  1OA7 A;  5GLX A;  4FFT A;  2HCZ X;  3ENG A;  3SUJ A;  4ZM7 A;  3X2K A;  3X2J A;  3X2H A;  5H4U A;  2G6G A;  2GAE A;  4JJO A;  3SUK A;  2AE0 X;  3SUM A;  2G5D A;  2PJJ A;  3CZB A;  5GLY A;  4ENG A;  1OA9 A;  2KQA A;  1WC2 A;  4AVR A;  4L48 A;  2PI8 A;  5GM9 A;  2BH0 A;  3SUL A;  4FG4 A;  3X2O A;  1HD5 A;  4FG2 A;  4FER A;  3X2M A; 
#chains in the Genus database with same CATH topology
 3DMR A;  1E5V A;  1PQE A;  1E61 A;  1H5N A;  1UHD A;  4AZD A;  1L8F A;  3GTG A;  2VPW A;  4JCW A;  3CF2 A;  1BW3 A;  2V45 A;  1CR5 A;  3GTL A;  3TIW A;  2E2H A;  4FFT A;  1CZ4 A;  3ENG A;  1PYU B;  1R7R A;  1EU1 A;  2VPX A;  3HU3 A;  1S3S A;  2A68 D;  2GAE A;  2EEO B;  3HU2 A;  4RV0 A;  5DYG A;  1SMY D;  4NOH A;  1G8J A;  1I50 A;  2IV2 X;  1UHE A;  1DMS A;  2KQA A;  2VPY A;  5T5I D;  3TM7 B;  3IR7 A;  4AON B;  3H0G A;  4AYB A;  3SUL A;  1E60 A;  2Y0S A;  1YNN D;  4FG4 A;  3X2O A;  4CS0 A;  5GLF A;  2A69 D;  1OGY A;  1Y4Z A;  2JA6 A;  1PT0 A;  2B63 A;  2PIC A;  5FTN A;  1SFO A;  2PJH B;  1FDI A;  3CQZ A;  4QIW A;  1BW4 A;  2WB1 A;  4KLN A;  1Y1W A;  2DMR A;  2ENG A;  2A6E D;  3IR5 A;  4GA6 A;  5GLX A;  1ZC1 A;  2R93 A;  1E18 A;  1SIW A;  4ZM7 A;  3X2J A;  3X2H A;  2G6G A;  4JJO A;  3SUK A;  3GTJ A;  2AE0 X;  2JIQ A;  4AAY A;  2G5D A;  2KI8 A;  2PJJ A;  2NAP A;  1ZYR D;  1FDO A;  5DYI A;  1Y5I A;  1AW8 B;  5FTJ A;  5C18 A;  1QDN A;  3QC8 A;  4AVR A;  2JIR A;  2PI8 A;  1TMO A;  1TWG A;  1I3Q A;  2YUJ A;  2VUM A;  5FTM A;  3X2M A;  1E32 A;  1Q16 A;  4JP6 A;  1WLF A;  2R7Z A;  2PNW A;  2NVY A;  3X2L A;  2YU9 A;  3HKZ A;  4D7Z B;  2VPZ A;  1IW7 D;  3X2I A;  3D30 A;  2JA7 A;  2PMZ A;  4JP7 A;  3M3G A;  1PT1 A;  2E7Z A;  1N10 A;  1G8K A;  4KDL A;  3SUJ A;  3IR6 A;  3X2K A;  3QQ8 A;  2C45 A;  3HU1 A;  2WAQ A;  2JIM A;  1KQF A;  1YNJ D;  4KO8 A;  5GLY A;  3CZB A;  1TWH A;  2A6H D;  1YLE A;  2O5J D;  1TWF A;  5C1B A;  1Y1V A;  3QQ7 A;  3GTP A;  5T5M D;  1WC2 A;  1H0H A;  5GM9 A;  1AA6 A;  3GTQ A;  4KOD A;  2JA5 A;  2R92 A;  5B6C A;  5FTL A;  1HD5 A;  4CRZ A;  2CW0 D;  3ML1 A;  3PLX B;  4FER A;  4C2M A;  4CRY G;  3X2G A;  4DMR A;  3QWZ A;  3X2P A;  1TWA A;  1CZ5 A;  4JS7 A;  3OUG A;  1K83 A;  3GTK A;  3X2N A;  1OA7 A;  5FTK A;  4GA5 A;  2NYA A;  3GTM A;  1DMR A;  2HCZ X;  1VC3 B;  1PYQ A;  2E2I A;  5H4U A;  2JIO A;  2V3V A;  3SUM A;  1R27 A;  1KQG A;  4ENG A;  1OA9 A;  4AOK B;  1PPY A;  1QCS A;  3FKI A;  3GTO A;  1PQH A;  1PQF A;  1WCM A;  2JIP A;  4KDI A;  2BE5 D;  2BH0 A;  4L48 A;  2NVX A;  1R9T A;  3O5A A;  1TWC A;  4FG2 A;  5EPP A; 
#chains in the Genus database with same CATH homology
 4JP6 A;  3X2G A;  2PIC A;  2PNW A;  3X2L A;  1BW4 A;  3X2P A;  3X2I A;  3D30 A;  1L8F A;  3M3G A;  2ENG A;  4JP7 A;  4JS7 A;  4JCW A;  1N10 A;  3X2N A;  1BW3 A;  1OA7 A;  5GLX A;  4FFT A;  2HCZ X;  3ENG A;  3SUJ A;  4ZM7 A;  3X2K A;  3X2J A;  3X2H A;  5H4U A;  2G6G A;  2GAE A;  4JJO A;  3SUK A;  2AE0 X;  3SUM A;  2G5D A;  2PJJ A;  3CZB A;  5GLY A;  4ENG A;  1OA9 A;  2KQA A;  1WC2 A;  4AVR A;  4L48 A;  2PI8 A;  5GM9 A;  2BH0 A;  3SUL A;  4FG4 A;  3X2O A;  1HD5 A;  4FG2 A;  4FER A;  3X2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...