3M3GA

Crystal structure of sm1, an elicitor of plant defence responses from trichoderma virens.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
DTVSYDTGYDNGSRSLNDVSCSDGPNGLETRYHWSTQGQIPRFPYIGGAAAVAGWNSASCGTCWKLQYSGHTIYVLAVDHAASGFNIALDAMNALTGGQAVQLGRVSATATQVPVKNCGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epl1 protein
publication title Crystal structure of Sm1, an elicitor of plant defence responses from Trichoderma virens.
rcsb
molecule tags Polysaccharide-binding protein
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3m3gA00
1L8FA 3X2GA 3X2KA 3X2IA 2PJJA 3D30A 3X2NA 2G6GA 2GAEA 4JCWA 3SUKA 2PICA 3X2PA 4ENGA 3X2LA 5GLYA 2ENGA 4FERA 4ZM7A 5H4UA 4JS7A 3SUJA 4AVRA 2KQAA 3X2HA 1BW4A 1WC2A 1N10A 3CZBA 1OA9A 5GM9A 3M3GA 3X2OA 1BW3A 2HCZX 2AE0X 4FG4A 2G5DA 4JP7A 4JP6A 3SUMA 2BH0A 1OA7A 2PNWA 4FG2A 3SULA 4L48A 5GLXA 2PI8A 3X2MA 1HD5A 3X2JA 4JJOA 4FFTA 3ENGA
chains in the Genus database with same CATH superfamily
3X2IA 1R27A 3X2NA 1CR5A 5FTJA 1TWAA 2GAEA 4GA5A 4ENGA 1H5NA 3HU2A 2ENGA 2R93A 4ZM7A 5H4UA 1E32A 1Y1VA 4NOHA 2Y0SA 3X2HA 1N10A 1QDNA 5C18A 1OA9A 3TIWA 3M3GA 1PT0A 1YLEA 4KDLA 4D7ZB 3FKIA 3GTMA 1E60A 1KQFA 1VC3B 5EPPA 1E18A 4KDIA 5FTLA 2A69D 1CZ4A 1R7RA 3IR5A 2JIPA 5FTKA 3ML1A 1TWCA 1G8KA 3X2KA 3QC8A 1DMRA 3D30A 3IR7A 3GTJA 1I3QA 4KLNA 1R9TA 3GTGA 2PICA 2JA5A 2JIOA 2YUJA 2WAQA 4AONB 1G8JA 5GLYA 3QWZA 4FERA 1PPYA 1YNND 3OUGA 3SUJA 4AVRA 1KQGA 3CF2A 5B6CA 1WC2A 4AYBA 1PT1A 5GM9A 1WLFA 2E2IA 2JIRA 4JP7A 2B63A 2VPWA 3SUMA 3GTPA 2KI8A 2A68D 1OA7A 5GLFA 2YU9A 3CQZA 3QQ7A 1ZC1A 3SULA 1FDOA 3X2MA 3O5AA 1TWGA 3IR6A 1AA6A 1HD5A 2JIQA 4C2MA 3ENGA 1E5VA 4GA6A 4CRYG 1E61A 3X2GA 2R7ZA 3GTLA 3QQ8A 1FDIA 4JCWA 4AZDA 3GTQA 2NVXA 4QIWA 1K83A 1SIWA 4CS0A 2NAPA 5FTNA 4JS7A 1Y4ZA 2VUMA 2KQAA 4AAYA 1TWFA 1BW4A 3CZBA 1Y1WA 1AW8B 1UHEA 5FTMA 4DMRA 1BW3A 4FG4A 2AE0X 4JP6A 1QCSA 1S3SA 2VPZA 2PMZA 2V45A 1ZYRD 2O5JD 1PQFA 2PNWA 2EEOB 1I50A 2A6ED 2DMRA 2PI8A 5GLXA 1PQEA 1SMYD 2WB1A 1PYQA 5C1BA 2R92A 1SFOA 1H0HA 4FFTA 5T5ID 2E7ZA 2NYAA 1TWHA 2V3VA 3PLXB 4AOKB 3GTOA 1L8FA 2JA7A 2JA6A 1EU1A 2PJJA 4JJOA 1DMSA 1WCMA 2JIMA 2G6GA 3DMRA 3HU1A 3SUKA 5DYIA 3X2PA 3X2LA 1OGYA 2BE5D 1TMOA 1Y5IA 2NVYA 2CW0D 1CZ5A 2A6HD 4RV0A 2PJHB 4KODA 4CRZA 3HKZA 1PQHA 2C45A 3X2OA 2HCZX 2G5DA 4KO8A 1IW7D 2BH0A 2VPYA 3H0GA 3TM7B 3GTKA 5DYGA 4FG2A 4L48A 5T5MD 3HU3A 2E2HA 1UHDA 1PYUB 3X2JA 1YNJD 2VPXA 2IV2X 1Q16A
chains in the Genus database with same CATH topology
1L8FA 3X2GA 3X2KA 3X2IA 2PJJA 3D30A 3X2NA 2G6GA 2GAEA 4JCWA 3SUKA 2PICA 3X2PA 4ENGA 3X2LA 5GLYA 2ENGA 4FERA 4ZM7A 5H4UA 4JS7A 3SUJA 4AVRA 2KQAA 3X2HA 1BW4A 1WC2A 1N10A 3CZBA 1OA9A 5GM9A 3M3GA 3X2OA 1BW3A 2HCZX 2AE0X 4FG4A 2G5DA 4JP7A 4JP6A 3SUMA 2BH0A 1OA7A 2PNWA 4FG2A 3SULA 4L48A 5GLXA 2PI8A 3X2MA 1HD5A 3X2JA 4JJOA 4FFTA 3ENGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L8F A;  3X2G A;  3X2K A;  3X2I A;  2PJJ A;  3D30 A;  3X2N A;  2G6G A;  2GAE A;  4JCW A;  3SUK A;  2PIC A;  3X2P A;  4ENG A;  3X2L A;  5GLY A;  2ENG A;  4FER A;  4ZM7 A;  5H4U A;  4JS7 A;  3SUJ A;  4AVR A;  2KQA A;  3X2H A;  1BW4 A;  1WC2 A;  1N10 A;  3CZB A;  1OA9 A;  5GM9 A;  3M3G A;  3X2O A;  1BW3 A;  2HCZ X;  2AE0 X;  4FG4 A;  2G5D A;  4JP7 A;  4JP6 A;  3SUM A;  2BH0 A;  1OA7 A;  2PNW A;  4FG2 A;  3SUL A;  4L48 A;  5GLX A;  2PI8 A;  3X2M A;  1HD5 A;  3X2J A;  4JJO A;  4FFT A;  3ENG A; 
#chains in the Genus database with same CATH topology
 3X2I A;  1R27 A;  3X2N A;  1CR5 A;  5FTJ A;  1TWA A;  2GAE A;  4GA5 A;  4ENG A;  1H5N A;  3HU2 A;  2ENG A;  2R93 A;  4ZM7 A;  5H4U A;  1E32 A;  1Y1V A;  4NOH A;  2Y0S A;  3X2H A;  1N10 A;  1QDN A;  5C18 A;  1OA9 A;  3TIW A;  3M3G A;  1PT0 A;  1YLE A;  4KDL A;  4D7Z B;  3FKI A;  3GTM A;  1E60 A;  1KQF A;  1VC3 B;  5EPP A;  1E18 A;  4KDI A;  5FTL A;  2A69 D;  1CZ4 A;  1R7R A;  3IR5 A;  2JIP A;  5FTK A;  3ML1 A;  1TWC A;  1G8K A;  3X2K A;  3QC8 A;  1DMR A;  3D30 A;  3IR7 A;  3GTJ A;  1I3Q A;  4KLN A;  1R9T A;  3GTG A;  2PIC A;  2JA5 A;  2JIO A;  2YUJ A;  2WAQ A;  4AON B;  1G8J A;  5GLY A;  3QWZ A;  4FER A;  1PPY A;  1YNN D;  3OUG A;  3SUJ A;  4AVR A;  1KQG A;  3CF2 A;  5B6C A;  1WC2 A;  4AYB A;  1PT1 A;  5GM9 A;  1WLF A;  2E2I A;  2JIR A;  4JP7 A;  2B63 A;  2VPW A;  3SUM A;  3GTP A;  2KI8 A;  2A68 D;  1OA7 A;  5GLF A;  2YU9 A;  3CQZ A;  3QQ7 A;  1ZC1 A;  3SUL A;  1FDO A;  3X2M A;  3O5A A;  1TWG A;  3IR6 A;  1AA6 A;  1HD5 A;  2JIQ A;  4C2M A;  3ENG A;  1E5V A;  4GA6 A;  4CRY G;  1E61 A;  3X2G A;  2R7Z A;  3GTL A;  3QQ8 A;  1FDI A;  4JCW A;  4AZD A;  3GTQ A;  2NVX A;  4QIW A;  1K83 A;  1SIW A;  4CS0 A;  2NAP A;  5FTN A;  4JS7 A;  1Y4Z A;  2VUM A;  2KQA A;  4AAY A;  1TWF A;  1BW4 A;  3CZB A;  1Y1W A;  1AW8 B;  1UHE A;  5FTM A;  4DMR A;  1BW3 A;  4FG4 A;  2AE0 X;  4JP6 A;  1QCS A;  1S3S A;  2VPZ A;  2PMZ A;  2V45 A;  1ZYR D;  2O5J D;  1PQF A;  2PNW A;  2EEO B;  1I50 A;  2A6E D;  2DMR A;  2PI8 A;  5GLX A;  1PQE A;  1SMY D;  2WB1 A;  1PYQ A;  5C1B A;  2R92 A;  1SFO A;  1H0H A;  4FFT A;  5T5I D;  2E7Z A;  2NYA A;  1TWH A;  2V3V A;  3PLX B;  4AOK B;  3GTO A;  1L8F A;  2JA7 A;  2JA6 A;  1EU1 A;  2PJJ A;  4JJO A;  1DMS A;  1WCM A;  2JIM A;  2G6G A;  3DMR A;  3HU1 A;  3SUK A;  5DYI A;  3X2P A;  3X2L A;  1OGY A;  2BE5 D;  1TMO A;  1Y5I A;  2NVY A;  2CW0 D;  1CZ5 A;  2A6H D;  4RV0 A;  2PJH B;  4KOD A;  4CRZ A;  3HKZ A;  1PQH A;  2C45 A;  3X2O A;  2HCZ X;  2G5D A;  4KO8 A;  1IW7 D;  2BH0 A;  2VPY A;  3H0G A;  3TM7 B;  3GTK A;  5DYG A;  4FG2 A;  4L48 A;  5T5M D;  3HU3 A;  2E2H A;  1UHD A;  1PYU B;  3X2J A;  1YNJ D;  2VPX A;  2IV2 X;  1Q16 A; 
#chains in the Genus database with same CATH homology
 1L8F A;  3X2G A;  3X2K A;  3X2I A;  2PJJ A;  3D30 A;  3X2N A;  2G6G A;  2GAE A;  4JCW A;  3SUK A;  2PIC A;  3X2P A;  4ENG A;  3X2L A;  5GLY A;  2ENG A;  4FER A;  4ZM7 A;  5H4U A;  4JS7 A;  3SUJ A;  4AVR A;  2KQA A;  3X2H A;  1BW4 A;  1WC2 A;  1N10 A;  3CZB A;  1OA9 A;  5GM9 A;  3M3G A;  3X2O A;  1BW3 A;  2HCZ X;  2AE0 X;  4FG4 A;  2G5D A;  4JP7 A;  4JP6 A;  3SUM A;  2BH0 A;  1OA7 A;  2PNW A;  4FG2 A;  3SUL A;  4L48 A;  5GLX A;  2PI8 A;  3X2M A;  1HD5 A;  3X2J A;  4JJO A;  4FFT A;  3ENG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...