3M3GA

Crystal structure of sm1, an elicitor of plant defence responses from trichoderma virens.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
b'DTVSYDTGYDNGSRSLNDVSCSDGPNGLETRYHWSTQGQIPRFPYIGGAAAVAGWNSASCGTCWKLQYSGHTIYVLAVDHAASGFNIALDAMNALTGGQAVQLGRVSATATQVPVKNCGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epl1 protein
molecule tags Polysaccharide-binding protein
publication title Crystal structure of Sm1, an elicitor of plant defence responses from Trichoderma virens.
rcsb
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3m3gA00
3X2IA 5H4UA 3X2PA 3SUJA 3D30A 4FG2A 4JCWA 5GLXA 3X2GA 3X2HA 1N10A 2AE0X 2G6GA 3M3GA 5GM9A 1BW4A 3X2OA 4JP7A 2GAEA 4AVRA 5GLYA 1BW3A 2BH0A 2KQAA 2PJJA 2PNWA 4FFTA 3X2MA 2PICA 4ENGA 1WC2A 1L8FA 2PI8A 1OA9A 3X2NA 4FERA 4JS7A 2HCZX 3ENGA 3X2LA 2G5DA 4L48A 3X2JA 1OA7A 3SUKA 4JJOA 3SUMA 1HD5A 2ENGA 4JP6A 3SULA 3X2KA 4FG4A 4ZM7A 3CZBA
chains in the Genus database with same CATH superfamily
2NAPA 3X2IA 3QC8A 5H4UA 1YNND 3GTOA 1FDIA 3OUGA 2VUMA 2E2HA 1YLEA 2JIMA 5GM9A 2AE0X 3GTMA 2C45A 3X2OA 5FTKA 2B63A 4AONB 1BW3A 4KO8A 3GTPA 1Y1WA 2JA5A 5DYIA 1TWGA 4KODA 1CZ5A 4ENGA 1K83A 2JIOA 5T5MD 2E2IA 1AW8B 2NVXA 3IR7A 3X2NA 4FERA 2V3VA 2V45A 3HU1A 2HCZX 3ENGA 1R27A 1DMSA 2G5DA 3GTQA 3X2JA 3HU3A 2R93A 1KQGA 2WAQA 5FTMA 4JJOA 1DMRA 4JP6A 1E32A 1G8JA 1PQEA 4FG4A 4KDIA 1PQFA 4C2MA 3CZBA 1SFOA 2NYAA 1Y4ZA 1R9TA 2EEOB 1EU1A 3ML1A 4NOHA 5FTJA 1AA6A 3GTLA 3X2GA 1BW4A 2NVYA 3GTGA 4AAYA 1TWAA 3QQ7A 2GAEA 3QQ8A 2BH0A 2KQAA 1SIWA 2VPYA 2PICA 4AYBA 2JA7A 1L8FA 1E18A 1OA9A 2PI8A 1SMYD 2Y0SA 4GA6A 3CQZA 4AZDA 5EPPA 1TWHA 2DMRA 1PT1A 1YNJD 2PJHB 4CS0A 3H0GA 2VPWA 1G8KA 3SULA 2R92A 4CRYG 2A69D 1OGYA 2BE5D 1IW7D 2KI8A 3X2PA 3TIWA 3O5AA 2A68D 5T5ID 3SUJA 2A6HD 3GTKA 4FG2A 5GLXA 3X2HA 3M3GA 2G6GA 4AOKB 2JA6A 1Y5IA 4KDLA 4JP7A 1PPYA 2YUJA 5DYGA 2PNWA 1ZC1A 4D7ZB 5B6CA 1KQFA 1QCSA 2PMZA 2YU9A 1PYUB 1R7RA 3DMRA 1WC2A 2JIRA 5FTNA 1H5NA 2E7ZA 2IV2X 1FDOA 3QWZA 3X2LA 3IR6A 2A6ED 1ZYRD 1OA7A 3FKIA 1UHEA 2VPZA 5GLFA 3SUKA 1E5VA 2ENGA 1HD5A 1H0HA 2O5JD 1UHDA 4DMRA 1E61A 1WLFA 1TWFA 2JIQA 1TWCA 3D30A 2WB1A 4JCWA 2R7ZA 5FTLA 1N10A 5C1BA 3GTJA 3X2KA 4AVRA 2JIPA 5GLYA 1TMOA 1Q16A 2PJJA 3CF2A 4FFTA 4QIWA 3X2MA 1CR5A 3HU2A 1I50A 3HKZA 3PLXB 1E60A 1Y1VA 2CW0D 2VPXA 4JS7A 3TM7B 1VC3B 1PYQA 1QDNA 1CZ4A 3IR5A 4CRZA 4L48A 1I3QA 3SUMA 4KLNA 5C18A 4GA5A 1PQHA 4RV0A 1PT0A 4ZM7A 1WCMA 1S3SA
chains in the Genus database with same CATH topology
3X2IA 5H4UA 3X2PA 3SUJA 3D30A 4FG2A 4JCWA 5GLXA 3X2GA 3X2HA 1N10A 2AE0X 2G6GA 3M3GA 5GM9A 1BW4A 3X2OA 4JP7A 2GAEA 4AVRA 5GLYA 1BW3A 2BH0A 2KQAA 2PJJA 2PNWA 4FFTA 3X2MA 2PICA 4ENGA 1WC2A 1L8FA 2PI8A 1OA9A 3X2NA 4FERA 4JS7A 2HCZX 3ENGA 3X2LA 2G5DA 4L48A 3X2JA 1OA7A 3SUKA 4JJOA 3SUMA 1HD5A 2ENGA 4JP6A 3SULA 3X2KA 4FG4A 4ZM7A 3CZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2I A;  5H4U A;  3X2P A;  3SUJ A;  3D30 A;  4FG2 A;  4JCW A;  5GLX A;  3X2G A;  3X2H A;  1N10 A;  2AE0 X;  2G6G A;  3M3G A;  5GM9 A;  1BW4 A;  3X2O A;  4JP7 A;  2GAE A;  4AVR A;  5GLY A;  1BW3 A;  2BH0 A;  2KQA A;  2PJJ A;  2PNW A;  4FFT A;  3X2M A;  2PIC A;  4ENG A;  1WC2 A;  1L8F A;  2PI8 A;  1OA9 A;  3X2N A;  4FER A;  4JS7 A;  2HCZ X;  3ENG A;  3X2L A;  2G5D A;  4L48 A;  3X2J A;  1OA7 A;  3SUK A;  4JJO A;  3SUM A;  1HD5 A;  2ENG A;  4JP6 A;  3SUL A;  3X2K A;  4FG4 A;  4ZM7 A;  3CZB A; 
#chains in the Genus database with same CATH topology
 2NAP A;  3X2I A;  3QC8 A;  5H4U A;  1YNN D;  3GTO A;  1FDI A;  3OUG A;  2VUM A;  2E2H A;  1YLE A;  2JIM A;  5GM9 A;  2AE0 X;  3GTM A;  2C45 A;  3X2O A;  5FTK A;  2B63 A;  4AON B;  1BW3 A;  4KO8 A;  3GTP A;  1Y1W A;  2JA5 A;  5DYI A;  1TWG A;  4KOD A;  1CZ5 A;  4ENG A;  1K83 A;  2JIO A;  5T5M D;  2E2I A;  1AW8 B;  2NVX A;  3IR7 A;  3X2N A;  4FER A;  2V3V A;  2V45 A;  3HU1 A;  2HCZ X;  3ENG A;  1R27 A;  1DMS A;  2G5D A;  3GTQ A;  3X2J A;  3HU3 A;  2R93 A;  1KQG A;  2WAQ A;  5FTM A;  4JJO A;  1DMR A;  4JP6 A;  1E32 A;  1G8J A;  1PQE A;  4FG4 A;  4KDI A;  1PQF A;  4C2M A;  3CZB A;  1SFO A;  2NYA A;  1Y4Z A;  1R9T A;  2EEO B;  1EU1 A;  3ML1 A;  4NOH A;  5FTJ A;  1AA6 A;  3GTL A;  3X2G A;  1BW4 A;  2NVY A;  3GTG A;  4AAY A;  1TWA A;  3QQ7 A;  2GAE A;  3QQ8 A;  2BH0 A;  2KQA A;  1SIW A;  2VPY A;  2PIC A;  4AYB A;  2JA7 A;  1L8F A;  1E18 A;  1OA9 A;  2PI8 A;  1SMY D;  2Y0S A;  4GA6 A;  3CQZ A;  4AZD A;  5EPP A;  1TWH A;  2DMR A;  1PT1 A;  1YNJ D;  2PJH B;  4CS0 A;  3H0G A;  2VPW A;  1G8K A;  3SUL A;  2R92 A;  4CRY G;  2A69 D;  1OGY A;  2BE5 D;  1IW7 D;  2KI8 A;  3X2P A;  3TIW A;  3O5A A;  2A68 D;  5T5I D;  3SUJ A;  2A6H D;  3GTK A;  4FG2 A;  5GLX A;  3X2H A;  3M3G A;  2G6G A;  4AOK B;  2JA6 A;  1Y5I A;  4KDL A;  4JP7 A;  1PPY A;  2YUJ A;  5DYG A;  2PNW A;  1ZC1 A;  4D7Z B;  5B6C A;  1KQF A;  1QCS A;  2PMZ A;  2YU9 A;  1PYU B;  1R7R A;  3DMR A;  1WC2 A;  2JIR A;  5FTN A;  1H5N A;  2E7Z A;  2IV2 X;  1FDO A;  3QWZ A;  3X2L A;  3IR6 A;  2A6E D;  1ZYR D;  1OA7 A;  3FKI A;  1UHE A;  2VPZ A;  5GLF A;  3SUK A;  1E5V A;  2ENG A;  1HD5 A;  1H0H A;  2O5J D;  1UHD A;  4DMR A;  1E61 A;  1WLF A;  1TWF A;  2JIQ A;  1TWC A;  3D30 A;  2WB1 A;  4JCW A;  2R7Z A;  5FTL A;  1N10 A;  5C1B A;  3GTJ A;  3X2K A;  4AVR A;  2JIP A;  5GLY A;  1TMO A;  1Q16 A;  2PJJ A;  3CF2 A;  4FFT A;  4QIW A;  3X2M A;  1CR5 A;  3HU2 A;  1I50 A;  3HKZ A;  3PLX B;  1E60 A;  1Y1V A;  2CW0 D;  2VPX A;  4JS7 A;  3TM7 B;  1VC3 B;  1PYQ A;  1QDN A;  1CZ4 A;  3IR5 A;  4CRZ A;  4L48 A;  1I3Q A;  3SUM A;  4KLN A;  5C18 A;  4GA5 A;  1PQH A;  4RV0 A;  1PT0 A;  4ZM7 A;  1WCM A;  1S3S A; 
#chains in the Genus database with same CATH homology
 3X2I A;  5H4U A;  3X2P A;  3SUJ A;  3D30 A;  4FG2 A;  4JCW A;  5GLX A;  3X2G A;  3X2H A;  1N10 A;  2AE0 X;  2G6G A;  3M3G A;  5GM9 A;  1BW4 A;  3X2O A;  4JP7 A;  2GAE A;  4AVR A;  5GLY A;  1BW3 A;  2BH0 A;  2KQA A;  2PJJ A;  2PNW A;  4FFT A;  3X2M A;  2PIC A;  4ENG A;  1WC2 A;  1L8F A;  2PI8 A;  1OA9 A;  3X2N A;  4FER A;  4JS7 A;  2HCZ X;  3ENG A;  3X2L A;  2G5D A;  4L48 A;  3X2J A;  1OA7 A;  3SUK A;  4JJO A;  3SUM A;  1HD5 A;  2ENG A;  4JP6 A;  3SUL A;  3X2K A;  4FG4 A;  4ZM7 A;  3CZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...