4FFTA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with mixed-linkage glucan
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fftA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fftA02
4FERA 1WHOA 5GLXA 2JNZA 3SUKA 3FT9A 5GLYA 3SUMA 3X2PA 1N10A 3ENGA 4JCWA 4AVRA 3SUJA 5H4UA 3X2LA 2AE0X 1L8FA 1BW4A 1OA9A 3X2HA 1WHPA 2PICA 2ENGA 4JJOA 2GAEA 3M3GA 3SULA 4ENGA 2PJJA 2G6GA 3FT1A 1OA7A 1HD5A 3X2MA 4JP6A 4ZM7A 2PNWA 3X2NA 4FG4A 4FG2A 2VXQA 1BMWA 4FFTA 3X2GA 3CZBA 1BW3A 4L48A 2G5DA 3D30A 2PI8A 3X2JA 3X2KA 2BH0A 5GM9A 4JS7A 4JP7A 3X2IA 2KQAA 1WC2A 2HCZX 3X2OA
chains in the Genus database with same CATH superfamily
4FS0A 4J3OG 2LLLA 4X0NA 1SF3A 5AW1B 2CUHA 3UAAA 3B7YA 2X4RA 2B5IB 2A9AA 3BAYA 5FB8A 4HWBA 4PW9A 3IKCB 2XBZA 1QR1B 3DGGA 3HBZA 4KQ4H 4WU7A 1JDAA 1GHFH 1A9EA 3FQ1A 2VLKA 5LGHL 4MAUL 4MCNA 1I4FA 3N91A 5DD1L 2A77L 4I1RA 4YZFE 4YLQT 2VDQL 3VD4A 1I85C 1TZIB 5AB9A 4JFHE 1AS8A 3AB0C 3GSXB 4L3CA 5D2LE 4F91B 4JLRB 3V8CA 4IS6A 4FNTA 2ZJSL 4AONB 1AANA 3MV7E 1WLHA 4M8UA 4XMPH 4F2MB 1ET8A 1RJZA 2I60H 3AXHA 2NY2B 1GA2A 4X7CC 2A83B 1BVKA 3UTTE 1TMOA 2Z3FA 2VYRE 4M02A 3IAPA 1MQ8A 1CC3A 3CVCA 2BOCA 3U46B 4N0CC 3KR3L 5E4IA 3VFGL 4F93B 3FT2B 3U7WH 5LUMA 3JYCA 5D71L 4DGVH 5F1OB 1R6VA 1O0VA 2X42A 3D0AA 2NX5B 4PI0A 3OAYH 5DVMA 5HHQB 4XMUA 4N2IA 5E5LA 2YO3A 3WU1A 4LSRH 1CS6A 5BOPA 2IQ9L 4HC1A 3FQUB 4ZFQA 3AGVA 1YVLA 1MPAL 3NZSA 1GVIA 4FNSA 1UVQB 2WKOA 1RPQA 2AFNA 1HQ4B 3CHPA 4N2DA 4YSRA 2DKSA 3PWVA 4KKPA 4OB5L 4DGYL 5GZOD 3VD9A 1YUHB 2Z1PA 1BWMA 1J1XH 4BM7A 5I6LA 1O6SA 4OM0H 1AD0B 3D9AH 1X5GA 3FTSA 5E1IA 3ZE0F 3V6FA 2A1WL 2OX5A 3EOBA 3S3SA 4U33A 2A99A 2RMNA 4AITA 4NZUH 2ED7A 3ARGA 1BAFH 5E99H 3RX8A 5M7QA 3R19A 1HIMH 3SKNA 3P02A 3WIIH 2HFTA 1LE9B 5J11C 1XCTA 1G6RL 3QDHA 3L1OH 2G75B 2E8YA 2P8MA 4IKJA 1DCEA 2HVJA 1NANI 1QRND 4C4BA 5KS9F 3VXMB 4RAVB 5FM5M 3AM8A 1BIHA 4J3VA 2H32A 1CI5A 2XIBA 1AXTH 4FF9A 3VWKC 5JDJA 5AEAA 1A3LL 4AAYA 3B2VL 1H3UA 4KROB 2Y07H 3FJTA 4N68A 3GJFA 3CHXA 3SHSA 1BYPA 1THAA 4PJDF 1XEUA 4IGBB 3FU6A 3O45B 4L8BA 4AGNA 2FH6A 4RDBA 1I9EA 4C4KT 1CT8A 5GSRB 4ZUUA 3T3PB 2OXHA 3O8XB 1H3XA 2QLVB 5TF1L 4DW2L 4DWHA 3SKMA 3VUAA 5IB4A 2C7UA 2XG5A 4XH2B 4J2XA 1EERB 2A0LC 3LZFL 4U1IB 1UD3A 3S4SB 1BD2E 1MJJB 1RVFH 4XPFH 4XVTH 4CADA 1F11B 1KYAA 3HW7A 1OGAA 4YIQB 2QQKH 1NCHA 2WSPA 1S46A 1IGJA 3POHA 1FH2A 3TO2B 1KCVL 2FVNA 3LOWA 4S10A 3HE6C 3D25A 3FSZA 2D4FA 1CR9L 2Z35A 4OCYL 3ZXAC 4YHPA 1NMBL 3OGCB 5J89A 1SEBA 1FSKB 1WLFA 3QC6X 5FTLA 1U8KA 2ADFL 3K6NA 4NPYB 3QS2A 4G9DA 1JG9A 1KBGH 3VXRB 5C0EA 1VFBB 1YEKL 2P8LB 5DC9B 2QPFA 4U1HB 2YMXL 2F2HA 2ZONA 3KLKA 4RX4D 1YYLL 4RIRB 4Z7NB 6FABH 1FG2A 3T77B 3ARDA 3EYQC 4ANVA 2LHAA 4LCCC 4QCIA 1EO8H 2R0WH 1BZEA 4KOCA 3E0GA 3ZDWA 4DKTA 1OAKL 3EBGA 4YAQB 4ETYA 1FVEB 1NUNB 2MMXA 1SY6H 1ITBB 2DPKA 4QKXB 5I18H 3MKGA 4KJWC 4R5XA 4AV0A 3PUCA 2DQGH 3T0DA 1OTSC 3MACH 5I66B 4W4OA 1LEIB 3JT2A 5AKTA 5DUBB 5IEHA 2GUYA 4WSGA 1UA7A 4L23A 5DZJA 3BW9A 4FQHA 2NOYA 2PTTA 2D2OA 1KBBA 3EBHA 2YU9A 3VD3A 5D9SA 1F13A 4L1SA 3HBPA 4PGDB 2NT1A 2Y36L 1TJGL 2VXQA 1B2WH 4LASL 4YHZL 3JXAA 1I8AA 3ETBJ 1D6VL 3HS8A 2OSWA 2GCYB 1F6AA 3GM0A 4AJWA 4PG2C 1Z66A 4ZMQA 1NANH 2FYVA 3PGFH 5DMGD 2WXIA 5D5ME 2EXWD 4MQSB 1MCCA 2HFEA 5JW5A 3BD3A 1B3IA 3LNHA 4UBDD 3SQOL 5ISZB 1EAPB 4U7SA 3DX8B 4AEEA 4XPTH 2APTA 5IBUG 5C08B 1IC5L 1UUNA 4J3BA 2GIYA 3JUZA 1XB3A 4P9MH 4YS4A 3SOBH 3UTSB 2CALA 1FHNA 3IN2A 4YPJA 3WELA 3LEYL 2JJVA 5SWSD 3X2NA 5HHVH 5GGVL 3W11C 4U1GB 4ODWB 5DTFA 4N0YH 3FTGB 1A9BA 1KB5H 4N90E 3MCKB 3GSVB 3GSOB 4I0PD 4CJ1A 5AW2B 3ROLA 2YRLA 4HUWB 3I9PA 1ILUA 2NR6C 4X9FA 1AS7A 5EEUA 4NUGH 3Q2LA 3SE3C 4XN7A 1EXHA 2IBZY 2BRQA 3NP4A 4Q2ZB 3CCHB 5K1NA 3HC2A 3P0VL 1BIIB 3GHEH 1NFKA 4HJIA 1KXVC 2F5AL 3FCTB 3HMWL 2H2PC 3GXPA 4ZX3A 2QVFB 2VDOL 4YHOL 4EO5A 4JRYE 4AH2B 1HXMA 1KXTB 2VR6A 3MNVA 4CN1A 1FDOA 4BHUI 1BEYL 1WCBA 5AW0B 4WKZB 1MQKH 1PPIA 1VB9A 4CSZA 1VGKB 2VN3A 4HKXB 1NCDL 2F8VA 4FL4B 4PJ7B 1W72L 2AJVH 3ZDXE 1JI1A 5KG9A 1MCFA 5BO0D 5CLZA 1GGIH 4NN5C 4A68A 3MDJA 2YPLA 1U8NB 5T3ZD 4X98B 1A2YA 1S9VA 4PMEA 4Z7QF 3UPAA 4DCQB 2R93A 1K2DB 2RR3A 3KH3A 3QH3B 5DQDH 2BSSA 4GMTH 4EQ3A 2VLJE 1MCPL 1I9JH 4WI3A 2IALA 5DK0B 5GJSH 2R4RH 3LB6D 2HTLC 4B9CA 2EH7H 4P2RB 1FNEB 2NY4D 4F57H 1KYFA 1ZANH 5JHLA 1R3HA 1KEMH 2L7EA 4RAUA 1MVYA 1ZHLA 2QDWA 2A74A 3DJ9A 5LB1A 4G11A 5FK9A 3K6IA 2O30A 5L7XL 5F1KC 5C0DA 3RDTD 4GI9A 5DRXA 1H3PH 2QSCL 4B27A 4F80A 5IOPB 3NCJL 5C3TA 4I89A 3IBOA 4XPGH 1KYOJ 1GL4B 3TVMA 2G30A 1SLVA 2Q7NA 4MKTA 2ZD0A 4HZLB 4IMLA 4JM4H 4X2UA 3E1F1 3HI6L 5A2BA 3VM7A 3VW3L 3MLRH 4WWKB 2BHFA 1CFTA 5D4HA 1I3GH 1U92B 4XXCA 4OCRL 4WNSA 5J9PA 4P23C 5IT2L 5TQ2L 1WO2A 4A6YA 5FCSH 2FUQA 3MLTB 4AE1A 1FJ1A 4GQPH 1JUFB 3RVVC 3CSFA 4KNQA 5D7LA 1YQVL 4ELMA 2PR9A 5LDSA 5IP4A 4JAMB 3L9EA 1E8WA 1U3HA 5GZOA 1M6OA 1MJUL 4PLJD 5FB8B 1A3ZA 3PAYA 4HH9A 1E4JA 3KWVA 5DMKA 3ULUD 1SBSH 4P57B 1W72A 1CDJA 1DEEA 1TXKA 2WLYA 4R0LC 3L95A 1I4FB 2JIXB 4K3EL 1RZ8B 3X17A 4K9JA 2ZCHL 4YDIH 4PCTA 1X9UA 4W9CC 4G7VL 4MD5A 3CZNA 4L4TD 3GXDA 3O2DA 1BHGA 4Y4KD 1V5JA 1TZOA 15C8L 1HS6A 1MHPH 4PREA 1BFVL 1QRNA 5TQ0L 4UMSA 2PPFA 5CUSL 4AKQA 5E23A 5IW1A 3IKKA 2GJRA 1AKJD 3RAJH 3EJJX 3VI3B 1BVKB 1MJ8H 1U8HA 2CRIA 2LU3A 4Y16A 1T83C 4WRLA 3UAFA 4XVJL 3F01A 5IW3A 1DJZA 2AEPL 4LVOB 3QEUA 1KG0A 5JHBA 3CK0L 2AV7B 5D1ZI 5SV3A 1RULL 4MQXC 3GTGA 1DLHB 5DHVB 5IB2B 4QOKA 4ZPVA 1IL1A 1YJDH 3B4NA 9CGTA 1UWFA 5B1AB 3L5IA 4R7LA 4XP6H 5EPMB 1I7UA 2PXYD 4PP2A 3DJRA 1Q1JH 3UBGA 5FO8B 4B5ZA 3MNMA 4V33A 4HEME 2OQJA 1K9TA 5JUEH 1DL7H 3ARBB 4UILL 4X42A 3EW3B 2NMSA 1F86A 3IJYA 3PWVB 4WHDA 1FNAA 2C3VA 3FQRA 5AZ2H 2Z4QA 1DQQB 1FNFA 5L2JB 3ARPA 5EU4A 3V6FB 1XIWC 1WC2A 2OX5B 1KXQA 3IR5A 1FGNH 4M3HA 2CW0D 5C2UB 2V7HA 3ARGB 4YLBA 1S7WA 5EG6C 4U1LA 1ZKAA 2N3JA 3SBRA 3SKNB 3HMXH 4KO6A 1URLA 1ZD6A 1XCTB 3D3VD 4H8UA 4HIPA 1TWFA 4RISH 2VDQB 2YAFA 1U93B 3H3BC 2P8MB 3T0VA 2CK0H 4R6UA 3MRRA 1IM9B 5J13C 3FCSB 4N1HB 3QDME 4JM2F 2IXQB 1MW2A 4N2OA 3RVUC 5JZ7D 4R96B 3DVGA 1JGLH 5TGBB 1H3WM 4D3CH 3F6JA 4X6DA 3V5KB 4I4WA 4OIBA 3UAEA 1S4IA 2YUXA 3PGDA 2UXVA 3VRJB 5ID0A 4OLVL 3ECQA 4OF7A 4HBCH 1S9XA 2AAVA 1A7BA 1MFBH 2OYKA 5BOZG 3BDXA 4F2ME 2VC2H 2OXHB 3FPXA 4FTVB 5DA4A 2EXSA 2XG5B 4P3WA 1ADWA 2O5XL 3V4PH 5FYJD 4MJJA 5FOJA 1DSYA 2L7UA 1NDMB 4Y2OB 5I26A 4DAGL 3LVTA 1OGAB 1CGUA 1A22B 2IH1B 2R69L 5T3ZL 2AGJH 3H42H 2F74A 1HHGA 1JN6B 1HH6A 3JTTB 2BS9A 4FQIH 2NX5E 1IBBA 4LDEB 1G9NL 4NM8H 1F4WH 3U2JA 1I1AC 2OTWB 2Q20A 4HCRA 5LBGA 3FUHA 5C3IA 1XH3A 1PW3A 1ACYL 3RLSA 3NTCL 2ARWA 3W82A 3VDCA 1ZSDB 1NBVH 2X53A 2ZWLT 1XR9A 4JPWH 5SWSA 2JK5B 3MCYA 4Y2DB 4FLOA 4S11A 5IVXA 1IGCH 1HXKA 4HUMB 3O6LL 3MZTA 4MX7B 5IQMA 3V6OE 4IBTA 1FG2B 3QWRD 4I0PA 1A6WH 4L9LA 1G6RB 3DC0A 5F88B 3O6FA 4G6JL 4R3SB 4UV7L 2EUXA 3QEGL 3DROA 4KAQH 1VSCA 5HDBE 3LH2L 3LKNA 1CK0H 4PG9B 2V5RA 4GEIA 3H7BB 1RU9H 2OMNA 4M5YH 1TTUA 3C09C 4XI5D 2DQEL 5EA0H 1UACH 2P48B 5FA3B 4HPYH 2APVA 1DBJL 1NCOA 3BW9B 4KY1L 4Y5XC 3N55A 5JIPA 3BKCL 4WEBL 1E28B 1JXGA 2LU5A 4S1DC 3L3OC 4APQD 2W9EL 1AP2A 2DJUA 2ERJB 1N67A 3ULUL 3UTOA 4QKTA 2VZUA 3AFLA 3CX5J 1HYRC 3I9GL 4K73A 5CXPA 2R69A 1F2XK 1Z3GL 5JW5B 4PV1C 4NQXB 1AO7A 1MLBB 2QQNH 5B7MA 5GS0C 5C07E 1KGXA 3T2NL 3BZEB 3LIUA 1D3CA 4ZI8A 2WXOA 4GEJA 2AEIT 2G3MA 3D12B 4HIEA 5IR1A 2B5IC 3VNYA 5KSBF 2B08A 1FVDB 1CXIA 1LL1A 2YHGA 4TPRL 4LPWA 3QO1A 4N1EA 4KUCF 4U1KA 1A9BB 2X4PA 3FU9A 4X4YA 4JANA 1J5OH 3RDTA 3KEDA 4GKNA 3MRGA 2XRAH 3QCTL 1J5DA 5T1JA 3KCPA 2BX5A 2PJHB 1I8LA 4CN4A 3DX0A 4YE0A 3VXRE 3L4VA 3GTNA 3WTXA 5IKCB 1OA7A 2VSMB 1SNRA 4ODVH 4X6CA 3NFSH 3TZVD 1O5DT 3VM5A 1PFCA 2NY2C 3FOMB 4Z7NE 1UWGL 1QWNA 1CYXA 1T4KA 2P5WA 4KJYA 3QHTC 1HXMB 1ZWIA 3MODL 3MNVB 3F84A 4JP7A 1PVHA 2EDHA 5EZOL 3FQYA 3FU3A 3OKMB 3P4LA 3P0YH 4WHCA 2HVKA 3WS3A 1U91A 1YN7B 2DYRB 4X5XB 2D9QB 2QELA 4IYKA 3JVFC 5KG9B 2ZQKA 2Z8WC 4ZRGA 5E1HB 2DQHH 4N25A 4XHJD 5E24E 1A2YB 1LLAA 1S9VB 2K6YA 4EZKA 4LZKA 1FFQA 5BVPL 5C86A 2LVCA 3MRBA 1I50A 4HSAC 1VEOA 2BSSB 1G7HB 1Y7VA 3GI8L 1YNTA 4MNQD 3UABA 4L4TA 2L0DA 3ZZSA 2G9HA 5K9OA 4AGLA 1C5DA 1IC7L 5DRNB 3V6OC 4ZT1A 4Q9QH 3FW6A 1FBIL 3TEWA 5D72H 1BF8A 5CCHE 2YXFA 2UXTA 4N24A 3WY2A 3GC3A 5ISZE 3JV0A 5C0DB 1RUQL 1UWYA 4NQVA 5AYUL 2QPDB 3ZL4H 5FHAH 4LEXL 5E2VH 2AK4D 1RZFL 3UTSE 2AJSL 3E6FA 1PEWA 4O58L 2FX9H 1EEZB 1S7QB 2F53D 1NBYA 1ZAGA 2YD7A 3QPQD 4IDJH 2CJTA 3ZMEA 3SDYL 3L2LA 3NJLA 2W60B 3KEHA 3ILPB 5IESH 1AGDA 2OCFD 5FYJL 1FZJA 1USQA 1V3KA 4NO2A 2Z31D 3V0JA 4N87A 4H88L 4X5PA 1OALA 5J9PB 3BCDA 4HFWB 3Q8EA 2ARJQ 1SIWA 1VACA 1QDNA 3DSFL 1R1CA 4N8CL 3VFMA 3GSNH 4WO4A 4X83A 1HZLA 2VDOB 1MAJA 4IGBC 4ELMB 2JIOA 2IG2L 5EZJB 5FTKA 1Z9LA 4PWGA 3BUYB 1N19A 1EGJA 4KTDL 2HT3C 1IQWH 1DVUA 1OCWL 2XQBL 3L7FB 2CO4A 3SQBB 1N64H 2BY2A 3A67L 3GTKA 2C3XA 3ARQA 3GMQA 4LB8A 1VKXA 1GMEA 1W72B 3DJTA 3GGWA 5I1DA 3NA4A 5AB2A 4YVUA 5C2BH 3FUIA 2PW1B 4HLZH 5TFSH 4ZOCA 2GJZA 2ZNXA 1LO3H 4S1SL 4QY8B 4DTGL 1T5WB 3D3VA 4PJ7E 4BCZA 3IMVA 4JQIA 3JYBA 2HVBA 4J6RH 1QRNB 4E9WA 1FIGH 2CM6A 5GRVK 2AMUA 1YYMH 1FSKC 1U8HB 2V37A 1QFUH 3BPCB 3GPEA 4OZFA 5E8PA 4JHVA 1EFQA 1ZIBA 3Q6GH 1AR1B 2ZKWA 3TJHC 2ZOKA 5EF2A 4P2RE 5E9NA 4OLXH 4Z78A 2EDOA 1KGCE 3B9EA 3RI5F 5L4MA 2FJFB 5AW5B 1KNOA 1NUDA 1TCRA 2DM7A 3C8KA 3DO4A 2WO3B 1E2WA 1X5FA 3MOBH 1DFXA 4AYEC 4J3TA 2E4TA 4MBRA 3TTYA 1IL1B 2K4AA 5L2KA 2VWEE 4HV8A 1J11A 2HJFB 3VFTA 2DH3A 2WKLA 1ZYRD 4WDIB 2RQ8A 1F58H 3DV6A 4YXKH 4N9OB 2NY7L 1J8HE 2AANA 1ZLVK 4OGAC 4F7PA 3DO7A 4YDVA 4H20H 1OARH 1KLGB 1UCBL 4JG0H 2E6PA 2VR3A 4HZ1A 1JZ7A 4XNMA 3FQRB 3K2MC 5J6HB 3P2TA 1SM3H 2Z0UA 4F27A 5C0JA 4H0GA 3WKYA 4D0DA 1KGYE 1N18A 2V7HB 2BSCA 4G82A 1S7WB 4QRRE 2OTPA 3C5SA 4GMSL 5GSVA 2Y7QA 3UMTA 3EOYG 2J20A 1DJXA 4NQCE 1OV8A 3WOVA 4GRMA 1ZTXE 2PYED 1ZLWH 2R92A 3QWRA 1AZRA 3MRRB 2W91A 3GM8A 3VXQB 4AY0A 1GZPB 3QHZH 3AQZA 4XR8C 2Y06H 4QHKJ 5EO0B 3MLSL 2IGLA 1P9MA 1I8IB 3DVGB 3ARED 3LS4L 4LP5A 5HHMD 4NGHH 5BOJA 3N50A 4UMGA 4ZSOE 3NABL 1LK2A 4I4WB 1CB4A 1DDHA 2BJML 1IGIH 2GBVA 4U1GC 3WN5A 1ZGLB 3PGDB 4LFHD 3MMEA 1KJ3H 3KL5A 5HGGS 1N6QH 4CS0A 1UUSA 1ECZA 3WJMB 2DIBA 4H40A 1BQHG 3B7TA 1H8OA 4P3CL 3VI3E 3VSTA 2W0LA 5H37G 2OYPA 4HK0B 1SMDA 4S0TD 5IMKA 1SOXA 5F96L 4FG4A 2APFA 4IU3B 4PJ8D 2Q8BL 4WWID 2K3HA 5IOKA 4L1LA 1VADA 3D0LA 3C6SB 4TN9A 2E6JA 2V2XA 12E8L 1LJMA 1REIA 4QT5B 3X1FA 1WAPA 2A3TA 5ID1A 4GKZA 2OMXA 4QXTA 2EE2A 1JXJA 3GS0A 4XMLL 1MKFA 3HBQA 1K5NA 1QVOA 3O6MH 1XH3B 3Q01A 4KFMA 5DHDA 3TXAA 5C70A 4M56A 1FDLL 4UI2A 4KTEH 3QRLA 1QFWL 1GGBL 3EUUA 3GEFA 1R3JA 1T0NB 1NAKH 2ICWI 5SWSB 4FL4C 2JKLA 2Y23A 3CZFB 4XNAA 2NXYD 4ZMTA 5IVXB 2BDNH 5F1SA 3WNKA 1MHCA 3H9SE 4CW1B 2EKSB 4I0PB 3QEHB 3F7YB 4L9LB 5EUOA 4M8QB 4JDVB 1VFMA 3IFPA 3S5ZA 4ZOEA 3U0WL 1Q0YH 4NQUA 4HLEA 4O2EA 5EHFA 2ADYA 1YNKL 4NUMA 3RA7L 3P0GB 4F7EA 4E36A 5HHNB 1U36A 3NFPB 1AQMA 1WAAE 3TZVA 5L8JB 2D3VA 5A3ID 2XKNA 3X14B 2VIRB 1Z9PA 4JW3A 1OHZA 3WGVB 2VWEC 3AZUA 3ULVD 1T0MA 2VITB 3PP3K 2YPKB 1U3NA 4I18A 4YH6A 1FIEA 5HXMA 5KOVC 4GG6B 4H8WH 3B3BA 1INEL 4FFWD 3CC5A 3S3DB 3EF4A 1TU2B 5INDB 1E9QA 4YHLH 5DD6A 4AIZA 1XGTB 5I75B 3UZQA 1DQMH 4FTVE 3X1GA 1SBBA 3DETD 5CSZA 2R8SL 3JV4A 4X4XB 5E4EB 2D2CC 4MNQA 4TF4A 4HIEB 5DS2A 2ALWA 3BIKA 2PLTA 3BRFA 1P4BH 3LKQA 4W68A 1MFCH 2NY4B 3L4YA 2OJZL 3ABZA 3G7TA 3P9MA 4O9HH 1TKWA 1P6WA 2B9AA 3VG0L 3F7PC 1ZVSA 4AUYA 2MNUA 3C75A 4X4YB 3K4AA 1JYXA 1ORQA 2RCSL 4GKNB 4MA3A 4U4IA 5IQNA 4HOMA 4ZAKD 3O41B 3KCPB 1NCWL 1XR8A 2AK4A 4Y4FD 1EJOL 2Y5QA 3FRPG 2F53A 5ITBH 1HZHL 4JP6A 4GT7A 3D4CA 1KIPA 1JMZA 2Y5TA 2ZZUT 1A6PA 5H94A 5TPWH 4ELDA 4GKLA 1BM3L 2AEWA 1U8OA 1XSIA 2H26A 3EFOB 5EU5A 3PNRB 3DARA 5FYKL 4RFEB 5EWIL 1JOIA 3CXHJ 3A24A 3TN0D 1ZWIB 1OB1B 4LVOC 4MDIB 4QTIH 1A6AA 4PJFF 3LH8A 4Y5YA 2VPWA 3BCFA 1QEWB 3FPYA 2IDCA 1J12A 5DHEA 3WS3B 4OVUA 1U91B 2WQRA 2BIQA 4CDGC 3E9TA 5FKPB 1RZKH 2HFFB 3R0MA 2ARJA 1CFMA 2BNUA 4OLWH 3DHPA 1JZEA 3RVXC 3BKJH 3BYYA 2NNAA 2WUBL 3MTXA 2E27L 1UH3A 3MRBB 4MSWA 5FGCB 1R3LB 1X9QA 5GRYA 3U82B 2Y2YA 4L4TB 5CSGA 3U25A 3ARBC 5EF1A 3KJ4B 3L3JB 1F00I 1P1ZA 3P73B 4X9IA 4Y4KB 1A7RL 3N44B 4JPVL 3BLBA 3FKIA 2HX8A 3TBTA 4WW2B 3UAJA 2IQAB 3NPZB 5LXVA 1AKJB 2H7WA 4H8PA 3KLHC 3CZLA 1DLFH 4K9EC 1M1SA 2OSXA 1K4DA 4XX1G 4WI9A 3WNNA 1FO0L 1SEQH 1NUGA 3E6FB 3GQFA 3HPJA 4JRFA 3X3GH 4WI0A 1NBYB 3FQTA 1AC6A 2F6AA 4NRZB 4MYWB 4WNQA 4MTMA 1JPFA 4WHYG 5DD0L 4F8NA 4KZEH 1RFDH 3MRMA 3QORC 2OJEA 3TJPA 2XXMB 2PXYB 4FA8A 4EDXA 4HFUH 1OSPH 2X28A 2RQEA 1YAIA 3VFMB 3GMOA 4CN6A 2VDLL 5GS1A 1TDQA 2ZICA 2A7BA 2RA1A 4ECNA 1IAOA 1MCRA 1Y07A 3HLAB 1TMQA 2QL1A 3IAQA 4PS4H 4Z8FL 3IE4A 4KJPD 1VKXB 1E4XH 2HCZX 2Q5BA 5DUML 4WI8A 3ZGHA 4AJVA 5IFHL 4M43H 1OOWA 4PJIA 1WFNA 2NY6D 4HUKB 3N41B 1KJMA 2ZNWA 2BIHA 2OMUA 5HGBB 3CX2A 3LEVH 2PYEA 4NX0A 3SD2A 5IIEB 3N0PB 5EN2A 4I3GA 4FZEH 4K7FA 4QD2E 2R56L 4N8VA 5IM7B 3RWIA 5I74B 2DAVA 4MS8D 4UV4L 1DVQA 4ACTA 1DBKL 1NAML 1KJVA 4P46B 3BP7B 5E8PB 3AREA 4PN6A 4HD5A 3WMSA 4DEUA 1WYJA 1X6LA 2BY3A 2QFPA 4UQ3B 5KVFL 5LCVA 1PD6A 3DGDA 4Y2DC 2ZOKB 3CD4A 5HYSA 2EH8H 4B9YA 1OE3A 5GLXA 1PIFA 4HOZA 3ULVL 4NB7A 3L5JA 3GMPA 4N20A 5K1JA 3FYIB 1TCRB 2R2EA 3C8KB 3EGDB 1AA6A 4Z6AT 3IRCA 5MP6L 4I1NB 3QIUD 2WIMA 4FA7B 1X5JA 1Z5LB 3QUML 5E03A 2AQNA 3QISA 4NZTL 1UOKA 2YD8A 5JXED 5ACLA 2A6JB 1YEGH 1GGYA 2AJXL 4FG6D 3FC8A 4IOFD 3DO7B 3KGSA 1UCTA 1RIUL 2R0LH 3MJGX 5IF0A 4YDVB 5SWZD 2DWEB 2FJGB 3CU7A 4P59L 4LAQH 1A66A 1LQBC 2FEEI 1W0WA 2QR0B 1YPZF 2DLFH 3HNSL 5E4AA 4JPKH 3UFIA 1PLGL 5D6CA 3GB7A 1PQEA 3FN0H 2LV4A 4LIQL 3K0WA 3QJRB 2BVEA 5I6XB 4I9WE 1P7QD 2YUWA 3V2AR 2CO6B 2QJDA 4R97B 3UPRA 4O5LH 3V0VA 1K8IA 4H26A 4OLYL 1KLFA 2NTFA 3V6ZA 5JIIA 5B38B 4LLVA 4DN4H 1ADQA 4TVPH 4R26L 4DIXA 5KSVA 5JORA 1URIA 3PAVA 1JMXA 1QNZL 2ZUVA 4N3TA 1DEDA 2V9UA 4UM8A 2F7RA 3OG4B 3UDWC 2OMTB 4G9FE 2IH8A 4YSTA 5CEYB 5JXAL 1QYGL 1EANA 5HHPA 3MMEB 4W4NA 3CSBA 5DMYA 3GBMH 4JGMA 1NICA 3QZNA 5FYJU 1I7RB 3IRZA 3OR7B 3C60B 2PUQT 3B9VA 4JO3L 2FHCA 4FTDA 4APQB 3KPPA 2XX1A 5AG9A 2NNCA 3BEWA 1NJ9A 3QUMA 5I1LB 1LDSA 3F62A 3D0LB 4XPHL 3TWCL 2C9RA 3EFFB 5D55A 4AJ0A 2C45A 3EH5B 1KBWA 4WUKL 2OMXB 1PD1A 2AABH 2MTPA 4YE4H 3LQAL 4ZNCD 4WV1A 3N04A 3SGEI 3NP3A 4XNXL 5L0QB 3QBTB 3O3DB 3RPBA 1NGWB 1MCOH 3EFDH 5CJBA 4BSWA 4MD4A 4PUBL 1XF5B 3QCUH 3RVWD 1JZ8A 1MHCB 4LL4A 3KM2A 2CQVA 3OJVC 2XJKA 3PWJA 3KS0J 5CEXB 4XMKL 2DLIA 1YY8A 1QBAA 4ZAKA 5GZND 1AS6A 2MCPH 1QUPA 3EJCA 4Y4FA 3SDXA 2WQXA 1E30A 2YA2A 4PVNA 1OCRB 5LBSH 3QWNA 4LPCA 4O2CA 3ATBA 4O2EB 4HEPA 2IH3B 2O5ZL 4ZM7A 2UUDK 3OMAB 1NFIB 3BAEL 1SXBA 3F64A 3K71A 5GJTL 3X2GA 3D4ZA 2ZX7A 5KSAD 4EOWL 4ZMNA 1RIHL 4M29A 4OR1A 1UH4A 2EEDA 2WLIA 3GTQA 3NA9L 3ZMRA 1JVLA 1PSKH 1KY7A 3NAAL 2DYSB 2MTAA 1TVBA 2OMVB 1JV5B 1INDL 2NY1B 4JVPA 2ZYRA 3QEQD 3IWVA 5D7IF 1A5FH 3CC5B 3HZVB 3L9BA 4GB9A 3TFBA 2WJ5A 4JO5A 5DD6B 2GBUA 5L8KB 1CYWA 2CA4A 4A7QA 4H1LA 3ZTNH 4IHOB 4ABVA 3UZQB 2W0PA 1GHFL 3OPZH 5IB5A 5B1CA 3NSCA 5J1AB 5DEZA 5JDSA 5B4MD 2CO7B 3BVVA 4KUZL 1DVYA 3W0WE 4O02H 4DPAX 2Y3NA 4OFQA 4XMPL 3P4MA 2PCXA 1MCWM 2JTDA 1S8DB 3LH9A 4UQ9A 2JF1A 4JCWA 1FL3A 2IGTA 1HL9A 1XT5A 3BZFB 4QRSB 1FUNA 1KY6A 5DS8B 1MRDL 1OSEA 3OKEB 2VN4A 5D2NE 5DRZA 1ORQB 4C8XA 5F9JB 1XR8B 4TNGA 2MQCA 2W81C 3NCMA 4MB1A 3U7WL 4AT6A 2F53B 1Y6MR 4LKXB 1IGYB 3VGDA 1OZTG 2Y5TB 5HD8D 1WZAA 5H94B 1EAJA 4XZ4A 3BPNC 4LBEA 1VF5C 4BZ2A 5EOCL 2A9DA 4G43A 3BE1L 2Z31B 1U8OB 4LSRL 4ONOA 2RJMA 3SGEH 3MGTA 1ZT4B 2CR3A 3CFJA 4B9IA 1N10A 3FCBA 4K8RC 4NWUH 3LY6A 1AR1C 4K7PY 5ICXA 5IMLB 1A6AB 3HA0A 3UZEC 1B6DA 3ERXA 4W6WB 2VXTH 1PZAA 2R2CA 2R1YB 3MUZ1 3Q43A 1J1XL 3V0WH 4WO0A 4WTZA 4X7TA 3N1PC 2VDML 2ARJB 3QQNA 1NFDA 4XB7A 3I6GA 2BNUB 1JPSH 4MA1B 3VFRB 2FAUA 1F1DA 2DWDB 3G5WA 5GGUA 2R0KH 3V6BR 3WGUB 4PRIA 1BAFL 3BDYL 4NN6B 2IMMA 2HYMA 4MSWB 3HNTL 3WIIL 4JFVA 4Z7VF 4ADJA 5KBKA 3I02A 4GG6E 4FZ8H 3F58H 3KDPB 5DZPA 1F4YL 3CVDA 3RI5K 2VLRE 3OSKA 4N4YB 3LIZL 1G1KA 2BOLA 1VZHA 1R3IH 4GSQA 2PJJA 2DM2A 4MNHB 2X4QB 1K85A 1KTBA 2Z65C 1CTNA 1W0VA 5CCKH 1NEUA 1CD9B 1AXTL 1D7BA 3DURB 5TDNB 4UB0H 4R2GD 5CGYC 1JK9A 1CLCA 3UJJL 35C8L 1UXMA 4LCUA 4GO8A 4NKQB 2R1XB 4WI0B 3L16A 4NI6A 3TL5A 4ZMWA 3IDXL 1JPFB 3SBWA 2O6CA 5CZVH 3CDZA 3GK8L 5AVYB 3UBXI 1J0KA 2AE0X 1E40A 2DWTA 2B39A 3QIUA 4XVTL 4MAYD 5IJCC 4KGLA 4EDXB 1I3QA 2EUWA 3MBXH 2KC0A 5AUMB 5JXEA 1JNHB 2WW8A 3GMOB 3Q5TA 2LU4A 2NZ1A 4PD4K 1G7MA 3TX4A 3VQMA 3WG7B 5CR1A 1UM5H 3UG4A 2WYHA 2VMFA 1IAIM 2YRBA 4XN4A 5FOBB 4GAGH 5GRJL 4ZOBA 5KYXB 4L8CA 4WUUD 3D4YA 4LSVH 1L7TL 2QTEA 4N0FB 2YC1B 3VXUD 5CCGE 3ZZ1A 4HETA 3VFUA 3IF1B 3LKRA 5INCA 1DJIA 1BFOA 1DFBH 2CDEA 4JFTA 3FO1A 3RZWA 1U8PA 1X5ZA 3BPLB 2DZEA 1EHLH 3Q2WA 3H55A 2EXWC 1FL5B 2XQYK 4KHXL 4IOIA 5DWPA 3EHBD 3P3SA 2E5EA 2PYEB 2VR9A 4BQBA 5JYMA 1EO8L 1S7VB 1HNGA 4JY4A 3D08A 3ULUE 4PJGB 3HTLX 3LIZA 2WLJA 4J3WA 1UB5B 5D2NC 2YUJA 3PPEA 1D5IL 3QIWD 3RNKA 3AREB 4PP1C 4Z7WA 2AK1H 4DGWC 5I18L 2VAJA 3ZO0A 1I9RH 3N1MC 2Y9RT 3CFBA 2DLHA 2BS8A 5HYSB 4XOBA 1Z5YD 2OW6A 4KTGA 2ZKHL 4ONHA 2X4NA 3CFCH 4JKLA 3GMPB 2B3RA 1FO0B 3FQ2A 2QHRL 4I0PC 2R2EB 3QR2A 2BP5M 4JDEB 1BPVA 1HSBB 3GPSA 2B1AL 2DLGA 5CKGA 1B2WL 4FQXD 2AKRB 4XAKD 4YQXH 5EMYA 4PJ8B 2C26A 3KW7A 5GISH 4PV8B 1I8MA 4AK2A 3L4XA 4PJAF 3VFSA 4PSPA 5HYIA 5IJDC 3IMUA 2XWJA 1ZJBA 4TLKA 3QQDB 4QXGL 2VDLB 1ZLEA 2VOTA 2ZXWB 4NEHB 4QIRA 1MI5D 1W0WB 2A73A 4XPTL 4WFGD 3GB7B 4W9KC 4P9ML 5M94B 4YO0B 3DI3B 4YVNA 1PNCA 3BISA 5HHVL 4XOAA 3IXTA 2CDGA 5BQ7B 3QYCA 3F2LA 4WLCA 2HUHA 3KZ8A 4N0YL 3MLZL 2NXYB 2M26A 5I75C 1NIAA 2YLKA 4H26B 4YL4A 1EDHA 2ZOLA 2A9ML 3T2QA 3UGXA 5F0MB 5ICZA 4WY7H 1TZGL 5E4EC 4ZUSB 1OAQL 4RSVA 1I3VA 1OANA 5IWLA 4D8OA 1N3NA 4NUGL 3WEMA 2FL5B 4OZGB 4IKLA 2EXYD 1H6TA 4AMKH 5JLZA 1J0HA 1NAMB 5D4IA 4Y19D 5EIIG 2NY4C 1DBBH 4G3YH 3KPMB 4MMXA 2W07A 2EVHA 3EYUH 3VI4F 2R4SH 5HHPB 4G5ZL 4EDWH 1FNLA 1JNLH 4I3SH 4FG2A 3T8MA 2Q7YA 1WBYA 5E08H 2DOCA 1CDUA 2VM9A 3HE7A 1MH5A 1V7MH 2VXSL 1GYWA 3FNKA 1OKEA 3WXVL 3HFMH 3I2CH 1FYTB 2W5PA 3K80A 3KPPB 4L29B 4LSPH 3QEQA 3VYNA 3ARSA 3BEWB 1JZ5A 4RWYL 1NJ9B 3QUMB 4FCHA 1UZ6F 2FHBA 3AADB 1B3JA 2NRDA 3APCA 3GWJA 2C7FA 4DK3A 3AABA 1P5UA 3NG5A 1DJHA 5I0ZA 4M62L 1ET5A 3I74A 1EZUA 4S1RH 3HC4H 5AL0A 1M7DB 4XOEA 1XGYL 2J6WA 5HI5D 1I9JL 4YSCA 2R4RL 1GGCH 2FQFA 2EH7L 5D1ZD 5FGBA 2F54A 1NOLA 2ZPKH 4PLJC 3TYFA 1RHFA 3KXFB 3L1GA 4NT6B 1JRHH 1TVHA 5CU5A 3NJXA 3ULUC 5I0YA 3LN5A 3QULB 1ED3A 3B5GA 4MZIA 3PWJB 3SUJA 1KB5A 3AWFA 3ZKNC 4ZAKB 3Q8FA 4C56E 1PDKA 1IEBB 3CHOA 3SDXB 3D2TA 4Y2NA 1UKSA 1F4AA 3KJ4C 4RWHA 1P84K 1OIOA 1TITA 4Y4KC 4XP1H 2Q6WB 5EZLA 1WITA 4WW2C 5E94A 3MLRL 5AYTA 1I3GL 3QFJD 1NBQA 1JGEB 3WUWG 2JKWA 1TJIL 3FU7B 4NQDD 2F8IA 2WLIB 2FBRA 2HJLA 3TN0B 4G6FD 3PJNA 4JGNA 4DP9X 2EYRB 1VZGA 1TVBB 2PCFA 2QVIA 3GTJA 5HHXL 5FUCE 1J5IA 3TPUA 2DQIL 2E74C 4A7TA 2DL9A 4QHLB 1N6VA 2BSDA 4F3FA 2XIDA 3AXIA 3X13B 4E41D 2E7LA 1JZ3A 1UYWL 2DTML 1R24A 4KY2A 2FZ3A 3BKMH 1TTFA 1CXFA 1Q90A 2GHWB 4G1EB 5EFIA 1XMEB 3AQXA 1J87A 4KKRA 4XCNA 5IB5B 2PXYC 2HLAA 3GLZA 2WQUA 2WKOF 4BSVA 4C4KO 4I0KA 5JDSB 5I76A 2X2JA 4DO6A 4IU2A 4ZMVA 4AENA 1HHHA 2JSFA 2UVFA 4JKMA 5EEYA 4HJUA 3A4DA 5EBMA 3W3BA 3O2VH 5A6LA 1MHPL 2CK2A 1K3ZA 1ZA3B 3QUYD 2AQ3A 4R4BA 2ADJA 3GZQA 1MJ8L 2PP9A 1F18A 4PTUA 4BWTA 3NIDB 5KYUA 1R5IA 1JFQH 1NCAH 2BVQA 1R3KA 5E6ID 3GO1L 3TF7C 1OAJA 3K6SA 5E1QA 2PO6D 1SGKA 2ZT9C 1HT6A 2VPZA 5DR5L 3VU1A 4UINL 2VO5A 4UT6H 2B59A 2V9TA 1G5GA 4LBEB 1WHOA 4G43B 5I74C 3WE6A 4ANXA 4P46C 2JJTC 3ZZLA 2VDRH 1Q1JL 3MGTB 3NSXA 3CFJB 3SCMC 5GS0H 4XNQA 1EJ8A 2FNWA 2WMPA 4NJAH 1CF8H 2EYTA 5JUEL 4KKAD 4GRLD 1DL7L 3IU4H 1RZIA 1WEJH 2LAAA 3O9WD 1S9YA 3E80A 2HRPH 2NZIA 3DV4A 3IMSA 5C0NC 3UYPB 4B3EA 5HTSA 5K9JL 3HAEB 4WUUA 5AZ2L 3ROOA 4MJ5B 3VXUA 1GR7A 2ZOUA 4M48H 5DLLA 1MJ7L 2B1OA 5BRZB 2ZSWB 3II1A 5A2AA 1G1OA 1KZQA 2D3LA 1JXDA 4ZTPH 4FERA 3MNZA 1P53A 1XD0A 3KWWB 2NY6B 3DMMD 3EO9L 4RISL 4H25A 3KPLA 4KK8D 3L5WA 4OV6F 5JNYB 3O4OC 4OZIA 4KZCA 3QR1A 4M6NH 2N1TE 1DBAL 2H9GB 3S97C 4FABH 5HPOA 1MCWW 2ZXBA 1CXHA 3HIZA 1FCGA 2QGEA 1RZJC 4BHUA 2K78A 5A2LH 5ETUB 4K94L 1PJWA 3BUTA 1MCIA 2UWEF 5I6XC 1K4CA 2BH0A 2CNZA 2V4LA 4LBAA 4N2LA 3U0TA 4PJ9B 1RUMH 3ARXA 4ZFZA 4R97C 3D87B 4HBCL 1MFBL 5LN4A 2VC2L 3HG3A 4FEIA 4WHYH 4OF0A 3IJ8A 1JL8A 4F8QA 1ASQA 3NK3A 1IT9H 3QIUB 1GPOL 1VAHA 1F5WA 4JREC 4FQXA 4FKEA 4XP4H 3RIAF 1G0DA 1VEMA 4PHXA 5FUCC 2A6KA 3G9VA 2VR4A 3PYCA 4ODSH 1UA3A 3KPRD 4E0RA 2AGJL 1LO5A 4IW4C 4A37A 4H2AA 1G7MB 4KK6D 4PJ5A 4XI5C 2VISA 4J3OD 2YD0A 5SWZB 5TK2A 1BEXA 4L5FE 1F4WL 1T20A 1WT5A 1XEDA 2YA0A 4LEEA 4DJMA 2Q7AA 1MFAL 3VD2A 1MI5A 3RKDD 1FFOA 5IHZB 3C60C 1ASPA 3LKRB 3VX1A 3WD5L 5T5MD 1KELL 2VDMB 4G70B 4APQC 2XFXA 1H19A 1U8PB 5AKVA 4YX2H 3CXDH 4Y7MA 4NP4H 5HJ3B 1IGCL 1T7XA 1WV7T 1LM8V 1P7QB 3AT9A 4IOIB 2P8PA 3HMXA 1S3KH 3BN9D 4U1MA 4MJIB 5JHDA 2IAMB 4DN3H 1I3UA 3MV9E 4JY4B 4AQ8A 4NOHA 1V05A 2F58L 5E2TL 1F56A 4LLMA 3FB8A 3X2JA 3T1FA 3WO4B 1T5XA 3DTXA 2NLJA 4CNIB 5ICUA 5L0QC 2ROYA 1TG8A 2VSDA 4Y19A 4QJ3B 3GBNL 1A7QL 3FMGL 4OGQC 4HPYL 3BWZA 3O11A 3CQPA 1UM4L 4JKPL 3CBKB 5FCUH 3S88H 1EPFA 4BFIA 2KPWA 4KO9A 1HINH 3BH9A 2P45B 3S3BB 5IQ9B 2OP4L 3U0PA 1KXHA 2EC8A 4QLRA 5L4FA 3APDA 4B3VA 2XX0A 4HPHA 5IHLB 1KYUA 1HAWA 2QDVA 4U3SA 5TDPA 3DUSB 3V4PA 4QHUA 3GINA 2XXCB 4IJTA 1T1ZA 3IDGB 3MYJB 1AI1L 2XA8L 3LX9A 3H0GA 1ZXKA 1YN6B 1QUNA 4KVCH 5SX5H 1JGVH 3QZPA 4C2MA 1KENH 2P24A 2ZOOA 3FU5A 2ISDA 1O6VA 2YKLH 4BH8B 1IB5A 3K72B 1WTGT 1PIGA 2IOOA 3RWJB 5IHHA 2NCMA 3KLQA 4JMNA 5HY9A 2ILLA 2NY1C 4K55A 5FYKE 1DZ0A 5K1VA 3WEXB 1GIGL 2IADA 1M7UA 2YGOA 2DMBA 1XGQB 2Z92B 3T65A 3RU8L 2L04A 3FB6A 1IKOP 4MVBD 1NDTA 4RGNB 2FIRT 1J5OL 3FYEB 2JNZA 4I48A 5I8EA 5F6HJ 3LAFA 3C08H 2OLDA 3ARWA 2QMKA 1CU4H 1FL6A 1FYHB 3O3AA 4Z7UB 4Z3IA 5FLVA 3QWZA 3FF7A 1E60A 4AV4A 3O5AA 3NH7H 1NGPL 2G3ZA 2DQTH 1JXFA 1ZPUA 1M05A 3I9AA 2W07B 3I3EA 3QNZA 4R7VA 4D94A 3RGHA 3FKUS 3QFJA 4GQQA 4ILDA 4IBUA 5KSAB 4PJGE 1K72A 4NQDA 3CFUA 2Q7YB 3FUMA 1H3GA 4DNLA 5TDOB 2V2WB 3MOQA 3TIWA 1VC3B 5G55A 3C5ZA 4HU2A 2QGDA 3CZEA 1QEXA 1QTPA 3TIEB 2NYZA 5C8JA 3QEQB 1RJLA 4JN2A 2OJ1A 3T6ZA 4ANWA 1DE4A 3PP4H 1UXSB 4HGWA 5K59F 4FHBD 1NTDA 2Z31C 3LYRA 2R15A 4KH9A 2C1OA 5GRWA 4R7NB 3GT6A 5DJ2B 2NW2B 4V2CB 4JZJB 2YR3A 3ME0B 4GT0A 2NCEA 4ELMF 2ZX9A 4J4PA 3MLPA 4RGOH 3RTQD 2AHIA 1DYZA 2OL3L 32C2A 4M1DH 2PWHA 5ESAA 5KUMA 3P40A 3U7YL 4K5NA 1KPVA 4JO2H 3S5LG 3QUYA 4PW3A 3RGBA 1UWXH 2OFQA 3C87A 3DX7A 4MA1C 4LL1A 1PQZA 2XQYG 4NJ9H 3T0XA 2OPCA 1ANUA 4DGIH 2WNWA 4QHKI 5FHAL 4YXHH 4NN6C 5E2VL 4QAMB 4EKXA 4ONGH 5IGXH 1KTCA 2WB1A 5EDSA 2EDDA 5LWYH 2FX9L 2XTLA 3P3RA 1YECH 2PO6A 2H8PA 4XO5A 2KDYA 3IMRA 1EMTL 2FLBT 3DRTA 5IESL 2CO3A 5E94B 1IO4C 3RJQB 2IBBA 2DQCH 1WRFA 2IDUA 2RTTA 1YEIH 2WQWA 3QUZD 3LV3B 2PMZA 1L9PA 1JTPA 4P4KD 4X50A 3DVNB 5CN3A 3CVIL 2P80A 1KTLB 2WK2A 3CGTA 4M7ZB 3FFOA 1NUFA 43C9B 3GSNL 2VRQA 1RURH 2XACC 5E56A 4XXDA 2E7CA 2ZCZA 4OZGE 5EBWA 3ARZA 3O3EB 1AG0A 4G6AD 1BZ7A 3L4UA 1F90L 5HGAA 4RRPG 1NCNA 5F9OL 3UTZA 3IDIA 4RV0A 1VLXA 3RTLA 3P30L 5FA4A 2DV6A 2FZ3B 4JVWA 2IFFH 3IU3A 1V54B 4ZD3L 2YRZA 1ZPLA 1RERA 2YJQA 2XVLA 5MHSE 5GM9A 4BSVB 1C9SA 1JV2B 1EDQA 3MJ8B 4QHPA 1FYTE 4GI8A 3DMMA 4IU2B 3WTUA 2D7OA 4OGYL 3VDBA 1RLWA 2BMKB 4XBPA 3H0TA 3FH5A 5BUPA 1R0AH 1CQKA 5AD0B 1MCEA 1U8CA 4HHAB 4R4BB 2JKJA 4TSCH 1KOAA 1I3RB 1E4KA 1QSFA 2QSTA 3G5YB 2VZ1A 3K74B 4MA8L 3W5MA 1ZCRA 4XO4A 1BMZA 2GSGB 2VCOA 3SPVA 3Q6GL 3NCBB 4Z3FA 3CSTA 5CCJA 4UQBA 4AEIH 3JBG7 2FUTA 3UPCA 4NWTH 2CJSA 3O4LA 4OLXL 3K6SB 1ZS8B 4RQQA 4EZLA 3NZ8A 4ZUVB 2XYBA 1KDIA 4HXBH 4OCLC 1N5YH 2AP2A 3KXFE 3UO1L 3MJ9H 3SDAD 1MNUL 4M6OH 3L3GA 4AI7A 2CGZA 3VJ6B 1U8MB 4G80A 4MAYB 4X6DF 1RUPH 3J2PA 1UASA 4BFNA 2XTSA 1F58L 4MCMA 5EF0A 1ZHNB 5DQJB 2WMPB 4R4ND 3K6DA 4GXFA 2EYTB 3GSNA 4LT7A 3ZTJH 1RZIB 3FSOA 1S9YB 5I1CH 5AW3B 5I5RA 2D9CA 4Z0BH 1YEEH 1ZTXH 2ZXQA 4OQTH 3VYOA 1NL0L 5ALCL 1C5CH 3ZDYE 3VXUB 2Q86A 5CLYA 3UZVA 2VZVA 1SM3L 2DICA 2DWSA 4PJ8C 4IIQC 3UTQA 3ZO9A 4OD3L 3GBDA 1N8ZB 1DSWA 3MNZB 3WNIA 4I5BA 3ZTEA 3L3HA 4IKNA 5FF6A 1JTTA 3EJRA 2VMCA 3B5HA 3WL9A 3EHBB 5I73B 3HPLB 4W9ZA 3PL6D 1KN4H 4U6XA 4WFEE 2Y06L 4TQEL 4JY6A 4JO4L 4P2QB 4U6VH 5I1IL 3QIWB 1D5XA 1SYSA 1C1EH 3I75B 4EUPG 3GUTB 1IGIL 3TIDA 5F3BA 5IVXF 1K4CB 5CBEB 1BF5A 4ZFZB 2WYZA 2VO8A 4X5QA 2O5NA 3PABA 3PG2A 5DHVH 1H6UA 2DDQL 4FCAA 1RJYA 4LSSH 5CP7B 1MSPA 3EH2A 3WIFA 4W9DC 2CO2A 1H8LA 1D5MA 1N7MH 4L8SB 2YQGA 3SPHA 5ITFA 3M8OH 2G5BA 3KYKH 4NHCL 5J1SC 1L0QA 5E00A 4OV5B 2A6KB 3TH4T 4M7JL 4UU9B 3JUYA 5D1QD 4C4UA 3HJEA 3WAJA 4Q58C 2E47A 4RFOL 2OKMA 3TFKC 2EIKB 1TZHB 2KLSA 3IJ9A 1T20B 4GAFB 3ULVC 3O6ML 5D7JC 2A2QT 4K2UL 2W0FA 2RBLA 4KTEL 2GJ6D 5E0FA 1CLVA 4K9EH 3MYZA 4OLUL 1JPGA 3RX7A 4JE0A 1YDPA 1NAKL 5C0AD 3S6CA 2V17L 5I1HL 1U21A 3FFDA 2PNWA 2JH2A 2GSIA 3LPOA 2NY3C 4KI5F 3JTSA 3SDDC 2CRYA 2P8PB 4GUPA 4YZWA 5F97E 2O61B 3DETC 4ADGA 1IFGA 3D51A 2IPKB 4XMZA 3MBEB 5BRZE 1YMHA 2ZJSH 1T1XB 4EI6A 1FAIL 2FSEB 3DTXB 1GW0A 1Q0YL 4PWEA 3WI9A 1BOGA 5AQ0A 1BZ9B 2X89D 4DO5A 4CL7A 3NCWA 2D31A 3QQ9D 1GZQA 4Y19B 1F1GA 3Q13A 3QZBA 3SODB 2QKIA 5CNHA 4LGRB 3NEEA 1G0XA 3TJEH 5CFAA 5EU6D 3IJEA 3KR3H 1JF1A 2V8LA 2VL5A 2VQTA 3VFGH 3SPCA 4O51B 1C16A 1YY9C 3BH9B 5DFWH 2VC2B 3DOIA 1ZT1A 3U0PB 4BDVA 5AG8A 4WK2B 2XV6B 4HG4J 1CO1A 4BK5A 1QABA 4NLAA 4U3SB 4GQZA 1FGVL 5EH1A 4QHUB 4X6CF 1AH1A 1E4WL 1BXXA 2I85A 4YDLB 5TE4L 2X10A 4DFHA 4LQFL 4PJBA 4LOEA 1ETZB 1DQML 1NGYA 1QUNB 3QHFH 2IWEA 4O2FB 4WJG3 1GOHA 1O7DE 2P24B 3TN0C 1H0HA 2YPVH 4MA7H 2DY2A 2WUCH 4OB5H 4DGYH 4HLJA 3PV6B 4TL5A 4CVZB 1U95A 1OCCB 4DZ8A 3C6EA 4HAFA 5HY9B 2FYYA 3EAKA 4F8LA 3JV6A 2A1WH 3S0PA 1MFCL 5D1ZB 4O9HL 2X7LA 3HN8A 5SWZE 5ESVB 3T65B 4C58B 4KPHH 2Y1ZA 3KBHE 1LP9B 2ZWNA 5E8NA 4WZ9A 1OP5K 3VD0A 3ES6B 4KX9A 2BLFA 3IDMA 1G6RH 3QJTB 3FSWA 3GRGA 4Z3JA 4MZ2A 5I8EB 1YNTF 4KDIA 1AY1L 3VRIA 1D5BA 1FL6B 5ITBL 5IW6B 4TVPD 2J6EH 2CHZA 1XCQA 3L4CA 4Z0XA 1ACCA 4NNPH 2XXGA 1RK0A 1WA0X 3QNZB 4MJIE 1A3LH 3B2VH 3HZMA 3ZKXB 5I1EL 1FZKA 4R84A 4H0IA 3WHXA 2JCCE 4HPOH 4NQDB 3HUJB 3FDWA 4QTIL 1EQWA 4G6FB 3RGVC 5TF1H 1YG9A 4XWGL 5I82A 4DW2H 2IMNA 2IIJA 3IJHB 4ZUWA 3ZBMA 4ICWA 1UB6A 1XDTT 3C6LA 3LZFH 4MQ7A 2HJKB 1OVZA 3OAZK 1RJLB 4UAHA 1QLEH 5DWUH 4E41B 3LKSB 1RZKL 5GGSA 3LKPB 1DE4B 1UJ3A 2OZ4L 5J8OA 3QIBB 4HGWB 4NRXA 4OLWL 3BOVA 3RNQB 4GBXB 1HSAA 2FO4A 3BKJL 4Q52A 3AITA 1FLRL 2JE8A 2QT6A 4XZUA 3HEIB 2J5WA 5IREA 3MI6A 2JTYA 4B5EA 2WVVA 1S2EA 1IQDA 3NEOA 1CR9H 1J05A 5FO2A 3REVB 3IAGC 4A2GA 1NMBH 4QRFA 1JGDA 4HUXA 3BSZL 5LXGL 3GSRA 3QUYB 1X5XA 3SEPA 5DFAA 5KVMC 2V6HA 1E8ZA 1YEKH 1DLFL 1CDHA 3GJFK 1R5VB 5DJ8A 1MWAB 4Y5VB 1T89A 3CG8A 5GIRB 3AGWA 3FAWA 1MHEA 5E6IB 1A14H 1EO7A 3HHRB 3STLB 1SEQL 8PAZA 2NY6C 3VH8B 3X3GL 1BYNA 2UWEE 1WBZB 2EIJB 1G7QA 1X4ZA 1MHHA 3C5JB 4LVEA 1RD6A 1OAKH 1SLWA 2H8PB 2PO6B 3MO1B 1UKQA 1XB8A 2DBJA 1EU1A 2ITCA 3GXNA 3ZSSA 4RGNE 5KTEH 4MS8C 4GFTB 3NRQA 3OWRA 4NUJB 4HFUL 2KMWA 3NJFA 3MR9A 5HHOA 1LWRA 4Z7UE 3DA0A 3FOLB 1LWHA 1D6EB 4PJ9C 1OW0A 3TO4B 1TUPA 3MAWA 2ICWA 4GRLB 3LD8C 3O9WB 1ZV9A 1BZ7B 4O4YL 2HG5A 4LASH 4YHZH 2DLTA 3I9IA 4JFHD 1D6VH 2X4TA 3RFRA 4JZOB 3QXAB 2V0AA 1O7DC 4ZXBC 4YR6A 4DMRA 3IU3B 2GSMB 4LF3A 3MROB 3D39D 3MV7D 3B56A 3BO8B 5BVJA 4M43L 1ES0A 4U7KA 2D8KA 3ECVA 2XETA 3EYQD 3UTTD 4UNVA 5DHMC 4FG6C 4IOFC 3DMMB 3SQOH 3T08A 3NJJA 3PLYA 2Q2LA 3LEVL 5JIQA 1IC5H 3IS1X 5AVVB 2CIIB 2OL3B 4XBPB 4FZEL 3PL6A 3H0TB 1U8CB 3LEYH 2CHNA 5KUKA 3WSQL 1FDIA 2EZ0C 3L4ZA 1CICC 3SPVB 1GOGA 3FH8A 1L0PA 1S7XA 5J3HD 1KGIA 1FZOB 3FHEA 4DCQA 3CDGA 1EEYB 3MRPA 1P7HL 2IAMC 3CPLB 2Q87A 4NFBA 3BZ4A 3LMJL 4A2LA 2X1PA 2ZP0T 5EOTB 3RWEA 1T6BX 1EHKB 1Y5IA 2BWDA 4JFPA 4WK0B 3FQXB 1XH2A 3ZT7A 4B60A 4B9JA 3P0VH 2ATPA 3LEXA 5DHYA 4Z3EA 2F5AH 3RZCD 1BVLB 1ZS2A 3HMWH 2DI9A 2MFNA 3KYOB 5I5MA 3WFBL 1P5VA 3C9NA 1MRFH 1YEGL 3DYPA 3KPRB 4OZHE 1PG7H 2ZKXA 4WFFE 5D1QA 43CAA 4NQSB 2R0LL 3OB8A 3RFZA 1E5BA 3GSNB 1XF2A 2RACA 3IETA 3WS6A 3SGJC 1M56B 3BIAX 1Z9MA 4RMTA 5D7EA 2EEOB 3PXHA 5B39G 4JPKL 3W11D 3M7OA 3E9UA 3FN0L 1AGCA 2XHNA 1XZ0B 2GJ6A 1AIZA 3NJHA 3LRGA 2UY7B 1F6FB 1UG9A 2V5SA 1P4IL 4PGZA 3TWYA 4FNQA 1ITCA 5C0AA 2A9NH 4ZUTA 4ZTOL 2GAZB 5DEGB 4LXFA 5DMIL 4I5BB 3QUHA 2AQQA 3L3HB 2NR6D 2OMYA 3X11A 1JPTH 4LU5L 3KPSD 4PYGA 3QCVL 4NENA 3DDGA 2EDMA 3RG1C 5IVNA 4K3HA 1U8JA 4W9GC 4UM9B 7TAAA 4TVPL 3GTVA 1Q16A 2AXGA 4WTWA 1G8KA 1GGTA 1UD8A 2CO1A 1J5CA 3CDFA 5MEQA 2DRUA 1A8JH 4K8RH 2WP3O 5DZ9A 2EICA 3T3MF 2BIMA 2X89A 5B6CA 5FECB 5L7XH 3CLWA 1S3RA 1PL3A 4KXZH 1Z7JA 2QSCH 3NYKA 3NCJH 4PJCB 5EUOF 3GBML 4RGNC 2BSRA 1SHXA 1F3DJ 1BGXL 3DECA 5JIDA 4X6EA 2C9AA 5GZNC 1D5MB 2WKGA 3VW3H 4OCRH 4OCMC 2FBOJ 3EYSH 1I85A 4EXPX 1YQVH 1QFPA 2AABL 5GS2H 5KN5B 5FYLL 5K59E 5KSAC 5LNGA 4TSAL 1LK3L 3KS0H 5JA8B 2HTLD 5DYFA 1MJUH 1SLUA 2BHYA 2W0FB 2XDHA 5C0FA 2JKXA 2H0JA 2WXGA 2Y6TE 3H8NA 3OBAA 1F45A 1Y6NR 3PDOA 4X4ME 4AC2A 4JPQA 1KT2B 2BP3A 2NYYC 3NCFB 4U1NB 1BVZA 4XCFL 2VN6A 3G6JA 1LHZA 4PJEE 4WSKA 3WFZA 1BJ1J 4K3EH 3JTSB 4PAZA 2ZCHH 4V1DA 4UT9H 1URZA 1VDGA 3BRGC 2XLLA 1T04A 4JZJC 4BFFA 3MRKA 1LQSR 15C8H 4EI6B 4PB9H 5B4MC 1BFVH 4X8GA 5TQ0H 1CCZA 3GMLB 4CRZA 5CUSH 3L48A 4ORGB 2J2ZA 1HKLL 3L7EB 5BZWA 4P23D 3INOA 1GZQB 2FEEL 3K7UA 3KBEA 2WXHA 2YSSB 4XVJH 4YPGB 3RVVD 3POCA 5DGQA 3SSGA 1RZ7L 2AEPH 4XCYA 1FNSL 3IJEB 4DP2X 4UIKH 2V7NB 3CK0H 3QJZA 5F0PB 1RULH 3HC3H 4PIRF 5KOMC 1I7TA 4Q74A 3BGMA 4P2QE 3MUHL 2X6UA 3L3IA 4CSSA 3UEQA 2ATKB 3ZE1B 3D2UD 4Z95L 2ADGA 3BUQA 5HD8C 5IUSA 2XT1B 2C3WA 4QOKE 2ODIA 3MLWH 4TUOA 5DQ9B 4PJBB 4NCC2 3A4AA 3K81A 4M7ZC 3FONA 3NACH 5C0BE 2N1KA 3NVQA 4XAKE 4PBXA 3IXAA 1U58A 3TNMA 4I13B 3RTQB 3QJHB 4DZ8B 3RY4A 3BMWA 3CJJA 1TPXB 3CMOL 3VWKA 1X5IA 2X7LB 3HG4A 2YXVA 3T6VA 3EKCA 5HGDA 4QI3A 3KLSA 2CLVA 3V7MA 4GSDL 4DP8X 5A2KH 3IDMB 1WBXB 2H6PA 5T1MA 3IPFA 4TNEA 2VW4A 1Q0EA 3DPDA 4JRYD 1U4EA 1RMFH 2WOYA 1GSMA 3W9DB 1TQWA 1XCQB 3GRWL 5DA0B 3W39A 3BPOB 1J1PL 1IAKA 1AC0A 4Z0XB 1KFAL 5LBSA 1WH0A 2PABA 2OTUA 4LVHB 3QUZB 3SY0B 3TU6A 3MRIA 4P4KB 3N6YA 4OLVH 4DP7X 4YWGL 2RD0A 3HE6A 2VDNB 3ILQD 1J9RA 3OJMB 4N0UE 4OCSL 2E46A 3A4FA 1NA8A 5DEFA 4ZUWB 2O5XH 4MQ7B 1XIWD 1SVCP 4BZ1H 2VLJD 5GGSB 5DK3A 4DAGH 3VFVA 5D2LA 4NRXB 3NN8A 1G7LB 2FO4B 4N86A 3BWAA 4MAYC 1XGRB 3J07A 3B43A 1CDBA 2A38A 4FXGC 1OEZW 5FFGA 1Z9NA 3HR5A 2NAPA 4AL8C 2VM3A 2VT0A 2E2HA 4LCCA 3UTTA 2WVVB 1M7IB 4Q9BA 5IBUB 3OB0K 3NRFA 4XNZB 3RVUD 1ACYH 2FQEA 4NO0D 4HUXB 5F70A 3GSRB 4O02A 4G8GD 4XP5L 2J25A 1OGSA 3RPIB 4PJIF 4FNRA 5TTRA 3BAXA 2AITA 4UB0L 2MCAA 1LYQA 1CFNB 5AL8A 2YMTA 2O6EA 4IRSD 5DC0A 5HYQB 3GZPA 4G6JH 4UV7H 4FJYA 3QEGH 3EHBC 3GSQA 5I73C 4AXWA 4K5OA 3FCUB 2CLRB 2AJZA 2LQRA 3LH2H 5AAWC 1EXGA 3SDAB 5JO5A 1JZGA 3KYMB 1LP9E 4LARL 3SE9L 4PG2A 4Y8DC 1QA9A 4U2YA 3GRWA 1MWOA 3DTDA 3F04A 3QIWC 3RZCA 4PW4A 3TBVA 1CFQA 2EDNA 2DQEH 3MR9B 1OD7A 5D4QA 5CBAB 5L88H 2B1HL 3BWUF 3SE6A 3FB7B 1XXFC 3ZHKA 3MRHB 2ICEB 1CGVA 3BKCH 3B5TA 4WEBH 1FNGA 4GAGL 4GO6B 1OAUH 3QT2A 1JS4A 2F68X 3LN4A 4N2KA 3SJVE 1A25A 4ETQA 4K5LA 2X4TB 3LPPA 3M86A 5B1KA 3N85L 3TASA 4BH7B 4OI8A 3ULUH 4L8SC 3HUJE 4LF3B 4F8PA 2XPYA 3HN3A 3I9GH 2CUAA 3TEXA 2YIHA 1EAOA 1SMYD 1ES0B 4UQEA 5IQ7H 1Z3GH 2OYLA 2J57A 3TBWA 4HK3N 3MX0A 2NR6A 1SN5A 3P4NA 2K70A 3NFNB 4JQVC 4PS7A 3QE5A 5FGSA 1D2PA 1ZVYA 3PL6B 3SE3A 1TYJA 3DIDA 5BJTA 3OKOA 1TF4A 4X6BA 3H3PH 3KPTA 1KXVA 2CWRA 4OUOA 2OR8A 2Q76A 2HA1A 2IDSA 5J06A 3VO0A 4Z9KB 1BD2A 1I9RL 3DXAE 3CBJB 4IBZA 2XVKA 3QCTH 4JFXA 1B6UA 3CDGB 2XVBA 3CFCL 3GLDA 3MRPB 5CZXC 2WIIA 4DSYA 3AY2A 5EC2A 3BZ4B 1VZIA 2R7EB 3RWEB 4YNYB 3MBEC 1YO4A 2YBRA 3KLLA 1ODAA 5F7MC 3UC2A 3VRLF 3WE1A 1AW8B 2JCWA 3LEXB 5BNXD 2EXYC 5GISL 4EQ2A 1UWGH 1CGXA 2PW2B 3I6LE 3C9NB 5D1QB 2YZ1A 1Y4ZA 4S1QL 2Y7LA 3MODH 1CZ4A 3SDCB 4K94C 2JXMB 2ALAA 4X7EC 4LSDA 1XF2B 2YEZB 5FKAA 2P5WE 3W38A 1A4KB 4W81A 3K8KA 1AGCB 4MMZC 4LK4A 1X7TA 3T2LA 1OT4A 2BC4A 3MXWH 4EI5C 3QDMD 3LNEA 5C0AB 4BXVA 1JZ4A 4DF9A 5I1KL 1TT6A 2OSLB 4MDJB 4YDLC 2GC7C 3X11B 1V8HA 2AV1A 2XN0A 5AW7B 2DQFB 4A7UA 5BUAA 2DBLH 4ZW7A 2GQHA 3PWNA 3BAWA 3FZUD 3NIGB 2I9TB 1IC7H 2CG9X 4HDIA 1B88A 1MN4A 4OF6A 4QRQA 5MEQB 5FFLA 3CZJA 2Q3ZA 4P23A 1CXLA 3X2HA 2WQVA 5D1ZC 1OP3H 5JW3L 1JPST 4LPUA 2R4SL 4EDWL 1XFPA 5AYUH 1PKQA 5EU6B 1UTDA 4I3SL 4KMQA 4PS8A 1RZFH 2AJSH 4D8PA 1AD9A 5FO9B 4FFTA 5D5MA 2EVJA 1CBJA 3GSWA 3SDXF 5KW9L 1SHWA 1UOLA 4Q4IA 3SDYH 2WY3B 2DYPB 5EBLA 1OSZA 4YFLI 3U6XA 4QO1B 3B3IB 5F7KC 2DMHA 3TT1L 1QI4A 4R0LA 5IHBA 2A68D 1S78C 3MRFB 3DSFH 2JVUA 2ZF9A 4N8CH 5CF3A 1WZLA 2WC7A 5AW4B 3ZKXC 2QBWA 2F8XC 2IG2H 1JVOA 2AXFA 3HC4L 4S1RL 1VGEL 1GTFA 3U6XS 2CHXA 3EJQA 1HD5A 4FYTA 2VE6A 4G72B 3OLIA 1X5HA 1DQLH 4KTDH 3Q8BA 1U8QB 1OCWH 2K8MA 1RZJH 2B63A 2MEJB 1WJ3A 3KPRE 3A67H 4HIHA 1SF5A 3VXTB 4DO4A 1HC1A 2ZPKL 1T83A 2DM4A 2VMJA 3G6JB 4G42A 3QIBC 4URTB 3NJMA 4POZD 5GGRA 4GBXC 4S1SH 4ZO6A 4DTGH 1T04B 3UBXA 5F3HB 4F15B 3P54A 1KEGL 3I6KA 3ZT5A 1JWUB 3TTSA 1MFEH 5FO7B 4QRUA 2GUOB 4DZBA 3KPQB 4JRYA 2W9DL 4WCYH 2HH0L 2ESVD 2BERA 2J2ZB 4XP1L 1WC7A 2VR7A 1LGVA 4OF8A 4RBPH 4YXLL 5E8EA 4Y89A 4F9PC 1IC0A 2KLTA 5GRUL 2HN7A 1OQOA 3JWNE 3NIDF 4WVRA 1KC5L 1RUKL 4PI2A 3KHQA 3P3YA 1PZ5A 1UHEA 4IGBD 4OU3A 4Y5VC 2XWTA 1QFWI 4ZW8A 3V0FA 1E9PA 4CUCA 3OKYA 4N2FA 4UT7H 5E6IC 4WHTA 4CAGA 1BQHA 5DD5H 3WTVA 3WTYA 3G5ZA 3QRBA 1FZMA 5C09A 4N6QA 4JFYA 3P4OA 5C07D 5TE6H 5GLFA 1XIWA 4NKDA 4HULB 2VLJA 3EDKA 4OTXH 4YSAA 1AXIB 4TUOB 1U8IA 1K8DB 5IJVA 3HI1A 3P9LB 4XE5B 3MOAL 4HSQA 2WWKT 1X44A 3CZGA 1QP1A 4FLRA 4NBYB 5DFVD 1U58B 4MDRA 4WEMB 1RV6X 1UCBH 3TNMB 1EXUA 3TO4C 3NSFA 1FA4A 4GRLC 4G7QB 1K6QL 2ZCLL 3O9WC 2D03L 4GAJL 1VHPA 3O2VL 1A1NA 1O6TA 4P04A 1E61A 3CDYA 3WTSA 2J44A 2MH4A 3AY4C 3LSOB 1NFDF 5JIHA 2IANE 3TJHD 4GMSH 5C1BA 2X0WA 1K5WA 3GMNA 4GH7B 2A9BA 4ENZA 5DJXA 2HXAA 5T1MB 3S96B 2JWYA 3EGSB 3UEZA 4PJXE 4DVRL 3MA9H 2CSPA 4YSEA 3MLSH 4K3GA 2XPGA 4KK8C 4HXAL 1YMMB 2RALA 1QO3B 1XGZA 3ZIMA 1PQFA 1IAKB 4MZRA 2IDQA 4JPIA 2EDTA 3VXSA 1YCSA 2BJMH 1PQHA 4JUTA 2FATL 3RWCA 4OGAD 4XWOC 1JHKL 1UWEL 2OMBA 4U1SB 4H5SA 2X3CA 4XXWC 1I1AA 2QPSA 2BWIA 4E42B 4NHUA 1D9KD 5DEFB 2J71A 1CYGA 4ZG1A 2Q2EB 5F96H 3OMIB 3VXPB 4C54A 1Q1PA 2Q8BH 5ANME 1XGPA 5D2LB 2EILB 3HZ3A 3MV8B 4M48L 4WSJA 1EZLA 5EOQL 5EEXA 1UXWA 3EDJA 1ZXQA 3D39B 2NUTB 1T3FA 3DSNB 3G04A 3KYNA 12E8H 3MV7B 4HKBA 4KZ0A 5PCYA 5T3XE 5DJCB 5GLYA 1JNNL 1XF4A 4XMLH 4LCCB 5IVZA 3PQYE 3FO9B 3AQDA 3H7LA 1QSEE 1WFTA 2QFRA 3QUGA 4J3OC 1FDLH 2DMRA 5AOIA 1L9OA 1X9RA 1H8SA 3LRSB 2W8CA 1WDAA 2ZUUA 1QFWH 2FNBA 1GGBH 1EJ6A 4TLUA 2E9WA 1KJ2L 4JDZB 4AQEA 2X2HA 2JB6A 5IK3B 4MCZB 3LQMA 1IBGL 2GC4C 1TEFA 2N7SA 1JZHA 4U4BA 5F6HI 5ANHA 4B7IA 4K07A 3B34A 1XSKA 4Y5XA 1T1YA 1E2ZA 3TCTA 1BJ8A 2VSKB 1CE6A 3OGOE 1NBZA 2ZSVA 3U0WH 3JWNC 3GSQB 2YARA 2AJZB 1RUAH 3L3OA 2X9ZA 5BUGA 4HEMA 4L5FH 1UEYA 5EUOE 4RNRB 3QFDA 1YNKH 1QA9B 3AU1A 2QZQA 3K46A 4UT6A 4XP4L 4Z7WF 4LVNB 1I1FA 3IE9A 3RZCB 4IKIA 5F1IB 2YGVA 1CFQB 4OIAA 1P2CA 4ODSL 3S37L 1E5VA 5J4MA 5KJRL 2JJSC 1S7TA 1ZLUK 2AZAA 5KYNA 3CIQA 4ZS6C 3BWSA 3IPBA 3H6JA 5ENWB 1A6UL 1FNGB 3LPFA 1HL4A 4ETQB 1B0WA 4KC3B 3GHPA 1INEH 4NFDA 2IF7A 1HCZA 2C9QA 4XNUL 1QR1A 5LNDA 1TETL 2XKSA 2Z4TA 3CXDL 4Y1SA 4NP4L 1ECYA 1G7JA 3GMRB 3TBWB 3MX0B 2XWZA 3AW5A 2R8SH 4X4ZA 3P4NB 3KPSB 3AWEA 3GSXA 3INUH 1NGZB 4ODXB 5IB3B 3LZLA 1OHQA 4JLRA 1PPYA 4TTGA 2NY5L 1T80A 4AGQA 4X80H 2NNFA 4X6BB 3DUUA 4GLRI 2OJZH 2VXVL 2Y6SC 3U79A 4WW1B 4F2MA 1NLBL 3T4AB 3VG0H 2A83A 3ZE2F 3CNKA 4K7PL 2RCSH 1OK0A 4JFXB 4L4VD 3FN9A 1NCWH 2WTPA 3S88L 4MVBC 2GVYA 3CQZA 1EJOH 2H1PL 1J8HD 1HINL 1NPJA 2VXUL 5FHBL 1HZHH 1JTOA 4DKFL 4CU6A 2YBRB 2NX5A 3ARUA 2NVXA 5HHQA 2Z7UA 4ONFL 2Z8VC 1BM3H 2WINB 4DGUA 4ZOAA 3FQUA 5FYKH 4NC0B 3QB7C 2JIPA 2FBJH 1I8KB 3KPNA 4E9TA 1JGVL 1A1OB 4QRRD 1KENL 4N2EA 4NQCD 3OMNB 2NTSP 3V6OA 1AD0A 4Y1TA 2DB8A 3FTWA 4TSBH 5AB1A 4G7YH 3VFPB 5JOEA 2V5MA 5B3SB 2VERA 2WUBH 2IEPA 1ID2A 1LE9A 3AG4B 2XICA 2ZYSA 1YC7A 3BD5A 2G75A 4OBSA 4M4RB 4MXVF 4QEGA 3ZL1A 1A7RH 3X2PA 2BVOA 3C08L 4JPVH 3RTQC 5JQ6L 1S5HA 4RAVA 5CJQL 4YFEA 4IBWA 2VL4A 4G7RB 4QRQB 1TPXC 4F7MA 1N2RB 5TE7L 3CZUB 2PR4L 1IM3D 1E27B 3BT2L 1FO0H 4IGBA 3O45A 4D8PB 1AD9B 4ZK8A 1BYOA 3HG1B 5GSRA 2JELL 5FDYA 4W9FC 4BV1A 4XN2A 4XH2A 3D2UB 5DD0H 4NM4L 3S4SA 4JRXE 1MJJA 5C07A 5C9KA 1F11A 2EKJA 3BPOC 4BUGA 3PP4L 4YIQA 3OD3A 3P3UA 2GW5A 4LVHC 3BVDB 3QUZC 4E2OA 4GLRH 4P4KC 3BESR 3LXAA 2VDLH 1CZ8L 2HB0A 3ARBD 3TO2A 2AXFB 3RWGB 3X12A 4GPVA 2X6MA 3H9SD 1E2VA 4RGOL 5DZLA 5HDLA 1VRSA 3CBRA 4M1DL 5BW7C 4Z8FH 3U9UB 3KLHD 2XN1A 4HIHB 4MNGB 3QC8A 4JO2L 4CJ0A 4RVBA 4NPYA 2L7JA 5DUMH 4NBXB 4QUOA 3KVPA 3OJ2C 1VFBA 3VXRA 1CJYA 2P8LA 2DIAA 2FDBP 4XN8A 1IEHA 3EUDA 1GS8A 4XBGA 3U9PL 1XO8A 1NSNL 4YXHL 4RIRA 1SLXA 4HMCA 2W65A 2YRPA 5LWYL 3UJTL 1ZVHA 1NC2D 2CZNA 4EIUA 2CIKB 5GRVL 4CMMB 2R56H 1NPNA 5IROC 4JRYB 5GGVY 2QV2A 5ADPH 1RSFA 1WC7B 1DBKH 1NAMH 3AMLA 3EOTL 3QORD 2DIJA 4ZDHA 1DCLA 3GXTA 4LLDA 4JFZL 5EV7A 4U0RB 1YEIL 5C97A 1FVCB 3FFCE 2XC8A 1G9EA 1QBML 5T1KD 5HBBA 3NIGE 3OKNB 5I66A 1LEIA 2JA5A 3NSDA 3ULVH 2ZKYA 1RURL 3VYPA 3FO0L 2Z8SA 4KDTC 3DVFA 1HX0A 5K39A 1BQHB 1Z9SB 4NC2B 2ENQA 4DPCX 1CLYH 5EU3B 4FI8A 2VZTA 2QQLL 4PGDA 5MP6H 3OXRB 2XWXA 3P4OB 1KTDA 3SDAC 2ADIB 2GCYA 1RZGB 2CD0A 4OCWL 3UYRL 2AJXH 1BVNT 3HI1B 1CFBA 2ED9A 1RIVH 2A9CA 3IR6A 1BWWA 2DH2A 2EUVA 2N7BA 3F85A 5E5MB 4R4NC 4FRWA 2NQCA 5ISZA 1C8PA 2ICEC 3DX8A 4N2NA 5E6YA 5FWQA 5C08A 3T9WA 3MBWA 3M6DA 1A1NB 2QADB 3A22A 4DPBX 3UTSA 2I7SA 4NO0B 3G5XA 5E2WH 4TSCL 4G8GB 3WNPA 4ODWA 2H4EA 4LCYA 2BSEA 2NZ9D 3SE8L 3RJOA 4GINA 1C7SA 4RESB 2M1KA 3GMNB 4K0OA 2YAPA 4GW1B 1QX1A 3GSOA 3EDDA 1OAXH 2VABB 3DUHA 2IWGA 4JJHA 4IRSB 4NWTL 2DQMA 2WWMC 3LQZB 4GUOA 3HNVL 4EE2A 4HXBL 3GSUB 3CLEL 4KXBA 4OZIF 4A67A 4XPAL 4OBRA 1D5RA 4DESA 2M83A 1QNZH 4Q2ZA 1CMOA 1BIIA 3VDAA 1KB3A 5C9JB 4L3EE 3RWCB 1RUPL 3FCTA 1QYGH 3E1ZA 2AEOA 5JXAH 3KM1A 3FAXA 3U4EB 4BXSV 1GYCA 1J48A 4H5SB 1KXTA 2E76C 4KNUA 4CC4C 2DQ6A 1EVTC 2J88H 2ZYHA 1CVSC 4ZPTB 4A2DA 3CVBA 2AJ3A 3IPEA 1ACZA 4OJFL 1MFUA 4JO3H 3L54A 1ZTXL 2DW5A 4HKXA 4QXUL 2FIKB 5LJYH 1MZZA 2VUKA 1XGPB 1BECA 4PJ7A 3SPGA 1TSHA 1HDMB 3GI9L 4XPHH 1UXWB 3ZMNA 4HKBB 3KYNB 3G04B 1U8NA 2DS4A 2H3NB 3L45A 4GP5B 4QWWC 4S0SD 3GTMA 1K2DA 2EO1A 5IVZB 3SDCC 3MA7B 5J56B 3QH3A 1UD2A 1E42A 2C9UA 1CUOA 3B9AA 3OLDA 4NLHA 4AYFB 4PY8J 4P5TD 3ASNB 5DK0A 1KN4L 4IDLA 5G4MA 1PG7X 3MREA 4P2RA 4Q56A 1FNEA 3RWHB 3D69A 3Q6FB 5DYGA 4HF5H 4AQEB 4LDOB 1C1EL 3SKOA 4Z3TA 3D09A 4PRHB 4PUBH 1W8EA 5FYLE 5I9QB 4YDKL 2I25N 5CM1A 3NCCB 4Y5XB 3QI9C 2J5LB 2W59A 4XMKH 5FDWB 5IOPA 3ZHDA 1XSJA 1NBZB 3FRPB 5GGTH 1ZDSA 5KYYA 3LHPH 3L3OB 4IJ3C 4P3DA 4HZLA 5FW6A 3QFDB 3QWQB 1N7ML 3F7RA 4B9FA 2FLRT 2O5ZH 4MXWL 5KZCD 2FEJA 4DUXA 2XUWA 3BAEH 1HHJB 1U92A 3DWTA 2WZ0A 3ELQA 1P2CB 1E8XA 1QBLL 5GJTH 4EOWH 3VSVA 2EYSB 4BRJA 2BHUA 5EIQA 2WB7A 5F1NB 4UAOB 1YMME 3V95A 3NAAH 2YZ8A 5CSBA 1QACA 4I3RH 1MRCL 2APWA 3MQIA 4QRRA 2WLLA 2HPOA 2X9WA 4NO3B 1INDH 1QRKA 4R8WH 4JAMA 3HAEH 5D93C 4LSUH 3S35H 1OL0A 2FT6A 4XNBA 4OQTA 4K9EL 1WHPA 1XX9C 3REWB 5FUZL 4YJZL 1IIKA 3MGAA 4XX5A 4P57A 5ALBL 3QDMB 3ZOAA 1E5YA 5F7LB 4AVIA 1DVXA 1G7JB 1TWGA 5C6TH 2JIXA 5KBDA 1RZ8A 1UD6A 2PTUA 3LKOB 4ZSOA 1OSYA 3JWNG 4K15A 3MV8E 2WXKA 3RWFB 4KUZH 2D0GA 4OZFG 3D39E 2DQDH 3ETSA 1DQDL 1S7SB 3DUUB 2ZCKH 2WAQA 1AGEB 5CP3H 5FV2A 4PWHA 1KJ2B 3VI3A 3ZX1A 2GTWB 1EEQA 3ETTA 1IM3A 2GAEA 2Y7SA 1MRDH 2BPBA 3MCG1 4MHHG 3TJEL 4PGCB 4MMYA 1SOKA 5E6ZA 2AV7A 1FFTB 3X1EA 5C3LD 3OZLA 2KI8A 1J9SA 4F15C 1DLHA 3DHMA 5DHVA 5KBMA 3IGLA 2B2XL 5IB2A 3FULA 1KQFA 5LLIC 4E68A 3FT3A 2PYFB 5EOCH 5GRXG 3BE1H 5EPMA 2BZCA 3QA3B 5CD5D 4KRPC 5FO8A 3CH1A 3KPNB 3QHFL 2J21A 4IEFB 4I88A 2J7LA 4PJHB 4I9WD 3R1GL 3ARBA 1AXSB 4QMEA 4GXUN 2YPVL 4MA7L 4BQCA 2WUCL 5B8CC 2R83A 1BQKA 1H15B 4KUCD 1IJNA 5AOLA 2VDMH 3KL0A 1DQQA 5L2JA 5E2UL 2KI6A 2HFGL 2M8XA 1E5UI 3L08A 3LXCA 4BQ9A 5IQLA 3ARFB 1PZBA 5HDBB 4IM8A 4KPHL 3BDYH 1KCBA 2YWYA 1NFDE 4FHJA 2AZUA 2I9LB 3HNTH 4LGSB 1AZZC 3CMGA 4G9FD 1F4YH 3MJWA 1U93A 3FBKA 1WAAA 4PRIE 5D7KE 3LIZH 3DVIA 1IM9A 1EBPA 2BVOB 2YMOA 1NC2A 3FCSA 1N8OE 1S5HB 3TH3T 2EUZA 4ZYKA 2IXQA 3UACA 2J6EL 5FM4A 3S2AA 5FPIA 2ESVB 4R96A 4F7MB 5IMMB 5KVEE 2B7DT 3QORA 4NNPL 4HIJB 1BV8A 5TGBA 3V5KA 3N1FC 4K8RD 3KPSE 1AR1D 4DKEH 2GT9A 5C0IA 3UJJH 35C8H 4Q4EA 1QOKA 3VRJA 1JSYA 4HPOL 4KKBD 3QXDB 2APXA 3IDXH 1BFSA 1RK7A 4X9HA 1P4LB 3QXWA 4FTVA 5DZVA 5I8KH 1IMHC 3BJ91 3GK8H 3MCLH 3MUUA 4PRAA 4R5VA 4Z77B 1W0YT 1KPUB 3U4AA 5I71B 2ZTBA 3GDCA 5C07B 5DWUL 1QLEL 4A7SA 3M3GA 1NDMA 3CFMA 4Y2OA 3N1QC 1W9XA 4B0MB 4AVHA 1DUZB 2IH1A 4I0CC 1ZRUA 2CLZA 4PY7B 4OF5A 3BP5B 4IMKC 3SO3C 1JN6A 2C4XA 4LRNH 3JTTA 3WTTA 3AJ7A 5GS2D 3X12B 1ZEAL 4F20A 4JFDB 5GRJH 3IVKA 2OTWA 1M2VA 1OE2A 2YPVA 1L7TH 2Q3AA 2Q3XA 5AKSA 5HJBA 1TTGA 1GRWA 1ZSDA 2AF2A 4XB3A 1Z6JT 5K69A 3M17B 3V79C 1CTMA 3IEAA 1CGSL 2JJWA 2JK5A 1U8LA 3AG1B 5CGYD 4Y2DA