4FFTA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with mixed-linkage glucan
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
b'AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
molecule tags Cellulose-binding protein
source organism Bacillus subtilis subsp. subtilis
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fftA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fftA02
1WHPA 2PICA 3M3GA 2PNWA 3X2IA 2AE0X 4FG4A 1L8FA 1OA7A 4AVRA 2JNZA 3ENGA 4JCWA 1BW4A 1OA9A 1BMWA 2HCZX 4FG2A 2KQAA 3X2KA 3X2NA 1WHOA 4JS7A 3X2JA 3CZBA 3X2GA 2G5DA 1WC2A 4JJOA 2ENGA 4FFTA 3SUJA 2GAEA 2G6GA 3X2LA 5GLXA 3FT9A 5H4UA 3SUKA 3D30A 4ENGA 3SUMA 4ZM7A 2BH0A 2PI8A 4JP7A 5GLYA 5GM9A 3X2MA 3X2PA 4FERA 2VXQA 4L48A 2PJJA 1HD5A 1BW3A 3FT1A 3SULA 3X2OA 3X2HA 4JP6A 1N10A
chains in the Genus database with same CATH superfamily
1UUNA 4HHWA 4JFSA 1ZV9A 2WLLA 4PS3A 4AL8H 5DQ9B 3RWCB 3TBWA 4IW4C 2E4FA 5KVDH 5L8LB 1F00I 1WC7B 2P1YA 3L5WB 3I9GL 4MS6A 3TEYA 3LZOA 4LLMA 2DQIH 3TO4A 2VH5H 4L3AA 4TSAL 4D9QE 4YBQD 1NCGA 4M56A 3S3DB 3F7RA 4DTGH 5D6DA 2XU9A 3HG2A 4IIQA 1WV7T 1J0ZA 4M43L 4Y19A 3WIHH 5GZNC 4PCKA 5I9QB 3UAEA 1JPTH 4BKLB 4DP6X 4NBYB 3R19A 5FDWA 1HL4A 4K9EC 4NQDB 1NIAA 2CA3A 5ID1A 1K4CB 1JYNA 3WL9A 2OP4H 1OSPH 3WIFA 1KIPB 1UWEH 4J2QA 2Z4TA 2EYTB 1ETJA 5DYIA 1MFVA 4O51B 5DD3H 4FFZA 5IW1A 2ZSWB 1QABA 5T1MB 1NLBH 3QHFL 4JFED 2HFEB 3PWPB 1J1OH 1QPPA 3UYRL 2QADD 3PGCA 4XNQB 1E90A 4N90D 3IETA 1I8AA 5FB8A 5HHOB 3JXAA 5D1QD 1AGDA 1JHTA 1AD9A 2YA1A 4YDJB 2ZX6A 1CFSB 3GSNH 4PY8J 2EJ1A 1L7IH 1TQBB 1S7TB 4YC2C 3C60C 2VISA 2VERA 1A7OH 1TZIB 4Y1AE 3CN4A 1EDQA 1JZHA 1WEJL 2G3MA 3C60D 3FCTB 3HVNA 4G7YH 4XPBL 5E2WH 3U0TA 2BVPB 2ZSWA 2H0PA 5T1MA 5KWYC 1OF2A 2X53A 3VGDA 1FO0A 3S4SB 1JGEA 5HHQB 4ODXA 3AS0A 4GQPH 4J3SA 4JFOA 4DVRH 3PGDB 3O9WD 3T3PF 2BVEA 4MA1B 4WCYL 5L7XH 4CRYG 2BJML 4DIXA 1KPRB 1ED3A 1MOEA 3P3SA 1XV8A 2CJUH 3PHQA 5IB3B 3DIVA 4X6CE 4E41E 2ZUQC 4RZCA 1PMYA 5AOMA 2ISDA 3ULUC 1WZMA 3LKPB 3Q2VA 3VXOA 1K5NB 4EUPG 1TO5A 2WXJA 3ETBJ 3RUGA 1FZKA 1XO8A 4A39A 3KEDA 4OD3H 4PJBE 1N4XL 1RQ5A 2EVHA 1XX9C 5DGRA 3DBXA 1BYNA 1HH9A 2IGFH 4HH8A 5CO1A 4TSBL 1W0YT 3MNZB 5D8JH 3V6OC 3AQYA 1TPXB 2ESVE 1W72B 3OLDA 4KRMB 2WUBL 5LN4A 1JI2A 3LDBC 1YQVH 2A6HD 3BGFB 3UJTH 4KMTL 3NZUA 3BQUD 2YGQA 5E1HB 3WGVB 4KK6C 2CDEA 2XV3A 3MJWA 3RFZC 3OKOB 3L1FA 3MRBA 1D6VL 5C0BE 1IQWL 2LGNA 3P73A 4B27A 5KSBF 2UWEF 2R0ZL 4JANA 3E1ZA 1XF2A 4R4BA 3WDJA 2YN3A 4ANKA 5E2UL 1WBYA 3N42B 3HUJB 1OWRM 1TTFA 4Q58C 4G82A 4IMLB 4F7KA 4WWKB 5DC9B 4HS8L 4KI5E 3U2JA 3ZBMA 4WAFA 5IB5A 1WLFA 3DV4A 3PF2A 4PYHA 5DD5H 3GWJA 3X2LA 5DUPH 1WBZB 2ADGA 3MBED 2JA6A 2QZQA 2DM3A 1ROWA 3ET9F 2VPZA 4IBUA 2CNZA 3F7VA 3AT8A 3I50L 4MWFA 4KUCF 5C0DA 3M1BA 4LLYA 2BNQE 2N7AA 2A9ML 2BNRA 2YOAA 3ROLA 4TVPH 3VMOA 3QCUH 1S3SA 1RJYA 3COOA 1NFKA 3MNVA 4HKBA 3TA3D 3H42L 1XH0A 3TBSA 2ICCA 2IOIA 1HE8A 2P52A 4NAMA 1HL9A 4U1IB 1EZUA 1ONQA 4KO9A 2FO4A 1RJZB 3ZKQD 3PLXB 5IEKB 4BH7B 1OANA 3HMXA 4PSRA 4XZUB 4UNVA 3S88H 5E51A 1PPYA 3HMWL 4FLRA 2RR3A 5DHMC 3WSQH 4NHCH 5JIMA 2DQHL 2DYRB 1OAJA 5CZVL 2OCFD 5I1DA 1CT8B 1TF4A 5GIRB 4R4NC 2OMVA 3BHBA 1E60A 2PW1A 4HBCL 5JHDA 2W0LA 1BF8A 5BZWB 3TPKA 2XYBA 4B9FA 4H5SB 1ET8A 3NCJL 1A2YB 4ZX3A 2E9BA 1E67A 1AZVA 1PG7X 2HJKA 4F24A 1E7VA 2C9XA 3OHMB 4UQAA 2VLRD 1CBVH 3GXDA 2YPVL 3KPRB 2J3SA 5AW8B 3S3CB 5EC1A 2BP5M 3GM0A 1JZDC 1IEHA 2VDQH 5IHBA 3T4AA 4MLSA 5F7UA 4JFZH 1MCCA 1VPOH 5JO5B 1ZJBA 2XPZA 4U33A 1FNSH 2D9QB 2JKTM 4K5PA 2WLIB 3LNEA 4GAAA 4YC2B 2EXSA 2KERA 2LHAA 3TCLB 3ENGA 4F7EA 1FWXA 1M57B 3EFOA 3UTSB 2GSGA 3MLTA 3KJ4B 1JDAA 3D2UA 5CINH 2A69D 1SDYA 4ODUA 1XB8A 5GSVB 2XNAA 3FB5A 5EZOH 3TPUB 3QUXB 1C7TA 2L7EA 3T0WA 4A2FA 4PJAA 1Q16A 2R0LL 1WA1X 1CXEA 2J43A 5JW4N 3L4YA 1IRAY 1KUMA 4AEIH 5DSCB 1ZA6A 4ODWB 2ZKWA 2EIZB 4Y16B 1A7NH 5FW8A 4V2CB 4M8QB 1KTKE 3WY1A 3FMGH 2GSGB 3MLTB 3BLPX 3QZBA 1DUZB 3SGDI 1QKZL 4I0PC 2HTLC 2E75C 5KSAD 2E9IA 2G3XA 5F8QC 1MCSA 3PL6C 1NDMB 1LO2L 5A6LA 2VN7A 4TSAH 5J8OA 2HLEB 2IOMA 2OLDA 5FOBA 3FQRA 5GZOC 5HGBA 4MMZC 1XH3B 4QI3A 4JX0A 4XGZB 1N3NB 5GM9A 1E3FA 1G43A 5HJBA 4JHVA 2EO9A 2FWLB 3L4WA 1EEYB 4GBXD 4OZFB 2IH1B 1A7OL 1NCOA 3QDGD 4PJFF 4UIMA 4B9IA 3TBWB 1U8JA 1AHMA 5MENE 1IM3B 3K6OA 43C9A 4RRPA 5DA4A 4UTBL 2Q20A 3BUTA 5D7KE 5JXEC 2QQLH 3W38A 2CM6A 3CFJB 2AEPL 2UXVA 5I28A 3L9RA 1QEWA 3FT3B 3H55A 2Q7YA 1VEPA 3V4VB 5A2BA 3PY9A 4NP9A 4QXWA 1J5DA 1SM3L 4X2UA 4LLUB 3RLSA 2IH8A 4F20A 2ZWZA 3N40P 1AANA 3VXTA 2IWKA 4PJCF 5T8IA 4MJJA 1CGUA 3FFDA 1IM3A 4XMLH 4ZAKB 2CUAA 2KBGA 43C9B 1BJMA 3D4YA 3F83A 2YLHA 5F7EL 3BUBA 2CU9A 2ICWA 3OXRB 1B3IA 1EVTC 3D6GA 3ETTA 3CC5B 1S7TA 4JBSA 2B63A 2R7ZA 1BBDL 3KG5A 4GI9A 2CJ3A 4OZGF 5BS0D 1J9SA 4KPHH 1TYEB 5C1BA 4G6FD 3FT4B 5DS8B 3FFCE 1AO7E 1K8IB 5HHPB 5I5JA 4FNPA 4HCRL 1XL6A 2OFQA 3ULSB 4PVNA 5I8CB 1Z9MA 2WXRA 2K6YA 3B5GA 4IIQC 3BQUA 2AXGB 4HUWA 4EUPA 1U21A 1U8NB 3VXMA 3VYOA 1LMKA 3ZT6A 5AAPA 3N42F 4PRHD 2AVGA 1KG0B 5BUGA 4OFQA 32C2A 3GUTA 3OXRA 3S5LG 1G7JB 5C0EB 4LKCB 4F3FA 2VAAA 1DFXA 3INUL 4AYDC 1Z5LA 2WNGA 4PJ5A 2R29A 4I2XB 4UZGA 5DFWH 5J11B 2CGYA 43CAB 4JRYD 1EAQA 2E8YA 5LGJA 1AHWA 3EUDA 4F2ME 2H9GA 4KXDA 3GSWB 1RZGA 2YOCA 2IGTA 3BAYA 1NGZA 2NNAB 3L6FB 1UZGA 4M6MH 3UPCA 5D6CA 1R3IH 3RWHA 3ZTNL 2FJHA 3V5HA 1KCVL 4JDTL 8FABB 2ZCZA 2AQ3A 1ZY9A 3ESVF 4Z7WE 3IF1A 1U3NA 4YNYB 5GISL 4L4VE 2V17L 5DUBA 2CLZB 2VWEC 2ILLA 3SODB 1YECH 3QDGE 3SYOA 4KOBA 4X99B 1IC5H 5IBTL 5INCA 2BOBA 4EIUA 5JDSB 1DHKA 1HHHA 3PE9A 3DPBA 2Q3AA 3EYOB 2UX6A 2GJ6A 1BVNP 4JNXA 5D2LB 1CDCA 5DRZA 3LHAA 2QPUA 4Z3JA 2H45A 1K6QL 3CCHB 3C09C 1FZOA 1OWWA 5HJDA 3WFDH 5FO8A 2R27A 3QUZA 4U6HB 3HN3A 5EU6A 3SGKA 2GC7C 1IAMA 3FCSB 4Q97A 4NZUH 1MCDA 2ITEA 1P53A 3I2CH 3QQ3A 1NEPA 2A9MH 3QK0A 5BV7B 3LH2L 2BCMA 2GY7B 3MRJA 3FH5A 1EO8H 3PGFH 3ARBA 4P57A 2OX5B 1KN2H 4G70B 4MRCA 3BKYH 2HWZH 3NZSA 5KBLA 3UP1A 5FTJA 3RUGF 3VB9A 3GBNL 2APVA 4Z7UB 1JPSL 4R7NB 4KXZH 3IETB 5FB8B 1IMHC 3QH3A 4UV7L 4HKBB 1A3ZA 4NRXA 1X7SA 2HTLD 4GY4A 3GB7B 1PSKL 1R5IB 3SKMA 4TXVB 3S37H 3EGDA 2XIIA 4N0CC 1FYTA 3GPSA 4YL4A 2GTWA 3LEVH 1RZ7L 2E8ZA 1KT2B 2QPSA 2R15A 4JK0D 5JQHC 1F4WL 1XH1A 1FH5H 4RWHA 2YD0A 2EUVA 5LAXA 1YLEA 3L5XL 4GRMB 1ZVNA 1ZK5A 1PY9A 4TUOA 3S7GA 4YMPA 3OC5A 1URIA 3F7YA 2FIKA 5GRUL 3T2LA 4DPBX 1WAAE 4P5TC 1E4XL 5EDSA 3REVB 1GC1L 2Y06L 2NQ3A 4JJOA 4NN5C 4G8FA 2Y2YA 4L4VD 3MROB 3T0BA 4KTEH 3RHWK 1FZJA 2L8AA 2HPTA 2VM3A 1I7RA 3X2NA 1Z9SA 4KV5E 7CGTA 4OFPA 2VLJB 1T0MB 4ANUA 4IQHA 3VH8B 5TPWH 4FXLA 2ZOOA 4HZLB 5D4IA 3ZZSA 2V5RA 1G1YA 1NCIA 4UILH 3DGGB 3VH8A 3FCUB 4HJGA 1DBKL 4FP8H 1IC7L 2OR9L 1MW0A 4JM2F 3QJHB 3DHMA 3LKNB 2MKWA 1HX0A 1PTZA 3N41F 1FNEB 4OCLC 3FOMA 5FYKD 4EUPH 1U8HB 4H40A 2DQFA 4JFHD 4ZFZA 5JPNC 1TFPA 2G60L 5EEYA 2Z31A 4AYBA 1T5XA 3GIVA 3AABA 3ZTJG 2BIIA 1U95B 2XSKA 4JRWA 3HZVB 2IADA 4F7CA 2X4QB 1I7ZB 1YVLA 1ZHNA 3NCJH 1OLZA 3AXHA 1RURL 1KJ3L 3WYRA 4FFWD 3R06B 2FWSA 4NKOA 5BQ7A 4HXBH 3TA3A 2KZBA 1NEZB 3GGWB 3LHPH 4E9SA 3DI3B 4KUCD 3E9TA 3W37A 2PN5A 4GKSA 3CFBA 2VUMA 4LEXH 2UVFA 5KSVA 1E5AA 2FH6A 5FAAA 1LDPL 4WGVB 1LEIB 1P1ZB 1UWEL 1HZHL 3P69A 1YDPA 3N44F 1E5VA 2XWXA 4DFIA 2C4FU 1GXEA 1TYJA 4Z18A 3AWEA 4P3CH 4AYFB 1BM3L 1H0DA 4F5CE 1XR9A 35C8H 1CPUA 4FZEH 3L4TA 4UOW0 1S9VB 2JB5L 4PJAE 3SCMD 1R0AH 4XXDB 1KCRH 4NKIL 3ECUA 2HFGL 1FL5B 1GVIA 3CBJB 4PLOB 2IBGA 4PRPB 1T21B 1WCBB 2XWDA 3DOSA 4OM1H 2FHBA 1IKFH 2A6KA 4B0MB 2ZG2A 3WN5A 3QWRD 1Y0LA 4P2OB 1BQHB 4GFXA 3Q2WA 1MJJB 4NSKA 3JWNC 3TIDB 1F11B 1QFOA 3MUZ1 5D72L 1F58L 4WHCA 2NTFB 1KCSH 1CG9A 1CDUA 4XP4H 5E5RB 3BMWA 1SJEA 3QFDA 4RAHA 3T4AB 3T6WA 3FMGL 1TZHA 3CVBA 1C9SA 3ZGHA 1RUML 1D5MA 4XAWH 2G3ZA 3BEWA 2AK4B 1XGPA 4MZIA 2A6KB 5C2BL 2I85A 3EOBA 3CMOL 2DJMA 2FHCA 2EEAA 2BERA 3ARSA 1VZIA 4K2UH 1WJ3A 2HX9A 2V2XB 4P46B 3HRPA 3M88A 2GHWB 4K3EL 3PL6B 2WC7A 4OV5A 2VM9A 1P2CA 4TYUA 1ZGLB 2NCEA 2EIDA 4DZBA 2FEDD 2GBAA 4NZDA 4AKQA 1EHKB 4E9TA 2H47C 4X7DC 3WJMA 4GO9A 4RA3A 4DGUA 5F7MC 5CD5D 1GIGH 4N3UA 4M8RA 5FO7A 3II1A 4U1GB 1FFNB 3FF7A 4YBHA 3BPLC 2CO7B 4FXGB 5JW4R 3MNDA 1F58H 4C83A 4E9XA 3FT2B 3ATEA 4YFDB 5CJXC 1XXFC 3O9WC 4CVXB 3PXLA 1G7JA 1P7QA 2DQTH 3BFOA 5M95B 3D0AA 2ZCKL 4FQ1H 1T2XA 1I7TB 1SMOA 4MASA 1HKFA 4JQIH 1MXGA 1KENH 3F62A 3VCLB 3U7AA 3IR7A 5AKSA 4Y9FA 1KYUA 4N3TA 3WO4C 1S7RA 5K59E 4CADA 4EDXB 4OSUL 2JQZA 1Q9WB 4MJIA 2GJ6E 4P2QE 2YGNA 3EBHA 2E9WA 4KAQL 3QEGH 4D9RE 5DMIH 4N0FB 2CAKA 4JPIA 3QCUL 5DVNA 1RMFL 1JWSA 3CXDH 4UTBA 3L9RB 5IW3A 4YN3A 2C3VB 2NTFA 1I85C 1D7FA 5KYWB 1WDAA 4WI3A 1J86A 5E94B 4KZDH 2FX7H 4NO0B 5KYWA 1P4IH 5H2BA 4O2FB 3WUWB 4HWUA 4LLUA 4NNXA 4NCDA 4ELME 3IF1B 3J2PA 4OLYH 4YNYA 3FNKA 1QHPA 1J05A 4HVBA 2ZPKH 3WLWC 4AGQA 2D7MA 3AC0A 5EWIL 2EAEA 5E6ZA 2Z4QA 4N22A 1TJXA 3T2PA 4ORGB 5F71A 4HCIA 2BSTB 5IF0A 4ZPTA 1F86A 4ZBJA 1ZLEA 1VZGA 2WVVB 3QFGA 5CP7A 3BAKA 5E7BA 4C56B 5IGXL 1U8OA 1ETB1 4Z7WF 1ITBB 4NQXA 4GO6B 1OTSD 2Q86B 4H25B 4PHXA 1KPUB 1C5BL 1ETA1 1IFHL 4N85A 3TIEA 4BDVB 1ZWIA 2GSIA 3TEWA 4LT7A 4NQVB 3VVWA 1FDOA 1DDTA 3T4AC 2YJQA 2ZF9A 3DX9A 1IARB 4YXLH 2AJSH 2X4TB 4AJ0A 2BVUA 2WCGA 3CFKB 3EIFA 1SN0A 3DV4B 1KSRA 1QO3A 2Y7QB 3VQ2C 5A2IH 2QSCH 5DHDA 1A14H 3TOPA 1TPXC 1RLWA 1OF2B 1KPUA 2J8UE 2JB6A 2YRPA 3A21A 3BKML 4QXVA 2W9DH 4H8PA 3VRLF 2CRZA 3TO2B 4P0DA 5CINL 5ICYB 3ZL4H 4KTEL 3SDXA 3SKNA 1H3XA 4Y4KB 3BP5A 1CBVL 2X3CA 3A5VA 1RFDH 1AVAA 3CFKA 3JWDC 3ULVH 2Q2LA 4I3SL 1KJ2H 2KUTA 3BMVA 4LPWA 3BWAA 5FA3B 1A3RH 2CG9X 1ORSA 1S78C 3B7YA 4LP8A 1M56B 5ITFA 2QDWA 3N0AA 2GJ6D 4YVNA 4P2QD 3AREC 1YN7A 2HJKB 2AMGA 3BGMB 2IVFC 5E94A 4BZ2A 2N1TE 1QKZH 1IJNA 1H3TA 1L7IL 1RU9L 1GOFA 2F5BH 5BZWA 3CCHA 5KVMC 1T6WA 3QJHA 5E2WL 3RB5A 1S5IL 3RUGE 3OKEA 5AZEH 4BELD 4JEGB 3CH8A 5C0CE 3QZWG 1A14L 4CSPA 4GUOA 1FZMB 4BM7A 3W9EA 5EORL 1QW9A 3H4FA 1FDLH 4WW1A 2IQ9L 5JPNB 4BINA 1M7IB 4XMZA 5KYYB 3QWOA 2EDKA 4FXGC 1AIZA 1NC4D 4MXQD 1FG2B 6CGTA 4J3OC 2PICA 3FO1A 4D7ZB 3NSFA 4HWEH 1EVUA 4P5KA 5DJCB 5MERA 3OMNB 4NKQB 5EA0H 3L3IA 2ATKB 3O6FB 3QDMB 1T1WB 2OKMA 4M8UA 4PLJC 5AZ2L 2JTDA 4K8RD 4PJIE 4XN2A 1I75A 4FGMA 5LO7A 1WK0A 5D1ZB 3T5WA 5I18H 3QISA 1ECYA 3KLLA 3RNQB 1KB9K 4P3DB 5FYJL 1RAMA 1DJXA 2IAMD 4XMLL 2GC4C 3KPPB 1IKFL 3L13A 1MPAL 1WFMA 2X4QA 3ATDA 1CVRA 2VH5L 3UO1L 1RJYB 3K3QA 2G2PA 2ORBH 3ARGC 1DBKH 3KNBB 3MMEB 4ZO8A 1KTLA 3M1BB 4GRWE 2R0ZH 3S0PA 4PGDA 2GYSA 3VFWA 3F5WB 4W9LC 2L7QA 4NFBA 4POZD 3MUHL 4RSYA 1YUHB 1HSBB 3RNQA 3US9A 4OZIB 3B4NA 1V3LA 3MYJA 4GIPD 1XTLA 2F54B 3ATBA 1S9YB 3QRBA 4XH2A 4AGLA 5LWYH 4GIAA 2VDKL 2UWEB 5CUSH 3LH2H 3W56A 1QSEB 4I3RH 4HOZA 4OGAC 1GYCA 4IU3B 1MJ7H 4WW2B 2R9HD 4DETA 2BE5D 3WIIH 3I9PA 2JI1A 2I27N 4KHXL 2X1PA 3FU5A 1BBDH 4U1SA 5JHDB 3GLAA 4Z95H 4NQEE 4X6DB 1D5IL 2EQDA 2RMNA 1PLCA 3PWUB 4P9MH 4UQ2A 4X4MA 5HHNB 5T1DH 5KBNC 3BIAX 3DUSB 1J0KA 5AD0B 4YQXH 1TO4A 2V3VA 3QUYC 4Q7DA 2EP6A 1E9OA 4M3HA 1PSKH 2HT4D 3WI9A 5I8OH 1FJ1B 3C8DA 4R6UA 4DVRL 1C1EH 5L2KE 1P4BL 3QFDB 3IJHB 1KJ2B 2VJ0A 2G5BA 2GJZB 3MKGA 4RDQF 4TNFA 3EJZD 1TTGA 4MJ2A 2Y25A 3QIWB 3C09B 2VC2B 2ZKMX 2MQCA 3UIZA 2BSCA 4OUOA 2AEQH 3P77B 4HIJA 1A64A 3UTZA 6PAZA 5GGQL 2VXTH 2FX8L 1PLGL 3WKQA 3RVWD 2NY3C 2FNBA 3Q2NA 4FEMA 3TYGL 6PCYA 5FFGA 4PM1A 4K94C 2Z3FA 1ORQA 2MCPL 5DEFA 1AD9B 3C5SB 2CCLA 2KI8A 1HI6B 1N64L 2QADC 3O3EB 3R06A 4PJXF 4WFHD 4JFDB 1BD2D 2XCMC 1AS8A 5IQ7H 5ENWB 4LLDA 3R4RA 1Z1WA 4KAQH 4HMCA 2GJPA 3QXUA 5JR1L 4XPHL 5HYIA 1FLRL 2BVPA 4K2UL 4K7PX 5I26A 2WB1A 3ELAT 5AW7B 1RHHB 4HV8B 1MFAH 3FUJA 5B1KA 4XTRD 5DMKB 1MWAL 2QGEA 3DUUB 4YHPB 3ZXAC 4H20H 4NN5B 1XZ0A 3SE8H 3RIFF 2EDYA 5CGYD 4RGMC 1FL6A 1UQSB 1Z9LA 2VN4A 5L8JB 3KJ6L 1KBKA 4M61A 1I1YB 4PCTA 3WHXA 4BE6A 1F3JA 3IAPA 1G7HA 4Q0XH 4U1KB 1TZHB 2WWOA 5INCB 3X13B 4AQ1B 4BXVA 2CO4A 3ATFA 4N6RB 2Q76A 2FJGA 4LRNH 2BY2A 1QTYT 3BESR 3IGFA 4U2YA 5T5NF 1S4IA 2FSEB 4X7EC 1MF2L 1HXMA 1PKQB 4ZPTB 5B7EA 2QQNH 1GCYA 3IFPB 1SBSL 3MZGB 4Z3EA 3ZYJA 2DIEA 2QADB 5FDYA 5JR1H 1JZ6A 3SEPA 4DZ8A 2CRMA 1Y07A 5JDSA 4AEFA 1A4BA 1GMIA 3FT3A 3GXFA 3S35L 5I6NA 5SWSA 4DQAA 3H9SD 2EIEA 4CBPA 1GC1H 1FDIA 2Y06H 1ZTXE 2WZPA 5IHUH 4HAGA 3SDCA 4OLZL 4PWFA 1M2OA 3OVUB 4OW6A 2IAND 3ZE1B 2FBRA 2QDVA 2BY3A 3LEVL 1EO5A 4HALA 3IJ9A 3KYOA 4MVBD 1URZA 5E9DB 1CICC 3GMRB 3QH3B 2CSPA 1YG9A 4OJAA 4JG0L 4DUVA 3GTKA 2PP9A 2ZWNA 1ZLVH 4U05A 2Z34A 3EJTA 4GKNA 1AGFA 1A5FH 4M43H 3WIHL 3FT4A 5DS8A 1KLFA 5DRWB 1FP5A 5F1NA 2GTZA 4PJGF 5I19H 5BMFL 2HFEA 5GZOD 4PWHA 4PWKA 3SQBA 5DI8B 1AZBA 4FQ2H 1OE2A 3LXAA 1G7IA 2NY6B 3AREA 1XF3B 4IRZA 4UANA 4EDWH 1EEQA 4X6BA 3OJ2C 4UT9A 3VFTB 1CFQB 2P26A 3FQNA 4NI6A 3UYRH 3FFCA 5HPMB 1LILA 4IRZH 4IGBA 1DVTA 1PIGA 3FJTA 1F1DA 4B9YA 4QO1A 2DJ4A 1RL1A 5SV4A 2HLAA 2DLEA 1FH2A 2NZ9D 1MCPL 4XP5L 1CLYL 4L8SC 4EN3C 4HCRH 1H3UA 1QZNA 3ES6B 3DXAD 3L3KA 3LPFA 4XHQA 3IR5A 3NIFB 5EUOF 5D7HA 2QVMA 3DYOA 4GA5A 1HH9B 3DWTA 3FUMA 3HI1B 2CBPA 1KCUH 4UYQA 4XC1H 1SYVA 5B21A 5MEPA 3QPQD 3W9EB 5I19L 1Z9PA 5HP5A 1U8CB 4UQ9A 5GGTA 3V4UH 4IBLT 1WA2X 2O26U 2DQJH 3I6KB 1NTDA 2JELL 1AI1L 4ZNCD 1FC1A 4NJAL 5DYFA 3V0AC 2JI2A 4OZHA 4QHKI 1E28B 3V5DA 2H1PH 5HYJD 3QG7L 5DMGD 4G7YL 2E7MA 2HRGA 2IALB 4NZTL 1YEDA 4DK5A 4RA0C 5DVMA 3ECWA 3BZFB 5GRWA 1FC2D 2IANE 3OX8A 1MCQA 4Q89A 4JPSA 2GUOA 3DHUA 3NJNA 4EIZC 5F9JA 5C2BH 3QNYB 1MCPH 4KNUA 4XP5H 1Y7VA 4H0LC 3T8VA 5KG9B 3UJTL 4YE4H 4FQXC 2XYCA 1XEDA 2W5PA 2NZIA 1UA3A 4C2MA 3PAUA 3CDGB 3QNZA 4P4KB 3TWCL 4K4KA 4N0YL 3ILDA 2R2CA 2X6VA 1Y6NR 2WQUA 1G6RB 4WI9A 1BF2A 4PJDF 3BP5B 4UTAH 1Q4NX 1DO5A 4ZMVA 1UB5A 5CSZB 5ANMB 1R5IA 2NY6D 3OF6A 4WO4A 3TV8A 3VWJD 1JV2B 2B9AA 5F89B 5I73B 4XMVA 4NRXB 2NY2D 5IBLC 3EJJX 5EWIH 2WKOA 2E59A 3Q9QA 1O7DE 2WO4A 2DWSA 4J28A 4ELDA 1O5PA 5L4IA 4ONFL 4ZMNA 1D5IH 5HHVH 2NY7H 4JW3A 5D2LF 2JE8A 1PZBA 4ZDHB 3TONA 4H8WC 2IMNA 2R4SH 2XBZA 4Z23A 1OCWL 5FLUA 2J2ZB 4BH8A 1NDGA 3LV3A 4NBXB 2BZ7A 2ICWI 3GJFK 4WIQA 2O61A 1S5HA 2EIMB 4IDJL 3C8KB 1B0RA 2BVTA 1QNZH 2F1AA 1U8JB 4IKJA 4Z7NF 2WZ5A 4OY9A 4OZHE 5F7NC 3DXAE 2P46B 3IFLL 3K8MA 3TU6A 2Q5BA 4L4VA 4F7MA 2D03L 1V3KA 2QSCL 3V4VA 5E2JA 3SO3C 4JHBA 4PJDB 2FX9L 2XWZA 2OMYB 1CL7L 2VLKB 5ESAA 4LRIC 4KROD 1RP9A 4APQC 5ADOH 1JVOA 1ODUA 5A2FA 3VO0A 1EAJA 1LE9A 3I74A 1D6EB 1NFAA 3G6AB 2R4RH 4KQ3L 1YNLL 2Z64C 1S9KC 1C7SA 1ZSDA 4KO6A 2XKNB 3UABA 2B1AH 5EF3A 5KSBE 3II3A 5EOTB 3T3PE 3SDDD 2NXZD 3APMA 1YMMD 1BIIB 1DO6A 1AOZA 1ZRUA 1R34A 5TGBA 2R69A 2Y2TA 4P4KD 3BGFC 1R17A 3N1GC 1S9WA 2X7LB 1KLGB 1MWAH 2B5IB 3VTTA 4IOFD 3OWRA 1UJ3B 1YEEL 2WM0A 5C07E 5I76B 2YAQA 3GGWA 4WFGD 1NFDF 3M7FB 3VFUB 7PCYA 2XWCA 5A2AA 2XG5B 3FB7B 4C47A 3RGVA 4TNEA 4ZX4A 4XNQA 4OCWL 2V5SA 4ZQKA 5J56B 2DEYX 4HV8A 1IU1A 5SX4I 4YQXL 3TVMA 5F8RC 4LAJH 1EPFA 1GYWA 1T0OA 1YDPB 2DQIL 3CQFA 3IRZA 4HIXH 4YIQA 1CDJA 2AE0X 2BNQA 4NGHH 5I74B 5I6XB 5JTWA 3SPCA 2WJ7A 1AACA 4POZC 3CBKB 1F56A 1MY7A 3RZWA 5ENWA 3MXVH 3VXPB 3O45B 2RB8A 3CFQA 4YHLL 4Y2DA 1D5BA 4IKKA 1RP8A 4XN5A 4AKPA 4FZ8H 1F6LL 4OD2B 3X12A 1Y1UA 3KR3L 4FNLH 1XBDA 4L1SA 5E2VL 2OXGA 4BZYA 1JXFA 4XVTL 4P8QA 1RUKH 2DQUL 5HDBB 1KJ3H 3TXAA 1QLFA 4YLQT 3VXUB 5CIPH 4N8CH 4NNXB 5AWNL 4HXBL 1HHGA 2FUTA 3ECBA 4ERSL 2ROYA 5ABDE 3Q3GB 5ICUA 2NPLX 3ZGIA 3DVIA 5I6OA 5FHAL 3VYNA 4N2NA 3F00A 1RV6X 2B1HL 5SWSB 4ZNEE 5IFAL 1T4KB 5DK0A 5ILTL 3BUPA 2HRHA 1AHKA 3RDTB 1EWHA 1PJWA 4JL1A 3RYMA 3EOBB 3WTXA 3V4VL 5FA4A 5KBMA 4LESA 2WN2A 1LWRA 3G6DH 1A1OA 3AG1B 1NUDA 4OIIH 5JIHA 4F7PB 5C71A 1PKQA 2R83A 3V6OE 3SDAC 1G9MC 5I0YA 4NKIH 2V5YA 4BA0A 4GA6A 4LOVA 2DWYA 1TWCA 1M2VA 2VDNL 2YD1A 4NHCL 1XDTT 4PRHB 2BHZA 5I1JH 1W0VA 3PWJA 5FUOH 4XBEL 5I66B 4HCGA 1SF5A 4KX9A 2CK0L 1FQ9C 2I60L 2IBZY 2EDBA 1YMME 1BJ8A 1E4XH 4UMGA 2K4WA 3KPQB 3TBCA 2VW4A 3QHTC 3FUEA 3OKNB 2CO7A 4FXGA 5GGVY 3TEUA 3VXRD 4ZI8A 5C07D 2YFOA 2AXWA 3ALWA 3SDXB 1RSYA 4JFQB 4KKNA 4KO8A 4FF9A 4IM8A 5F7LB 1IL1B 5C08E 1MG2C 4HJEA 2NUPB 3T3MF 2VISB 2BP8A 1QBML 2KDYA 4UUJA 5DQDH 4D7PA 1CFTA 2P5WE 3W5NA 3WEBA 3S2CA 4N2CA 1V7NH 2IXQB 1M05B 4QTFA 1YY9C 2H26A 3MJ8B 4C58B 1UURA 1A0QH 5GS1A 3WTTA 4KRLB 4QYAA 1YY9D 3VFMA 3UAFA 2YPVA 3KXFE 4U6XB 4PR5A 4MCMA 1HE7A 1L6PA 4O2CB 4TLUA 4J27A 4Q2ZB 3TWCH 5I1JL 3IMWA 4W9FC 1MW1A 3RDTC 3LRLA 4CILA 3MX0A 4HS3A 4PS8A 3DNKA 4QWWC 5JIIA 1ZVSA 4LSDA 1RZKH 2GIXA 2VL4A 5CEYA 2X1QA 4F2FA 2YXFA 5DQ9A 3RWCA 3UAJC 4YHZH 5A2LH 3N6YA 2FIRT 1D5XA 3BGMA 2CLZA 1DQQA 3D50A 1MREL 5TQ2H 3P2BA 2BXZA 4OFIA 2GI0A 1VFAA 4KPHL 4BFBD 4M8VA 5ERWB 1MDTA 2DLGA 3Q43A 3MA9H 4UAOC 5B3NA 1LJMA 1YYML 2BOBB 4YZWA 5AL0A 1W72H 3C60B 1A21A 4J1UB 1AY1L 4NQEA 5KTEH 2WQ8A 3G6JB 1S8DA 3UO1H 4NUMA 1N5YL 1W8NA 5JQIB 2QR0A 2JQMA 5LN8A 2IDTA 3H2WA 2DOCA 4OCRH 2Q0ZX 1JZEA 3ULVF 5CKGA 5AEAA 1R33A 3CSPA 1BYOA 4F33B 1VDGA 2YMXH 4WCYH 1HOCB 3TN0B 4G8IA 3UTPE 3Q0HA 5I74C 4CN1A 1BYPA 1KN4H 1DYZA 3U4KA 4LLYB 3NIGB 3ROLB 4EI5B 4S1SH 3RNKA 5I23A 1AOHA 4DGVH 2YK1L 2Y5EA 3RJQB 3DJSA 5I1IH 1ID2A 4GUCA 2C9VA 2IC2A 5ISZA 3PCYA 3PPSA 2IWFA 1BQ5A 5DMYA 4JRXB 3ZMNA 4X6BB 3D2UD 3VXRE 3GIZL 3EFDL 1SYSB 5IOKA 2WSPA 1JZ8A 1KTRL 1SNRA 2XJLA 4FRWA 5CJOL 3SKMB 2OR8A 4PWIA 4X8JA 2PF6A 3BZ4B 3GSNB 4HFUH 2FX8H 4AKOA 4ZUUA 4XMKL 2ENYA 3OB0K 3X2GA 3LQAL 3HI6L 2OPCA 4OKVB 4M48L 4NZTH 3L95B 3PQYE 4XT1C 3EZ8A 4UCFA 1TENA 3TZVC 1A7QH 3BKCH 3X3FH 4DPRA 5FFOA 5C86A 2X4PB 3L9YA 4LHQB 5FYLH 4RNRB 4B7IA 1DQJA 3RQ3A 1E9QA 4L3EE 2YD6A 2IBBA 4KQ4L 4WI0A 1MELA 2LQRA 1WFIA 2RCSH 4FXKA 4GIOA 3RGHA 3X3GH 4WWKD 3B3IA 4B50A 2VO8A 4HC1A 1PLBA 4HS8H 4LPUA 2A99A 3CHQA 4NENB 4O9HH 3NEEA 4PJHB 5BZDB 3C5ZC 5BV7C 4WU5B 4ZXBB 5HYFA 1YEWA 4ISVB 1W16A 3MFGB 2P8MA 1BQSA 3CHPA 4QT5B 1G7QA 5GRYA 5ICXB 4AIEA 4ZMYA 3KHOA 1FZMA 4Y8DC 3INUH 4GYBA 1XGTB 4PG2C 4L0ZA 2XQ0A 4HWNA 4LLQB 5DA0B 1GAFL 1FLRH 3GNML 3PWNB 2VITA 3KR3H 4FNLL 4LGSB 4NC1E 4OD1L 5F3BB 4M6ML 3GXMA 4TNVK 15C8L 3D85D 2FGZA 1ZGLM 3FOLA 4BZ1H 1FNAA 1EQWA 2VKWA 4HWZB 5DHEA 4Z8FL 2DAVA 2QQNL 4PV8A 2HVJB 1QSFB 4KK8D 4F80A 3MGTB 1VZHA 3V6FB 2E6JA 3GEFA 5DLMH 4LVHC 1RU9H 4B53A 3KJ6H 3VJ6B 5IBTH 3ZX1A 2PTUA 4JFYA 2HKFL 3CK0H 4M7ZC 1I7UB 1PY4A 4F5CA 4IHOB 3MV7E 2G5RA 1CXLA 2ZX8A 2XVLA 3SYPA 3QRGH 1H6FA 5C0AD 4EMZA 2A5UA 3H7LA 4QHNA 3UOAB 1UB5B 5CSZA 3VH8G 3DSFH 3GZPA 1ZA6B 4ODWA 1OP4A 3VXMB 1F4HA 1SHXA 2J2ZA 4BH8B 4G9DB 3R7QA 1CL7I 4GB9A 1N5AA 5T5FH 1YN6A 2E2HA 4BEIA 2WLYA 3HCVA 4M6AA 5B6CA 4LO9A 4JAMB 5E9AA 3PGFL 3U82B 5DMKA 1J8HA 4PJXE 2EXTA 4F92B 3QEQE 2F54D 5D1ZI 3KL5A 1E18A 3MRGA 2V6HA 1KB5L 3L3OC 3NT0A 3B7UX 3QJTB 4R7LA 1EAPB 1DQLL 3GMLA 4MAZA 5L6YH 4F15C 1UXWA 5IWLC 5J06A 4YE4L 2Q2EB 3RL1B 2WLLB 4PH8A 2WOYA 1U4FA 2EDQA 2YFNA 3RIAF 2JIXD 1AP2A 2FATL 3QYCA 5DUBB 1SQ2N 2YAPA 4Y19B 1RK7A 4Y4FB 1BZ8A 3U4BH 4Z3GA 5IV2B 5EF1A 4LAQH 3MV01 4MZ2A 3UXFA 2OS7A 2R0WL 4NIKB 2NYYC 1S6NA 3RVXD 3PWJB 1YEGH 3OLEA 4AQZA 4BIKA 1D2OA 1FRGH 1SJEB 1CXHA 1M2VB 2PO6D 1CBJA 3QQXA 4GXFA 2BMKA 3GXPA 3G5ZB 3FZUC 4G8EB 2NY7L 4OUUB 1RUKL 2E74C 3ZKND 1E6JH 4NRYB 4M93C 1W15A 2OA9A 1BM3H 4MBOA 2VSMB 1U41A 4KHTH 4KDTA 1DCEA 3N9GL 4U1LA 5ISZD 1GTFA 4Z3FA 4YFLF 4PJ5D 5BRZD 1U3HC 3G6JF 1A4KB 1R3JB 2ZKHH 2VQ1B 2YC1B 1YYMH 4M7JL 4UILL 3MLWL 4N2GA 3MBXL 4H2CA 4JFOB 3LCYA 4G2AA 4AM0B 2XWTB 4GI8A 1U33A 3APCA 4OLEA 1I53A 5MEQB 2QFRA 4CVXA 4HIQA 4S10A 3WS6C 3DO7A 2D7TH 3MXWL 1NGXB 4XN9A 4KZCA 4Y89A 3KPSB 2AQTA 2MH4A 2CHWA 4W6XB 3K74B 4KX8A 2H4EA 4RCAA 3UFIA 5B8CB 3VXPA 2CCVA 4MNGA 3TCTA 2J12B 5FYKU 4AC2A 1NFIB 4MB3A 3OR6B 5SWZE 2F7QA 4NM8L 3T9WA 2YPKA 1X5JA 2B1AL 1KB5A 2P7TB 4GJTB 5DD5L 5KTEL 1WHOA 1IGYB 3PAZA 3V0GA 3NEXA 5IBUG 4F27A 4QD2E 3WUWA 4Q74A 2Y1AA 1ZT4A 1ADWA 2LU7A 2V5TA 1L5GB 1QLRA 1S78D 4WWPA 3GBNH 4YPGB 4X6CF 3MNZA 5DLLA 1U92A 2YMXL 3NCXA 4GSXA 3V6OA 4Y4FD 4TUUA 4PB9L 5GGSB 3TJHD 3V52H 2DM7A 2J1YA 4JO8A 1NDTA 4N0FA 5EO0B 4YAQA 1CF8H 4L3CA 2ODIA 1NUGA 4YAQB 4K94H 3RDTA 3SE4A 1XHHA 1Z9OA 3L5IA 3BAWA 1MZYA 4O2FA 2YUWA 3OPZL 3RGVC 1QLEB 3L3OB 5IW6A 1EXGA 5MEOA 1HHJA 3B3BA 1Q0YH 1J9TA 5CBEA 1UACH 3IDMA 4L4TD 4Q9QH 4JS7A 3TJEH 1TCMA 1WH0A 4DK3A 2ZYSA 5F97E 4KK9D 1ASOA 5AW1B 2XZQH 3VWKA 2EEXA 1ZTXL 4M7LL 1IV8A 1TT6A 2OSLA 4KOCA 4MCZA 4UQDA 4NKDB 2ICWJ 4FFVD 4TNWF 1NPJA 2R0KH 1LP9A 3MNVB 1I1FB 2NY3B 3U6RA 4WEBH 1YY8B 1RULH 1BIHA 1UJTA 1UGNA 5G2NA 3S35H 2XZAH 4EXPX 5CLZA 4KNTA 1F4XL 2F7IA 1KGUA 2AZUA 4WRLA 2B4CH 3PWPE 4N87A 4M1CC 1HU8A 2DDQL 4V1DA 3P30H 4KZDL 3WLWD 3GSUB 1CTNA 3O11A 3CDZB 3EOTL 1HK6A 1O7SA 2HSIA 3DHJA 1HHIA 1CL7H 3O11B 4PREB 3QR2A 1Z3GL 5CP3H 5B1AB 3A6BH 3IN0A 1JI1A 1LO4H 3OD3A 4GNKB 4JY5L 4XBMA 4WWKC 3O5AA 4HEPG 4QR7A 2JSFA 4XPGH 1WZKA 4AVJA 5LG1A 2H6UA 3GLEA 1YMHB 2B16A 3O9WA 2HN7A 3T1WA 3DBSA 5CJ5A 4JHAL 2R1WA 1QD0A 3ZE0B 2Z93B 4NSKB 1CUOA 4LNVA 3CFNA 3OKDA 3WKML 5EZIH 3OXSB 3CZGA 2CD0A 3MOBH 2FJSA 4PTUB 3S97C 1JD9A 3MLRL 4N6QA 1E0OB 3BAXA 3K1DA 4G5AA 5KVFE 5CWSA 5AOZA 5T5MD 1T0MA 1ZANL 2AERT 3KAAA 3WNOA 2P5EE 3NIDE 4X98A 3CK0L 4PJBB 1AYOA 2J7LA 2UUDK 4ERSH 3RVUD 4NQSB 2X0WA 1A7QL 3X3FL 1A6VH 3QFJA 3QORA 1UKQA 4PVLA 4BQBA 4NWUH 3BP6B 3QVAA 1XGRA 2ESVB 5FUCE 1G0XA 1ERNA 3RHWF 5CHNA 4QUOA 3I9GH 3DJRA 4LCIL 4AAYA 2DN7A 1T66D 2OMTA 2V5MA 3T1FA 3ZDXF 3Q13A 4I1PA 2DLFH 3VFOA 2J1ZA 3CSGA 2VUKA 2X87A 5C0BB 5C0RH 3RWIA 3DOHA 4IGBD 4ALAC 2VUOA 2YO3A 1FDLL 1ZJAA 3OLIA 1KB5H 4XHJC 4R90L 4MMXC 4HLZG 3A47A 3SDAD 5F7KC 5FUOL 5C1MB 3N1PC 5CJBA 4MAYA 4UM8A 3CFMA 1KIRA 3KGUA 4DFHA 1YYLH 4N0UE 2XV6B 2F5BL 2DKSA 2IBZX 3LZPA 3MJ9L 3QJSB 5DD3L 2H1PL 4I0PD 4IHOA 4XH2B 2XWBB 4LDEB 2GK0A 2X9WA 4ZD3H 3Q01A 1A7RH 3PREA 4PREA 4Y2DB 2QSTA 2ZOLA 3RTQA 3PS6A 3BWZA 4XO9A 2ZX5A 4JDVB 3ZW3A 2GK0B 4OKVA 4X7CC 3EADA 2EVIA 1A6VL 1OY3B 4JZNA 3WFBH 4BQ9A 1T03L 1JL8A 3HLKA 2ZUTA 1HWHB 3VXQA 4RMQA 5EU3B 3WE6A 5DRXB 2ZOTA 4FQIL 5HHXH 4JKPH 4MDJB 4CJ0A 4X6FA 3MCYA 1WEJH 1L4IA 3RVVD 3K6SA 2WANA 3OGCA 4JKKA 3QNXA 3U1PA 4XR8C 1GY2A 1G0YR 4E41D 5L88H 5E00B 4NCC1 1SIWA 3L4VA 4OJYA 3FUHA 4UB0L 3RWJB 1TU2A 5SX5K 1TWHA 1UWGH 2NY0C 3MOAL 5CWSB 4AV4A 1OGYA 3MTXA 4LOUC 3DGGA 2DY2A 2GJRA 4GQ9L 1NAMH 5KAQG 2NCMA 3TEZA 5HHNA 3VGAC 2HT3D 5CIPA 3EJRA 2O5ZL 5J6HB 4OFYA 5J6GB 2Y6SD 2GBVA 1FVEB 4DSYA 4HU8A 2ESVD 1D6EA 4XMKH 3ALXA 1IGTA 2HT2D 4XNDA 1DVSA 3MU3A 2R2BA 1EJOH 4KKCD 3D9AH 1IGCH 3EUUA 4F9PA 3WMPA 4JZJB 4X0NA 1ZLVK 1EGJA 4EBQL 1BEYH 2GAZA 3AT0A 1CN4A 1I1AA 3QC5X 5DEZA 1Q1JH 3BQUC 1E32A 3CG8A 3U48A 4D8OA 3M7OA 3QB7C 4XCCL 3NFSL 4YZFF 5D7IB 3SOBL 4Z1PA 5B38G 4MJ6A 3STLA 1YNKL 4KKZA 3ULUE 3IDJA 3B2DC 2NX5B 5AKRA 4PJ8D 5BRPA 2HH0L 4TLKA 3MRQA 3MPCA 4BK5C 3TA4D 1WD8A 4YIQB 3MDJA 4GQ9H 4JFQA 4LVNC 5IQOA 5LVEA 1V5JA 3FQ4A 2YEQA 3QXTA 3HRZA 4L29B 1TJGH 1A6AA 1V8HA 2QSVA 4YK4B 3NEOA 2MQ0A 2X6CA 1BVLB 2Z92A 15C8H 4K23L 3TGXA 2BNQD 2QVFB 2XPGA 1MFUA 3OAZH 1Y1DA 4FLQA 1MHEA 3TO4B 3VFVB 2P8LA 4A7GA 4CMHB 2YAEA 2UYLA 2A6ED 2WIMA 4XMPH 4LBEA 5G5DB 1PJ9A 2VCOA 1RULL 5DEGB 1FORH 1UH2A 4DGVL 4HF5L 4AGNA 1F4XH 5IVXE 5BO1L 3ILQD 4QOKD 3CVIH 4K15A 2A6IA 3ESUF 2HKAA 2C9UA 1G9NH 2OL3L 1H19A 5CCKH 4LSRH 4HIHB 2PI8A 4U7MA 4AV5A 4OM0L 1GSKA 3NCYP 5HI4D 4APXB 4ZMPA 1JF1A 2QJDA 3I75A 4UYPA 5EEVA 2AQ2A 2D4DA 3GRWH 1OA7A 2Q7NA 4AW7A 5MENB 3U36A 5E6IB 5FIEA 1Z3RA 3S5LB 2VLRE 2NLJA 3KGRA 3O2DH 4RGNC 4DEUA 3H42H 4OGYL 4U1HA 3G04A 4LGRB 1N18A 5ACZB 1UFGA 3FQTB 2CIIA 2HFFA 1TG8A 5HGAB 1NOAA 3BSHA 3CD4A 5E03A 3QEGL 2YWZA 3FQXA 4P5TB 3OZ9H 1AC0A 2DYSB 3HKFA 4OQTA 5MHSE 1XCTA 4FKKA 1HQ4A 1H5BB 1MG3C 4XBPB 4Z6AT 2B08A 4ZUUB 3ULUD 4LKCA 4QXGH 4F3FB 2DRUA 1W0WA 3KLHC 3K8LA 3EDKA 4B3EA 3W81A 1QNIA 3U0TB 2WYIA 2GQHA 4QYOA 5C8JA 4AM0A 2VWEE 5IJVB 1SYSA 3ZL1A 4R2GB 2R2HB 3CN3A 1EK3A 5B4MC 2AF2A 4G8GD 2P9RA 2AJUL 5DRWA 4G72B 1WWWX 3FFCB 1HHKA 4GG8A 3VMPA 3BVVA 3FQNB 4KITB 1DN0B 2AZAA 4LOFA 1CIDA 3KLQA 3VFSA 3MLRH 2W0KA 3H9HB 4L48A 5FGSA 3SKJH 1INDH 4G6AD 2VXQH 3P9MB 4YXHL 3RJOA 3T0EB 4HUVA 3LN5A 3VI4E 3ARBC 3RB7A 4N2IA 5MP6H 2X6UA 1TCRB 4QPEA 3ULVD 5HYJB 3VI3A 1BZ9B 5JHMA 1MFBL 1KBGH 4KODA 1FE8H 2A2QT 3D5OF 2X1XR 3RP1A 5JW5A 4LFHD 4M7JH 4LCIH 1NBYA 3EF7A 4HZ1A 4HIHA 3TH4T 1IT9H 1FNGB 4HA1A 4KUZL 4ZUSB 3PAVA 4KDTC 4QT5A 1EXUB 2V7HB 5DZAA 4DPAX 3PWUA 4UQ2B 4R3SA 5DZVA 2W9EH 3VWJC 2NY4B 3L1EA 4KRPC 4R8WH 3QFJB 2FEDC 1UYWL 5HSFA 5CU5A 3F6JA 5D7KD 3IAQA 2A9CA 2P43B 1CD0A 1SJVA 3HPJB 3QWOB 3GO1H 5FO8B 3B56A 2KZKA 4MMXA 3EO0B 1BQHG 4PIRF 5EOCH 1FNGA 2JKWA 3BRGC 5D2LE 2FK9A 2VJ8A 2R0WH 4A7QA 5JPMA 1K8DA 1MQKL 3CZNA 4HX1A 3VU2A 3ZO0A 4APQD 3CSTA 4N2OA 3CZEA 2KLTA 2Z31D 1SM3H 2HVKA 4EZJA 5DZ9A 3VI3E 1ADQA 3NRFA 5GSVA 5JQ6H 3DGCR 5LJYH 5GS0L 3HI5H 1JZ4A 4WWOA 2VM4A 2BNRB 4AGOA 2O6EA 4ELMB 3BW9A 2ATAA 2Z7ZA 5FKPA 1HWWA 2VZ3A 2JTYA 2O4EA 4KUZH 5ANMA 1X9LA 1WIUA 1GW0A 1AZUA 1CGWA 2VDNB 1OB1A 4MMYA 2DV6A 3D0VB 1AC6A 1LE5B 1ODAA 4FMFA 4MS8D 3KPNA 3WN5C 3R4DA 5D7LA 4R0LC 1RHHA 1P5UA 3CDYA 2BSSB 1BVKB 3OKLB 1AFVH 3ARDC 4L1BA 2HKHH 4GXVL 4LCWB 3V7AG 5EZLB 2IDFA 2MOVA 3EDDA 4RDBA 2OMXB 2AV1B 4FQJL 1PLGH 4KKLC 2W81C 1IAIM 1A5FL 1NLBL 2AITA 3QHFH 3DVGB 4GQQA 1OW0A 4J3XA 3UADA 4N0CD 1YEFL 1T1ZA 5I6PA 4OKDA 5TK4A 3ZMEA 2V2XA 3OQ3B 4JUSA 1BX2A 1QFHA 4ODTH 1VJSA 4KVPA 3KPRA 5M7QA 1U30A 2B0SH 4F7MB 2VLJA 2WKGA 2O93L 3BPCA 3CFJA 5EOTA 3WIHA 2A4EA 4FZEL 1H8LA 1CG9B 1A6ZA 4PRID 4LDLB 2HJLA 2VDPB 3FQUA 4P07A 4YPJA 5I0VA 3PWNA 1N70A 3X1EA 5E6RB 4N1CA 2X42A 1Z2KA 3LD8C 1N0XL 1D7BA 2YAFA 1NUFA 4JY4A 1DCLA 3HPLB 3IFLH 1JVKA 2WZ6A 1A6WL 3HN5A 4OZIF 3RVWC 4PRBA 3S35X 5EO9A 1MI5D 1JBJA 4PLKC 5F9DC 4AYMC 4HGMA 3EYUL 5AOKA 2YLKA 2Q8AH 1FYHB 3FDWA 3DHPA 4W9IC 4MNHB 4L8CB 1QBAA 2ZUWA 1J7VR 3SD5A 3E9UA 3QZPA 1CK0H 1MAKA 4WW2C 4XCYB 2ZCHH 4W70A 1JXDA 4ZMTA 4JKMA 2CGZA 3FZUD 4R96A 5IESL 4Y1AA 3UC2A 2HT4C 2YJLA 1MWOA 4EUPB 5IGXH 2EVJA 1DL7H 1U8KB 2VRQA 3NJMA 3EXJA 3EJYD 5AVUB 3SPHA 3ZJAA 4L18A 2AMUA 2EE3A 4L1LA 1E4KC 2FLBT 4V1DE 2BFGA 2A6JB 2Y5TA 3C5JA 3BN3B 3OPZH 5BV7H 2AJXL 1A9EB 4N8VG 3IDYB 1OM3L 2EDJA 2AJZA 4N8UA 4ONHA 2I5YL 3CN2A 3C2AH 3MR9A 5DRNA 5FK9B 3DO4A 1IJ9A 4IRJA 1GW6A 4RMTA 4HUXA 4ANVA 1MWAA 1RZQA 3QORC 4IU2A 2JXMA 3HC4H 4PG2A 3SDCB 3TM6A 1FNFA 2JK5A 2I32A 3NGBC 3QUKB 4APXA 3CXHJ 3DMMC 4PWGA 2AS5M 2CJTA 2ITDB 3F04A 4MD4B 3HRZC 1LO4L 2F1EA 2ZAHA 2X4RB 3VXSD 4AYID 2QGBA 4TVPL 4HSAC 1IEBB 3IDMB 4MZRA 4CVWA 1W0VB 3D39E 1VIWA 3BD4A 3N50A 5E4AA 1OCWH 5MEOB 1XGZA 1A3RL 3L3GB 4X80L 4KI5C 4U3SA 5FCUH 3IKCA 1OPGH 3ECVA 5GGSY 3U36B 2OK0L 2P4AB 3LVEA 3CUPA 4KWUA 4JG5A 2GIYA 1OAQL 5EU6D 4ETQA 1TKWB 2CDGB 3S48A 5C97A 2EVFA 2VABB 4WUKH 1AMXA 2CIKB 4ODVH 2ED9A 5IFAH 5IMLA 3NJXA 2VR7A 5DVKA 5BXFB 3F6LA 3HNSL 2CIKA 4YDJA 4M4RA 3RAJH 4FLSA 3QPXL 4I48B 5FYKE 1F3RB 5HHOA 4FP8L 4PJ5B 4DCQB 5HYSA 3DX7B 1X5ZA 3BPNB 4JPWL 1V55B 3O8XA 2MSPA 1L3NA 2XA3A 3EFFA 3I02B 1GGCH 3MACL 5JIDA 3SKNB 4AIZA 1MCJA 1J5OH 2VR5A 4P4RA 1UWGL 3CX2A 5T1LD 2JQAA 3DETD 3N1QC 2UZIL 2GTZB 2AXGA 3ASWA 3R18A 2UXFA 2M1KA 3VFMB 5FA3A 4TQEL 1CLCA 1CGSH 5GS1B 5B8CA 1E6JL 3MV11 5AVRB 4LPVA 3QG7H 4KDIA 3ZY7A 1Z5LB 1TNMA 2NUPA 4CMHC 3WTSA 3E2HB 3X2OA 5DRNB 3HMXH 1BZ7A 1M71B 2W0FB 5FEBA 2NY5C 1RZFL 3D09A 3W0WE 4MA8H 4Y9BA 2XG4B 5DQJB 3HB3C 5DYOB 1MCIA 4YSSA 1JNHA 2G4GA 3QE5A 4JCWA 1ACZA 1BDYA 1IBDA 1KIUA 1Q94A 4Y9EA 2R2EA 2TRHA 2BZCA 5E8PB 3V5DB 4QWWD 3TN0D 1VB9A 3FONA 4R3SB 4TN9A 3K0YA 5EN3A 2IEPA 2VR4A 4PP1D 3OKOA 4FHKA 3WNMA 2BSTA 4L5FL 4GUPA 2J8HA 4FJYA 2XWRA 3GJFH 3EH2A 3LEYL 5IF0B 3V7AE 2GJ6B 4ACTA 3LQZB 2HFGH 3BUDA 3FHQA 1KCWA 3U46A 5EO0A 4ZOAA 4PP2B 2DLHA 2DMHA 4X9GA 4PJEF 3WEXA 3ZZ1A 3BSZL 3EO0A 4B7LA 4GS7C 1WQVT 1AFVL 5C92A 1TUPA 1OP5K 1G8JA 1OEZW 3HPJA 5FYKL 1RVFL 1YYLL 3WU1A 4R4BB 1UOKA 2E0PA 4I0PB 4RH4A 4GAFB 5ACLA 2DB8A 1MCOH 5LG6A 3M1CA 3KH4A 3HS0B 4ZFOB 3RX7A 2AQQA 4JCMA 2I26N 1DSFL 1G7MA 2R29L 3BO8A 3IJSB 4JMNA 1JS4A 4O02L 5F9AC 5D70L 1WFNA 5E95B 2W91A 3T6VA 3ZTDC 2IDQA 1ZHKB 2NNCA 3QI9A 3BAJA 4R5TA 4WTXA 4X6DF 1ZA3B 4IDJH 4JGMA 1NAML 2XHNA 1N8ZA 3LKRA 3DSNA 3DX2A 1GSMA 4FTVA 3PFQA 2GUYA 1OKEA 2VDPH 5B38B 2Z0UA 2R2HA 4RGNE 4F8PA 3LB6C 3QIBC 4DP9X 4KH9A 4A6YH 4UU9B 2YWYA 1SLUA 4GQRA 4M5TA 1PCSA 3ZDZB 4JFPA 4MAYB 4RAUB 1TIUA 1F2QA 4JHUA 1A7PH 3MMEA 2X3BA 4RESB 3RWFA 5D5MA 3ETSA 2FX9H 3L5JA 4EBQH 3PP3K 3ZQ9A 3QEQA 5KSVB 2B3RA 1E4HA 3RKDD 2D7NA 3AT9A 4JRXA 1HHIB 3ZVVA 3GO1L 3HCVB 1YUHA 1UACL 2GFBA 4YVUA 1J9CT 1CU4L 1JV5A 1OAXL 4XOEA 4ZM7A 3GSUA 4JN2B 5EA0L 1DMSA 2W9LA 2Y4SA 5LDUA 1NCWL 2ZP8A 1IGJB 3BKYL 1N64H 2VMDA 4NWTH 5E0QA 2MQ3A 2OMWB 1NIDA 2VDKB 3L7EA 3LJ3A 4GAJL 2B9BA 2V4LA 4POYA 1T22B 4WKZA 3KVQA 4PS7A 4HFUL 1AGCB 4KXCA 2XTJE 4R83A 2J1KA 1DEEA 2BSBA 3Q05A 1E2WA 2IAAC 4HJJH 4LVOC 4P46A 5F93C 4HIXL 1MCKA 1U8CA 4AENA 4BXSV 9CGTA 2B4CL 1GJIA 5C0IB 5EFIB 1G9EA 5K59F 2A6DB 4MMXB 5J89A 5CU9A 2N4IA 1RZ7H 3BIBX 1A2YA 4I0PA 2VO5A 4FNRA 4PIBA 4PJ7E 4OJDH 1LE9B 2JIMA 3GHEH 5JXAL 3ARWA 2YPLB 1MKFA 1K3IA 5CZVH 5KVGE 1M7IA 1MVYA 1U2CA 4HF5H 4OF5A 4ONFH 1Q8MA 5HDLA 3W5MA 3BPOC 4E0RB 2W07B 2CKNA 4LLQA 5IB2B 1MXDA 4M5ZL 5EC1B 1JPGB 1YPZE 2HUHA 3C6LC 1MLBB 5EBWA 4OZFH 3MRIA 3RBSA 1MNNA 1R3LB 4NUQA 3SUMA 2BH0A 1OT4A 1BXUA 4NQDE 2V9QA 5ECJE 5F88A 4MD0A 4GMTH 3VI4F 4OLXL 3MV8A 4CW1A 4IOFC 4D8PA 3VRLE 2DL2A 5SWQB 1AR1B 2IWEA 5D4JA 3NZ8B 1OM3H 2JIQA 4DP2X 4RGND 4QHNB 3QDME 2K6WA 4ALAH 3A0OA 3DOSB 1C5DA 1GPOH 2DKMA 1A8ZA 3CFUA 4QRPA 3HAEA 1S9YA 3VYPA 5HYQB 2G0LA 2VLKD 4RRPG 1QFWI 2DW5A 1QG3A 4OM0H 1LE5A 1HILA 4AQAB 4E9WA 2PPAA 4FXTA 1BVZA 4IOSD 4AYFA 2YQ3A 4Y1AB 4H0HB 4Y5VB 1U93A 1VRSA 2D31A 4FFZL 2J8UA 3ILQC 5KSUB 2VZSA 3BIKA 2RJMA 1IM9A 3L2LA 3EJCA 5DUPL 5C0JB 1CGTA 3FBKA 3LZFH 3EJUA 4YGVB 2OK0H 4Y1TA 5J1AA 3NN8B 3IB4A 4PYGA 4DGYL 2XXCB 5FDWB 2H7WA 1KBWA 1QA9B 4CBZA 2ZJSL 3NJJA 4GLRI 2GVYA 3FC8A 3RPKA 5I66A 4FG0A 3BVDB 5F7WC 3I85A 1TU2B 1WG3A 2Y1VA 1M7DB 2GEQA 2CPUA 2VZOA 5CZXD 2CDGA 8PAZA 5FM4A 1M4KA 3BC9A 2PP7A 2IMMA 1QWUA 4Y0GA 2R2BB 1MFDL 1HHJB 4Q6YA 3T2QA 4PV1C 5EHFA 4QTHA 1KJMB 3FL7A 3LSOB 5JHDE 1F4WH 3P1VA 4NDMA 4RSVA 1N68A 3NIFF 3CZSA 1KJVB 1NBQA 5I30H 3B1UA 3VFRB 5KANI 4CU6A 1Z7JA 2NY1B 3FTWA 5DD0L 2WINB 4X4ME 1U0QA 5H35B 2H5UA 2IJ0C 3B2UC 3MKKA 4LRNL 4V11A 5TE4H 5AFAA 2VDMH 3IXAB 5JNYA 3V7MA 5KVDE 2BSRB 4ANXA 1AXTL 2HG5B 5FC9A 3QQ4A 1VFBB 4MAYC 4BSVB 3GPEA 5J4MA 3SSGA 3HMXL 2WUCL 3TO2A 8CGTA 2NX5D 5ICYA 3BCFA 2AQSA 2VGLM 2DZEA 2UXGA 3H4HA 4DWHA 1EV2E 2WB7A 5DI8A 1KG0A 3IS0X 3GB7A 3VNZA 3LKPA 3JWNE 2A6JA 3KH3A 4UNTA 3DJTA 4AZUA 3H9HA 1T2QL 2OTUB 5A16A 3PHQB 1UWXH 4V2BA 4P99A 2F53D 4P05A 2HTKD 5F7DA 4M6NH 1M9SA 1AMYA 5E99L 4U7KA 3E1F1 3HRZB 4H1LG 1NCDL 4I8DA 4JFDE 4M29A 5J12B 3IM1A 5I1HL 4CN4A 2B5IC 4HAFA 4DT2A 5C0FB 3SGEH 1AR2A 2NY0D 2ZYIA 3DO7B 5GGRB 1YJDC 3CVHA 3QG6A 1IGML 1WITA 3D0LA 1QEXA 1T3FB 3FN0H 1MRFH 1VCBC 2F7OA 3MV7A 2VZVA 3FCBA 1DQML 1EJ8A 4RRPM 1YNJD 4CGTA 3BH9A 1A25A 4I77L 2CLRB 1Q9LB 1ACYH 2C8NA 4KZ0A 5I6MA 4C59B 3L1GA 1OHQA 2DQTL 4K71C 3CVHL 4N8VA 5ERWA 1UD6A 5DEJA 4EIBA 2ZCKH 4FQ1L 4OZFG 3GHBH 5ABAA 1DBBH 4ODSL 1HINH 1S2EA 3P4OA 4JRYA 2DMKA 3SPVB 2AHIA 1XSKA 1KJMA 3LSOA 3QJOA 4OAWB 5PCYA 1A7RL 2MPVA 3BT0A 3L3OA 5IW6B 1XGQA 3MUUA 4C56A 4Q8BA 4J3VA 1YEFH 3SBWA 5D6DC 5JPNA 1PKQE 2N3JA 1UZ6F 2NR6A 2ZWYA 4I48A 5D2NC 5C7ZA 4AY0A 3WEXB 1KC5L 3QUMA 2DI7A 3BVXA 2PYEA 3P54A 5EU4B 1JGVL 2EC9T 3KPRE 3SBRA 5C0CA 3LNFA 5GLXA 1UB6B 4ZUTA 2PUQT 1NIFA 4HC1L 3SO5A 1IGMH 4WNSA 2XN2A 4FCAA 2EUWA 3RURA 1HIML 1CS6A 1RK1A 2NQDA 3HE6D 4IBQA 2D03H 3QIBD 2P45B 5K9OB 2KT6A 4NP4H 5AB9A 1QX1A 1NCWH 4WJ5A 3DK0A 1LK3H 3HB3B 3MOAH 4FTVD 4HJSA 4KROC 4CMMB 5F89A 3QEHA 3FCTA 4XNYL 4AUJA 5IG7A 1ORSB 1UM4L 4BQ8A 4Y5XA 3DLQR 3GSRA 3MRNA 1NINA 5E9DE 3K6DA 4YWGH 4XMXA 1J88A 3S98A 3EYQD 2P3YA 3BH8A 1HHKB 1G6RA 4OD1H 4XMUA 3X1FA 1N0LB 1L9RA 3IDXH 2CBMA 3Q5OA 5F7EH 1CE6A 4F8LA 4HGWB 4L4JA 3K71A 2DMRA 3UDWA 3CDZA 4Y4KA 3FYEB 1E27A 1F4YL 3BP7A 1OGSA 1C1EL 2Z31C 4MAUH 2ICEB 2VL5A 4JFDD 3NYKA 4HUVB 3QDAA 2OJEB 4OCSL 3BH4A 5HVFB 3FU7B 3NK4A 3OHXA 4HPYH 2XX1A 3HZ3A 3SPIA 3FB6A 5BW7C 2ZP9A 2G75A 2B20A 2WBJA 5GJTH 2BSEA 4UTAL 5FTMA 1GPOL 1OCOB 3SQOH 3H2QA 5J9PA 1FBIL 3CFTA 4HJGB 3WNIA 5KW9L 1AQDA 2E47A 1XGTA 3SDCC 4FQQA 3KBEA 2DLIA 3TNNA 5CGYC 2VDLL 3GK8L 5ICXA 3N5AA 1SYVB 1ZGLP 4YHLH 4ELMA 1CLOL 1F4AA 1AG0A 1ZSDB 4FLOA 4M00A 5PAZA 1V54B 4LF3A 1TJGL 1TZOA 3G5WA 4OV5B 3OG6B 4U1JA 1FJ1A 4HLZH 3QCVH 3C8HA 2VXQL 2A6DA 4JJHA 2ZUXA 2KH2B 1A6TB 1INEH 1QFWL 4IBSA 3P30L 1RK0A 5MP6L 2PYFA 3VFOB 3KBFA 4WFEE 3WJJA 3H9SE 4KROB 2IDSA 4MJIE 2DTSA 3FTUA 1FSKB 1JHKL 3HE6B 4DW2H 1BFOB 4UZSA 1EUUA 4X7SH 3WS3A 2V9RA 1MJ8L 5IQNA 5TF0A 5K1VA 1CCZA 1JK8A 3QXAB 4JFWA 4J8RA 1NPNA 5HHMB 3HU3A 2FL5A 1QZ1A 4XP1L 1RZIA 2VUYA 1WA0X 5IHUL 2ZYRA 5HD8C 4J4PD 2XN9B 1MCEA 3GSXA 2AEIT 4LLWA 4RIRA 2FWOA 4OLYL 1JWUB 3MRGB 4PGEB 2QV2A 3CZBA 1XH3A 5MI0B 1ANUA 3TTSA 4Y5VA 2FBJH 5B39G 3KLHD 2D0FA 1ILSA 1RVFH 2C34A 1EO8L 4W9HC 3IDNB 3WAJA 4LSTL 3V6ZB 1IC4H 4PY8I 1GGCL 3MACH 5KSUA 1KDIA 4O02H 1SY6A 3PDOA 3FU8A 5K39B 2P8LB 5CFAA 1O6VA 2PWHA 3RZCD 3MRRA 3OPUA 4XE0A 5T5NG 1H3GA 4YGAB 3VD5A 1S7WA 1MFDH 4UT9H 3G5YA 1BQRA 2VRAA 1HILB 2F08A 3PDDA 4WY7H 1UM6L 1L9OA 4D0BA 4WEBL 3U9PL 3DX3A 1T80A 5TE7H 2BHYA 2CHZA 2QELA 4IBYA 1I9IH 3B7SA 2FJUB 3E7JA 3PP4L 4KY2A 4JPKH 4N2FA 2DJUA 4DN4H 2WYTA 5KS9B 1SGKA 2X9XA 4NEHB 3WFBL 2PR4H 4L4VB 4EI6A 4NDMB 2Z65C 1A0QL 3ZKMD 1L9PA 2W07A 2IWGA 2B8OT 3T71A 1H9DA 5IOPB 4LL4A 3FQUB 4IMKA 1RZJL 2OYKA 4PJEE 5LGHL 3QDGB 5CP7B 5J6GA 5IOPA 1Z5YD 3RDTD 4KBPA 4FFZH 3ZOAA 5D7IA 1CGSL 1DQMH 3L16A 1RZKL 4LSTH 2AANA 2WKOF 3LQAC 5AW0B 2H2SD 1MEXL 5A7BA 1CMOA 2E27H 2FRGP 4MS8C 5HHOD 5D1QB 3MCKB 3NABH 4TUJB 5EMYA 5I1HH 2QPDB 4GG6A 2DWDA 4M4PA 4I2XA 1M3IA 2K3HA 2WBXA 1E8YA 2BP8B 1K4DB 4JKPL 4UAHA 2MCG1 3L1OH 4JR9L 3OJMB 4LSQH 5KSBB 2H1LM 2XXFA 1IL1A 4OFYD 5HD8D 3QI9C 2JB6B 3G6DL 32C2B 3GUTB 1XTMA 4NC1C 3LKOB 1F2XK 5KSAA 3L4ZA 1MCWW 3POHA 4Z7UE 1FHNA 5KAQF 3KYAA 3RVXC 1LXMA 3T08A 1N6UA 1NKRA 2VDOB 1TJHL 4QAMB 2RD0A 4MCYA 2DLTA 3MLZH 3JZ7A 5BZXA 4HD5A 1ZEAH 5L4FA 2V8LA 3DDFA 5DGQA 4TNGA 2X40A 5AZ2H 3VWJB 1QFWM 2YPKB 4PRAB 4KZEH 3WOVA 1QPKA 4P23A 5D70H 5E08L 4IRJD 1BV8A 1KCLA 2ZCLL 3WG7B 1U8QB 1AQKH 3FTVA 1OE1A 1A1OB 4A2HA 2QV4A 3D7PA 1DVZA 4NNPH 4JQIL 4WV1B 1Q0XL 1A3LH 2J1XA 3DPBB 1HH6A 1MJUL 3QW9A 4H0IA 3KYOB 4DESA 1X5IA 5FW6A 4DP1X 3FRPB 2OTPA 4OSUH 3TH3T 1JNNL 4JG1H 2MWCA 2WVVA 4RFOH 4JANB 5CLWA 3R1GH 1G1CA 4LSPH 2NY4C 3DSNB 5SWSE 3FQXB 2YAOA 2OTWA 2FLMA 2SEBB 3BE1L 1UOVA 1XF4A 3D25B 3FQTA 4O9HL 3WD5H 3P4NB 1H6UA 1G7MB 3BO8B 4LBAA 4E36A 1G6VK 4MSWB 3E8UL 2LU4A 3X2MA 5HJ3B 4D2NA 1RUQL 4KKPA 4MQXC 1KIQA 1P4LA 3HNTH 3JTTA 4TOYH 3WFEL 3D33A 1MCFA 3OJVC 1N9PA 4P49A 4U4IA 3B43A 2J88H 4EZKA 3BZ4A 3GSNA 2CE6A 3DECA 4JDEB 4Y5YC 3EGDB 1WAAA 3WKMH 4ES9A 4JO2L 5DZJA 3SQBB 3KNBA 5EZPA 4JGUA 3VE0A 4TTGA 1TWAA 1MQ8A 1PZAA 1YMMB 1VSCA 4WF7A 4OGYH 3BWAB 3ELQA 5F9OH 3ZHNA 2GFBB 1CE6B 2BLFA 3O81A 4GG8B 4JRXD 1SXCA 3KJ4C 1FFQA 2ZWSA 4H8WH 2OTUA 1AHWB 1ZV5A 1FVDB 3BN9C 4NWUL 2XWBA 2ENQA 3KE0A 1FYTB 3WE1A 1ACXA 5IJVA 5DO2D 2R92A 1HQRB 3NCBB 2EDLA 1QATA 4Z7VA 3TF7C 2DLFL 5GGRA 1U8LB 2OQJB 2KQAA 3DMMA 2ZNWA 1DJSA 2P5WB 2R93A 5FO2A 3ME0A 3MRCA 5B7FA 2F8OA 1M7UA 1TQCC 1ZTXH 4QRSA 3NQKA 4Y88A 4QJ5B 2X1WL 4YSUA 1QTSA 3FSWA 3C60A 5T1KA 4PRPE 1UG9A 2F2HA 5E1AA 3VG0H 2ZCHL 3H0TA 4LOUD 3CH1B 3OUGA 2MHAA 4G43A 5D7LD 4ZMLA 3GSOB 3HR5B 1YA5A 2IIJA 1I7RB 1NEZG 1AGEA 3PJSA 2DQUH 1JAEA 2XUWA 3FOLB 4WKXA 2Y1ZA 4DGIH 3CX5K 4ZFZB 4ZD3L 5DXWA 1K9TA 5BW7A 1Q72L 3V8CA 4AEHH 1RCYA 4FQCH 4LL1A 3IFOA 4OAWA 4R84A 4H8WL 1A6UH 5GLFA 5I9QC 5JPMB 2P5EA 2AK4E 1OCCB 2PWDA 3Q1SL 3LN4A 1LEKA 1T83C 2I5YH 1C16A 3QUXD 4KVCH 2N01B 4C56D 4QRQB 2VOTA 4OIIL 1CXFA 2C1OA 5EORH 5BJTB 2PR4L 3TBYA 4UB0H 4ADIA 5IBLD 5KVFL 1UA6L 1TQTA 1JNLH 5EU7C 1EANA 5DJ6B 4OFDA 4KQ0A 3ZE0F 2R56H 3IDNA 2BSSA 1E2ZA 2QMKA 5GRZA 5TPWL 2YBGA 4MQ7A 2Q7AA 4JFZL 1XH2A 1JG9A 4GI6A 3CFDB 1KTDB 4TULH 3QCVL 2ZONA 1TWFA 4YDKH 3T3ME 1IKNC 4JRXE 4RMVA 4YHYC 3DETC 3GF8A 1ZLUH 5I18L 4OCMC 3C6LB 2J4WL 4L9LA 4QJ4B 3WCYA 5D7IF 4AK2A 3Q1EA 4IBZA 2F68X 2PW2A 4HH9B 1FAKT 1S7UA 2DM2A 4ZFFB 3HAEH 2NY1D 3N1MC 1DSYA 4U4BA 5B3SB 2LLGA 4MQXD 2YBRB 5ADPH 1BZQK 4N25A 4HKJB 4JPWH 1R24A 4GRLB 1NCDH 1WS7A 3X1GA 4WI8A 4GP4B 5L2JA 3MBWA 2UY6A 5ESVB 4P2QB 3QO0B 1K2DB 5BMFH 1YCSA 3PXJA 1NCCH 1QFPA 2XFXA 4FHBD 5AW6B 5LNEA 3RA7L 4KVNL 2WBKA 5KVEE 3WY4A 1B0IA 5JXEA 5EN2B 4JFUA 3CLFL 1RJLB 4U3SB 1IGTB 1TSHA 1CE1H 2JV6A 3B9KA 4ZTEA 3WFHA 4Y19D 1X5MA 2VIRB 1ZKAA 1J0JA 2DKUA 2VITB 4YUEL 2ZZUT 3FPXA 3I75B 1IBYA 2WAHA 3OF6D 3ASNB 4WO4D 2BPBA 4WK0B 3BPCB 4JZOB 4NOHA 1K2DA 3IAGC 4Y5XC 1T5WA 4W9GC 3UZEA 1CICA 4OLWH 2AK4D 4HMDA 4KMQA 3SBPA 5IB2A 4YSAA 1FAIL 4JE4B 3ISYA 2FR4A 4YDZA 1AY1H 1I9IL 5CXPA 4C56E 3PU7A 1CFNB 2MCMA 5ADPL 1OAUL 3ULUF 1ZLUK 4LZKA 4HAKA 1KXTB 1FO0B 5HHQA 5GZND 1PS3A 1P7QB 5I5RA 5DF0A 4IMKC 1QSFE 3NACH 1MHEB 1NCUA 1V7ML 1YLBB 1EMTL 7PAZA 5DSCA 1THAA 1S7RB 5IT2L 2R8SH 1NGZB 2NNAA 1P84J 4MJHA 4U1GC 5LGJB 3L4CA 4L29A 4O5LH 2CKBA 3MV7B 1A4AA 1X5XA 4OLUH 4R96B 4ZOCA 2IQAA 2J8UB 4AVIA 3IMSA 4OQTH 4P2RE 2IQAB 2WXMA 5FWRA 1GJUA 1VF5C 1VA9A 2F8XC 2VQ4A 2Y36L 3JVGA 1ET5A 4G7QB 4PU2A 4N9OB 3U6XA 3GT6A 2VPWA 1IGIH 2UZYB 5A3IC 1ZT1A 2W60B 4QXTB 4U6YB 3JYBA 1QUNA 4L3ED 4PJXB 2CDEB 4JQXA 1A47A 1CDGA 4PJ8B 5IBUB 2DJSA 2XICA 3WJLC 2G2NA 5IB4B 3TFKD 3BKCL 3AJ7A 3HKZA 2EYTA 2WLNA 2Q8AL 1BQKA 3AAZB 4JDZB 4XB7A 3MV8D 4F33A 1PF3A 3ZO9A 3PJNA 1WBYB 5IT2H 3KLSA 3PL6A 1E28A 3AQDA 3MLSL 4A38A 4F7PA 2QVKA 2WKLA 5GJTL 1S8DB 5EV7A 4L0YA 4Y19E 4ZXBD 1HAUA 2J71A 5DZNA 1CICB 5C0CB 4OF0A 4PJ8A 2GAZB 3RVTC 3QXVA 2DD8H 1A1NB 1MF2H 3QWZA 2VN6A 2WNWA 4RMRA 2V37A 4AOKB 5DJ8B 2MPAL 2CDFB 5IHLB 1SOKA 3CUPB 1PT1A 1SBSH 4NI3A 4XHJD 1OARL 4H8QA 4FJZA 3P9LA 3KCPB 4NFCA 4W81A 5C0EA 2PCFB 4IKLA 5DJAA 4XBGB 3PP4H 3UYPA 5I8OL 5LNDA 1VADA 2WXGA 4BK5A 1U2HA 2XQYK 1OAQH 4R26H 3FN3A 1BD2A 5EO1B 4DJMA 4LEBA 4S0SD 5KBKA 1CFSA 4HUWB 4XVOA 1BPVA 1QSFD 1VKXA 2FO4B 1UYWH 5IY5B 5FO9B 5AB1A 5A16B 1KBVA 2NSQA 1OD9A 3O6ML 4P23B 1CFTB 1EUTA 2E9JA 3VE0B 4BD4A 1EZSA 5CJ8A 1BG1A 3BT2L 5GRJL 2QSQA 3TYGH 3QWRA 2NZ1A 5L4MA 1MEXH 2F6AA 1RPUA 2MCPH 3DVNB 2DQEL 4ONGL 4P2RD 4BSJA 3RY5A 2D3NA 1E42A 4PQXA 1KELL 4Z3HA 1W6WA 2Z8RA 2Z8WC 2J5WA 3UBXB 3QEQD 1G1KA 3PUUA 3SKOA 2F54E 4HBQA 5BVJA 1HZHH 3I6KA 4BCXA 2E3VA 5LGKA 4WLCA 5SWZB 3VRIB 3QDJB 2EDFA 1OHZA 4NYLB 5BRZB 1ZLSH 5KVGL 3S37X 2X28A 3M46A 4UINH 2CWRA 1Q38A 4R26L 5CBEB 1YEHH 1GZHA 1U8HA 3B9VA 4A37A 2V8MA 4R0LB 3LH8A 1OCRB 5MENA 4WEUD 3MV8E 3QORB 5GS2H 3K1KC 3HJ0A 4MAYD 4NQEB 4X6DE 1N8ZB 3WNLA 2VMEA 1RIHL 3MRBB 2A74B 2F53A 2HLFD 1A1NA 4KO7A 4NM4L 1QI4A 1AIFB 2RA1A 2L7JA 1UB6A 2LU3A 4X83A 5ACZA 3T1FB 3I6SA 1E6OH 1JGLL 4K3HA 2TRYA 4FQJH 5DJYA 2OTWB 2SEBA 3D25A 4DF9A 4G8IB 1ZC1A 5L2KB 5L9DH 3LPGA 4N1EA 3GI8L 3N85L 4JM2A 5AENA 3TZVD 2KI6A 4XVUC 4YHIB 2OJ1A 4U1MB 1T20A 4J3TA 4QCIB 1KTLB 1FE8L 4LASH 5FYKH 2G4EA 2I7SA 2NRDA 3DTXB 1KTJA 4A67A 5EUKA 4H2AA 5JW3L 4X5WB 1DQJB 4TVPE 4X6CA 3VG9B 5AZEL 1U6AL 2YSSB 3BGAA 4PCYA 5IB1B 2F54A 2J55A 4I0KA 1L6XA 3PG2A 3CHOA 3FKIA 1U8KA 4M93B 3ZDWA 4ZFFA 5KJRL 1EBPA 1KN4L 3MRRB 3V4PL 4XCCH 3PPEA 3SGKC 4ELKA 4L37B 3BZDA 4XO5A 4NN7B 3MO1A 4P48A 3V6ZA 2HFTA 1R7RA 3PIQA 2A9AA 1RZ8B 3VSVA 2MFNA 3E6FB 5I1LB 3GTPA 2Y22A 3EDEA 1FIGH 3TX4A 4TLTA 3L3DA 4PWJA 1HDMB 3QUHA 1FVCA 2BVQB 1WF5A 5LNGA 2WO3B 2FE0A 5IROD 4Q56A 4DH2A 2X4SB 3PL6D 1J9QA 4KJPC 1JHLH 1U6AH 3KDMB 2JKJA 1HJCA 3RTQC 4NWTL 4HP5A 4JFYB 2IPKB 2P80A 4NUJB 3U30B 1R3LA 1UENA 3JWDL 2Z7UA 4HK0A 4NNYB 1JPGA 4PJDA 3V52L 3MV9E 1Y1VA 4N90E 1A6TA 4ZOBA 2D7QA 4WTZA 4JP7A 3BSZA 5FTLA 5LCVA 3Q06A 1M1SA 4YHIA 3EGSA 4OD3L 1G9NL 3ZLQC 2FJFB 3CSFA 3GEWB 4ENEC 3AQXA 3VFGL 1IW7D 4FA8A 4LSRL 2AJVH 3ZE1E 3QCTL 2Y3AA 5D9SB 1UCTA 1GZPB 1JRHL 1V27A 1TZIA 2QKIC 4Z95L 2YGVA 2ZXGA 3CPLB 2NQCA 3SCMA 1T0PB 4KQ3H 1YYCA 4X0KA 4BHUA 1CE1L 2O6DA 3S96B 5L4JA 3WXWL 1E9PB 1XZ0B 1N5YH 2CNYA 2NY1C 3Q8BA 3QA3A 2IH9A 2XFGB 3M17A 3S3SA 4GW4A 4MXWH 4O00A 1AA6A 4WZ9A 1N7ML 4OFVA 4YGVA 2WWNA 2D3LA 1F97A 3MO1B 1TETL 4LHJB 5BPPA 2OMXA 2Y5QA 3X17A 2ALWA 3VFVA 4NXKA 5C08A 2MIZA 2VAJA 3FTZA 3F65A 2HYMA 4JKLA 2UY6B 2O5YH 4BUQA 5TH2B 5I1IL 1I1CA 3U7YL 4G3YH 3WN6A 2EH8H 3B2UD 3T0VA 1T6VN 3SE9H 3HNTL 4ATTA 4LLAA 4CRPA 4ZQTA 5I1CH 4JFHE 1NMAH 2J88L 4LLMB 4JM4L 2Y6TE 4PVMA 2WLKA 1KNOA 1HNGA 5CMAB 4X7TB 5TD4A 3STZA 3C5ZD 4XODA 5HHVL 4PRHA 5CBAA 1KEMH 4N2KA 2HJLB 4NAJA 4BUGA 3LXBA 3X2KA 1U9KA 3E3QE 4PB0L 2C9PA 4NQDA 3CHXA 1XMEB 2K7PA 4I0CC 3DTDA 3HG1E 3O0LA 4MAUL 3ZMRA 1YSOA 5TQ0H 1IKOP 5I5MA 4G59C 2YKKA 4XMPL 4O2EB 5L6YL 4JZOA 4EZLA 1NBZB 4Y2OB 4AL8L 4ZFOA 4E41A 2XTSA 2LVEA 3WSQL 4JM2D 3GI9L 4HJJL 4NT6B 1Z5HA 2FYVA 1U91A 2DMBA 4PJ7A 3NFNB 1O6SA 5C0GA 4AJYV 1SHMA 5KW9H 3LEYH 3MLVH 2NMSA 4Z7WA 1JPTL 2IANB 3VFNB 4YHOL 2JJTC 2J20A 4ONGH 4LCYB 5IFHH 1OF0A 3IMRA 4QKTA 2RFXB 4WWID 1I3GH 3D08A 3MV9A 3QWQB 4HT1H 4QO1B 4DGYH 4DEPC 1B4LA 1E2VA 4M5SA 2E7BA 2ZKYA 4GP5B 5DR5L 4FERA 3APDA 3TBSB 2ZUQB 2J8OA 3BISA 4ZSOA 5FCUL 3JWOC 2DH2A 2W0FA 3QG6B 4NUGL 1ZLDA 3WDHA 3P9MA 1SFHA 4HYTB 2VDQB 2XDHA 4IKNA 4DP5X 4PJAF 3I3DA 3GKWH 3D3VE 3VVVA 3KM2A 5JZ7C 3TS8A 1CZ4A 4EF3A 1EAOA 2QVIA 4DOHE 3V6BR 3MJ9H 3L1OL 2HRLA 4EIGB 1QQDB 2W95A 4ECNA 4NZRL