4FFTA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with mixed-linkage glucan
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fftA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fftA02
3X2MA 4JP7A 3X2IA 2JNZA 1BW4A 2HCZX 3X2HA 4ENGA 2AE0X 3X2OA 2VXQA 4JS7A 2BH0A 4FG4A 4JP6A 1WHPA 4JJOA 1WHOA 2PJJA 1N10A 1HD5A 2PNWA 3D30A 3SULA 1OA9A 1OA7A 3SUJA 1WC2A 3X2LA 3X2PA 3X2JA 2PICA 3CZBA 3SUMA 2PI8A 4L48A 3X2GA 3M3GA 4ZM7A 1BMWA 3X2KA 4FERA 5GLXA 2KQAA 2G6GA 4JCWA 5H4UA 2G5DA 5GLYA 3SUKA 4FG2A 2ENGA 2GAEA 1L8FA 4FFTA 3X2NA 3FT1A 3ENGA 4AVRA 3FT9A 1BW3A 5GM9A
chains in the Genus database with same CATH superfamily
3EBHA 4F8OA 1ZXQA 5IGXH 3CZGA 5FYKU 4ZYKB 3VXUB 2P8MA 4M43H 1OPOA 2ADIA 1TETL 2VDOL 4X6EA 1JG9A 2AV1A 1M57B 4NENA 4CVXA 4DK3A 3VGGA 3BGMB 2QGDA 5GRYA 5BVPL 2BXYA 3SDXE 3V4PA 3NGBC 4I8DA 1P5UA 1BZOA 4LF3B 1WFMA 1HZLA 3SZKC 3NJKA 2EINB 1IAMA 1JVLA 2B3IA 4FXKC 1YMHB 3KPLA 3CDGA 1U58A 1AC6A 2MNWA 4PGCB 4HCRL 2EDJA 4R6UA 2YPKA 3BFWA 3FCSB 2GJ6E 2AZAA 1RERA 4A7GA 3NSYA 1CGXA 5EU6B 1O9VA 1RD6A 4LNVA 5FFGA 4B7IA 3AY4A 1IE4A 4K3JH 2AJZA 3ZXAC 1R0AH 1WC2A 1EZSA 4X5RA 4XVJH 4L2YA 4F3FB 2HWZL 3CZUB 3KPRE 4DGVH 5CJOL 4QF1B 3P73B 4ZFOB 1FFPA 3E2HB 3MXVL 1PD1A 3O11A 1SXSA 5T33H 3VDCA 3VFSA 4MS8D 1E67A 3M1BB 5LDUA 2WLNA 1EXUA 2AQTA 2VRQA 1D7DA 3BUDA 4GSQA 4QUOA 4EDWH 1U41A 2J1KA 2YS4A 2X70A 1A6WL 2A4EA 3RU8H 4HUVA 4QHUA 3KBPA 1FZJB 5C0IA 3LPPA 1G94A 4TVPH 3QGVA 4IIQB 4R3SA 2YUWA 2J8HA 1KBGH 3TO2A 1UURA 2MPAH 3OJ2C 2GTZB 1I1YB 1XT5A 3AITA 4OZFA 2IMNA 4NWTL 4PJBF 1FG2A 1QX1A 3C5XA 1IC4H 1A6WH 4P2OA 3BKYH 4LSQH 2WYTA 4B96A 2YXFA 1KB5B 2BSTA 1OY3B 4EMZA 1QTYT 4N8VB 4EKJA 1W8NA 2QVFB 2ZX9A 4WI7A 5T5FA 5EZLB 1U6AL 4WEUD 1OAQL 5EC2B 1ID5I 2EVIA 4L05A 4NAJA 3FH8A 4DGYH 4L3CB 4Y16B 1DFXA 2R0WL 2PCPA 2XQYG 3V9EA 5IM7A 3G6JF 1N6QH 2VZUA 4JRYB 1YEJL 4UTBL 5GGTA 4G7YH 5CKGA 3T6VA 5F9WC 2WUBL 4Z7UF 5D7SL 3OHXA 4KY2A 4QJ5B 3HRPA 3RUGE 2HT4C 2V6HA 1WA1X 1UM4H 3B7YA 5SX4H 4YSCA 1L0QA 1URLA 5GGQL 5E2VL 4AMWA 1L5GA 2A4CA 2BSCA 4NM4L 3EGSA 3IDNA 1E6JL 4IYKA 3HG1D 3PQYA 4QOKA 5LAXB 2YA0A 1T2JA 2WLMA 5C6TH 3GINA 2L7QA 3OLGA 2GKIA 1I9JL 2EKJA 4EDXB 4P5RA 4FQ1L 3L81A 2X6AA 1RIHH 2C1OB 4MJID 2BDNH 2KQAA 5EDSA 1GH7A 1T6WA 3C2SA 4QTHB 4RFNC 4JO3L 5JZ7C 1F58L 3MRLB 4GPVA 5FYJU 3GD1C 3ZE2E 4N0YH 3UTPE 4G6AD 3ARQA 1M71B 3RE0A 2YN5A 2Y3NA 1C1EH 2AQRA 2X1WL 4CMHC 2DBJA 1OAQH 5C08E 3FFDA 3X2LA 1A14H 4XP6H 2MQGA 2WJ5A 1WLHA 1FNAA 2LTQC 4Y4HC 1NC4B 2WHVA 3X1FA 3KCPA 1H5BB 1FSKB 4LSQL 4GBXB 1H3TA 1QSFA 3CQPA 4XE5B 4BK5A 1GL4B 4OSUL 4ZFFB 5DVKA 3C5ZD 3PWJB 3TN0C 4X98A 2V0AA 3KL5A 5DJAA 4W93A 4KJWD 1IZKA 1OAUL 1VFAA 2A38A 1P4IH 1WAAF 3BPLB 1X7QB 1FIGL 4HHAB 1AOHA 5BUGA 4UNIA 5EFIB 2JB5H 3OLEA 4OLXL 3JTSB 5ERWA 1KCVH 4LVHB 3SZ6A 4FJYA 3ZL2A 3H9HB 1K8DB 1MHHA 3CSBA 4Y9EA 5C6TL 2YGVA 2ZJSL 3S98A 2CR6A 1IBZA 1BGXH 3I6GB 2QLVB 4YDIL 3ZKXC 3ROLA 4OJCA 1MCPH 5ENWB 5AG8A 1BZQK 2DWYA 4Q9RH 2ADGA 2XETA 1KN4L 3FU7A 1SY6A 4IOFC 4QRQA 4WTZG 1SJXA 1D6VL 4BWTA 3UP6A 4P5KB 1TEGA 5D9SB 3GTVA 1KTLA 4R4BA 1GKOA 4AL8L 4AVJA 3BCFA 3HW7A 2D7QA 4GNKB 4C54A 5ICUA 3BUTA 1WDAA 4DSYA 1OAXH 2CK0H 3QNFA 2DI9A 4AMXA 2UWEA 2QQLL 4UV7L 3IETB 1BGXL 5HDBF 3KPMA 3LH2L 1AXSB 3ARWA 1KB5L 2XIIA 2A74A 3V6FB 4KTGA 4H5SA 2IWEA 4R2GB 4ACTA 3IPEA 5I1EH 3WTTA 3PFQA 2D4DA 4LKXB 4YX2H 4P9HH 4Y89A 3OMNB 5FYJH 3S2CA 4TOYH 3U30B 5J6GA 4L0YA 1MW3A 4JRXD 2Y72A 2VSCA 1MQKH 3GSVB 1H19A 1RJLB 3V4VL 4S1RH 4C56A 1DVFA 4FE9A 2Z35B 3MYJA 3V4UL 4AKOA 5FA4B 3SJVA 4DP0X 1RVFH 5HHQA 4MJ6A 3AREC 4UQEA 5DO2C 1CGTA 2VN6A 2X4RA 5DD3L 1CE6A 4E9RA 3H42L 3O3DB 1JYVA 4Z3EA 5I76B 1SGKA 1K6QH 2C9VA 3MRDB 3OG4B 1XGQA 3EGDA 4R0LC 1ZLVK 3VFTB 2M1KA 3V6BR 4NZRL 3MAWA 3US9A 1HU8A 1WHOA 5C9JB 1KIPA 3AREA 5CUSH 1TMQA 4YDMA 1S5IL 1B90A 1TU2B 1XCQB 5LBSA 5CN1A 3TV3L 2HRLA 2P1YA 3QZWG 5ESAB 3MGTB 3ZMEA 4J8QA 4WO4D 1ORQA 1SBSH 2XKUA 1ZPLA 5AOIA 3VXOB 3UZQB 4YHPA 4UQ3B 4C57C 5IOPB 3CVHH 1T1YB 3SOBH 5JIMA 4Y5YA 3WEBA 1L7IH 1QYGL 4PG2C 1E61A 1NAMH 1W72B 3KLSA 1IKFH 4JR9L 1F8TL 2ZXCA 4OZHB 4Y5XA 2NSMA 5DWUH 5EZOH 4KKLC 4PJGB 3MACL 1NMBH 3NCCB 3X13A 4E9SA 3FJTA 4IMLA 1OLLA 3VMPA 4EVNB 2X12A 4EQ2A 3S8WA 2D8KA 3LN4B 4AENA 1A7BA 4M5ZH 4MD0B 3DETD 4IU3B 1AGFB 4TSAL 2TAAA 1U2CA 3G6JB 5FO7B 1BZ9B 4LKXA 1UADC 1TMOA 3VXRA 3CLEL 2BSBA 1HVXA 2GC7C 3H7BB 4JHZA 1K4DA 5K1JA 5KBNC 3VYOA 1THAA 4OCMC 4G7QB 4HKXA 3ORJA 2Z1KA 2R0LH 3OSVA 4LCWE 4YSTA 5ID1B 2QZQA 1ZK9A 3IMRA 4OGXH 1YUHA 3FT9A 2OR8A 4V1DE 3LKQA 3FF7A 5T1DL 3B3IA 1UD5A 2F7OA 2J21A 5E2TL 2DKSA 2BERA 1NLBH 1LO4L 5FDYA 1KULA 1BSIA 4MNGA 4AUUA 4D0BB 1H15B 2PTTB 1ORSA 3BZFB 5HHVL 4MA3B 1PLGL 2YN3A 2VLJE 3ZKSD 3IDYC 4YSRA 2VDPL 3BWUC 4KX9A 5DK0B 1J0KA 5HYSB 4J27A 4WCYH 4PRHA 3ZZSA 5GS1C 3C5ZB 1FL3A 3ARXA 3G5WA 2VUMA 2VC2B 5C09A 3BVXA 1NLBL 1GYWA 1MIMH 4WO4C 5C0BB 1XTMA 3FSVA 3QBTB 4QHPA 5HYFA 2DLEA 3FT0A 2X3AA 1ET7A 1AGBB 3K0WA 1KCLA 4M7ZB 1CGSL 1SXNA 2XLLA 1G7IA 2ZX5A 5GIRA 1ASOA 4M93C 3BAYA 2DQUH 4ZQKA 5J3HD 2AMGA 2OMTB 4RDBA 1BD2A 3RBGA 1OOAA 4F7EB 3GS7A 4LCIH 5DHDA 5DEGA 3QWRD 3MACH 4NUMA 5D7IF 2VKWA 2VMEA 5KSAB 1RUML 4G72B 2A6DB 4PMEA 4PY8J 2IDSA 1AD9A 2NZ1A 3UJJL 5E00B 4PRIB 3VW3H 3KLAA 3NPSB 1MCDA 4TUJB 2JIRA 2VSKB 4XODA 3QHZL 1R3JB 4KVNL 4PWIA 3MJ8B 5ISZB 3NA9L 1KDJA 1WV7T 4RA3A 4QRRB 4WI3A 1JI2A 2G3NA 4WEMB 4UV4L 4MAUH 4JDZB 3GT6A 4UOJA 4HQQL 3DRTA 1P5VA 4Y19A 4RSVA 1X5YA 5DJ8A 6FABH 4Z7NB 1WG3A 2FEDD 2Y7QA 1NEPA 1T0MB 4GJTB 1DBKL 1UOWA 5EUKB 1OK8A 3TBWB 1T7VA 3RPBA 3VTAA 4OCSH 2FJGA 1X4YA 1WA0X 3JTSA 4FX5A 1DQML 3ZY7A 4O4YH 1IVTA 1PQEA 2JQMA 4QRSB 3HS0C 5TE6L 1J0YA 3WNMA 4ENED 4HZAA 3TPKA 5KVGL 1MFMA 5EC1A 5F0PB 4L29A 1JHKH 2B5IC 1RY7B 3M1OA 1AG6A 3B2VL 3L6FA 2DLFH 1DJXA 3C12A 4PI0A 3LN5A 2B7DT 2Z8RA 2G5UA 1AYRA 5D5MF 5KJ4A 2W9LA 5G2NA 1X5HA 4MMXC 4N2MA 4MDRA 4FYQA 4OJEH 2HVBA 2VPZA 4NRYB 4C8XA 4AX3A 4ODHH 2WVUA 4AEIH 2YU9A 4BSWA 2YZ8A 3KCPB 1R4XA 3VSTA 3FH7A 4KK9D 4Z76B 1SPDA 4CVZB 2ZICA 1M1XB 4LLVA 4PIBA 5BRZE 1FVDB 2I85A 1IIKA 3S6CA 1A4CA 1FHNA 1NBVL 4G9FB 3WMSA 3T2NH 1KB3A 4UT9L 5ABZA 2NY3B 5LJYH 1MREH 4NN6B 3IT8D 1AGDB 4LEBA 3RL1A 3D9AL 3VU2A 1JVKA 2EACA 2DH2A 1Y6NR 2JIPA 2SODB 1U95A 2DWSA 3QISA 5CFHA 1FO0H 2FEDC 4OFKA 1OP3K 2WW8A 4JREC 2NY0D 5B39G 3H55A 4LLYA 4B9KC 5LNEA 4HCRA 4C4UA 5DO2D 5MENE 5AYUH 1I8IA 1X5XA 1D5MA 1I3RA 2YUXA 3GDBA 1HE7A 3VWKA 4NNYA 3OD3A 2CCLA 5J11B 3GPEA 3MRQB 1HEJC 4L4JA 2CZNA 4NKQB 1OEZW 2MIZA 5CJQL 1QWUA 1UTDA 2O93L 4MXWL 3N1PC 3L3GA 4I88A 4CNIA 4XMPH 4DKFH 4Q7DA 5HDRA 1YO4A 1NWOA 1C12B 1I1CA 3VD3A 1K85A 3BESR 5J1TC 4JN1L 1PPYA 2OTWB 3BH9A 5HDQH 1IAIL 2WXRA 2XN0A 3BIKA 4NSKB 1CQYA 4OLWH 1SFHA 2C3HA 4G59C 3GO1H 3SDCC 1IW7D 7FABH 3MLXL 5IBLD 1HINH 3SE9H 4S2SA 3EYVA 2ZG3A 2J4WL 4W6YB 4APQB 1QPPA 4KY1L 2HFTA 1UXLA 4KK6D 5FR3A 4GSDH 1BVNT 2FWSA 1JZIA 4JO1H 3DROA 2NW3A 1RURL 1Y18B 3WKML 1QKZL 3MNVB 5TE4L 3RTQA 3QQ3B 4YGVB 1EDYA 5AD0A 7FABL 3D85D 1BDYA 3OJDA 4ODSL 4D8PA 3F85A 3QNYA 1AS6A 1Q9OA 3OGOE 3VXMA 3H9ZA 3BP5A 4LFHG 3UAJC 4E41A 4JFPB 1UOLA 2W07A 4M02A 3H4HA 1RK7A 2PO6A 3OPUA 1LEIA 3ES6B 4GRLD 1RZJC 1QOKA 1SN2A 4I3RL 4NEHB 4NKMA 5FA3A 1SJHB 4MJ4A 3EJRA 3G04B 4LEOA 3BEVA 5DZVA 4H25A 1L9QA 1F4YH 5J9PB 1P84J 4HGKC 1USZA 3SUMA 4LBEB 3QB7C 4O5LH 3V5KA 5BV7B 1A6TB 2ENYA 1PDKB 2DJUA 3P4NA 4UZUA 2HLAB 4GEJA 1BZ8A 4D7ZB 1MCNA 1M05A 1NCNA 4PS8A 4D3CL 1ICTA 4L4VE 1IBGL 1MJ8L 4LCWD 1EJFA 2X42A 1J10A 4BD4A 2QZ5A 3OKMB 5F7EH 3AG2B 5M95B 2Y1VA 3EJZC 4KAQL 5DDHA 4BCZA 4K7FB 5ALCL 3RL2B 3WJMB 2AZUA 2WBWB 3CH1A 5DD1H 5FK9B 4G80B 1BZEA 1BEYH 1H8SA 2R7EB 2YMXL 4L4TB 1RMFL 2YPVL 3OAUL 1RHHB 2AXGB 3TEZA 1MZYA 3X3FL 5MENB 3F5WA 4HU2A 3RPKA 5F3BB 3ULVH 5AW6B 2NR6D 1VADA 8PAZA 4BHUA 3DV6B 1QLFB 3EFDH 2FEEI 2FEJA 3AB0B 3RILA 3KE0A 1MH5A 4I77H 2Q7YA 4NZ8A 1JZ5A 5F8RC 4LOUD 4BQ9A 2F53D 4JPVL 3DK2A 1NH6A 2DEYX 4DAGL 1U8PB 2B9BA 1UT9A 2JIXD 4HPYH 3TBYA 3ZTJG 3BHBA 3Q8FA 3WTUA 4Y8DC 1TOXA 3SGEH 1G7LA 2EZ0D 4PRIA 2ITCB 2Z91A 3NDZE 1CDGA 1LGVA 3COOA 2H6PB 1R3HB 4P2RB 3VXSB 3FQXA 4GBXA 4N86A 4ZT1A 2YD9A 4HIIA 4WEEA 4XAWH 3SGKA 3VH8A 5HI4C 1JPGA 1ZT7A 4PG9A 2V9TA 5CJQH 2MQ0A 4AK2A 4M1GH 5E6ZA 4GAGL 5CN2A 5I2IA 4XC3L 4JFQB 2DQHL 4Z8FH 3HA0A 4GI9A 1KFAH 3CDZB 2G60L 1ACYL 3M17B 4PJDB 1KIQB 3T2OA 4F7KA 4R4FH 2VMJA 4J3TA 3GTPA 3MLSH 3PUCA 3TH3T 1ZVNA 1ZY9A 3UZEA 4LOUC 4XNBA 2UYLA 2Y7LA 1J11A 3EDEA 4L23A 1D7FA 3QXDB 3H9YA 1AO7E 4XC1L 5ICZA 4LGPB 3EF7A 4AYSA 3IGAB 2EVJA 1DLHB 3DJ9A 3RJDA 3FL7A 4JBSA 5F9AC 4OZFH 3U7YH 1DLFL 4ZS7H 4BZYA 4ZMNA 1A3LH 5IESL 4HEME 4N8VG 1A1NB 4MCMA 4PJ8D 1L9TA 3UC0L 5KUKA 3QJFA 1B0WA 1PSKH 2C7FA 3ECUA 1PG7H 2YD2A 2IANB 5EG6C 1EZLA 3REWB 5HYSG 3A24A 3Q8EA 5D55A 1WT5A 1AQDA 4N8UA 5FM5M 4NRYA 5F9OH 3TJHC 1V8HA 4X50A 2DQHH 1A3RL 5BZZA 3B9VA 1KCSH 8FABA 5BRQA 3GHEL 3FHAA 3P3RA 5L8KB 4JHBA 3AG1B 5AKTA 2WVTA 4IMKA 3ZZQA 4M5YL 1E8YA 1IEBB 3FONB 4XPGH 1KB5A 2BSTB 4G8FA 1KCUH 2J1YA 3W9DB 3X2QB 1FFQA 3MV11 2WYZA 3VVVA 2HP4A 3FTWA 1KMGA 1QR4A 4O2FA 4OQTH 2P5WE 2FX8L 3AQXA 2PABA 4EN2A 2F54A 5FX3A 3UPRA 4FFVD 4S1SL 3LRSA 3QC5X 4Z8FL 1GY2A 3CZNA 5DMIH 4POZC 3D87B 3NRFA 4XWGL 3GRWH 5DEJA 4OH2A 3CFKA 2X9YA 4YSUA 5BRPA 4UTBA 3OQ3B 3LB6C 5F72S 3QI9C 4EXPX 1A66A 2L7EA 3MRJA 5IW6A 4X83A 3NFPA 4G9DA 4AJ0A 4MJHA 4MJ5B 4ODBD 3HBZA 3RURA 1A4KA 3SHSA 1ZDQA 5L4FA 1WWBX 4M3HA 5CLXA 5LBSL 3JWNE 4BK4A 3WUWA 3VI4E 1HZHH 2EDHA 4RDQG 2P5WB 3KNBA 4I48A 3MSPA 1J05B 4Z77B 4JFED 2VZOA 3RHWK 1P6WA 1XBDA 3HR5A 3TVMD 3DVNB 1XIWA 5DJ2A 1Z0MA 1B2WH 3AU1B 3BWSA 4LSSL 4MRCA 3S97C 3ELAT 2HT2C 1N6UA 2Y1ZA 4LSDA 3B7TA 4M7LH 5J1AA 2AXHA 5I76A 3TM6A 1F4XL 4WO4A 1EJOH 5HVGB 1F6LL 2C3VA 4MMZB 3BISA 3I3EA 4UB0H 4N2AA 3ET9F 2WP3T 4ZD3H 2ILLA 5JW5A 2YD4A 2K9UA 1C8PA 2VWEC 2ESVA 1WCBB 2PW2A 2VW6A 3VX1A 1R7RA 4S10A 3UX9B 3MPCA 3WLWD 3QJXA 2B39A 2PICA 1KWGA 4HLEA 2C9UA 1JYNA 2IBZX 4JQIH 4BBWA 4HS3A 1VFBB 4GS7B 4MD5A 1PL3A 3BD5A 1XCWA 2JQAA 3IS0X 4XN1A 3QARA 1A6VL 1UXSA 4ZFGH 3DNKA 4FMVA 4PJXF 5JA8B 4HIJB 2PYEE 2A69D 4YH6A 5D7SH 4Z7QF 3RFZB 5BO1H 5CZKA 3TNMA 2PCFA 2FVNA 4XNAA 2HJKA 4XCCH 2W80C 3SKOA 3HR6A 3H4FA 3WNNA 1FGVL 2C9QA 4ZUVA 1UWEL 1XAUA 4HC1L 4MKMA 3IM1A 3X2JA 4OTXH 5FYLE 2YD8A 3E6FA 1NUNB 1U93B 3GM0A 4X7CC 5JHBA 1J5OH 2B4CH 3GSQB 1IEAA 2WXMA 1YUHB 5D5ME 3U1PA 1F11A 3RWJA 4OZFG 3TYGL 4FQXC 1UB6B 3WY3A 2WIMA 4ELMB 3BEVB 3PIQB 1CK0L 5HHME 4JP7A 2QLYA 3NRQA 4Z7WF 2E0PA 3RDJA 4F9LC 4WFHD 1NDMA 3B7UX 5EUOA 5GGVY 3MNVA 2RQ8A 1J88A 4XVUC 4AUJA 1IFGA 1SY6L 4DKEL 1ZHBB 4OV6F 5EBGA 4DUXA 5K9KA 1S9XB 1CMOA 1VKXB 4JPWL 1WZ1L 3N55A 2OR9L 3T1FB 3NAAH 4NIYE 4MS8C 1ZVHA 4ZPVB 4PJGA 3X13B 4CC1A 1J1OH 2B1HL 1G9ML 5DD6B 1JL8A 2BOCA 4IGBC 1NKOA 3DBSA 4X9FA 3V0HA 4KKZA 4JY5H 4ALAH 4JZNA 2I69A 3O8XA 4WJG3 5I18H 2ZAGA 4QXWA 3FQTB 4D9RE 2EVFA 2J55A 1N0XL 1UEMA 4AL8H 1V27A 3OAYK 1I1RA 3FCUB 4YSDA 3S34L 3MUUA 1QI3A 3LDBB 3AXHA 4WJ5A 4Y1AE 4AV5A 3B1TA 1GHFL 3V4VA 4XO9A 1QBML 1WITA 2CG9X 2O72A 5CIPB 1AXTL 2WP3O 1XR8A 2PTUA 2NZIA 4NO2B 4N24A 4W9DC 5SX4I 4KROB 5LBSH 3O6LH 3BT0A 1EGJA 4PJFA 3SY6A 4HUWA 5TQ2L 4HC1A 5B39A 5J5EA 4F7TB 4FYSA 1GRWA 2Q86B 2GYSA 3LNEA 5MENA 3GMMB 3FUNA 2C9SA 3OBAA 3S36H 4MCNA 3T3PB 4YLCA 3KWWB 3VI4F 1REIA 3KMDA 4KZEH 3LZRA 4EPSA 4ELMA 1O6SA 4K71C 2FATH 5DD6A 1AR1C 5E6ID 2P8PB 1UWFA 1A1MB 4L48A 3SGDH 2JA5A 2AGJH 5IW3A 4AEFA 4JPSA 3TV3H 4XOCA 3V6ZB 2DTMH 2XG4B 4L1HA 3X3GH 4ABQA 1KN2L 3K7UA 2ZSVA 4J4PD 2ZG2A 4M4RB 3LMJL 4HWZB 4JN2B 4KZEL 4L3EA 2XKNA 5EU7E 3ARGC 4AGOA 3DTXA 1MRDL 4YL9A 3CC5A 4TS6A 4IBQA 5HHVH 3L7FB 3G9AB 1E90A 1I8LA 5F6HJ 4UV4H 5FYKE 1FDLL 4HGWA 4XPAH 2K7QA 2YC1B 4AH2A 5CWSA 2NY7L 4DWHA 2QFRA 4GO6B 5JHDA 4JNXA 2CH8A 1R3LA 3UAEA 2QL1A 3CN4A 2WYHA 1MHHB 1P0SE 1QFUL 3DOSB 4S1RL 4JUTA 4G6JL 1MWAH 4G6KH 5GM9A 4NO0A 1X7QA 4ZJ9A 2FUQA 2VLLA 4UOZA 4MBRA 4KZCA 5GHWH 2DOCA 2IG2H 4KK5C 2Y4SA 3A6BH 4HF5H 2BSSA 3H9HA 4YK4B 4ZOCA 3MQIA 2NTFB 2WZ5A 3FQWB 2V2XB 1VGEL 3OKNA 3UBXB 3IDIA 2MHAB 3X1NA 5TQ2H 1WFIA 1KQFA 5L6YH 4MXVE 3HC0A 1V55B 3PHQA 4YHYC 4ISVA 3H9SB 5JTWA 1RQ5A 3PHOB 4M1DL 5BXFA 5KVDE 4P23A 1EGJL 1CFNB 5IJBC 1H5BA 5D2NC 3HR5B 2MCMA 1XV8A 3ZSSA 5ICYB 2NT1A 5FKPB 1QPXA 3FQUA 5DD5L 4RNRA 3U4AA 1RZKH 4X99B 5ADOL 1Z2KA 3ZN6A 2V7HB 4MCYB 4UUJB 4BDVA 3HS0A 1B4JH 4JFDD 3Q1EA 5AEAA 3KJ4B 2PNDA 2DQEL 3E38A 2NNXA 3IMBA 4ZOAA 3VFRB 3PJSA 4Q6YA 2Z0UA 2IDCA 4LHUB 5A1AA 1FYTD 5JPNA 1L9RA 1U9KA 1JCKA 4HS6B 3VGEA 4FLRA 1P7QB 1SJEA 3R19A 3CV5A 3MRQA 3N1FC 3TTYA 2WJ7A 4DK5A 4A67A 2X4SB 3VB9A 5IMOA 1QRNE 1UA7A 2YAEA 5DEGB 4BWWA 1ZPUA 1ZWIB 3CWGA 3LHAA 5I0WA 3UPRB 1BF8A 4NRXA 3E2HC 3GTJA 2XWJA 3LZQA 1DANT 4GSDL 5C0JA 1ZRUA 3UH8A 4GO8A 2UX7A 1YN7A 2E4TA 4UNUA 1LXMA 2FB4H 2QHRL 2X53A 3TO4D 3P77B 1JV5B 2BCMA 1L7TH 4JL2A 4TSCL 1AJ7L 4LQFH 5F96L 2W1NA 5C07B 2XHNA 1AANA 5CEXA 1YA5A 2MWCA 2VDLL 2XZCH 4TQIA 4FQ2L 3P54A 1A8JH 1KPUB 4G42A 1HOCA 4JY4A 4WGWB 5DRWA 4F7PA 5IZ7A 1DQLL 1W0YT 5TPWH 1JPSH 4X4ZA 2HVKA 5ADPL 3PQYE 4LPXA 4QOKE 3V0GA 4HBQA 1KENH 2H9GA 3Q44A 3TEYA 1L4IA 1TJIL 4HQQH 3UOAB 3WIIH 4N0UA 3R7RA 4EIZC 4YAQA 3FXIC 1YAIA 4Y16A 4P2OC 5F7LB 4B9ZA 3MLRH 3W3BA 4PGEA 5DHVH 2WNXA 2Y7NA 2O1AA 4XN8A 1G9HA 4OZ4A 5HYJB 2QT6A 4WUUB 4J3XA 3BPNC 4KHTL 4GUOA 1T5XA 5IROD 3ERXA 1YDPB 5I6XB 2J6EH 4M6MH 3WU1A 3WFHB 2JKLA 1UKTA 5EU3B 2J6EA 1ZHLB 4JFDA 2IALB 4UWQB 4ODWA 3VFUA 25C8L 3H85A 3LEVH 3LY6A 1CT8A 1M2VB 3PGDB 4KH9A 3ARGA 2VUYA 3HN5A 2E9GA 3QHTC 4ANWA 1LE9A 3O2VL 4KO8A 5B7FA 1ZHBA 4HLZG 4N28A 4TMPA 4WU7A 4GP8B 5D1QC 3STLA 1PG7W 3UYRH 2XX1A 3ZDZF 3QUZD 4M43L 2WXGA 5LG1A 2FSEA 3R0NA 1G0YR 4TVPE 5DYOB 3KWTA 2E4FA 4G6KL 2CJUH 3A21A 2FB4L 3FYIB 3D2UA 2NY5H 3MRBA 4K2UL 3ZYJA 3WELA 1S9YA 1JK9B 2MOGA 3DXAB 4OGYL 1VZGA 1OF2B 1OARL 2CRYA 5BVJA 3V6OE 3D6GA 4ORGA 3G6DH 5DWPA 5IBUG 4YHZL 1WK0A 5HDQL 5I8CB 1C9SA 4Q89A 4WHCA 3BT2H 3MOQA 4FJZA 2F58H 4JCMA 3VQMA 3KPPA 4QRPA 2Y22A 4MXVF 2B14A 3KM2A 2ZCLH 2XZCL 4XVOA 3M3GA 4JY6B 2WLLB 3N44B 4IRSB 2IBGA 1WBZA 3FCSA 2DW5A 3DLQR 1AACA 3I50L 4JO1L 4HV8B 5E9DA 1KJMA 1HIML 1E9PB 2VE6A 3VRJA 2GT9A 1RZIA 4FXGA 5B8CC 5DR5L 5AVRB 1FSKC 2ICEB 3GBLA 4AYFA 1AR1D 1DDHB 2OL3H 4EDWL 2VQ1B 3IN2A 3MRHB 2QV4A 1E4XI 2BIOA 4LCCB 2ADIB 4J4PC 5AAMA 1OHZA 3HVNA 2WTPA 2I27N 3U6XA 2UWEF 1A6AB 4L4TA 3VRLF 5F7WC 3WKPA 4PR5A 2IQ9H 4HOWA 2VL5A 3AC0A 4OIAA 5D7JB 2BY2A 4LVHC 1TMCB 2VDKB 1HXMA 5KSBA 1UCBL 3TZVA 1IM3A 3VFOA 3DVNA 2XXCB 3KLLA 2F5AL 2HB0A 2P8LA 2YFOA 3HI1A 4ZXBA 2WXFA 4MB1A 1BG9A 3Q6FB 1F4YL 3KYOB 2NDGA 1WFJA 2X4OA 3IXAA 4O5LL 4R4BB 4XO8A 2NT0A 2JLLA 3CDCA 3VXPB 3IXAB 2F8VA 2R0WH 1XGTA 4Y9GA 3CHXA 2P24A 4D8PB 1NCJA 1RIUH 1JZDC 2YAHA 4MNQD 4RIRB 3JVFC 5IMLA 3X12A 1MUJA 3EO1B 1QW8A 2IWGA 2BVEA 2XV3A 5D71H 3CMOH 5AKVA 3V0DA 2VH5H 3CK0L 3QVAA 1TETH 3IEAA 5AFAA 4I3GA 2P80D 2ZOKB 3KXFA 1D7CA 3HUJE 4ILDA 3WKMH 5DYFA 1HS6A 2BP3A 5TE4H 3ZJAA 3ARFB 5IY5B 4DAGH 3VFWB 4XWGH 3LPWA 5DRNA 2MPAL 3E3QC 4IRSD 2RMNA 1MLBA 5I6KA 4XZUA 5CO1A 2ARJQ 2HX8A 1V7ML 1ZGLM 4PV9B 1RJCA 3VFNA 1MHEA 1L0XA 4K23H 5AVXB 3VSVA 4KNTA 3NJVA 5EFIA 5JOFB 4J3OG 4ELKA 5T1MB 4MDIB 2CDEB 3QNZA 3SO3B 4KQ0A 4HJSA 4URTB 2FLBT 4FYRA 3D51A 4XE0A 1CLVA 5D71L 2B3RA 3RNKB 5FO9B 4YOKA 5C0CD 4J3OD 4JM2C 5IF0A 3QDJE 3GMPB 2QDVA 4NQSA 3T9WA 1HHGA 1E4XL 3AREB 2Y7OA 3S3PA 2IOOA 2GFBA 2KZ1B 2WLKA 3KPTA 5IB5A 2NCEA 3FB7A 4JUSA 1FZMB 3MFGB 4DCQB 4Z3IA 1I7ZB 2GAZA 2OJEA 3D12B 4V2BA 2X3BA 5E9DE 5F44A 4ZQTA 1S7WA 1Y6KR 4CMMB 3S8GB 3EJYD 5D7JD 5I0ZA 4X4MA 4F15B 1MCCA 3H2PA 1U2HA 2AQSA 4B60A 3IDJB 4DP9X 4ZMPA 1HOCB 2K0RA 4JY4B 3K8LA 3DA0A 2EILB 4XXWC 5HI3D 5BVPH 1S9VB 5FUCC 1XR9A 4HKJB 5JORA 4MJJA 3FRPA 2NNAA 4GKNA 4FL4B 1KACB 2W38A 4S1QH 2KQNA 2X2YA 3KLHD 5T5FL 4RFOL 2IIJA 1VEOA 3O2WL 4JMXA 5ETUA 2BWDA 4YXHL 3I02B 1NMAH 5JHMA 3MRGA 2N0KA 2AITA 4XPBH 1ZHLA 4OM0H 3D0VA 5T1LB 3FTGB 5D7LE 1T0PB 4PV1C 2KZWA 3S96A 4LVOB 4HAKA 5IQMA 2CHWA 5KYWA 1CL7H 2V4LA 4P04A 3QC8A 1DTUA 4HU8A 5DTFB 1N67A 2OCFD 2JJSC 4UUJA 2F61A 3T77A 3VMNA 1QLRA 5KVEL 4PW4A 4TNVK 1ILSA 3MRMB 4N0UB 5AB1A 3G08A 1M7UA 3HG1A 2CNYA 3PQYD 4QOKD 3GDCA 4YHOL 5ENWA 3TV8A 4ZTOL 5BZWB 3UFIA 2BVQB 1KB9K 1MCFA 3NCMA 4PJ8C 4KJQC 2FR4B 4KVCL 1KJ2B 5HI5C 2BC4B 5D7LB 4Y4FD 2XTJB 1KTDA 5IJKC 4X9IA 1T6BX 4WO4B 5D96B 4P9HL 1VFAB 3ULUE 2XG5B 1FZKB 2GJZA 4Y8AA 1X9QA 4YXLH 2BP0B 1NPUA 3P30L 3RZCB 3SDDC 4HXAL 2A6IA 2ZXWB 2XZQH 1BG1A 4PJAB 5EBMB 5AOJA 1TTAA 3IFPB 4A37A 3PPSA 2R1WA 3GGWB 3BJLA 4X8JA 1N59B 2WXPA 2VITA 3GXDA 1T03H 4BZ1A 5GJTH 2J44A 2WANA 5AVZB 3L95A 3IRZA 2D7OA 1FI8C 2APSA 4I85A 4GXUM 4K3DL 5DVMA 5BO1L 4AITA 4OIFA 3IGLA 1OTSD 2OXGB 2FGZA 1B9KA 3OAZK 4JFFA 1MUJB 5HPMA 1SMAA 4WNSA 2HFFA 1BD2B 1AIFB 1UWXK 2APTA 3N91A 3RI5F 3ZT5A 1V3LA 2WKOA 1JXJA 1KDIA 3CN2A 5KSAC 3U2SB 2EDLA 1NCBH 2ZX8A 4JFVA 4PWGA 2PXYA 1ZLVH 4ZSOB 4QNPE 1MDTA 3HCVB 1D5IL 1SXBA 1VGKB 3K2UL 3ZGHA 1XF4A 3O3UN 1MI5E 4HPHA 4M7JH 2OR9H 4I0KA 4BE5A 4K3GA 4K8RD 1O9WA 4YL4A 3TL5A 2WAQA 5FTKA 1NAML 4JR9H 3QIBC 3LQAH 5E6UB 5F7NC 4AGQA 1LEGB 3SCMC 2VDNH 4LGRB 4PWJA 2Y5TA 2DF3A 4H88L 4BZ2L 4CU7A 1SY6H 1LYQA 2Y7MA 4DKEH 3LD8B 1HDMA 2MKLC 1FIEA 3EYOB 3NIDB 4AEHL 5LAXA 3MLTA 2LR4A 1I1AC 1CLCA 1J0HA 2L4OA 3QWNA 4U1LA 4ONOA 3K71A 3FOLA 1JJUA 4NN5C 5ESQA 5GZNA 1HZHL 5F7DA 4YBLC 1QHQA 3SYAA 4CNIB 3K1DA 5CLWA 5HGDA 4Z7NF 1K9TA 2YRBA 3NIFE 4NZFA 1L9NA 3L5JA 4P3DA 5ACLA 2IO5A 3LS4L 1WBZB 2CK0L 5JXAL 1LO3L 2B2XH 2I32A 2E7CA 3D4CA 4IRZH 1JMZA 4MMXB 3APNA 5D7KD 3GXTA 3VJ6B 1AD0A 2WVVB 3B9EA 3O5AA 3F64A 4HUNB 1WAAA 1LD9A 2ZX7A 2IGLA 2XA3A 4OGXL 5EZIL 3OWEA 4OKVA 3FOMA 4LLWB 3GZQA 4ERSH 1D5MB 1JHLH 2FATL 5LGJA 1KCRL 3QYCA 1NICA 3B8YA 3K8KA 4Z3TA 3UTTA 4M4PA 3QQ3A 1FVEB 2YPLA 4P5MB 4YHML 1D3CA 4Y2LA 2DI8A 2FBJH 1J18A 3QWRA 4WUUE 2A2QT 1B3IA 2A9NL 4YDLB 1KJ3L 3DPBA 3UAJA 4ABUA 2F74A 3IVKB 4M61B 1KCVL 5HHPB 3DPBB 2G9KA 3N1QC 4XXCC 5EZOL 4XPGL 3TEWA 1KCRH 1SIWA 1Z9PA 1N68A 5FGSA 1OE1A 1JZEA 1Q90A 3HE6C 3MLUL 1QA9B 5E8EA 2NQ3A 5L8LB 2O6FA 4BEIA 1NAMA 2EYTB 3VXNB 5IK3B 4GP4B 3PWUA 1AGCA 3FNKA 4BZ2A 5ITFA 3SE4A 4AK1A 3TFKC 4CDGC 4YDKH 3ILPA 1GSMA 4KXCA 2IALA 2X6UA 5DJ6A 5E4IA 1AD0B 1ZJBA 4HMEA 4FFZA 5F88B 4KK5D 2R2EB 4L4VD 1KPRA 1QSVA 1CR5A 3FQNB 4B0MM 2C1PA 2ESVE 3QUML 4MAYC 4FKKA 4FFYH 2QQNL 4UILH 5HYJA 3AS1A 4R7DA 3VFGL 1I7UA 2CDGB 2OI9B 1NCDH 4P3DB 5L0QC 1TQCC 5BS0E 5IHUL 3JVGA 3IFLH 5I1DA 3MLVH 3VQ2C 3VGBA 4GRWH 1MVUA 2HLFC 2P44B 4JJHA 4CL7A 3N2JA 5HDBE 1G7QB 5FW6A 2XWJB 1J1PH 2DWTA 3BGMA 3V4UH 5KVEE 5L2KD 4HUCA 1RU9H 3WEXA 5FGRA 1QO3A 4J3WA 5D6CA 2Q8BL 3FFOA 3L4CA 1UJTA 2D9QB 1KEML 4ZBJA 1UGKA 1UACH 2OX5A 3BIAX 1MIML 5KVGE 4ZYKA 4WI0A 3ZIYA 4Z78A 3MI6A 1RUQL 1RFDL 2BWQA 1XB6A 2XQBL 3BUPA 5AW7B 1UHDA 2PXYC 4YC2B 5E9NA 4XNMB 3V0IA 2QQNH 4UILL 5F7YC 5E5RB 1NEUA 4YVUA 4EKXA 3SGDI 3MO1B 4ZTPL 5K1VA 2ZSWA 3DMRA 4AOKB 2GITB 3W0WE 2VM4A 4OZGB 1CZ8L 3Q3GB 1H3UA 4PMFA 4UU9A 3CNKA 2XN9B 1T21A 4Z7VA 5FCUL 3V0FA 4TNEA 5FKPA 2J6EL 1HYRC 2L3BA 1T1ZA 3SQRA 2LVCA 3VXMB 4NQTA 1A4KB 1TZGL 1EZVX 1INDH 4LKCA 2JI2A 4V1DA 4JG1L 3QORA 1QFWL 3NJMA 3P9MA 3NUKA 5TE7H 4W9LC 2X28A 1I75A 2YZ1A 3RUGF 3GUTA 3ARED 4ZQKB 3O4OB 1QD0A 3EHBB 5KJ7E 2V17H 3L3OC 3F12A 1G9MH 1AS8A 3F6JA 4DN4L 4PD4J 4JG5A 4MD5B 4Y4KB 3VI3E 1E40A 4L9LB 4UQAA 3V0AC 3CE1A 4JJ5B 4DN3L 4ZZFA 5ITBL 3HBQA 2N7SA 4TLSA 4M56A 2ZYRA 4XCNB 1SXCA 2CPCA 5LGHL 4YFLI 5I1HH 5JW5B 1U8NA 1JHLL 3IDGA 2JXMA 4OCYH 2ZUVA 2Q8BH 3VA6A 3CFBB 1DR9A 4KRPD 5IEKB 1UGNA 5ACZB 1IGTB 4KKAC 1FNLA 1A9BB 1G1KA 2P5EE 3FZUC 3H56A 3WE6A 4IRJA 1JF1B 5C0GB 1OSYA 2DDQL 3T6XA 3C9NB 5HP5A 2DQTL 5HYQB 4FNQA 4GAJH 1R5WB 2EC9U 2NY6D 3N42F 1OAKL 2QQQA 4CILA 1XEUA 2TSBA 5HHOB 3HPLB 5DU7A 4GIAA 5DHYA 3LOWA 3EFFB 5C0DB 2GW5A 3MXWH 1GIGH 1WFTA 4G3YH 4RFEB 1PD6A 5AW9B 1MVFA 1T0NB 3QPXL 1MFAH 5JW3H 1L7TL 5I1AA 4FFTA 2BIMA 2ATKA 2QMJA 4NAMA 4UMSA 1Z9MA 3PABA 1OT4A 2VT0A 3A4EA 1MPAH 4N9OB 3ETBF 5EBWB 1GGIL 1IQWH 1ZV2A 5CGMA 1FAKT 4NBZB 5FO7A 2DQDL 1G9MC 2IPUK 3QG7H 2FL5A 2PPAA 4KRPC 1L5GB 2JKSA 2NY4C 3OB8A 5E2JA 4K3HA 3IJHB 3V0JA 5F7EL 1YEKH 4H8WH 2LFEA 3TBVB 3CFQA 3H53A 1FP5A 2EO7A 1QACA 3OHXB 2WGXA 3FCGA 1LO2L 3H7LA 4GMTH 4EDXA 4CJ0A 2XFGB 3V95A 5DUBA 5JR1H 2XTJD 4JHWH 1JZ6A 1TTBA 3QXWA 5FHAL 4HKBA 2F54E 4Y1AD 1NBYB 4KOCA 2I26N 3ZE0F 1J8RA 1J9SA 2J8OA 2LABA 3E8UL 1EX0A 3GMQA 3NZSA 4GQ9H 4F7CA 2ZT9C 2OTUB 5A6IA 1XF2A 1JOIA 1U3JA 3LRKA 2UY6B 2R92A 2EXYD 2ZCLL 1ZS2A 3ETBJ 4YPGA 5IMKA 3REWA 5C08A 5CZXD 1ASQA 5TPWL 4A2FA 5HHXL 1I1YA 3VD9A 1X7TA 1T89A 3AUWB 1QATA 4ES9A 2AANA 4M6OH 1RULL 4OQ1A 1AO7D 4F8TA 3CFJA 1VCAA 3T4YB 2CLVB 1CR9H 3EFOA 3CVDA 4ZFZA 5ID0B 2YAQA 1BCIA 2FJSA 4JDZA 5IB1B 3HC4L 1BYOA 1MDAA 2HUEA 4ZMOA 5C8JB 3GSRA 4ZW6A 4HK0B 5HSFA 4O4YL 3NJNA 2C4FT 2NY7H 4BH7B 2P5EB 3MLXH 5BJTA 1M9SA 2NY1C 3GPSA 3VSQA 1SLUA 4L8DA 3GM8A 4CSSA 5F6IC 1T66C 2NZ9C 5LQBL 4LU5H 3TOPA 2DRUA 1TTFA 4KKQA 3OWRA 2DV6A 3ULUD 3S0PA 5AZEL 1MWAB 4MXWH 3RY6C 1LP9B 3C08L 3WUWG 5IWLA 1IV8A 3OAYH 4KXZI 4ANXA 2VQUA 2E7MA 2NNRA 3A5VA 3HAEG 3QHZH 3N43F 4QRQB 2XDHA 4N0RA 3TZVC 1IM3B 2CCWA 4FHKA 1MG3C 2ZOTA 3QUGA 5BOPA 1ROCA 4PJAE 5F9OL 3MUZ1 2JSFA 4PJ5D 4B6ZA 4PJIE 3UEQA 4U0RB 4U31A 3VG9B 4DF9A 1O7SA 3K71B 2AEIT 1KBKA 3R18A 4KI5F 3GEWB 3MLPA 2PTVA 1Z3GH 4FLHA 5CLYA 3UYPA 4D0DB 2BSRA 4QAWA 4PB0H 4L3ED 5EBLB 5KS9F 2BSRB 4FP8L 4PREB 1OP3H 1L6XA 5FK9A 4I4WA 5AYQA 1AZUA 1W91A 4LIQE 3VFPB 2H3NB 5MEPA 4A6YA 1IGYA 3T3ME 1NFIB 1GZQB 4BH8A 2ICEA 4Z3FA 5DC2A 4ALAC 4Q2ZA 5A2CA 4LLUA 1N64H 1ZA6A 4UT7H 4OF3A 2GPZA 1AS7A 1ETZA 3MUY1 3PWPB 2QJDA 4FI8A 4RQQA 4HPOH 1R33A 3MRRB 3FC8A 5AZUA 1YLBB 2G3ZA 4BRVA 5SWSE 1NCOA 5IK3A 4JB9H 5HGHA 3NFSL 4PS4H 4MNQB 3GIZH 1KXQE 5DEFB 1U8IA 1YHPA 3U2IA 1SVCP 1J05A 4BFEA 2A4ZA 1WAEA 4OCLC 1YJDH 5IJKA 1IO4C 2ZQKA 1HCVA 4IU3A 3VYNA 5JYLA 3DUSB 1WP6A 2EXSA 4N87A 4YZFE 5DHMC 3LQAC 1MLCA 1AW8B 2EDBA 1S2EA 4U6VL 2GB2A 4S0TD 2DMGA 2CK2A 1KZQA 3DRQA 1A1OA 1B88A 5ISZE 3S5ZA 2LE9A 2VR8A 3NCBB 5HHMB 2W9EH 2TRHA 4Z3GA 3OPZL 3SBRA 1T5WB 2NY2C 3EGSB 3IDNB 4YO0A 1KBVA 4E9QA 2OPCA 1YNJD 1NGQL 4AYBA 4P57A 1RZFH 4LCYA 2G3MA 3IKCB 4XO4A 4QNPF 5DFVC 4NNPL 3GKWL 3ML1A 1TR7A 2E27L 1UM4L 2ZXEB 2GSGA 1DUZA 3BSZA 1RXLA 2OTUA 3VFUB 2VN5A 4RISL 4ZMLA 3OV6A 4IGBB 5E6SB 4YPGB 5D5MB 5IMKB 3ZE2B 2EDMA 5GGSA 1EUTA 4QY8A 6PAZA 5I30L 1U8KA 3EOAA 3QIUC 1ZV5A 2NY0B 3L4XA 1AHWC 4GQQA 4NLHA 2E75C 4LSPH 3AVEA 4WY7L 3CQZA 3IJHA 2ODHA 2R1YB 3S3JA 4B9YA 2ORBH 4DFIA 5FGBA 1CJYA 4Y4HA 3TNNA 3JSSA 5C18A 1YEHH 2GVYA 1RZFL 1T22B 5D70H 2VERA 3P0YL 3HN8A 1QLEB 2R56H 3HI6L 4I5BB 1T83C 1YNKL 4S11A 5EBWA 5DUBB 4F80A 4W9KC 4P4RB 2YSSB 4QI3A 3FHQA 1OSPH 3HUJB 5C0CA 2EDQA 4KRMB 1Q0YH 2W60A 1T7YA 4B41A 1UB5B 3Q8AA 5ALBH 4KNQA 1MAKA 4KJWC 1TWAA 3CSYB 4DVRL 4J1UB 1U36A 2YQGA 4XI5C 1EO8H 1VGKA 1DE4A 4IOSA 4LBAA 3BGFC 4OSUH 3B2XA 4M62L 3SCMA 3IB4A 3QIWB 3EG9A 3LZFL 3QUYD 5DI8A 1IEHA 3QXAB 3V8CA 5D1ZD 2P46B 1AA6A 5GGTH 4QTIH 3QJVB 4EUPH 4HS6A 1LDPL 4CU8A 2F19H 5C0FA 2ZCHL 2CRIA 3PU7A 5FCSH 2X4SA 5JHAA 3C60C 2Y2WA 4WUUD 3EZJB 2VPXA 1MOEA 4J6RH 1KY6A 4XP1H 3OXSB 1KYUA 5ICXB 3G6AA 2JK5B 4C47A 1JZGA 3GSXB 4OZIF 5CD5D 4DEPC 2FCBA 1EFXD 2R69L 4OF0A 5EZLA 1FC2D 1K83A 3T4AC 3RA7H 2LU5A 4W1TA 3K91A 1WEJH 4YFDB 2H47C 4IHOA 2VAJA 1TVBB 5IBTL 5IP4A 1MNUL 4UM8B 5KG9B 5IFJB 1BEYL 2DIAA 3K1KC 4OD2B 3P0YH 4F93B 3N41B 5DRNB 3RTLA 1B4LA 2DM2A 3EZ8A 4Q9BA 3ECVA 1FJ1A 1M05B 4AM0A 1T0MA 2X10A 3A6OA 2VDOH 5TK4A 1QMUA 2V9RA 4WY7H 4C56D 1KGWA 4UB0L 4P07A 3HIZA 4B9FA 2ZWSA 4KK6C 1L8FA 5HGBB 4PCSA 1PQFA 1U8QB 4KNSA 3WY4A 4Z7VB 3CVHL 4H13C 1U42A 3SE3C 5HBBA 3T2LA 1FN4B 4AIZB 5H94B 1A4JB 3GUFA 3PGCB 4PJHB 4F27A 4PJCE 3LKPB 3EG9B 4KJQD 5DI8B 3EKCA 4PCKA 3QWZA 5E6RB 4HZLB 4HOMA 1FFRA 4WWKD 2XKNB 2JKXA 5FWRA 4MLSA 1U3HC 1IQDA 3KJ4C 1QVOB 3ZYIA 3P9LB 2X2JA 1MFDH 3X2NA 3FPXA 4H8VA 5FOJA 1CFVL 1PPIA 4P4KD 1FF5A 3RFRA 3VI4A 3VXQB 2IPKA 4BA0A 1MCBA 4KQ3H 2X0WA 5DZOA 2BJMH 3KLHC 3ASWA 3QO0B 3EO0A 2WXQA 5DC0A 2Q76B 2AF2A 5CP3A 3T0XA 2PLTA 3HB3D 4U1MA 1L9PA 1EBPA 2X2IA 4S1SH 1I7UB 2CDGA 1YMMA 1GS8A 1NC2D 2K6YA 4YGVA 3TBSB 2J5LB 5E70A 4OGZA 3UO1H 3VXUA 4OCNC 3DBXB 2Z92B 4EI5B 3TESA 1MVUB 3HI6H 4GKLA 1E42A 4MGXA 2XNAA 4W70A 4UV7H 5E0FA 4TL4A 4MZ3A 3D39D 4LL4A 2YIHA 5ANMB 5B39B 3TA4D 4M1CC 2NNFA 2HRPH 3IWUA 4K5PA 1FZMA 1Q0XL 4S1DC 1B0GB 3FQTA 5E8EB 5B21A 4Z7OF 2VDQH 1JRHI 4HS8L 5TD4A 3W57A 3FQ1A 4BXSV 1F4XH 1INDL 3HG2A 4JFSA 4PY7A 3QUYA 3ABGA 4PJGF 4TUOB 1R47A 4JQIA 4ABWA 2WTRA 4YE4H 2VLRA 3CVHA 4AQ1C 3DK0A 3WAKA 4AQZA 1ZKAA 1MSPA 4CN1A 2EKSA 2UWEE 2NRDA 3HE6A 1EQWA 3P11H 5KBKA 1PY4A 3I75A 1JGIA 1QQDA 4JGMA 5AB9A 1AKJD 3WMPA 4N2BA 4FFZH 4PRDB 2ARWA 1UM6H 5C3TA 4K94H 1MLCB 4Z7WA 1P1VA 4GRWB 2FQGA 2FBJL 4L2LA 4L1LA 3J27A 4ZD3L 4QO1B 1FIGH 2MH4A 1MJ7H 1QNZH 1JGUH 4YNYA 2ZUQB 2X6VA 1L7IL 1HC1A 1E7VA 1QYGH 5G5DA 1Q72H 3UZVB 3RA7L 4GP5B 3BN3B 3FT3B 1EXHA 2K70A 1SXZA 2EEXA 2BVPB 5JNYA 2PPEA 5DSCB 1A9VA 5D1QB 1E5AA 1IAKA 1M1XA 2WINA 1TQTA 4OCWH 3IMUA 5DUML 3SJVE 4A7VA 4Z76A 5CEZD 4ZTOH 4BFRA 4PJCA 1HEZB 4IK7A 1UH3A 3EYQD 4GIPD 1LO3H 1JI1A 1XGTB 1BBJB 3S8FB 1QEXA 2HVJB 4NFCA 3QA3A 2CO7B 2H2PD 4E5XG 1PEWA 3SDXF 4GLRI 4AKPA 3CSFA 4HJEA 2JJVA 4CRPA 4XPTH 4M8QB 5F6HI 1RK0A 3RVVD 1PT1A 5SX5H 2VYRE 3OG6B 1JWMA 1NEZA 3NCWA 4PGDA 5CGYC 1UZ6F 3R7QA 1BBDL 4I0CC 1RUAL 4GA6A 2X4RB 4P2CG 5GSVB 2AV1B 2OSXA 5KZCB 2R0LL 3NGBB 5L9DH 5D72L 5L88L 4JHAH 3IE9A 1SDDB 1DQDH 3EYSH 1VLXA 4R0LA 5I1HL 4FXKB 1PG7X 4HX1A 4IS6B 4ZNEE 2VQ1A 3FW6A 4NZDA 4JQIL 1PQZA 5G55A 3VXUE 4CBZA 4XMLL 4DN3H 1DVZA 1OWRM 2KYIA 2P5WD 1ZLWK 1ZLEA 4I89A 4HLZH 5IBLC 2DPKA 3B5TA 1FBIL 5KN5A 3DIDA 5DS1A 4TNVF 1WH0A 2CGYA 2HFFB 2E3VA 1AKJB 1ZK5A 4LSVL 5KYYB 3P11L 3QUMA 3PNRB 5IB4A 2HPTA 3SE9L 3RNQB 3Q0HA 4C58B 3L5HA 3FMGH 4G11A 2Q20A 1GJIA 1QABA 4LPUA 4LPCA 4F37K 3KWUA 3WEAA 1BEXA 1IBBA 3TO4C 4G1MB 4JGJA 1EDQA 3HCVA 3A67H 2BE5D 4MA8H 4NO5B 2A74C 3NP3A 1BLNA 1A7OL 3O45B 3QJQB 4MHHG 4PWFA 4PLNC 4XZ4A 3ZDXF 4RGOH 12E8L 4I1RA 3CSGA 4OZIA 3QXAA 4P0DA 2HTKD 2XXFA 4XX1G 2O61A 1PZ3A 4X9HA 2AVGA 3K81A 3UL4A 1Y0LB 3U46A 2QADC 3LV3A 4FZEH 1SVZA 1WVZA 4UM9D 2UX6A 1CICA 5A2AA 1YEFH 2DM4A 2G2RA 2W60B 4O2FB 1ND0A 5F71A 3C5SA 1XB8A 2XICA 3LRSB 2Q2EB 2PPFA 3Q5YA 5IROC 3MNDA 3DHPA 4Q4IA 3LXBA 3WJJC 1OT1A 3QC6X 4CA4A 3HE6D 1BQHA 4Q0XL 5DGRA 3RZCD 1HL9A 1R3IL 1C5DB 3BAXA 4MJIB 3WIFB 1TLMA 3SYCA 4LP4A 4LRNL 3EJJX 3MXWL 4JN1H 4O51A 1MEXH 2TRYA 3HZYB 1UQSA 4J2QA 3TASA 5CF3A 2DMKA 3A4FA 1CFSA 1JCVA 4JW3A 3QWOB 5BRZB 4ONGH 2WLYA 3T77B 1BFTA 1HCZA 5CKAA 5IHBA 2WXNA 2JJSA 3LKQB 1OA7A 1GW0A 2C9AA 3G08B 3HG1B 4OF6A 2MQ3A 4FQCH 1R19A 1UVQA 3EIFA 2VL4A 3LS5L 4Y88A 1GHFH 1NSNL 4KMLB 4RLDA 3MBWB 1Q9WA 4ESKA 1NBZA 1DHKA 3WJJA 4JQVA 3QAQA 2IQAB 2A9DA 2EECA 4OCYL 2QPSA 2E6QA 4TQ8A 3NEXA 2RFXA 3RWGA 2FHBA 3ZKQD 4ZNEA 2DQFA 4XRCA 3BP4B 5I19L 2HCZX 1MHPH 3NJXA 4G83A 1TJHH 5T1LD 5ESVA 4HJGA 2OMZA 4F15C 3RWJB 2EE0A 1T1YA 1KGCD 1CFTA 2PI8A 2A0LC 2NW2B 1CXLA 1EHXA 1QRNA 5HGAB 2D3VA 3ARBC 2B59A 1NCUA 4PG2A 4HUXB 2C8NA 1KC5L 5IB3A 4HETA 3QHFH 3DX6A 2NCMA 4YQXH 1AGFA 1TF4A 1S7XA 3NK4A 1WIOA 2VMDA 3MRFB 2X38A 2JIXB 2AEOA 2BX5A 4UT9H 4ZUTB 5C0NC 4GBXC 4RMUA 4X6FB 4ZO8A 2WCGA 4XOAA 1HQRB 3N04A 3P73A 1IE5A 2Y23A 2EVGA 2PWHA 3SDDD 3WTYA 1IKNA 3US0A 3QNZB 2NYYC 4GRLC 3WIIL 2EICA 5FYKD 4Z23A 1JZ7A 4NBYB 3DUUB 1JGEA 3CQQA 3FTYA 3NZ8A 3PY9A 4RGNB 4TUOA 4DK6A 1OKEA 3TEXA 3HG4A 1NFIA 1RCYA 4JM2A 3S4SG 1N19A 4R5TA 4QLWA 1AZRA 5F1IB 5JIKA 5C9JA 3QRLA 5M94B 1RURH 2R0KL 32C2B 2EEDA 4JPVH 1I1FB 1A7NH 4U6VH 1VFUA 4N8VA 4R8WL 5GRJH 3IFNL 3IAQA 4FTVA 4P8QA 3UACA 1OZTG 4PW9A 3DRQB 1PGRB 3DBXA 5EOCH 5HHQB 4HW6A 3NJHA 4H8QA 2HFEB 4UMGA 4AT6B 2K6WA 1EUUA 5T5NF 2PF6A 4N6RB 4PUBH 4PJ8B 3MODH 4DO5A 3GSUB 1JUFB 3NZUA 2J6WA 4KKCD 3AFLA 1BX2A 3DURA 2C3XA 4I9WD 4KWUA 3KGRA 5FOBB 3ZQWA 3DX9B 2X7LA 8CGTA 3QZLA 2AQ2A 2Y6SD 3BKML 5D96C 2HWZH 1NFDE 2WSKA 5TE7L 3RL2A 3ASNB 5A2IH 2H2PC 4CRYG 5E1AA 4KHXL 5CWSB 2X6CA 4FG4A 4Z7QB 3L7EA 2ZNXA 5C0RL 2PNWA 1U33A 2DIBA 1TWHA 3ULUF 5DC9B 3S48A 4HIPA 2Y36L 4EZLA 4LQ1A 1SYSA 4NNXA 1ZA6B 4TRPH 4FN0A 5D93B 3U30C 4Q2ZB 2FJFB 4FP8H 3NIDF 2XN9A 4OLYH 4LSRL 1SEBA 3U7YL 2CIKA 4MSWA 1H5NA 3RY4A 2N3JA 2EC9T 4FYTA 5CHNA 5D1ZA 1MNNA 5LQBH 5IMMB 3IDUA 4LF3A 5DJAB 1PZ2A 1WCMA 1NDGB 3BKYL 4BGLA 5EF3A 5D7JA 3SE8H 2FO4A 3RX5A 1EK3A 2R4RH 4OGAC 3F05A 4TSCH 4RAUB 3ESNA 4K4KA 3PXLA 3GSUA 5DR5H 2YUJA 1EO8L 2D31A 4L5FH 1E9OA 1U3NA 2Z8SA 4IBSA 4X7DC 4BGDA 3MV7D 3VU1A 1R5VA 3HUJF 2AJ3B 2H6UA 2ZONA 4HIHB 4UNTA 5B6CA 1EZVY 3OVUB 4LVNB 3QPXH 4F20A 5TH2A 4MQTB 3ILPB 4OT1H 2Q9OA 1Z9SA 4PS4L 3UTZA 1T6VN 3GJEB 1DSFH 3NPZB 4KUCD 2OS7A 2ICWB 4K9EL 5EA0H 5HVFB 1MVYA 1W72L 5MEND 2V2TA 3GEFA 3PWJA 1GTFA 4OLUL 1NUGA 1BJ1J 5BCAA 1XCXA 5FYLD 5EV7A 1OVZA 1JGDB 2J1XA 3ARYA 3EXLA 3EDFA 4X4KA 1JNJA 1RIUL 2X05A 1NPNA 4FTVD 1U4FA 1ASPA 1AE6L 2B0SH 2VDQB 3G5XA 3M8OH 3TA3C 4RGMC 2XXGA 4IDJH 2B08A 3FB8A 4YBLB 4ZUUA 3IJYA 4LLYB 2N4IA 2KERA 3IYLW 3EFDL 1S8DA 2E7LC 3TBVA 4XGZB 1YPZF 1KJ2H 2X4TB 3EJSA 5I8KL 4KHXH 4WFHE 2GI0A 4A6YL 1BQSA 5MHSE 2H0PA 1HL4A 3DO7B 1YNTF 1L6PA 1IGML 1XF3B 2D03L 4QAMB 5AOMA 3RPIA 1BXVA 7CGTA 5FC9A 1FYTA 2NZ9D 3AMLA 1AGDA 3A47A 3RL1B 1LO0L 2J20A 1OP5K 5JW4N 2V9QA 3HUJA 5GZOD 2XRAL 2WBJD 4E5XA 4AVRA 1G0XA 3OXRB 3T65A 1D6VH 1G5AA 3G3LA 5HHNA 2JNZA 2CRZA 3SPVA 4NQXA 1E3FA 1YZZA 1Q4NX 5D7KE 4DKTA 1YDPA 4L37B 3SULA 1YYCA 2VR6A 3AM8C 4MZIA 4RGND 3ZDWA 4RMRA 5ESQB 1M9WA 2LVEA 1A5FH 5DJYB 2L04A 2BNRD 2FIKA 3LNIA 3MBWA 3QO1A 1PAZA 4POUB 4FMKA 2XPGA 2B4CC 3KGTA 4CVZA 1WRFA 4NHUB 4OZFB 4MNHA 4OT1L 5BW7A 4L18A 2NUTB 1GPOL 2QHLA 4RCAA 4MCZA 2YJQA 5B7MA 4NUGL 1QBBA 2ARJB 4XOEA 4Z7VE 4NKOB 3JQOB 4C4KO 1AVAA 4NCDA 5CSZA 1YY8B 3ZRSA 4AVHA 3QEQA 4BKLA 4BZ1H 1P84K 2X0UA 3P77A 3BSZL 4U1MB 1N4XH 4UBDC 4MA1C 4PYHA 4N22A 1WC7B 2JKTM 4IHOB 3U2SA 3C75A 1AH1A 3GBEA 3FO0H 5B4MD 5C07A 4LAQL 5BZXA 4ODTL 2X40A 2E8ZA 1H8NA 3H0TA 4PRID 4QLRA 5D1QD 3ALXA 4EBQL 5JPNB 1UD6A 3NT0A 3K2UH 5HYJE 4NOHA 3C6SB 1MCOH 4MHHI 5GGVL 2KPNA 5KJRL 2Z65C 3BFQG 3VAEA 3QDJB 4GG8B 2VXQA 4H44C 4DKAA 1CICB 1OAXL 1Y6MR 4PU2A 4Y4HD 4NOBA 3BXNB 2OMUA 2PXYB 1HHHA 2W59A 4RNRB 3QUXA 4XPBL 2EUVA 1Q9LA 3C8KB 1NFAA 3DPDA 1U8JA 1CF8L 5J6SA 1IC7H 4X4YB 3BHBB 3VXRD 3TU6A 1XIWC 4ZFGL 2ZF8A 1DVUA 4FEIA 4TSBL 3O3AA 4NI3A 1JK8B 1XAKA 2G0KA 3FT4B 2VQTA 2VLRD 1EEZA 1UJ3A 4DGYL 3QJOA 4UBDD 2NPLX 1RV6X 4TN9A 4AQEB 3WTSA 5D1XC 1C08B 1K4CA 1LMIA 3I9AA 1KY7A 1IGYB 1H0DA 1X9LA 2YQ2A 4Q97A 2JIQA 1G7IB 3MV9A 5DA4A 3D1MC 3SPGA 2ZUUA 2CBOA 3QJTB 1GZPA 3CZEA 3GMNB 4FZ8H 3Q7JA 4BZ1L 3KPRD 3HNVH 1OB1A 2K9FB 3OZKA 1S3KH 1RU9L 4L9LC 3GI8H 4CGUB 4R7DB 5GS1A 2F2HA 4J8RB 5DZAA 1S5IH 3HNTH 2BCKA 3QEQD 4NQVA 4NM8L 4DUVA 5CD5C 2R69A 5LKNA 2FX8H 5K9QG 1YN6B 3QFDA 2O6EA 4L0ZA 3ABLB 5CR1A 5KYXA 5JHDB 1CFVH 3IU3B 5HVWA 3LEXA 4R2GD 5F3FA 5C07D 2OQJA 3NACL 2BOLA 3AW5A 3WUZA 5D4JA 4A7TA 4XXCA 4NN6C 1OP4A 4GG6A 4NDMB 4HPYL 5I1GH 1JGLH 1OANA 3AGWA 4WF7A 1SJHA 2CD0A 7PCYA 3HG5A 3QQ4B 4N0YL 1A1MA 1ORSB 5DJZA 3F7LA 3VXTB 2LU7A 5E08L 1NIEA 2NX5E 5DRXB 2EVHA 3DO7A 1S3KL 1URZA 2PP8A 4ONFL 4WWNA 2F74B 3IVKA 1UXMA 1PZ5B 3X2OA 2VDRB 4PBDA 3UTSA 1KGUA 2F1EA 4DO4A 5I5RA 5B3NA 5B7EA 4C83B 4UQ9A 2G4GA 2PCXA 4JQXC 1N7MH 4EZMA 2AXWA 4Z0BL 1DBAH 1UA6H 4LB8A 4XP5L 5B1AB 2VNCA 4DVBA 3UTTB 2GJ6B 1FBIH 2GSIB 3ESUF 4IHBA 1DQQA 1OGAA 2WCPA 4FABL 2H32A 1YEDB 3KZ8A 4NZUL 5H2BA 1FV1B 1GC1L 4HUWB 3TT1L 3EHBD 2EIMB 3UZEC 2ID5A 3PS6A 5KZCD 4G8GD 1B9ZA 3LKSB 1N7ML 1U8OA 2NY4B 3C60D 3GMMA 3MKGA 3O2DL 5EEWA 2H7WA 3CU1A 4WI8A 1S9VA 4POYA 4KPHL 4WK0B 1UUSA 3LXAA 3QEUA 3ILDA 4KO6A 3R06A 2EE6A 3QZMA 5C0AB 1QPKA 4N5UA 3GMRA 5IFAL 4QY8B 1I82A 2GIMA 4NKIL 4JZJC 1F18A 1MCLA 5IQ9A 4UQ3A 4YDJB 5AVQB 4K3DH 3CTTA 5IQ9B 3SDCB 1BIHA 3IKKA 1DBJH 4HIHA 4WHTA 2MCPL 1XF2B 1BMWA 1DUZB 2CUMA 3W81A 5KJRH 4GUCA 5FYKL 3ALWA 2XSKA 1XZ0A 5INCA 4NQCE 3V9CA 4APQC 2BMKB 4FQLH 2X4QA 4WWOA 2EE3A 4QRPE 3OKOA 4NP4H 4WV1B 1KYOK 5E56A 4N26A 2Z35A 3MYJB 4HCGA 1CLYL 1E27B 4NQEB 1MFBH 4EI0A 2GSIA 4M29A 1P4UA 4P3CL 5DUMH 1RIVH 4YBQD 3US1A 4OGQC 3PLXB 1I9RL 3D3VD 3F7VB 2XWTB 4RGNE 2EDTA 1L0YA 3GTGA 4RESB 4JO2L 4LARL 2VXTL 1KTJA 1GYCA 2ZUXA 1MCWW 3UTSB 3K6SB 1U3ZA 3V6FA 3L4TA 4NNXB 2BP8B 4R7VA 1F6AA 3NIGE 4MTMA 2ZPKH 2G0LA 1CICD 5SX5K 4OF7A 3GTLA 2XY1A 1AHMA 4P5KA 3FU3A 1EEYA 5LBGA 2AE0X 1TO5A 3BP6A 1KBWA 4FFZL 5T3ZD 4XMZA 3SD5A 4AIZA 3TP4A 5GS0C 1WJ3A 1AQMA 1WBYA 2WOBA 3GXIA 3WS6C 3UPAA 4R84A 3PPEA 1JIBA 4K9EC 4XH2B 5F7AA 5GRVL 3GI8L 3KJ6H 4HJIA 3I6GA 3DHJA 2JB6B 1PVHA 2VLKB 2EYRA 3S34H 4U3SA 4UOW0 2R1WB 3GGWA 3B9KB 5SWZB 3EADA 3WS3A 1TZHA 4OCSL 4KXBA 5HYQA 4AT6A 3W38A 3AB0C 2ZKXA 3L2LA 3BE1H 1I1FA 1EO7A 3Q06A 2X9WA 4X7EC 1F3JB 3C60A 2VJ0A 3HZKB 4WK4B 3T8VA 1E18A 5AAWC 3VXMD 1ND0B 4PJ7F 4GY4A 1BJ1H 3ZL4L 1VIWA 3SOBL 2UUDH 2CO6B 2GHZA 1L3NA 4IBYA 4OLVL 5T5MD 3OF6A 3MA7A 5JO5A 4YHKL 3H54A 1QFUH 3MLZH 3TFBA 3QDGB 3T2QA 2O6PA 3X2IA 2GBUA 1DCEA 1PYWB 1O7VA 3BLKA 4MQXD 2B1AL 3BQVA 4OJFL 3IAPA 4L8BA 5J6HB 1A4AA 1DFBL 2FLMA 4OU3A 1WHPA 3FDWA 5DJ0B 3LS4H 4HV8A 5JXAH 3I84A 2P7TA 5TK2A 3REVB 1N70A 4Z7WE 4KO7A 4DP7X 2FWOB 4X5WA 2A9CA 3U4BL 1TPXB 1SZNA 4ELDA 1TYJA 3LVEA 3KBEA 4OB5L 3TCXA 4F58L 4YGAB 3QQDB 3BUIA 3LMJH 4Z77A 3OB0K 1QNIA 2ZF9A 4PRHD 1RVFL 5F7BA 1E5VA 1AJ7H 4OGYH 2NQDA 1S5HA 2F54B 1E0OB 4FF9A 4B9GA 2KLTA 5IHWA 2ZXGA 4XHJC 2OM5A 3KPQB 3PGDA 2E9WA 1MRFL 1I7TA 5BVJB 4CU6A 2C9XA 1KC5H 5CNHA 1DJGA 3NSJA 4AJWA 1JPEA 2WSPA 1KTDB 4WENB 5D4IA 2GY5A 3DVFA 4LASL 4J3SA 1P4LB 2NXZC 1NC2B 4BKLB 3LEVL 1AMYA 3NIDE 1NGZB 1EIBA 4B3EA 4YR6A 1GGBH 3ARRA 3L3HA 3MRMA 5C0BE 4QHLB 3ROOA 2XWXA 3T0BA 2BVYA 4PJ5A 4WAFA 5JA9A 4JG1H 2P45B 1X5JA 4X5QA 1VF5C 2VABA 4HG4J 3VM5A 1W6WA 1QUPA 1ZJAA 5FO2A 1FORL 2N1KA 2Y07H 3HNSL 4JFEE 5F89A 4R83A 2O5XH 4YSOA 4MQ7B 4L1SA 1U8KB 4G8AC 2UVFA 4MQ7A 5JR1L 3FRUA 1SMYD 1ULVA 2ESVD 1D9KD 3I9PA 4J8RA 1XGUA 1G6RB 3CZLA 4KI5C 4U1HB 4Y16C 5E5LA 3QCUL 3OXRA 3F7QA 5EIIG 3T65B 4W6WB 3EBIA 4U1NA 2RR3A 4IRJD 4D0CB 5DJCA 4AXWB 2K8QA 3MROB 3I02A 3QIWD 3TO2B 2PXYD 1YY9C 5D1QE 3QS2A 1BW4A 2Y2TA 3APMA 3AT8A 3WY1A 2HX7A 3LEYL 1KGXA 3A6BL 4HF5L 3TM7B 4GW1A 3BO8B 1GY1A 3I2CL 1KEMH 4PGBB 1ZVSB 4FI7A 1E8WA 3FT2A 3RDTD 3L45A 2WQSA 1MXGA 5K5YA 2H8PA 4Z7AA 1E65A 1R3HA 1W72A 3VE0A 2FH6A 3PGFL 4P46B 3HZMA 3I2CH 4PP1C 4N2CA 3BCDA 2AJZB 1FYHB 2Y25A 5KYUB 5C0IB 3UG4A 1ED3A 3WD5H 1CD1B 4OVVA 2CALA 2V7HA 3NTCL 4QRBA 2X4OB 1QLEH 4LSRH 3VFSB 5D1ZI 4MMZC 1CBJA 1LEKA 3VH8B 1QBLH 3NEOA 1OTSC 2F68X 4APQD 1C8QA 4F2FA 5DVNA 1KIUB 1EFQA 3U6RB 3B2VH 1G7JB 4JM0A 4LHQB 1MIEL 1WS7A 5EO9B 4WZ9A 3PJSB 4PVBA 1EWHA 4DQOH 5E1GA 3V0VA 3AAZA 4XPFL 4CC4A 4UT6L 1GMIA 4KZDH 4RH4A 2R4SH 3QPQC 4N4YB 4PV9A 1ACZA 4P23C 2QKIB 2OX5B 1U8PA 1Z9NA 4JFXA 4DESA 2IQ9L 3RZWA 4JJOA 2Z64C 3ZLQC 4E41E 3FTSA 4GINA 4R96A 2J57A 3LKOA 3GSVA 4MAYA 1FL5A 2DYPA 4PJDF 4GXVH 3JTBA 4X6CA 4I87A 5DQJB 1NDGA 3DX8A 2EYSA 4LIQL 5DQ9B 4U1JB 4F8NA 5IMMA 2AXGA 4RAUA 5C0BA 3NA9H 4KVPA 4NERA 2XV6B 1Q0EA 1TYRA 2DJSA 2RHEA 5J9PA 1KTKE 1T80A 1I8MB 1NGYB 2BIPA 3RGVD 2WBJA 3BP6B 4Q6IA 4JHWL 1BAGA 3WHXA 1P7BA 3MR9B 1R46A 2OKMA 5BS0B 4L4VA 3GKWH 1XGPA 3JWDC 4M4RA 1KCKA 3CUPA 4G3YL 5AVUB 1ECZA 4ZO7A 2CE6A 5DT1L 1U30A 1PU0A 3K72A 1PTZA 1TJIH 4X7SL 1XSOA 1U8HA 3RB7A 4JDVA 4WW2C 3SBQA 3SDXA 3U9UB 3JWDH 1IGJB 4LMQE 1BJ8A 5HI3C 5F7MC 5E99H 4AYMC 3MBXL 4JX0A 2OTPA 4QHMB 3MV9E 4F9PC 3V6OC 5KBLA 4BQ6A 2YGQA 1I3QA 5G5DB 3L9RB 3UZVA 3KPSB 1OSEA 5DMIL 2WBJC 5C6PB 3PWNA 3CU7A 4HALA 4MD0A 5KVFE 3DX0A 3NCYS 4DERA 1ZHNA 2Z3FA 3HC3H 3SB3A 2CUIA 2F8IA 1ZLUK 1M7XA 5DMKA 1IAIH 3CBKB 3FB5A 4WHTB 2IXQB 5IVNA 2DTSA 2CDFA 1CTMA 2VLJA 3LDBC 2XA8H 1EBAA 5CBEA 2WVVA 3CVHB 4JEGB 3AXIA 4HVBA 5HYIA 5LBVA 1WFOA 2WKLA 2AKRB 1DN0B 4CW1A 3V52H 1E9QB 1QRKA 3VSUA 1JWUB 4CW1B 5GZNC 5BZWA 4Y5XC 4TQEH 1GS7A 5AW8B 4BINA 3VWKC 1XR8B 4NO2A 2VO8A 3SKUD 2NX5A 1I9EA 1M6OA 2WXOA 4QXTB 3TLRA 4K3EL 4RETB 3MOBL 1FV1A 3O0LA 2WUBH 2I9TA 1YQVH 4YAQB 1JNLL 1FNEB 1W0VB 3NZ8B 5IOKA 2YBGA 5CN3A 1XL4A 1QSEB 2J8UA 3TBTB 1OD9A 3NSCA 3OSKA 3PWVB 2FZ3B 4BJLA 3A23A 3UAAA 1HL5A 5ECGA 4L8CB 3BDBA 3BIBX 2OCCB 3R06B 4P06A 3CFNA 4PB0L 4Y9FA 3D2UB 1J7VR 4JL1A 3QI9D 1HDMB 4PJIF 5I82A 3FT2B 4DQAA 1OT2A 3Q2LA 4AQ1B 3ZHLA 4XXDB 3N42B 3TIEA 3SE6A 1FFOA 2IPKB 2NY5C 3CXHJ 2PR4H 1LK2A 3GRGA 3ZL1A 1OAUH 3D25A 4KUZH 1VSCA 5A3IC 3R4DA 3S88H 2BNUB 3BQUB 3S3SA 5GS2D 2QR0B 3SKNB 4PJEB 3KM1A 1FLRL 3WNPA 4GRWE 1Z5HA 5EO0B 4DVBB 3O9WB 1KGIA 2Z31C 1L9MA 3QZPA 3OL2A 3L5XL 3WNIA 3C6LC 2ZUQC 1UM5H 2A9MH 3UMTA 2RFXB 4MMXA 3OB0H 3BWAB 2Z93B 3M6DA 3D30A 1BVKB 1U6AH 5GGRB 5F1NA 4KDTA 2OCJA 4DW2H 5KSAD 4OBSA 2ITFA 3V4PH 1OB1B 3HRZB 4B3VA 4YK4C 1D5BA 1H3VA 2VITB 2EC8A 4GQPH 1CQKA 3T3PE 4J3OF 3FQUB 2HTLD 1U21A 3OLIA 5H8DA 3PDOA 3U9PH 2VPWA 4L5FL 2VXQH 2X4UA 1XF5B 1COBA 3ARUA 3P3TA 4FFVC 4L29B 4M8UA 1HSAA 3CXDL 5FO9A 4DGIH 4KGJA 1R24A 4MNQE 1G87A 1UCTA 4XBEL 2BH0A 4IRJB 4DFHA 2G3XA 1NANH 4PSRA 3ML8A 1OGAD 2B16A 4PW3A 4C59B 2CKNA 1DMRA 1DLFH 3LB6D 4NZUH 1XHHA 1ZA3A 4KBPA 1UM6L 2NUPA 4JO4H 4XZUB 2Y0SA 3FSWA 3N6YA 1YPZE 2DWEB 2IAMC 4HWNA 3SY0A 4E9LA 2BNRA 2MOVA 1CFQA 3QAZB 1MJ8H 2C45A 1Y4ZA 1XSJA 3GHEH 2Z31D 3MA9L 5D2LB 1HH9B 2YKLL 3ZMNA 1A7RL 4QXUL 2HMID 3L3JB 4I9XA 3HB3C 1VEPA 1FZOB 1MJUL 1P5VB 1MCHA 4HSQA 4GKSB 2XWDA 3QEGH 3DI2B 4NFBA 4EQ3A 3IF1A 3BKCL 1HT6A 4XBMA 5CMAA 4AIOA 4JFDE 1JERA 2GUOB 1P4BL 3UAJD 5IIEA 4ZS7L 2CHDA 3CCHA 3LZOA 4MDJB 2GJRA 3SDAC 5AW2B 4GRMA 4UINL 3I9GH 2D03H 5E00A 1WWWX 5E03A 4QTHA 1QR1B 2NY2D 2DQIH 1UA6L 4UAOB 4XP5H 1O6TA 3NPSC 4XMXA 1CXFA 2NY6B 1TNNA 3W11D 5CD3B 1WZ1H 4LOFA 3MNWA 5EF1A 1BIIB 1HK6A 1N3NA 1HEHC 1OD7A 1F02I 4I4WB 1H3WM 3TCLB 1CDUA 2HT4D 5BRZD 5CJXA 2R23A 4LCUA 5E4EB 2NVXA 2VXQL 2YFNA 3RY5A 2AGJL 2QADB 3IDIB 2P5PA 2QDWA 3GB7B 3W9DA 4IKIA 3V5HB 3LPGA 3C5ZA 1BF2A 3SPJA 2PN5A 4GB9A 5KSVA 2HMIC 3L4VA 2A5UA 1NWPA 2R2EA 3WFBH 2IDFA 3GYRA 1UKSA 4CVWA 1NCDL 3EF4A 2Q6WA 2IQAA 2PTTA 1H15A 3BPNB 4ANUA 8FABB 4G6MH 2CNZA 1RZ7H 1KCUL 2ZP0T 2Z34A 3PDDA 4KV5E 4NQXB 5DZJA 4BK8A 4OTXL 4NM4H 4B9IA 1QEWB 2XYCA 3HPJA 3VGFA 3RAJH 4KKAD 4XMVA 5KYWB 5C0AA 1PT0A 2P4AB 3LNDA 5FUOH 5F7HA 3FQNA 3FU0A 3QP3A 2X4NB 1S7VB 1UQSB 3TWCH 4GFXA 5DF0A 5C0BD 2MTAA 3WO4C 2A6KB 3CN1A 4E41D 2Y1AA 1RIHL 1WGVA 3KYMA 4JM4H 1IAKB 4K07A 1T3FB 2JWYA 3T0WA 1U0QA 1AGCB 3MBEA 3RVUC 2XRAH 3CBRA 4Q9QH 1GVIA 4BFKA 1RP8A 3WS6A 4G8IA 5ETUB 3Q2CA 2BOBB 4MNGE 5EEZA 2F08A 1DQKA 2BOBA 4QRTA 4PJEE 5PAZA 2XVBA 1D5IH 1SFOA 2X9XA 2KZKA 2BLFA 3V5DA 5C92A 1S8DB 2HAZA 1U8MA 3QW9A 3PHAA 1DBBL 3NAAL 4UIMB 2NY3C 1IFHL 4BV1A 1I9IH 2F7IA 2FAUA 3DVIA 1TSRA 3MV7E 4BYHA 2VJXA 4HUVB 2WCSA 4DPCX 3GMOB 2P80A 3KXFD 4OZHF 2Y5QA 3FKIA 2BVOB 4CSTA 1YEWA 2IMMA 5EOQH 3KH4A 4NCC1 2PYFA 4FTDA 5E4OA 3UBXG 2O61B 3S37X 5H37A 3RP1A 1J8SA 5EORL 4TQHA 3F6LA 3TVMC 3ZDZE 3ARBB 2R29L 5JLZB 1KEGH 1OCWH 5I1GL 4LOEA 3TPUA 1PW3A 3C2AH 4NN7B 1MRDH 5J11C 1BVNP 2RJMA 1LLAA 4JFEB 5IVZA 3O4LE 1I31A 3HHMA 3LVTA 1BD2E 1T5XB 4LT7A 3LQMA 4NXSA 2H6PA 3Q6GH 3Q1SL 1CL7L 5EEVA 2EXTA 3VXRE 4XTRD 3FO0L 4AIEA 3CDGB 4PGCA 1U8OB 2V9UA 3L2NA 1A9EB 4I1NB 5EPMA 4OF8A 4XCCL 3BAEH 4AC4A 4D0DA 4OFVA 2DTML 4RRPM 1GA2A 2MNJB 4RGNC 1WD9A 2XVLA 3AACA 1W8EA 2AMUA 3O2DA 1LVEA 2H9GB 5T1KD 2BJML 3AMKA 4I18A 4PJXB 2YD3A 3LQAL 4WK2B 3D3VB 1XGYH 1SDDA 2E47A 1YEEH 4GKZA 3MRKA 2D0GA 5BPPA 3L9RA 5AWNL 2Z7WA 2Y5TB 1EEQA 4G80A 2AERT 5GS0H 3VM7A 4QKXB 4W9EC 3L5WA 6CGTA 4HP5A 1OOWA 2WLJA 5E2TH 4ZMWA 3D0LA 4KJYA 2P24B 1DVTA 4FTVE 4GT0A 1CG9A 2IGTA 2W95A 2UV3A 3CVCA 5KBDA 2HXAA 3UJJH 3KJ6L 2VDQL 4HS8H 2GCYB 3FO9A 3MCLH 5E9DD 4MJIE 2QQKH 3AABA 4AV4A 2GIXA 4UQCA 4E9VA 3MRJB 5CGBA 4KJPD 3WDJA 3L1GA 4PRPB 2PO6C 1ACXA 3PWLB 5BV7C 1UWGL 1LNUB 1SYVA 3GSRB 1HHJA 1R24B 4N9GA 4X5XA 2EYSB 2Q0ZX 4M00A 5DQ9A 1CCZA 2VDLH 2ADGB 3RTQC 1MREL 32C2A 1G84A 4X80H 3MRHA 4R9HA 1RZGA 3LKRA 3IDMA 5EZIH 1AIZA 2XWZA 1N6VA 2AAAA 5GRJL 5TE6H 3GI9H 4X98B 3JV4A 3UG3A 2VN4A 5FXCH 4YFEA 2COVD 5I16A 3EXJA 2VDNL 3R0MA 3WN5C 3KDMB 1KUMA 3OTTA 2CA3A 5EU3A 4G7RB 5E2UH 4F58H 3FQRA 4NQCA 4K9JA 1TTCA 2BVUA 2UZIH 2V7NB 4PY7B 3BT2L 4NRZA 4FQLL 2XQYK 2BNQE 3GBNH 1NC4A 4NT6A 3DX2A 5HHMD 3TIDB 3OKDA 4M8VA 3EJCA 2JLPA 3TBCA 2E7DA 2P5WA 1I3RB 4FG6D 5JYMA 5IB3B 1N8ZB 4HFWA 1HWWA 1LWRA 4QHLA 3ROOB 4UT6A 2AP2A 2B59B 1M71A 3KVPA 1KIRB 4JFUA 3C5JB 4FRWA 4LVEA 2XNAB 5KYUA 1G7HB 5I28A 5A16B 2QELA 3RTQD 4EAEA 4Z7IA 3DSNA 2Q1EA 4OLVH 3W82A 1MJJB 1YYMH 1F3DH 3FTGA 2MNUA 5A2FA 1E5CA 1M7DA 1GGBL 2J25A 1R34A 2X89A 2W8CA 4FZEL 1NCIA 4HAGA 3RWGB 5DRXA 4IJTA 4A7UA 3QYNA 4NZTH 2IDTA 3L54A 1NIFA 2BSEA 1KYDA 3F04A 3WEXB 3PWVA 2VTFA 2V5SA 4O9HL 4XMLH 5BZDA 1DBJL 1CFTB 3GBML 3D9AH 4OZGE 1CU4L 3KWWA 1S7QA 3DVGA 3MFFB 4K5NA 3FK3A 5EWIH 3T6QC 3VW3L 4V2CB 4GOSA 2GC4C 4GAYA 4HISA 2DJMA 2X44D 4TF4A 4HIXL 3D8MA 1KLGA 4O2EB 2R9HC 3HKFA 5FFOA 4TUUA 1JGVL 1RZJL 2AQNA 5HVHB 4QPEA 3T0EA 3GBNL 1XDTT 3DWTA 2WWKO 2GAZ