4FFTA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with mixed-linkage glucan
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fftA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fftA02
3X2IA 4JJOA 1HD5A 2PI8A 1BW3A 1L8FA 2BH0A 3CZBA 1WC2A 4FFTA 2G6GA 2PICA 3D30A 1OA7A 3SUKA 5H4UA 2KQAA 3X2MA 2VXQA 4JP6A 1OA9A 4L48A 2JNZA 4JCWA 2PNWA 1BMWA 3SUJA 4FERA 3SUMA 2GAEA 4FG2A 2ENGA 1N10A 4ENGA 2G5DA 1WHPA 5GLYA 1BW4A 4FG4A 5GM9A 2HCZX 3X2OA 4JS7A 4ZM7A 3X2LA 3X2KA 3ENGA 3FT1A 2AE0X 3SULA 3X2NA 3X2PA 5GLXA 3X2GA 4AVRA 1WHOA 3FT9A 2PJJA 4JP7A 3X2HA 3M3GA 3X2JA
chains in the Genus database with same CATH superfamily
1MJJA 1PW3A 4PRHD 1IBHA 2ESVB 4OF0A 4DOHB 3WNJA 3FHEA 3PFUA 3O4LA 5JZ7D 4L3FA 5C0GA 1FNGB 3ZDZB 1YY8B 4QMEA 3VSQA 1NH6A 5C0RH 3HZVA 2IGTA 4M61A 2IJ0C 4LOFA 1LO4H 5MHSE 4AUUA 4LPWA 3D8MA 4NXKA 4DVRH 25C8L 3QHFH 4M4PA 3BEWA 3FONB 3RWEA 2F6AA 1IFGA 2WVVB 4OCNC 1KACB 2WQSA 1HIMH 1NCGA 3UBGA 3KDMA 4QKTA 3V6FA 4Q6IC 3T2NL 1OB0A 1BAWA 1P4UA 3T9WA 2HKHL 3DGCR 4N2KA 4JZNA 3D06A 4N5EC 1CG9B 3LZFL 3ARFC 3OXRA 4HPOH 4PQXA 4WHDA 5FYLH 2LOEA 1V55B 2GK2A 5AWNH 3RVVD 2H32B 2PCFA 1FVDA 2VDKB 1XD0A 4HIHB 4U6XA 2ZWKA 4JKKA 3HMXL 1GAFL 2D0FA 1I7TB 3D18A 3DX7A 1D5BA 1I7TA 3BDBA 2C1PA 3M8OL 3RZWA 1SXBA 2ZX5A 1LM8V 2PW1B 4UU9B 1BREA 1KLFA 5FV1L 3I3BA 1IARB 1N4XH 3NIFE 5GGSA 4E0RA 1BMZA 1MCNA 2OBGA 3TNNB 3DHUA 4UT9A 5IB5B 4HFWB 3ZE2F 2KC0A 4JQXC 1HT6A 4TNVK 1G7PA 3G6AA 4X8JA 1IGIH 1XGRB 3ARBA 3UGUA 5DRZA 2HRPH 4B5ZA 4FFTA 2A4ZA 2C26A 4LCWB 3ZDYE 3WO4C 1JXKA 1UOWA 2APTA 2NW2B 2VITA 2XN9B 3HPJA 3REWA 2EDRA 2H0EA 1DSWA 4R2GD 3VXSA 5E0FA 2XU9A 3LKOB 3BZ5A 3QIUB 5IVZB 1TTFA 4G80B 3C87A 1CLZL 4HPOL 4PAZA 3L4CA 3X11A 1V05A 2YN3A 4E9QA 5E6UB 2Z65C 2OS7A 2EDNA 4UAOB 3QDJB 4XN7A 4GXUN 1E60A 3QJTB 3MRIA 4G8FB 3C8KB 1WFNA 4MSWA 4KXAA 4QAMB 5AYTA 5IV2A 5HDBE 2BVTA 1Q16A 1SOSA 3D1MC 4J2QA 4LEBA 4QCIB 4BA0A 1EWHA 1NMAH 1S6NA 4HXBH 1I7UA 3GTPA 1K85A 2WZ0A 3VRJA 4JQVA 3ARGD 2ZUSA 4MCZB 4PJGA 4MCZA 2WGXA 1CD1A 2WLKA 4JKPH 2KLRA 3AXLA 3NRFA 5A43C 2WBJC 4GP8B 3G3LA 1COBA 4AVIA 1WV7T 4R97B 2DLFH 3ZQWA 1HH6B 3NJFA 4K3EH 2NUPB 5HDOA 1KFAL 3NK3A 1NPNA 5FK9B 1W80A 1A6PA 5H94A 2NPLX 3MTXA 4UTBA 1MFUA 2DM2A 2H9GA 5T3ZH 5DJXA 1K4CA 3NZ8B 1I9JH 3QRBA 2BC4B 3AADB 1DJYA 4U3XA 3VWKA 4D0DA 2W9DL 3PLYA 1JYNA 2SEBA 1RZFL 5ACMA 2MH4A 4JN1H 3TA3C 3B56A 4AMWA 2WD0A 2WO2B 3EGXA 4MAYC 5IF0A 1HWGB 3D50A 3C08L 4OBRA 2I07B 2X3CA 5IT2L 4EKJA 1KCSH 1CLZH 2JIPA 2F15A 3TBVB 4HU2A 4BSWA 4IJ3C 1R47A 4KXCA 1Q9OA 3EYOA 3GLDA 3IBOA 3RTQB 3EO1B 1WZLA 4EBQH 1PVHA 5ILTH 1DDTA 3MLYH 4PJFB 5ALCL 3KH4A 3QUKA 4QLRA 5HI5C 5KVGH 4XCYB 5KW9H 1ZSDB 2R7EB 2UWEF 2VW6A 4I48B 5CZXD 3QUYD 5K9JL 2VM3A 2GW5A 4G9FB 4OZIB 5FS5A 3GSNB 4QWWC 4WWKD 4X7SL 4U1MB 3WJMB 3H2QA 2HVKB 2PWGA 2Y2WA 3CDGA 4NQTA 4OM1L 5DGQA 1SVCP 2VPWA 4JKPL 3LPPA 2PUQT 2A74B 2AXFB 2O5ZL 1A9VA 1T0OA 5I1LB 3FSAA 3C6LD 1XAUA 4NS0A 4LFHG 4Y1AD 4MMXC 3TEZA 2VPXA 1JZGA 1JZ8A 4PS4L 4HZ1A 5CEXB 3IDIA 2Y7LA 4RAVA 2Q7NA 4PGZA 3VJ6B 4QJ3B 5T3ZL 1DSFL 3CZEA 1I9JL 1NGQL 3Q2WA 2CLVA 4AUYA 4ZXBA 4XWGL 3TPUA 4EI6B 1IGCH 4HUCA 5LAXA 4OSUH 3NVQA 5TF1H 4UDTB 5AVRB 3SSGA 1VFBB 2YKKA 1X9LA 3S5LA 2AANA 2J7LA 4LOVA 5HHMD 4RMBA 5BZZA 1AI1L 1X7SA 4ODTL 2VWEC 5TH2B 2E27H 3OZ9H 2W88A 3V7AE 1XF2A 5J12B 5ILTL 1DZBA 2L7EA 2XPZA 5BS0D 2YUVA 4DN3L 4GBXA 1EK3A 3WY2A 2VRAA 3P4LA 1DUZB 1IQDA 2IFFH 5IMOA 5BUAA 2C9QA 5JOFA 4P5KB 2R1YB 5HI4C 5EF2A 1ZIAA 2XG5A 4AAYA 4OM1H 4ADJA 4BQCA 3K91A 3FSOA 3OC5A 4M62H 4FFZH 1IAIM 4JREB 1GYVA 4K71C 1O9VA 2OMBA 1TQTA 3LXUX 3P0YH 3P77A 3IDNA 4MAYB 3DA0A 4GKSA 4JB9L 4HUVA 5JHLL 1G6RA 1G7HB 2UYLB 4Y16C 4U1JB 3B5HA 1NBYA 4Y89A 4FL4B 4M5ZH 4HS3A 5EH1A 1INEH 3UJTH 4TQPA 4GQZA 1UC6A 1FYTB 1QACA 2CD0A 3FB5A 1W0WA 3L3OB 2ODHA 4F7TA 1W0WB 4YHML 2ZONA 3F6IA 1FNGA 4OSUL 2HG0A 4IU3B 5I8EA 4MD5B 1SBSH 3UPRB 1F90L 1T22A 2EE3A 4LSVH 4PB0H 1CZ8L 1TFHA 5I2IA 2YD4A 2PCPB 3REVB 2NY2D 2CKBL 1SNRA 5PCYA 3VI4A 2CQVA 3HN8A 4PW9A 1QSFE 5EZPA 3B9VA 5C0BB 5C0EB 1R6VA 2BIPA 1QWUA 4TLKA 1RZJL 2IBGA 1T7WA 1D7BA 3FBKA 4PWKA 2A83A 1KIRB 1T04B 5TE6H 3MBWA 3CU7A 4QRRB 4UV4H 1ZK5A 1P5UA 3WUWA 5I9QC 1UT9A 4M62L 4LOUC 3LD8B 5EN2A 3D87B 4JB9H 5F70A 3NJIA 3H6AA 1A3ZA 1IC7H 3Q43A 4ZO7A 5E7FA 3QCVL 4A2FA 3ZKXC 1WP6A 3KWUA 1MIML 2E4TA 1DQML 2VN4A 4BZ2L 1CGVA 4DJMA 2VN5A 2Z8RA 4N0YH 3VI4F 3TV8A 2P28B 3BD4A 4HHAB 4N25A 4K15A 4FG4A 1X3DA 3CFQA 4RBPH 1F90H 3I9PA 2VZ3A 4NKIL 4PJEA 1U8CB 1E2WA 1USZA 1YZZA 1AGCA 3VO0A 2XT1B 1QATA 3NSJA 2A9BA 4LEOA 4NO2B 1D7CA 5ELIA 1HS6A 4YZWA 5FW8A 3VXSB 3FSZA 5DRXB 1SJXA 5K9OB 5KVEH 4PJAE 3SD2A 4JFQB 4UIMB 3CHRA 1S7XA 1H5NA 2H2SC 3I9GL 1H3XA 3ULUL 4N3UA 4ES9A 4FP8H 4GEJA 2ENSA 3T2PA 1BM7A 2VUYA 32C2B 4ALAH 1J1XH 2ICWB 3R06A 3E6FB 2BDNL 3C75A 3DVFA 1M7DA 5FYKE 1CFMA 5MEOB 3Q5OA 5D70L 1NANI 3TJEH 4M1DL 5I76B 2FSEA 2NY5L 3CSFA 3O2WH 5DI8B 1DVFC 4N26A 1M6OB 3ORJA 4IU2B 5F7FA 1UYWH 4Q9BA 5IG7A 4ZPTA 4PJ7F 4Z7VF 1BLIA 1PZ5A 3IDJB 5H94B 4CW1B 2PYEB 3MRCA 2XG4B 1JNHB 1M7UA 4XP5L 2ZXAA 1SN0A 5AVYB 4A04A 2VZVA 3GXUB 4OW6A 1GJUA 4OKDA 3SPJA 1ZHKB 2QVIA 3NSDA 1CLOL 1UWGH 4Y4KA 4FEMA 3RPIA 1EFXA 3OKKB 4ZMXA 5KVEL 3OG6B 4MLIA 2NVXA 3P4OB 2X2YA 4MQXD 2A6IA 2MNJB 5D7JB 4CVZB 2A6IB 2P3YA 3I9GH 4CVZA 2DN7A 1JD9A 5E1HB 2Y6TE 1IMHC 4HKXA 1I1AA 4LPVA 5DTFA 5EO0A 1INDH 5EO0B 3O4LB 3U25A 2Q87A 3DROA 2ZQKA 1FNHA 3GSWB 1JGIA 2ATPA 1ZPLA 2AJZB 4IQHA 2J5LB 3WS3A 4Y4HA 4YXHH 1BXAA 2ZYIA 3F12B 4B50A 1KGIA 3LXBA 1QFWI 3DJRA 4G5ZL 5KG9A 4JFDD 3AM8A 4U1MA 5A2BA 2R0KH 3FONA 3Q6FA 3AMKA 4PV1C 2FUQA 1UA7A 4JFEE 4WWPA 5JPNA 4HW6A 3RKPA 4N1HB 1Q38A 3FO9A 1I1YA 4O2EA 2O5NA 5IUCA 4ONGH 1I8MB 2OQJA 1CXLA 2EDXA 4OI9A 3CN3A 5IBTH 3D52A 5IFJA 3OKYA 3I6KB 1DQKA 2Z34A 1K6QH 1YEGL 2WZPA 2DYRB 3GBNH 3IN2A 4HCRL 1BG9A 1EHNA 3ARZA 3GEWB 5FF6B 1GZHC 3NFNA 3QEQA 4EI0A 4M43L 1MI5A 4PTTB 7PAZA 3ESUF 5JIIA 5F8RC 3ASOB 4WW2C 5I23A 3JWDC 4AX3A 1MVYA 3IGUA 3MRGA 3FF8A 4G1EB 4MQTB 5DR5L 1FDLL 4F9PA 4F1ZA 3ARXA 4Q56A 2EDHA 1PKOA 1OB1B 1YDPB 1SDYA 3MRDA 1XGRA 3BQVA 1T03H 3ZVVA 2AK4E 4WI8A 3PF2A 5BZDA 1S5HB 4YXHL 3KDPB 2H45A 2C7UA 1MJ8L 3EYFB 5FYKL 1AIFB 4OFYA 2DJSA 4M6NL 1ZTXH 1VKXB 1KTRL 2R69H 4PRIE 2WN3A 4UAHA 3CHQA 3APMA 1U3NA 1UVQA 2WLMA 2IVFC 1YO4A 1P7QD 1NSNH 1BQSA 1F02I 4PJEF 5I9QB 1OEZW 2NZ9D 2Z4TA 3HN5A 5ID1B 3ECBA 3ECBB 4QTIL 4ONGL 2F53E 2X4SA 3X14A 2V2XA 4QR7A 5IBTL 3OHXB 5ACLA 2DBJA 3MOAH 2YRLA 1E5UI 1NQBA 1ZS2A 5DFVD 1QLEH 4PRAB 2XZAL 2EECA 1UZ6E 4O51B 3QI9C 1MHCA 4LLUA 2PN5A 1AQKH 4BZYA 5F9AC 1G5GA 2X4OB 2GK0A 4Q2ZA 4OT1H 1H3VA 3DETD 5E8DH 1RFDL 1RULH 5I1AB 1Y18A 1HC1A 3KXFD 1FDLH 1NOLA 5E95B 1OGAA 5ISZA 2BM3A 3EBGA 5TTRA 5ISZB 4YHIB 1I8IB 4FQJH 9CGTA 2WINA 2ADGA 3FQUB 2VE6B 5F3BA 4D3CH 3H3KA 3WD5H 2H2PD 3LRSA 5C0AA 5KOMC 1IAKB 4OQ1A 4YL9A 2BY0A 1CICA 4UYQA 3N40P 4C83A 3SYAA 4WNSA 4C83B 1DE4B 4KK6D 4KI5E 3FCGA 5C3IA 4IJTA 3VDCA 1SLVA 3BW9A 3K81A 3OKDB 4JFEA 1GRWA 3B2MA 2Y7OA 2V3DA 4O9HH 5CWSB 3RVWD 5B1JA 5DS8A 3HG1D 4LPUA 1MCOH 4GKZA 4OH2A 2J73A 4TTDD 4XPFH 3MV9E 3CNKA 3MOAL 3FU7A 3KJ4C 2JKJA 4Y2OA 5LN8A 2FEDC 4Y2OB 3PJNA 4PGBA 2ZWNA 3S9DB 1KYDA 4AMKH 4FTVD 1UASA 4LVEA 4J3VA 4LKCB 1J0JA 5H2BA 2YEZA 2EACA 4MD0B 2EXWC 4PJEB 1EUTA 4PWIA 3IE4A 1U3YA 1HQ4B 1HQ4A 3TYFB 2R9HC 1IV8A 1MLBA 5EPMA 4JM4L 2YZ8A 3KCPB 5HDWA 2PW2B 3X2KA 2AJVH 1L7IL 1VGEL 2EABA 5DMIH 3RVTD 3S4SB 1R3JB 4PJ9D 1FV1A 4GSUA 4MXWL 3T3PB 4MMXA 3N40F 4LCCC 2C9UA 1NBVH 2Y5QA 1YEJL 4XNUH 3VD1A 2XY2A 4XMPH 3SDDA 4N2DA 5E6IA 4TQIA 1OVZA 1I1CA 1WD8A 2W0KA 3MPCA 4J1UB 1SHWA 3MJ8A 3UACA 3MJ8B 1TO5A 1O7VA 2BOCB 5I73B 2NW3A 1J9SA 1EGJL 1ZJAA 1E30A 3VFOA 5ESAA 4JMXA 2GPZA 2GJJA 4HGWA 5FUCE 3RHWK 2WXKA 3ZDWA 5JNYA 1UZ8A 2W80C 1WK0A 5A40E 4CA4A 5FYLD 2QHRH 1I4FB 2VN7A 3ECQA 4GQRA 3ZLQC 1ORQA 4X7CC 2VDPB 5K9KB 3AC0A 4MQ7B 3AREB 1PAZA 4H8HA 3ML1A 5IMOB 4R7DA 4RZKA 5CGYD 1IM9A 4PGCA 5BVJB 1D5XB 1JPGB 5DJYB 4R4FH 2Q2EB 3CSGA 1L7IH 4WFFE 4Z7WA 3T0EE 3V4UL 2UWEA 2R39A 5FC9A 1B2WL 1PJ9A 1HILB 4HZAA 2YAFA 4U1JA 4L3AA 5EUKA 3G5XA 1YNTA 1P4BL 4XNUL 3PJSA 4NKQB 4BH8A 1FZJA 2OSLA 3DURA 2R29L 3FO0H 3A6BL 3QXVA 1LO2H 2HT3D 5BMFH 2HLAB 2XN9D 2D8KA 1K8IB 4BKSC 1XXFC 3IJ9A 4TVPL 1CGWA 1EJ6A 3IFNL 4WUKH 3LJ3A 5EC1B 3BE1H 2R8SH 4HH9A 3BGMA 1U8LB 2VKXA 3BGMB 3C5SB 2VISB 1G9HA 1OTSD 2IPTL 5B38A 2CA3A 4TQHA 4PJBA 1FNSH 2WCPA 4A39A 1J5OL 2Z3FA 1CFQB 3TCLA 3VU1A 5HDRA 1HE7A 5C09E 1Q94B 5DJ2B 2DQTL 3GTMA 3KPSA 4M7ZB 4O2EB 3O2DH 5E8NA 2FBJL 4JY4B 5ID0B 4YLQT 3QQ3B 4FE9A 4ZPVA 3FHQA 3K5RA 4RETB 4R7XA 3QDAA 1PY0A 4QO1A 1AGEA 1QNZH 3A21A 5C7XH 2GAEA 3II1A 2NY6D 2RBLA 2LFGA 1HTYA 5J13B 2YMOA 4YS4A 4JHWH 4RDQG 3PJLA 3RI5F 3ARBC 2HMIC 3MO1A 3OKNA 3WG7B 1BXVA 3HU1A 1MCQA 4Z6AT 2AEWA 3QT2A 5HYSB 5E2VL 3IMUA 3RWCA 3FO0L 4D7ZB 2HWZH 1LO2L 1MPAL 3FSVA 5BMFL 2B9BA 5FKPB 5C9JA 4TVPH 3NCMA 3P2DA 1TZOA 2ZSVB 3BESR 3H0GA 3I6SA 4HOWA 3EYVB 5DGRA 3KPSE 3H3PL 3FUKA 3BIKB 3PWNA 5DFAA 1AG0A 3US9A 1O7DC 5JHDA 3DMMD 1CI5A 3QR0A 3T77A 3T4AC 3W56A 4ONOA 3SOBL 1J5OH 3O3AB 5A2JH 1T83A 3HUJF 4UM8B 4ENGA 2YA2A 5CUSL 2NSMA 4ZMLA 3HC0A 2EP6A 3AROA 3E80A 3H2PA 4DVRL 1RK0B 2GJ6D 4NQEA 3RL1A 4DQOL 2ARJQ 5IK3B 2FJHB 2XC8A 4F5CE 1WVZA 4GBXC 1QNZL 3L2MA 1L9OA 3WFDH 2DB8A 1BIIA 5C7XL 3P73B 1M2OA 4MXQD 1FL6A 4RGOL 5F96L 1CZ5A 5EBWB 1QVOB 3FUMA 3MSPA 4LHUD 2FK9A 4ODWB 1RU9L 4JZJA 1QEWB 1XGPB 1IKOP 4OFVA 1K3IA 4OJFL 4PJ5D 4ZMZA 3LNFA 5E2VH 1U92B 3M6DA 5B1CA 2YGNA 2G4EA 3H55A 2F9BT 4UT6H 4F27A 3GZPA 3FO2A 4EZLA 4PJIF 4MNHA 1MCSA 2PO6B 3MRQA 5C0AB 3KWWA 2BRQA 4KX9A 2VMDA 1ZLDA 3EUDA 4KK9C 1SEQH 1KIQA 1SRDA 4HBCH 5T5FA 4AQEA 2GI0A 1J9RA 3RYMA 3DIDA 3PREA 4P5TB 2Z35B 3N55A 4KKNA 4WTZA 3GRGA 2X9WA 5KBKA 3B5GA 3CXDH 2BIQA 1NIEA 3K74B 4H26A 4R5VA 5I0ZA 4MVBD 3FNKA 2BHFA 1N2RB 2FEEL 2WTOA 5F1NB 5HHOE 2DQDL 5IMKB 5HDQH 2VXVH 1OP5K 4S1SL 1NGZB 2IFGA 4LMQI 1IC4L 1WWCA 1RAMA 4OGZA 2CR3A 2FD6H 3F12A 1BF8A 5B7MA 2UX6A 4NQVB 2PPCA 3Q2VA 5HJ3B 3GUFA 1ET8A 4JR9H 3VXPA 1KBGL 2P5WB 2PPAA 1VA9A 3V10A 4YQXH 4XNMB 1DCEA 4H44C 3BUDA 3PGCA 4HAKA 2VXTL 2YSSA 1FN4B 1NMAL 3QEQD 2RH0A 4DKTA 1B4LA 5J11C 2G2RB 4W6YB 4JFXA 3VWKC 4FHKA 4MXVF 4IRSB 4P23C 5C0IB 4Z8FL 4YSPA 5CLXA 5FGSA 1GTNA 4OLYL 4JFTA 4Y4KD 3WNOA 1T0NA 1J8SA 1J0KA 1NGWB 4B9FA 4OF8A 4JRYE 1SUJA 2DLFL 3CXDL 1QASA 4YZFE 3RGVD 3QRGL 3EYQC 3AU0A 1R3HB 2DMGA 2P24B 2RMNA 3PL6C 4MCYA 1ZLSH 2VLJE 3RWDA 1FH2A 2LT9A 4LL1A 5C0BD 4JAMB 1UA3A 3TCTA 4JQVC 4A2DA 1ZGLM 2G5UA 3ESVF 1JDDA 1UZ8B 1LILA 1RZFH 3BWAB 2A6KB 4JN1L 1PPYA 1C7TA 2VLME 4HIPA 4DGIH 1YDPA 1KB5B 1IC4H 4G7YL 2R92A 4KQ0A 1KWGA 4JRXE 2VPZA 3V0VA 4UT7L 3GTOA 4JR9L 3M3GA 5TF0A 4HKBB 5T1LB 5KAQG 3KE0A 1FPTL 2CUMA 1S7RB 4PYGA 4QXGH 4U1LB 4PSRA 1T1YB 1GIGH 5ALCH 5IJCC 3F8UB 4XN5A 3WEOA 1UD5A 2HFFB 4LSPL 4X50A 3TEUA 3WYRA 1B0WA 4FQXC 3OJVC 4F37K 2HKAA 4QRRE 4FG6D 5H37H 3TA4D 4K0OA 1CWVA 4Z8FH 4AYFB 4MNGB 3A6CL 3V4VB 2UVEA 1DBKL 5F6IC 3ALPA 3ZR5A 1E5YA 5KJ4A 4CC0A 3MCKA 4HK0A 2EIZB 4PRID 1LTXA 1MG2C 3CWGA 1IGJB 3P0VL 4KX7A 4PS4H 1IGJA 4PY7B 3RNKA 4L4VD 2XQYA 3RIFF 3V4PA 4H8UA 4YSTA 3CN0A 2R29A 4JHUA 3SUKA 3CH8A 1YMMA 4K8RC 5F3FA 4NDMB 1CD0A 2P46B 3KLSA 4OQTH 1A65A 4FFZA 4PJBB 4WEEA 5DQJB 4DPCX 1KGWA 1JD7A 2VE6A 3IBEA 3H9SA 4PVLA 4ZQTA 3IKKA 3CFEB 2DQ6A 2O6DA 3IRZA 3NJKA 2Q2LA 2HLFC 4ODTH 2VZ1A 5DURD 5DHMC 3L4WA 1JGEB 4ZQKA 1DE4A 3SPVB 3FT0A 1AO7B 2FHBA 2YOAA 4DN3H 4RFNB 2IFFL 1O6SB 1E4XI 3NA9L 3HOGA 5EFIA 2Y7QB 1I3VA 4Y4HD 1BWWA 3A6CH 5I5MA 3D12B 3CD4A 3D25A 1DBKH 3GXDA 1Q9KA 3LSOA 1IKFL 4EN2A 1IGTB 4P46A 1WZAA 5DVMA 2R27A 3BPLB 3PAYA 3QUZB 1WISA 3P0YL 2D03L 3F7QA 4DZ8A 4IKIA 4PG9A 4X9YA 2VDLL 5MEQB 2IQAA 4D9LH 1JL8A 4B6ZA 3ES6A 4Y2DC 4DCQB 1LEIA 4ODSH 4DCQA 2WW8A 4JKNA 4OQTL 4BKLB 4NM8H 2ZCHH 5A3ID 2K8MA 2OX5A 5EOCH 5FTMA 2ZZUT 1SBSL 2BSCA 5IB4B 1FG9C 2BVOA 3L3GA 3GSNH 2OTWB 3UIYA 1U21A 5F1OB 3U0PB 4WFHE 3HC0B 2OMXB 3HZMA 4GAJL 3LYRA 5LBSL 4K4KA 3OL2A 1L9TA 1TWFA 2ZSWB 3WIAA 1H5BC 2XUWA 2JTDA 3FMGL 3LAFA 1U8QB 2OP4L 1U8QA 2EEFA 3FTXA 1NM4A 5AW8B 4TNGA 1A64A 2KH2B 2ZKHH 1ZT7B 3N1PC 5E4AA 4E41A 4KO8A 4UV4L 5CP7B 2ZUUA 4XBPA 3NTCL 1CD9B 4HIHA 4WHTA 4HD9A 4ZX5A 1XSIA 3NABL 4U4IA 4YN3A 4DT2A 4KMLB 3AXHA 1TWCA 1KN2H 1MRFH 3ILPA 1TTAA 2B7DT 3RWIA 3E6HB 1U41A 2AABH 3KWWB 3WMSA 4BZ2H 3MV8D 3NACL 3TBCA 4ODSL 3K5SA 4YE0A 4AQEB 4CGTA 2WQUA 5A2IH 4NM8L 4LIQL 3SPGA 4G42A 2FZ3B 2C3XA 5EOCL 3OC8A 3TBTB 5LO7A 2DQUL 2QFPA 4L9LC 5HHPB 1YPZF 4NKIH 2DH3A 4P05A 2C4FU 2LABA 1KCRL 4F7KA 2Y07L 1R27A 1IUZA 3FU3A 3LKOA 3FMGH 5CCJA 4P46C 3WDJA 1YNKL 5KSUB 2NYYD 1L4IA 3WLBB 4G80A 1EZVX 4MA8H 1SY6L 4AEIH 4XO4A 3ASWA 3DYOA 3RVXC 3TV3H 1N68A 4JM2C 4MKTA 1Q9WA 4MJHA 5E4EB 5ANHA 5F0MB 1OE1A 5K9QG 1OGPA 4P2RB 2WY3B 1Z5LB 2QKSA 3C5SA 2EDJA 4FP8L 1MCRA 2MPAL 3IFPA 4PJCA 1TNNA 4DETA 3NABH 4X7EC 3SZ6A 3VFGH 5IIEB 3ETBJ 3T5WA 3MN8A 3TCLB 3S3BB 1TZIA 4AM0B 5I8OH 1X7QB 4DKFH 5DZOA 2A6JA 3PWLA 2A6JB 2G2RA 3VQ1C 3OKEA 1NDGB 5F0PB 5GISH 2JI2A 1NUDA 2ZUQB 2D7MA 1ZD6A 3O2WL 1AAJA 3KW8A 1TWAA 4OGQC 1TQVA 4Y88A 5HYSG 2DQUH 1U2CA 2DOCA 2P24A 1AQMA 1R3HA 2JVUA 5F6HI 3DI3B 3BVUA 3E2HB 4EQ3A 3DX9B 2F5BL 4XMVA 3D2UA 2ZAHA 3HMWL 5I0DA 3WS6A 4XP5H 2FX7H 5FUOL 3IKCB 3QW9A 2FBOJ 1FCCA 5T1KD 3P3YA 1OANA 2PNDA 3WNLA 3QJFB 5AW2B 2IADA 2GABA 2L04A 4L8BA 1U9KA 3EGDA 2VABB 4NXSA 1OCOB 3DBSA 3RG1C 2G0KA 1SY6H 2YSTA 4L3CA 4RCAA 5IJBC 5HHQA 2YLHA 3TV3L 3GHEH 2JKLA 3N44B 4Z7VE 5F9WB 4NKMB 5AVWB 1AQHA 4FI7A 3FQRB 4GXVH 2PPDA 4IIQB 4M56A 4WI3A 4QXVA 1S7RA 4U1LA 2H0JA 4KQ3H 3QDGB 5T3XL 3HN3A 1W2KT 2BNRA 4GSDL 4NB7A 4WUUE 2VUMA 4G9FD 5C3LD 2R0KL 3VXMA 5LGJA 2D0GA 3HJ0A 2JA5A 1QFOA 1OSEA 2AK1H 3UAAA 2W5PA 1KEGH 2ARJB 1U8HA 2WXRA 2QPDB 1BJ1J 5IP4A 5GZOD 2WXNA 5F21B 2JLPA 4LBEB 4Y1AB 3BAEL 3DK2A 4QHLB 4ZTEA 1W6WA 4U7MA 4WFFD 5CCKL 3T0AA 1YEGH 3OPZH 3BX7C 4FL4C 4J8QA 1PLCA 3BH8B 4ZUWB 2GUOA 4KHXL 2A6HD 1D5BB 1YY9D 3ETBF 4M43H 4P2OD 2OZ4A 4PJ8B 3BEVA 4BQ9A 4DWHA 4P23A 1F3JB 3GHEL 1F3JA 1VGKA 1TZHA 1YYMH 4XBGB 5IUSA 4KK8C 3RL2B 1B3JA 1R3KB 1L9SA 1ROCA 3HZKA 1R3KA 4GP5B 5IHUL 1KXVA 1XSKA 4KQ3L 1AO7A 2JH2A 3QSKB 2VQUA 4NWTL 4FA7B 4AV0A 5GZOC 4WWKA 1PY9A 2AE0X 4OLZH 4NQED 2KPWA 4GRLC 4L29B 1NKRA 1PEZA 2D4FA 1WLHA 4HT1L 4IKKA 1NSNL 3EH2A 1BPLB 3T8XA 3NRQA 3T8XB 3KWXA 4RA3A 3HJEA 3GPEA 2MHAA 3FFCB 1S7UA 1K4DB 2NX5D 3VUAA 3CMOH 2R2BB 4J8RB 4XN1A 3WIHH 3FB5B 1B4JH 1EAOA 2GCYB 1QYGH 3W81A 3PDGA 4X9IA 4NLAA 1TR7A 3W11D 2ADFH 5JDSB 3K72B 4WW2F 1AQKL 1KPUB 3RX8A 1KXTB 4N2OA 5AVSB 2OTUB 5DJZB 3NP4A 2F1EA 1G0XA 1KIUA 4I1RA 1DQJA 1DQJB 4UNUA 1ZA3A 2AV7B 2O5YH 4KMQA 4RDBA 2X70B 1F0LA 2X38A 1R1CA 1AC0A 5DQ9A 3N6YA 2AEPL 4X4YB 1NEZA 1T20B 1OA9A 1WIUA 4MS8C 3GBEA 2OL3H 1F13A 1TIUA 4ACPA 4DPBX 4NWTH 1IBYA 2WLLB 3MV7B 1I85A 3RB7A 3SY0B 2Y9RT 4UOZA 1QBAA 3CZUB 3HFMH 3W82A 5JQIB 4OLZL 5ISZE 3DHPA 1EBAA 1FF5A 3ABKB 3FBQA 1I75A 5T33H 1ET5A 3IS1X 3L3IA 3TO4A 2V5YA 2X4NA 4PLOB 3KVQA 4ONHA 1TSRA 2E76C 1E4KC 4AKPA 1UURA 3VD5A 3MBED 1OLLA 1T89A 1YJDH 5JYLA 1TTRA 3FN0H 3GB7B 3X2MA 4BGLA 2VT0A 2XFXA 4PBDA 4OLEA 4KKQA 1HNGA 4JM2D 5GGTL 4R97C 3BISA 1SXSA 4JJ5B 1UG9A 4N90D 3EG9B 2D2OA 4GG6F 3TBTA 4AYGA 3ARGA 1QFHA 1WAPA 4G8GA 1LYQA 1U8CA 2NNXA 2G5BA 5E4OA 4HJEA 2JJUA 2X2IA 2IQ9L 4Z77B 3SQRA 3S37H 3L4VA 1PX4A 3DPDA 3L7EB 4KKBC 1W15A 4M3KB 3MOQA 2N0KA 3K2UL 3CVHH 1J0YA 1DBJH 3ZDXE 3ZHDA 2AJSL 2P5ED 2F8XC 3K4AA 3HFML 4WGWB 1MFAH 3MV9A 4AQ1A 2CDGB 3DMMB 3C2SA 2DMCA 1MFEL 3S37X 1WRFA 2K6YA 1YPZA 3HE6B 4R7VA 3BSZA 4DEWA 2Y72A 4U0RB 1EUUA 2JIXB 4JLRB 4ZTOL 2GJ6B 4YE4L 1YJDL 4ILDA 3WKPA 4ZD3H 3FN0L 1YCSA 3UTTB 2G3XA 1UD8A 3QPQC 4XXCA 1AZVA 3QXDA 5GZOA 3SQOH 4WI0B 4JN2B 1N0XH 3BUYB 1IEAB 4YDJB 2FL5A 4NUGH 1U2YA 4NX0A 4L05A 1X9UA 5FOJA 2JCCE 1XMWA 4YSQA 5HXMA 4EDWH 2RFXA 4CW1A 5I82A 5IW3A 4PJ5B 1CFVH 3W39B 2V7HA 2V9TA 3BP6B 1RURH 4JPIA 4JPIB 1MRCH 3QORA 1Q4NX 7FABL 2BFVL 4WJKB 2C3VB 5SV3A 4W9JC 1MHPH 1JXFA 4AGMA 1I53A 3GSUB 3GSUA 4WI7A 2QQQA 5CINL 3Q13A 4LASH 2IQAB 4F80A 2V5TA 1QG3A 3U4EA 3EUUA 3LV3A 4P5RA 3A24A 1CBJA 4Y2DD 3WEAA 1U58A 2X6BA 3AT8A 2CGZA 3PAUA 1BQHA 3ZW3A 3SUMA 2I5YH 4B5EA 4XCCH 1FVCA 1H6FA 4N87A 3WS3B 1K8DA 2JJTC 4X6DB 5BV7C 5HHOD 5I17A 4R4ND 3DRQA 3I50H 2R2HB 3ZHFA 4UQCA 2NT1A 2V7NB 3Q6FB 4OAWA 1NBQA 3VW3H 1D2OA 4UM9D 4PCKA 1N0XL 4Y4HC 2WC7A 5TPWL 4NUGL 2BLFA 4GFXA 4JDEA 2BIOA 3D85D 1U8MB 2Y1YA 5BV7L 3MXWL 2XTLA 2DW5A 3CZNA 3QUXB 4O5LL 5DLMH 5FA4B 1MZYA 2R51A 1ZPUA 1RZIB 1IL1A 1ACXA 1T0MA 1TVBA 5GGUA 3V0JA 2CIKB 7FABH 2BFVH 5EBLB 4TKWA 3C2AH 1MHPL 2NUTB 5KSBA 1E42A 3LXCA 4FQ2L 1JRHH 2D7TL 1QR4A 5BRPA 5DYOB 5BQ7B 4ODHL 1KC5L 4JHWL 5L4JA 1I1AD 3HBQA 3DJZA 5EPPA 3QVAA 2MEJB 2VDRL 1XH0A 4XBGA 3DTUB 1J1PH 2BY3A 1HCYA 2VMCA 1UACH 4PRPE 3VXNA 5LG6A 3V4PL 1WTLA 5HD8D 2H8PB 3F84A 3N04A 1AIFA 1CLCA 1NL0L 2AI0L 1TOXA 4FNSA 3TLRA 2ZT9C 3NT0A 4M48L 2G75B 4P99A 3GDCA 4W9KC 3VDBA 3WMQA 2BVPA 4K7FB 5L9DL 3X2OA 1XTMA 1QKZL 1SM3H 3CC5A 2IXQB 4R4BA 5G4OA 2O26U 1P7QB 3QCTH 5D1QC 5JOPD 1DJSA 4GRWB 5K9OA 1OPOA 1J18A 1EPFA 4W93A 1FH5H 3UG4A 3KL0A 5IBUB 1QR1B 2XZCH 6FABL 2ZICA 4DQOH 3MC0A 4DVBA 1KOAA 4DVBB 3GSVA 4MA3B 2VXQA 5CCGE 1GC1H 3C9NB 3ZK0A 2EC8A 4M5YH 3C2AL 43C9A 1F58L 3F7LA 1ZGLA 3S88L 2HN7A 4KJPC 3E6FA 3EDJA 3SKNA 2CUAA 5SWSB 3FCSB 1HZHH 4L8CB 2H1PL 3HC4L 5E1GA 1RU9H 2GITA 2ODIA 4M3HA 4OJFH 1GXEA 2B3RA 2YPLE 1A9EB 4QYOB 3FULA 4PRBB 1NMBH 3PWJB 3FT2B 3INUL 3O3BB 2FSDA 2VDMH 1CTMA 3BJLA 3Q0HA 3PL6D 4UTBH 3ZPDA 4AL8H 4W6WB 5IY5B 3B2VL 2DWDB 5IROC 1ZTXE 1AMYA 5B38G 1SEQL 3OZKA 4HBCL 3OJDA 4UTAA 1TJIL 2ZP0T 3D39A 4XC3H 4FJYA 2X4NB 4P23D 1MCPH 2GTZB 3NEOA 3DPBB 5AAMC 3OKLB 4F2MB 5DS8B 1EZSA 3H9SE 1OARH 5GGSY 1NUGA 4AQOA 4FXGA 2IH3B 4JREC 3QEHB 4Y5YB 4M5YL 5IOKA 3WKQA 5JW4N 3FTUA 1F58H 2BH0A 2APXA 3S88H 3PYCA 5DU7A 5E24E 5DJDA 3BFOA 5MEND 4Y4HB 1IFRA 3LQZA 1T4KA 4FTVB 3B7UX 5CLYA 3ZE1F 5HY9A 1JTTA 3TBSA 1GGBL 5H8DA 1MREH 3O41A 4BM7A 3O6KH 2VQ4A 3NCEB 4IGBA 5AVQB 4KBPA 1OD7A 4PVNA 1GHFH 5GGQL 3B7YA 3TH2T 1KZYA 4CRZA 3VRLE 4MJIE 3CXHJ 3WE6A 3INUH 1UWFA 2VDML 4AL8L 5FLUA 2WXHA 5HGBA 2H5UA 3GUTB 2QMJA 4WW2B 4WW2A 1HL8A 3QXUA 3CZLA 4P2QA 4RFEA 4GUPA 2H3NA 5J0BA 2HFEB 3PQYD 4GUPB 2BNUA 2QVTA 4OLYH 1S7VA 2Q10A 2Q8AL 5FF6A 4EOWH 4WUUD 2NTSP 5HYFA 2L7JA 4S2SA 3FK3A 4BWWA 3FH7A 1A7RH 3GSXB 1E8WA 1U8JB 3STLB 3N85H 4LNRA 3FB6A 4NT6A 1GKEA 3UTTA 1Q9OB 3EYOB 3LH2H 1A02N 2F53D 1JHLH 3DDGA 3FQYA 4XH2B 1UM6L 5J6GA 5GLXA 1BW8A 4DGIL 5JW5A 3KS0H 1WF5A 1F86A 3QFJA 4MXQC 5CGBA 3Q7JA 5FECA 4JJOA 5CZVH 1DO6A 4GBXD 4X5RA 1WFMA 2FATL 5FW7A 3MODH 3F64A 1MREL 3VXMD 4E41E 5JXAL 5L2KD 2NYKA 4MJ5A 1BQUA 4QXGL 5JMRA 2A1WH 2CK0H 1A25A 3HC3H 5EBMB 5FO2A 1ESOA 5FM8A 3GC3A 4U0RC 1T5XA 4LSPH 5D93B 4HJTA 5EO9A 1GW0A 2YFNA 5F93C 4ZXBC 2HJKA 5LGHL 1PEWA 1KGCD 2WUBL 3MRFB 4H8VA 1WCQA 2NNAB 2NTFA 1YEHL 2JK5A 3KLDA 1E27A 3VRLF 4HWEH 3TM7B 5I6KA 4G83A 4K7PH 1J12A 4OCSL 1PD1A 4U6HB 5HI3C 2VMJA 4J3SA 1Q0XL 1A7RL 1WA2X 3BYTA 1JHTA 2GBUA 5EU6B 3L9EA 5EU6A 4U49A 2CRMA 1LP9E 4B97A 3IYLW 3U7WH 2GJZB 3D2UD 3JWOL 4QD2E 3N9GL 4G6AC 1QHQA 3WELA 1NBZB 4QEGA 1MDAA 1F8TL 1XTLA 4HX1B 5BO1H 3QAZC 1Q9LA 4NOHA 2CH8A 2NY6C 3FXIC 2GSIB 4JY4A 2FATH 4MD4A 1T2QL 1CICB 5JXAH 5HYJD 3INOA 4BFRA 1IILE 1N7ML 1RZIA 1QP1A 4JGUA 5C70A 1R3IH 2EH7L 2QDWA 2NXYB 3LKRA 1XB3A 1LGVA 5JPMB 2R4SL 3MRJA 1Y6KR 2FECI 3E3QE 4ONHB 1SFHA 3G6JE 4YO0B 2EVHA 4HUVB 1AQDA 2X0VA 5AOMA 3ZMNA 2CO2A 1SMYD 4FQQB 4NCC1 1F3RB 2VLJA 4GG6E 5T3ZD 5KZCD 3BUQA 1OTSC 3D51A 1MY5A 3BUTA 2HJLB 5DVPA 1XCQA 3Q6GH 4XXWC 3MA9H 1WAAE 4X5LA 4WY7H 3CFKB 3F7YA 4LKCA 2VDLH 3DX8B 3V52H 4IRJB 2H8PA 3EH5B 3Q2LA 3H6JA 2CJ3A 3MGAA 3HE7B 4XRCA 3HE7A 4RQQA 4XRCB 5CZRA 3SKOB 4JRXA 3JWOH 1S3SA 2ZUTA 3T1WA 4FDWA 3GXMA 4IDJL 4Z7UF 2ZG2A 4G6FD 3N3EA 1N59B 3OTTA 5EIVA 5IQMA 4AH2B 4WHYH 2D9QB 1CZ4A 1J48A 1X5AA 3IB4A 3TO2B 1Z0MA 3OKMB 3T6ZA 2YWZA 2BIIA 1JOIA 4CMHC 4J6IA 1E28A 5D2NC 4ELDA 4QRRA 1EXHA 2BWQA 3L81A 5E9DD 5T1MA 5TDOB 4YDLB 1Y7VA 3NIFB 4QI3A 1CQKA 4GT0A 1PNCA 3SJVA 3QDGD 43C9B 3WHE1 3VRIA 3Q8AA 1R24B 3NEEA 1YNLL 3M46A 2HT2C 4JLRA 4BQ6A 1MZZA 3PUUA 3MUY1 1M56B 1GS6X 2WBKA 4OIBA 2MCG1 3A67L 1A1NB 1BBJB 2J4WL 1BVZA 4K5PA 4S0HA 1ACCA 1AY1H 1W8EA 3EDDA 3IMBA 2QDVA 4FOMA 2LLGA 2VZSA 1M05A 4RA0C 4XAKE 5IMMB 3MLVH 3W9EB 5K59E 4QHKI 1KN2L 1MRFL 2XJKA 2XBDA 1RI8A 1S9YB 3GS4A 2PO6A 3MRQB 1JNLH 4YDZA 4LDEB 2RAMA 2EUZA 4YVUA 2NLJA 1EDHA 2XWTB 1IW7D 4LDLB 4FTVE 5CCHE 4EUPA 3R7RA 2FGWH 1SHMA 4NP4H 3RRQA 3JV4A 3VMOA 4PJ9C 1JDAA 1CDUA 4MWFB 4BINA 3KM2A 4JFED 5LAPA 4F2MA 4YLCA 3PS6A 2BSRB 4FXGB 5T3XE 1JVLA 2P8MB 3BLPX 4KRPB 4ALAC 4F15B 3TF7C 3KPRA 4DGUA 5KSAD 4YUEH 4AEIL 1FNLA 1WBYA 4HEPA 3S96A 5MEOA 4HS8H 2P5WA 3A67H 2P47B 3AS3A 3VNYA 1TTUA 4XCNB 4TTDC 4PEEA 2NQDA 2KLTA 4XHQA 1EDQA 3BKCL 2VZTA 5EO1B 2ROXA 3RVWC 3TH3T 3LOWA 3N42F 3EYSH 3FYIB 4AV4A 4X99B 3B2UD 3GK8H 3DMRA 1V3MA 4S0TD 4GW5B 3QQ3A 3RUGE 1QSFA 4MFHA 2RIKA 3JSSA 2AJ3A 5GISL 4H88H 1CE6B 5A6MA 5CJXC 4QO1B 2FGWL 4YBLB 4NP4L 1BHGA 5AW7B 1JPEA 5IQ9A 4BWUA 2X1OA 1R4XA 1E0OB 4JG5A 5B39B 1RJLB 1QPPA 5DYOA 5BQ7A 3PWUB 4KTEH 3HMWH 3MO1B 5FUOH 3SPHA 3A22A 3EDKA 2A6KA 4MJ4A 4F7MA 2ZE0A 1TQCC 1E61A 4JGJA 4MAUH 4EO5A 1ZS8A 1SMAA 3PABA 4N6RA 1AANA 4J3TA 1N0LA 3CFJA 3ZDZE 2FJUB 4F15C 3THMH 5F88B 5C0JA 1KY7A 1B0GA 2EDTA 1LWHA 3MBEB 1QO3B 2GIMA 2EO9A 3U6RA 1MCDA 1N8OE 5IJKA 4F2FA 3AG3B 4Z78B 3WJLC 5CEZD 3T3PE 4ENZA 3KAAA 3RL1B 5EOQH 5IK3A 3WE1A 2BP8B 1E27B 1E9PA 1RJYB 1L6PA 3HE7C 3IMTA 2BNRE 1MF2H 1MI5B 1MHEA 3F65A 2I32A 4PTTA 3T65A 5T5MD 5IFAH 3E2HC 4TOYH 4Y1SA 3RNQA 5B1KA 1UOVA 1J88A 3SO3B 1MWAA 3U36B 3FQTA 4C56A 3OPZL 3CZBA 4RFOH 1CFNB 4PSPA 2UVFA 2VB5A 4PRBA 4FJ6A 1YAZA 4OR1A 2M1KA 3FT2A 3IXTB 2FLBT 5BZDB 3THML 5GRUL 1LO0L 1MUJA 2K3HA 1KT2A 1L0YA 4FJZA 2XRAL 1Q0YL 1L9QA 4ODVH 3HE6D 3A5VA 2BO0A 2GIYA 2ZUWA 3G5ZB 4CMHB 3LN5B 3EJTA 5CKAA 3SPVA 5KWYC 3Q8CA 4NUPA 4J3XA 4Q58C 1B4RA 4JFPA 2E4FA 2VDOH 3EJQA 2Z7ZA 1IJ9A 2VXSH 4BV1A 4M7JH 3MYZA 4TULL 5EFIB 3L1GA 4XOEA 3VGDA 2QKIA 2TAAA 1TZGH 3D5OF 1YYLL 5IMKA 4HT1H 3LX9A 3EOAB 3QHTC 1L9MA 2EE0A 3GBLA 3KPOB 3SZKC 2YA0A 3G6DH 4QXWA 5DD0H 1IC5L 5JUEH 4AONB 3MGTA 3BOVA 1UA6H 5L88H 2GK0B 2TSBA 3O6MH 1KEML 1SXNA 1T4KB 4FTVA 3VXRA 2CDFA 1CXHA 1G7QA 4U1SB 5EZLA 5F9OH 4LCCA 4F57L 2FX9L 2XCMC 4W70A 4QHUB 3ULSA 2CALA 3KYMA 3ULSB 2ADFL 2OAAA 1J7VR 3FYEB 5IB4A 1ZT1B 2BNQB 4R7NA 4XMLH 3MFFA 1KJMB 1LO0H 4JFXB 5GRUH 3U0PA 1LQSR 2J1ZA 2BSED 5LNEA 4ORGB 5IESH 1NAML 4NQSB 3CDYA 1Q1JL 5LUMA 3MMEA 2V9UA 3QUXC 2BY2A 3SDAA 1FE8H 2OL3L 4Z3JA 4KNSA 4LHQB 3GRBA 4N2LA 2ZX6A 5M7QA 3OKDA 1FFPA 3MR9A 5DJ6B 5AOJA 1OV8A 3CBRA 3FT1A 3S48A 2X6AA 4YGVB 2DI9A 1YN6A 3V9EA 4UM9B 1CVSC 4FHJA 5C08B 5T33L 4HWNA 3EOBA 1JZ7A 3D0VA 5KBNC 4OCLC 5C92A 4L9DA 1XF5A 1A4JA 1YUHA 5BUPA 4LVOC 5D2LA 2A4CA 2QSTA 3S98A 3N41F 5HJGA 5L88L 4XODA 2DV6A 5HGDB 1KCUH 3P1VA 2A7BA 3CLWA 2A5UA 2LR4A 1M1SA 12E8H 4X42A 3DXAB 1V3LA 3HRPA 3VH8A 1WZ1L 2Z31B 5FB8B 1UKTA 2YPKA 3HG3A 4MDJB 2H2SD 4O4YH 5EBMA 5GGTH 3U48A 3AY2A 1RIVH 1X4XA 4IM8A 5HGHA 4BH7A 1H3WM 4XMLL 3QORC 4B96A 5DRNA 3GZKA 5GGVL 2PXYB 3BT0A 4MNGA 3V4VA 4XB7A 4UBDC 5ICZA 5LXGL 5ANMB 2YPVL 5ABZA 5C1MB 4CNIB 5F97E 4OB5L 4A2LA 4U1IB 1J5CA 4MRCA 1V3JA 4RWYH 3B9KC 3MRHB 5DT1L 3MOBL 4BJLA 4KI5C 5LGYA 4P3CH 1IO4C 1HI6A 2BMKA 1JHTB 5DEFB 3WN6A 1L0QA 1G8KA 15C8H 1L5GB 3NIFF 2A77L 1L5GA 3X1NA 3EGSA 4Y5VA 1NBZA 4AGOA 1AXSA 4YXKH 4FZ8L 1V7NL 1T5WB 3BZDA 1NC2D 4NQXB 2AQQA 1FAIH 3T3MB 1NOFA 3JV0A 5C0CE 5ADOH 3PWVA 1BXXA 4RGMB 2JQAA 2X28A 3M1OA 4NCDA 4NZUL 2BVUA 3GSRB 5MENE 2YK1L 5DF0A 3FQ2A 1ZWIA 4X98A 3TJHD 2IWGA 4PJHE 3IDYB 3BP7A 1XF1A 1SEBA 4Y2LA 1OGTA 5GGVH 4GS7B 3FOLA 1D5IH 1LK3L 1PZDA 4FQQA 3MFGB 5HDLA 1Q9KB 2YPVH 1P5VA 4ZYKB 2E8ZA 2J8UE 5HHNA 4BQBA 3X2JA 2HLEB 4KDTA 1U8OA 2NY2C 1UH3A 4AUJA 4NEHB 2EUXA 3S5ZA 4PWEA 4QLWA 2NY0C 3GXIA 4JM0A 5DS2A 4Y5YC 5CINH 2Z4QB 1AXTL 4E36A 4X6CA 5L6YL 2BCMA 4PLKC 4Q9QH 15C8L 3P9LA 3QDJA 1H8SA 1UXWB 2A77H 4FG2A 2JKRM 1UXWA 5DFWH 1HQRB 5FM5O 1T0PB 1ES0B 1BZ7A 2QR0B 4J6RH 4DPRA 4XO8A 4AEEA 3MRLA 4LOEA 5C0BE 1R9TA 3OR7A 4ELMA 1HN1A 4Y16D 4DW2H 2XBZA 1TQWA 2F7IA 2LU3A 3LNDA 4TSCH 1UH2A 1IM3B 3LRMA 1LE9B 1HESA 4TNEA 4W4OC 3SYCA 1IEBB 3J07A 1KN4L 5JHLA 2J55A 1LO3H 1ZVSB 4NN6C 1KPRA 2CCLA 4G8EB 2VLRD 2J8HA 2WYZA 1NCAL 4NNXB 4NZUH 4HV8B 3LHPL 3IPEA 2J88L 4A7QA 4RIRA 4AZ8B 4AZ8A 4QHPA 4ADIA 1JNJA 1ZT7A 3T65B 4Y1AA 1RH8A 5DLML 5KAQF 3MV01 2H9GB 4OZFG 4AZDA 3GHPA 3NJXA 2IV8A 2PWHA 4TVUA 5INDA 4LKXB 3O3EA 5CJ5A 3O3EB 3BVXA 4P0DA 1TJMA 3OJMB 2Y36H 3ZRSA 1CFNA 4P9HL 4PJHF 1WGVA 3F2LA 4N0FB 4QRUA 3RIFK 4UTAL 1UT1A 3HZ3A 3L1OL 1JRHL 2D7TH 2Z0BA 4PCTA 5C9JB 3PQYB 4ODHH 1A6VH 1AXTH 4PJ8D 1A4BA 4M8VA 1FJ1A 4ZFQA 4DK6A 4Q9QL 1NFDF 2XZZA 1ASOA 3HPLA 3PPEA 5CLWA 1MFVA 4AYID 4ZUUB 3O8XC 1E5ZA 3G04A 1TYJA 2VSKB 4X6FA 3VTMA 5DO2C 4EUPB 4F7CB 4J6RL 3LN5A 4XT1C 5IQ7L 3O3AA 1DVFA 1WBZB 3B2XA 4F20A 1HAUA 1VF5C 5DZPA 1ILUA 4PP1C 4C55A 1IE4A 3UEZA 5D4QA 2AVFA 1A7OL 1NCAH 3BEWB 4G8AC 1PF3A 4R96A 2WMPA 2YGPA 4BFOA 1EA9C 3G5VB 4R9HA 3SJVD 2A74A 2AXFA 4WWKC 2CDEB 4NRYB 4PN6A 1HCVA 2VIRB 1C1EH 1I9RL 2CHDA 4OUOA 5JA8B 4XP4L 3BH9B 2EADA 3QUYC 4LSSH 4AC2A 2PP9A 2VLKE 1KXVC 2EXYC 3IAGC 1CQYA 1MJUH 2BP0B 2R2EB 3FTGA 1Q9WB 4KY2A 1WBYB 3PHOA 4LRIA 3KG5A 3OAWA 3S96B 5GSRB 2XZCL 2HJFA 1PCXA 2ZAGA 2OCJA 4Z9KB 4J8RA 4L1HA 2APWA 5E8PB 4MMYB 4O00A 2Y36L 3IFPB 3GDBA 3U30B 2CHXA 4A1RA 1A3RH 5EO1A 4UTAH 4F58L 5T3ZE 1N64H 2VQ1B 2PW1A 4AV5A 1YQVL 1OAJA 4Z23A 3VFRA 3PWLB 4PMFA 3VFRB 3K71B 3TA3D 1HAWA 1OO2A 1M57B 2WAHA 4HQQH 8FABB 2BERA 5FO9A 1PS3A 2VLJD 5EU7E 2A68D 3KD4A 1Y1WA 1MDTA 4M6AA 1C5BH 3C8HA 3RFRA 1OD9A 3ZDXF 4AGQA 5AALA 3SY0A 1UM5L 2XWCA 4ICXA 3ABMB 4LRIC 3PGDB 4AK2A 3L5IA 1A0QL 1QPXA 1T1XB 1PIFA 1T1XA 1P0SE 2PPFA 3D2UB 4HJGA 1O9WA 4Z7UA 3QJSB 4J3WA 1YEIH 4IEFB 4NSKB 1CIDA 3L3IB 4I18C 3MRBA 4M8QB 5FCUL 2YJQA 2DLHA 2X53A 1C1EL 1I9RH 4RMTA 1TQSA 1ZS8B 5SWZD 2CCWA 3PABB 5EZOH 4N8CH 4YR6B 1TJHL 4IHOB 2G9HA 5HYJB 3X11B 2XPGA 4OCXL 1OARL 4Y4FD 3TN0D 4R6UA 5DJCA 3CF2A 4FXKC 5GS1B 1FP5A 3O8XA 4O2CB 3T4YB 4JM2B 5CU5A 4K3JL 4GAYB 2G5BB 2MKWA 3NN8A 3T2LA 1X4ZA 1AE6H 2JKTM 4E42B 1FVEA 4FFWC 5JLZA 3QNXA 1GYUA 3MJ9H 3VTTA 3ZMEA 2OMWB 4XTRD 2R59A 2NNFA 1T0NB 1WPCA 4IYKA 1TU2A 1C5BL 3CXFA 5AD0A 5I24A 2BINA 2OKMA 5E5RB 4X6CE 4EDXA 3OGOE 4EXPX 4OD2A 5HJBA 3MX0B 4LLWB 3Q5TA 4PWGA 4N0UE 4Y16A 1YC7A 2J8UF 4Y7MA 2Q8AH 3HE6A 3V5HA 3VGBA 2BVQB 2J6EL 4DP8X 5ALBH 5E0QA 4GG8A 5EZOL 4PJDE 4K9EH 4W4OA 3ZHNA 3ZDYB 3RVUC 3HMXA 3QJZA 3HZKB 4JPWH 5TE4H 1YEDA 1UM6H 2FLMA 3RVVC 4I18B 1DEDA 1VAHA 1H6EA 4GKNB 3WKNA 4OQTA 3N42B 3UTTE 1KENH 5EEXA 2JIQA 3CX2A 3W39A 3GI8H 2QKIB 1AD9A 1R46A 3N0PB 2GJPA 4Z7QF 3BSHA 3VYOA 3FQNA 1JK8B 5IOPB 1OOAA 5FYJD 2XQBH 3DOSA 1N26A 3PLXB 5C7ZA 2N0MA 2XKUA 3KGUA 2KLSA 3MGTB 3CSBA 4NPKA 3IDIB 1Z5YD 5DHDA 1Y1DA 3V4PB 2WKOF 2WUBH 4IOSA 4JE0A 1X4YA 1YEHH 2B1OA 2WNXA 1KBKA 4HWEL 4H8PA 3S3SA 2K7PA 1EH9A 1BZ7B 2QR0A 5ALBL 4NQDD 1LWRA 4G8GE 1JXDA 4N9GB 3KYAA 5MEPB 4XXDB 4P04A 4GI8A 4HGMA 2VWEE 3CFEA 4YFEA 5I6MA 3ROLB 4I0PA 5I1HH 1A1MA 4S1DD 1SQMA 1QLFB 2N7AA 1HL4A 3NSCA 2ESVE 4RIRB 1RCYA 4IMKA 4PJBE 2LHAA 4LP5A 1KYAA 4DP7X 3UYPA 2Y7NA 4Q6KA 4NRXB 2XG5B 4ZJ9A 4A7GF 5F89B 4P2QE 5B3JE 2C3WA 2R4SH 1O7SA 2G9KA 5INCB 5IHZB 3IU3B 4WGKA 4NO5B 5DK3A 1IGYA 2H6PA 1O0VA 3BYYA 3GTVA 3QDMB 4OCYL 5D7JA 5IM7B 3PWPD 1FNAA 3VGHA 3ZYOA 4GIAA 3CHSA 1M1XB 4FMKA 4Y2NA 2ZKMX 3GTTA 3VH8B 4TN9A 1WITA 5DD3H 3MA9L 2Z31A 5DMGD 2R4RH 2MMXA 1LEGA 2XXCB 2W1NA 2NX5E 2EXYD 1WQVT 2NQCA 2JNZA 4QTFA 3RU8L 3LIZA 2WXMA 4Q14A 4X9GA 4GRLB 2UUDK 4R0LC 3CTTA 4F9LC 4K7FA 2XVBA 4U6VL 4IDJH 2W0LA 1RMFH 1MCKA 2YXVA 2CIIB 3QJUB 1Y0LA 1JDCA 2VIRA 1MCLA 2NY5C 2IH8A 1I8MA 3R1GH 1N67A 4PLJC 2EO7A 4I85A 4FXTA 4HKJB 2Q5BA 4JUSA 1OIOA 4HKJA 3OV6A 4Z1PA 3IMVA 5DO2D 5CJOL 3ULUF 2X40A 1BBDH 2OJZL 4WO0A 4M8RA 3OWRA 4PRNA 1ZHBB 2IGLA 3D18B 3DX7B 3FCTB 2QSVA 4DOHE 1BX2B 3UGXA 3GBDA 4PB9L 5FGBC 3KJ6H 4YFLF 4U0QB 1CT8A 5IHLB 3WFHB 3QO0A 4ZMYA 5GLYA 3GMOB 3BZ4B 2Z8VC 4UT6A 1MI5D 1VFUA 2HTLD 4YHNA 3CVDA 1ACZA 1W6LA 1XH3A 1P4LA 3TH4T 3O9WB 2XWDA 2NCMA 3FOLB 1HHJB 1PY4A 5FGBA 4LRNH 4A55A 4JP6A 1IBDA 3DDFA 4EZJA 1FGVL 4DP9X 2IOIA 1GY1A 2EUVA 4WW1A 3L48A 2GTZA 1XQ4A 4JO5A 1KXQA 3S35L 3L4XA 1GZQA 5CJOH 4D9QE 3I85A 1HQRA 2OJZH 3ZUNC 4N0RA 2A2QT 1OOWA 1FCGA 2VR7A 3MRLB 4MBOA 3TFBA 4X6DA 1H6UA 1IM3A 4JM2A 2NY0D 5LCVA 5CMAA 4TQ8A 4XOAA 5HY9B 5F7MC 2UZXA 3MU3A 1SMOA 2DYPD 1NCHA 3KCWA 3UBFA 2AXGA 3U4AA 3WEMA 2ADGB 3BKCH 4X8XA 1BP3B 1NCBL 1U3HA 5F3BB 3GMNB 2EE9A 3GK8L 4X5WB 3QRFM 2P5EA 4KZ0A 4OGYL 5A6IA 4JPVH 3MUZ1 5DZLA 2YARA 4LVNC 3RIKA 1LMIA 1LK2B 1FGVH 3FB7B 4E5XG 1XCXA 3X1EA 5ETUB 3V5HB 2F58H 3QA3A 4I13B 2Q8BH 4EUPG 3WTYA 4LDOB 1S9WA 4WSJA 3QISA 4TUOB 4BYHA 2MQCA 3C60D 4KTEL 1N4XL 2HTKD 3VFWB 3BDXA 4KVPA 1ID2A 1WEJL 3NIGE 3P4MA 1MFCH 2YUZA 4QF1A 5DCCA 4QF1B 2DLTA 2OM5A 3DVGB 4PGBB 4QOKA 2F53B 1QSED 1JMXA 2MOVA 1GJWA 2XWJB 3BO8B 1N12A 4KI5D 4MD0A 1ZSDA 3D07A 4U3CA 1RJCA 1QBMH 1U0QA 2IV2X 1T1WA 3B9KD 4XPAH 1H0DB 1MVUA 2B3IA 3ULUE 5E94B 2DMBA 1QRNB 4HIEB 5GIRB 5EPMB 3QQ7A 3V79C 3RWEB 4DGVL 3SCMC 3G5VA 4ZW7A 1U95B 4MX7A 1XMEB 2IBZY 3ZE0F 5CEXA 1IVTA 4OGYH 4QHLA 4NC1C 5E5LA 4GLRH 2BS71 2F5AH 4IBSA 3RY4A 1NANH 4DKAA 2F58L 3AZUA 3TZVA 4XHJD 3SKNB 2XZQH 3MNWB 1HXMB 2BZCA 2IGFL 2EKJA 2PXYD 2A9MH 3H7BB 3H7BA 5HBBA 4B9KC 1BDYA 1S7SB 3H0TA 1RL1A 3NP3A 5I1EL 2X4TA 2X9XA 4P06A 2X4TB 2I24N 4PUBL 5EU6D 1WEJH 3CIQA 1MFCL 3TNNA 3NJNA 2X4PA 5IB5A 3P4NB 4FF9A 4OZGF 5C0DB 4I9WD 5I1CH 3GJFB 3GT6A 4JHAL 3FUDA 3OQRA 2H3XC 1W72L 1UQSB 2YEVB 5CXPA 2XRAH 3CH1A 4OCMC 5C86A 4PJAF 1Q0YH 2MJWA 2VDQH 4NRXA 2BPBA 1CICD 1NAMA 4DGVH 4BFNA 2R15A 3GFUA 2C9XA 4UQEA 3TO4D 5INCA 3SODB 4FQ1H 4C2MA 2A69D 1JF1A 2BSBA 2YQ2A 1BVKB 1IGYB 1MCWM 3EHBB 3JWNH 4Z7WE 2BVEA 2IAAC 4MJID 5D7SH 3GTQA 5FO7B 5I1JH 1TZGL 5TDNA 1YYLH 1BQKA 2ENGA 4WEUD 5TDNB 2HJLA 3KPNA 5TDPA 4YSOA 5FV2A 5CEZL 2WZPD 2HUEA 1E9OB 4XVSL 3QGVA 1A8ZA 3F7YB 2KQMA 2EIKB 2IGFH 5ESVB 1I3GL 1AKJD 2FIKA 5D72L 3RGBA 4BHUI 4FABH 2ITDA 5D2NE 1G7JA 3DSNA 5EIIB 4L0PB 1U8LA 2LU7A 4LLDB 4P4KC 5ECGA 3CGTA 4IGBB 4Z3GA 3VI4B 5D7LD 4HIJA 1CB4A 4X9FA 2O5ZH 5I1CL 3TBWA 5L2JB 3ZKMD 4L48A 3M1CA 2I9TA 3LEXA 1W72H 2IG2L 3OKOA 1P53A 1UENA 1E90A 3QIWA 4PRPD 2CBMA 3FT4B 5DA4A 3WFEL 4FQXB 4RFEB 4XO9A 1NAMH 4FQXA 4ZODA 4AT6A 1HH9B 4AT6B 3U46A 4WHCA 2HFTA 2NZ1A 3QFGA 4G70B 1S7VB 3WFCL 5EF1A 1K83A 3CFDA 4GOSA 4XWGH 3CCHB 1DJZA 2FR4B 4WV1A 5C0CD 3J8F7 4OZHB 5TF1L 5GS2H 3LZQA 2VLRB 4Z76A 5J1AB 2VM4A 3WFBL 4G8IB 3GMRA 1P6AB 4QRSB 5B21A 2DIBA 4KTDH 2O5JD 3MBXH 1TQUA 1AO7E 4WI2A 4YHPA 1R5IB 4WO4B 3V0HA 2C8NA 3BZ4A 3VE0A 3BP4A 5D7KE 1J5IA 3RILA 2AERT 3SYQA 3SEPA 3LMJH 4HJJL 1I3GH 4FABL 4HOMA 4WKXA 4E5XB 3GSNA 4NWUH 3TYFA 2HVBA 2ITCA 5E9NA 3LN4A 1UD2A 2J1KA 4AQAA 1G5AA 3E9UA 2AQ3A 1DEEB 3T6QC 1FFNB 1FFNA 3BPOC 4HSCX 5IWLA 1OZTG 1SZNA 3C5XA 2FO4B 4PP2A 3RJDA 5ITFA 3C5ZB 2ZYSA 3ARTA 5FCSH 2NZIA 5EMYA 5DSCA 1X44A 5BW7A 5TGBB 3MOBH 5DHVB 4RAUB 2A74C 2CHNA 3KYNB 1IAOA 4EF3A 1CZ8H 4ZZKA 2BOBA 1WT5A 2R69A 3IU4L 4W9GC 5CAYB 1XR8A 5HVWA 4I0PB 1U42A 2K78A 2FSEB 5I73C 1L6ZA 3RY6A 1NINA 4ZO9A 4I0PC 2M26A 3VCLB 1W0VA 2UXFA 2XTJC 3LS4L 2CO3A 3UAEA 4PJCE 5TE6L 3I6GB 4TL5A 5L2KA 3ZN6A 2WB7A 3DV4B 1QSFB 3EXLA 2YD8A 1GVIA 1IT9H 1UB5A 1YAIA 3EH4B 4I1NB 2JIOA 1D5XA 3MXVL 4UIKL 1CYXA 5E6ZA 1CE6A 2YK1H 4QGYA 2VNCA 4BUQA 3MRJB 1EEYB 3VFMA 3SDCD 2YGVA 3QA3B 2EDEA 3LRLA 3RIAF 1WA0X 2XQYK 1ZJBA 1IC7L 4PJ7E 2WLZA 3V0FA 5EEZA 2VLJB 2XA3A 4AJWA 3FFOA 3GHBH 3VFWA 3D2TA 1PLGL 1QABA 5C09D 3TNMB 1ICTA 1S46A 2CJUH 1B0IA 2Y3NA 3PHAA 3TL5A 1S78C 2FEJA 2B0SL 2F53A 4JZJC 2HLAA 5IKCB 4YX2L 4MD5A 5KSAC 3TIDB 1THCA 2EE6A 4UOW1 3IU4H 2JA7A 3TS8A 5H37A 2V3VA 5B3SB 5BO0D 3P3TA 4QUOA 3UZEA 1F3DH 3D4GA 1PYUB 4AVJA 1I7ZB 1ZE3H 4TF4A 5C07B 4YBHA 2VR9A 1TJGL 2VXUH 3T2QA 5I1DB 1HDMA 4TSCL 1IZKA 5LDSA 4Y4FB 5I6PA 1EO8H 1YMHA 2OXHB 4Z5RA 2JF1A 3VTAA 3OXRB 5IFJB 2VLMD 3ULUH 4XX1G 1RJZB 1YEKL 4Z7QB 3R4DA 4GRMB 4MDIA 1TVBB 3GXPA 5GGUB 3A4AA 2J88H 2EIJB 3QIUC 3OMNB 5LAXB 2OK0L 1R24A 5DJ0A 5HYJE 2YAPA 3F58L 1JZDC 2VTFA 1N18A 2K9UA 5FYJE 1SYVB 3HVDA 4TSAL 3TJEL 3IVKB 1PLGH 3MDJA 1CK0H 4GS7C 5GS0D 1KY6A 3M1BA 3BWAA 3BWZA 4P9HH 4OU3A 3B7TA 3HZYA 3ARBB 2WWKO 4IGBC 3EJCA 2EIMB 1HNFA 1V54B 1UQSA 5I8CB 4N24A 5GRWA 4F91B 2Z0UA 3SUJA 1GJIA 3UBXB 1CGYA 2EZ0C 3UBXA 4FXKA 4JBSA 4JL1A 2BVPB 5CP3A 2NXYC 1KYOJ 4ZX6A 5JPMC 2WANA 3HHRB 4Z0BH 3VG0L 4UCFA 4MZRA 4H25B 3T0EA 3TYGH 4UNVA 1EO8L 1KJVB 4JFQA 1JF1B 3FUIA 1UTDA 1SXCA 5D7IB 2CR6A 1ZANL 3CHPA 1YRKA 1BD2E 1YEKH 1Z9OA 2PCXA 3DRTA 5K39B 4Z95L 3GTJA 2JI1A 3QZBA 5TDPB 1DUYB 2RACA 3NCYP 2MRYA 4LSSL 4OIFA 5DD1L 5GRJH 3UTPE 1MJUL 2V8MA 3AWEA 3SE6A 1PQZA 3OF6D 4ODWA 1AZUA 5EZLB 3Q2CA 4G5ZH 2C4FT 5DRWB 3VXRD 5FAAA 4ZMAT 1CK0L 4IK6A 4NQCD 2X6VA 3HG2A 1IQWL 1PYWA 1EEUA 5DVOA 3PWJA 5T5FH 5ADPL 4M4RA 4IBUA 1VEPA 1TJXA 1XWVA 1YQVH 1KIRA 2ZG3A 5E08H 5C97A 3A3YB 3NFPB 5D93C 1KIQB 1K6QL 3ML9A 4PJXA 3GBNL 4F8TA 4HCRH 4WF7A 2HRLA 3OMAB 5A2AA 4IHBA 4EE2A 4M7ZC 3CFDB 2MQGA 2WZ5A 4LU5L 5FFGA 4AJYV 5H35B 3BVTA 5D96C 5J9PA 3HKFA 4GIOA 2I07A 4WCYH 5JPNC 1ROWA 1U33A 2Y7QA 2YPLD 3RZCD 3QUYA 3KLAA 1ZANH 4G6AD 3SGKC 1YEIL 2PTVA 3L95A 5DR5H 5I28A 5TFSL 2G2NA 1XIWB 4P46B 4NHCL 3VFUB 3LIZL 4HG4K 1JBJA 4PJAB 4PJAA 5CFAA 3OMZA 3M88A 5MENA 1J0ZA 1HSAA 1MCFA 5D1ZI 4UOQA 4NO0B 5CF3A 3D3VE 1KTLB 1TJHH 2XXMB 5E5UB 2F54D 1R7RA 1QDNA 3UJJH 4CMMA 2I7SA 1ZTXL 3LCYA 2LAGB 2R69L 5E00A 4AQ8A 3BLKA 3D34A 3CDGB 2JQZA 2XI9A 2V2TB 2V2TA 1T2JA 4OLVH 3ZXAC 2YSSB 2IDTA 5J56B 1BLNB 1FLRL 1P7HL 1F45A 1HNYA 3HNTH 3R8BB 1VC3B 1P2CA 3LZRA 4P2QB 1FNFA 4X6EB 3MJ9L 1UOKA 4ZW6A 2WLHA 3VI3E 1A9BA 5AW3B 2N7BA 5J57B 3SYOA 3OSKA 1G6RH 1QLEL 3LVEA 5IB3A 4KRNA 2X4QA 3TPUB 4EI6A 2ZCKL 1NJ9A 4K7PY 4LU5H 2WLIA 2Y4SA 3NQIA 5C6PB 4C59B 1EAJA 1U6AH 2Q86A 4NI6A 1VFBA 3GSQB 4HIXL 4ZUTB 3GSQA 1RUAL 2NW3B 3D3VB 2YN5A 3QG7H 5TFSH 1XR8B 2W92A 3JVFC 4NHCH 4AKOA 3C12A 3LTVA 2R1WA 1FL5A 2KDGA 2BFGA 2P52A 2WKOA 4P49A 4JKMA 3SKMA 1QUPA 3PQYE 5EU5A 5B39G 4OF7A 4K9EL 1JGUH 1A3LL 4MQ7A 3JT0A 2ATKB 1S3KH 1NC2A 2DDQL 2EKSA 3DV4A 1NC2B 1SHSA 5FYJU 3G08A 1R0AL 1OHZA 1GTFA 1JI1A 4JPWL 4ELKB 4OZFB 1EFQA 2G2PA 3BKML 4JFPB 1HWWA 5CSGA 4DSYA 2L8AA 1K2DB 2G4GA 1K2DA 2Z92B 1JF5A 2X41A 5AZ2H 2K4WA 1E6JH 4M03A 1NEUA 2Z8WC 4XVTH 4ZYKA 1ORSA 1HXYA 3WY3A 3NBNA 1G6RL 5DUBA 1BFTA 3O9WD 3LIUA 4UDUA 1A3QA 1J9CT 3GSWA 2BHYA 1ZDSA 4DESA 2I27N 3TIDA 2FDBP 1G7JB 3DSNB 1TLMA 4WJ5A 2NCEA 2WP3O 3MGOB 1V27A 2WQRA 4LPYA 1WH0A 3QI9A 1YMMB 3ZY7A 4FADA 4JM4H 4X9BA 2YAEA 2CHWA 4PTUB 1CUOA 2MKLC 4J3OH 4JVUA 3RWJB 1A3LH 2J6EA 3AT0A 1U91A 5JIPA 4PIRF 2LVEA 3NJLA 1ETB1 3OKEB 4BCYA 4G7RB 3BVDB 1WICA 3NZHH 3U46B 4JQIL 1YEJH 2CO6A 3TVMB 4GRMA 4XMPL 2DQFB 4XPGL 3BKMH 3UCQA 4I3SL 4RSYA 4YDVB 1RIUL 2DYPB 4B7LA 2QSCH 2VC2B 1OAQH 3IF1B 3VFTA 4DHLA 4H7VA 3QQ4B 4LPXA 2HT4C 1MFNA 4APQD 3ZE0E 1SLXA 5E8EA 3NDYE 2HYMA 1W72A 2B39A 4P5MB 2QHRL 5FTNA 3HZYB 4F9PC 3FN9A 3LKPA 2NY7L 5CJXA 3JVGC 4K3DH 5T5ID 1E65A 4ERSH 1C08B 3DUSB 2VXQL 1MJJB 2WTRA 4ZUUA 4GUQA 4Z7NF 3PWNB 2XYCA 3Q1SL 4UILL 2WCSA 4MDJA 4YHKL 4QRBA 2YKLL 1BECA 3IXAB 3KLQA 3X12A 2G0LA 1SF3A 2EINB 5EOTA 5F1KC 4M61B 1B2WH 1IAMA 4DGWC 4XMKH 2CM5A 1QWHA 4C47A 2NQ3A 1E28B 1T89C 1ZTMA 3C09B 5AW4B 4S1QL 1NAKH 1A6WH 3SDAD 3LPOA 3QFDA 4U6VH 2D4DA 1RMFL 5JHAA 1AKPA 3H9ZA 5E6IB 1CTNA 2C9PA 1K5WA 2YJLA 3A6BH 3SJVB 3UZEC 4X4ME 5HVGB 1CL7H 4KRPC 3U4BL 1RIUH 4YL4A 1DVSA 1CF8L 3KPRE 1BQLH 4WUKL 3ALWA 1SN5A 4JFOA 1I85C 1T21A 3IDMA 1QBLL 5DRWA 3RTQC 1BBDL 1I8LC 3T0DA 4FQLL 4DN4H 1G7IB 4KOBA 4L0ZA 1I1AC 4NENB 5K33A 1DTUA 1T6VN 5HGAA 2C1PB 4WWID 2B8OT 1I8KB 1CMOA 3BEVB 5GPRA 1ORQB 5K9KA 3BT2H 4K3DL 4U4BA 4J2XA 3O2DL 4GO9A 4UT9H 3I6GA 3IDJA 2QADC 2DWTA 2X9YA 4Y19E 3GMPA 4C58B 1KDJA 3APNA 4XVJH 3P9WB 3CPLB 1VFMA 3IS0X 4FG0A 1HZKA 2PO6C 4KJQD 1XXDC 3G6AB 4X8JB 2B4CH 3C8DA 3HAEH 3L9BA 4BEIA 2X1QA 3HIZA 1E5BA 2JJWA 4RBPK 4QHKJ 1JCVA 2QPFA 1FDIA 5B8CC 4Y7OC 1HYSD 2HPTA 3L3JB 1I9EA 2X0WA 2XA8H 5KANG 4R90H 5AOIA 1JSYA 1UH4A 2GBTA 3AABA 1VLXA 4MQSB 5BPPA 2J5LC 4A2MA 5L8KB 3K1KC 3KPRB 1CL7L 3U4BH 1WT5C 2W0FA 4P57B 4XBEL 3ZO9A 1FSKB 4DH2A 1M42A 5FUZL 3KVDD 3SGKA 3QULA 1CLVA 3EH3B 4E9LA 2DL9A 5EZIH 3CMGA 4BGDA 1NGXB 4NC0B 1BEXA 2P80A 1X6LA 5CHNA 2EAEA 3AQDA 4GAYA 1FV1B 4NLHA 4W9EC 1YVLA 1KCKA 2DMKA 3BAKA 2BNRD 3JWDH 2VOTA 3ZTNH 5I1KL 5LKNA 1RJZA 5J89A 5ICUA 1DBML 1X5MA 5JORB 1CBVH 2PABA 3OD3A 1AKJB 1DQDH 4YHLL 1AKJA 4WI9A 3LH9A 3MV7A 3DTXB 1K72A 3DTXA 4J1UA 5D7LE 3H3BC 5KBDA 4GA5A 3IETB 1GGIH 5CN2A 4KQ4H 4H0LC 3RPBA 2FCBA 4TUKH 4LCWD 1SYVA 5I1IL 5DJXB 1XHHA 2DQCH 2R0ZL 2XA8L 1AA6A 3QO1A 1RUKH 4I5BB 4KZDL 3BN9D 1QUNB 2BVQA 1ODAA 3KPSD 4QNPF 4QJ5B 3B9DA 1XL4A 5DZNA 4YSCA 1UHEA 3UTQA 4UTCA 4XBEH 1WFIA 2Y69B 5HHVH 3QFJE 4YBQD 1HJCA 4N28A 5FGRA 2C7UB 3EYFA 4AYMC 4KO5A 1S7TA 2GHWB 5C0JB 3R18A 5JHDB 1JPGA 5DJYA 3A6OA 4AW7A 3EHBC 3VFVB 3NCXA 3V0EA 3RFZA 4NKDB 4MZIA 4KROC 2QGCA 2ZAIA 4MDRA 1X5IA 1P5UC 4H25A 4LARL 3KNBA 5I5IA 1X9QA 2QJDA 3STZB 3JWDL 1NFDE 2QGDA 5D1XA 3ZKNC 2DH2A 2WZ6A 5JR1L 2DQDH 2P8PA 3R0NA 3DOSB 3T2NH 1YNND 4O51A 2HKHH 4LLUB 3FTGB 5GGTA 4JFYB 2D7QA 4Q2ZB 2ZOTA 4ZOAA 4TUKL 5FTKA 1C5DB 4PBWD 1MWAB 4N6QA 5I1IH 4AW4A 2R0ZH 4LEXL 1BOGA 2RTTA 4TPRL 5DJAA 1GAFH 1KWKA 4IS6A 3S5LB 3MBEC 4FLRA 3SBRA 4DIXA 4Q4EA 3ZT7A 1MUJB 2V37A 3LKNB 2V9RA 5FO9B 3SYPA 2H4EA 3TVMA 4JS7A 1TTGA 1II4E 1FLTX 3IGAA 5I8KH 1F2QA 1AZRA 3AWFA 4JHAH 1DMSA 1PMYA 1N5AB 1H3UA 3QJQB 4U3SA 4MS8D 3Q3GB 2K70A 2VDQL 4ZW3A 3KWTA 5JR1H 3V4VL 4GAGL 4S0SD 4KKLD 3OAUH 1A4KB 1HSAB 4QY8B 1RZPA 3PU7A 4D9RD 5I1JL 4BFKA 2EIDA 3BPNC 4UT7H 4LEXH 5KSVA 4TPRH 1WO2A 2D31B 2EDOA 1FPTH 1BQHB 2V8LA 4Q4IA 3VI3B 1C7SA 5AZEH 1URLA 2D73A 4PJIA 1ZXKA 4FMVA 5I17B 4H4NA 5KYUA 3K6OA 3BQUD 1OKEA 3HS0C 5I0YA 5GXBB 4MMXB 1DQQA 2R2HA 2F19L 5G4NA 3K6NA 5FO8A 4HEPG 4GAAA 3AVEA 2HXAA 2X6UA 1KTDA 3PAVA 4GRLD 1ETA1 1F6AB 3F7VA 5D1XC 2AV1B 5EU4B 2ZNWA 3ISWA 4JO2H 1KFAH 4JFHD 3ZTCC 4MCYB 2FQFA 4YSAA 2DWEB 4PJFF 2X88A 2WO3B 5CP7A 1DN2A 2Y2YA 4D0BB 4FN0A 3WDHA 4H1LG 4GAGH 4J3BA 3OAUL 3T3MF 1KCBA 3GZQA 1WUNT 4F93B 1A4JB 5I1GL 1MFBH 3Q06A 2MCPL 3SJVE 4UQ2B 4QRPB 1KCSL 4P2OC 1KLFB 1TVDA 1ETZA 4ZS6C 2X6MA 3P02A 2H47C 1PT0A 2N7SA 3C5ZC 4LGSB 4I7ZC 1QI4A 1VFOA 1QX1A 4FNPA 5JIQA 3P3RA 2FZ3A 5AZEL 1XH3B 4L3ED 1DBBH 1E4HA 2DQMA 2UX7A 4NZTH 1JJUA 4TL4A 2EO1A 2DTMH 5AAWA 2OMYB 3QUML 2GTQA 4JP7A 1TITA 4X7SH 5EUKB 1QSVA 4NWUL 1ORSB 4L4VE 3L7EA 3QARA 2BOLA 1LP9B 1CGSH 1PIGA 2P42B 1NFKA 1RK1B 3VD2A 5J3HD 4UDUB 4CBZA 1ADWA 2DEWX 5DWUH 1CPUA 2A0LD 5E1AA 4JVWA 2AQRA 4NC1E 3ZL4H 1DJXA 1FI8C 2VW7A 1DSFH 1JK9B 1JK9A 4Z3IA 3LHAA 1S8DA 3CFTA 2LFEA 4K55A 4AC4A 3BXNA 4NDMA 3QWQB 2FYVA 2O6EA 1H3TA 5ENWA 4UQDA 1E4XH 5SWSA 1JG9A 5I1GH 1RERA 1ZVNA 3EJYC 1IBZA 2OMZB 3VXUE 3BZFB 4OGAC 2NY0B 5ID0A 3HC2A 3OZ9L 2IAND 2FWOB 4ZQKB 4YDJA 3UG3A 2V0AA 4L4VA 1PLBA 4XP6H 4NZTL 5BXFA 3ABGA 1A7NL 1T1ZB 2IDUA 4XCEA 4KDIA 1SEBB 3KLKA 2AC0A 1OGAD 3IF1A 3FQXB 4F8LA 4JNXA 4JO4H 3FQXA 3KEHA 4D9RE 4FFZL 4GNKB 1USQA 2C3VA 3MJWA 3RB5A 4NO5A 5L2KE 1JPFB 2DQGH 1E2VA 1D2PA 4IOSD 1IU1A 1B0RB 5AYQA 2YUJA 3MJ9A 1OLZA 4M5ZL 1KTKE 2OA9A 3GHBL 2QQLL 3EYVA 3OLGA 4HKXB 5DTFB 2GSMB 2CJUL 1LHZA 4LIQH 5AFAA 3QAZB 3QUKB 1ML0A 3RVXD 1NCIA 3FFDB 1QSEB 4Q74A 2IDQA 5AVXB 2EYTA 1Z9PA 2CG9X 3MUJA 1JPSH 3WIFB 4P46D 2CKBH 2OMXA 2QEJA 1UXSA 1XZ0B 3STZA 2HVKA 1PZAA 2AZUA 5IW1B 2XOTA 1PDKB 1A6ZA 5LGJB 1QRND 3QS2A 2NR6C 2P8PB 4JRLA 2O72A 2X9ZA 1N70A 1TJGH 4MX7B 2JKSA 4R0LA 2WYHA 2XN1A 4XP6L 3EZJB 1HHHB 2IPUG 3GXTA 4M93B 4MA8L 1BMWA 3FB8A 4PGJA 3FB8B 1T3FA 3HB3D 3I6KA 1PCSA 1IL1B 3MUHL 3ATDA 1KQGA 3GM8A 2PYED 1YEEL 3D69A 2BK8A 3NFNB 4AM0Q 2OR9L 4K5NA 2HX9A 3VH8G 4EZMA 4JRFA 1CXEA 2OK0H 3TOPA 3EFFB 4L8DB 1KCLA 2R2CA 1MEXL 3F58H 2QHLA 3STLA 3X2HA 4P2QD 1OAZL 1NM9A 4A2GA 4MJJA 1ND0B 2ESVD 3DBXA 3E6HA 4U1NA 4U1KA 5AB2A 1MIMH 5BOZG 2DWYA 4ANUA 3PY9A 5FM4A 3D9AH 4N0YL 2EH8L 2P7TA 3L9RA 3LKQA 1KLUB 2AKRB 2VDKH 4JQIA 3US0A 3EJSA 4YHNB 4UOJA 2FT8A 1DVFB 1WBZA 5DO8A 3WGVB 2PF6A 1SOKA 4ZFFA 2WB1A 2XN9A 3P54A 5F72S 4P5KA 4NQDE 2BW4A 2NR6D 4N20A 2WBXA 5KEZA 3T09A 2RJMA 5GHWH 5LBSA 5F3HA 3QEUB 4MGXA 3B8SA 4EN3A 3ENEA 5EO9B 1NWOA 1JGVL 5D7EA 4M1GL 4Z7OB 2C9VA 4HDIA 4Y5XC 1GOHA 3MA7A 4APXA 1KPVA 1OHQA 1MKFA 1FGNH 2HJKB 4M8UA 1IM9D 2MHAB 5GSVA 4ENEC 1K5NB 4UZSA 2KKQA 4MJIB 3TXAA 2XTSA 3APDA 4ZSOA 4NBYB 1BZEA 4KI5F 2J8OA 4ZMNA 4NNYA 1BM3H 4WZ9A 2KQNA 2IANE 4QNPE 3KYOB 3UPRA 4JM2F 5GRJL 3FCSA 1MJ7L 2ITDB 2VR6A 1OAZH 5T3XH 2PCPA 3REVA 1T6BX 3X2PA 2UZXB 4GSDH 1D9KA 3NZUA 5FO8B 3D9AL 5C0BA 3FPXA 3SQBA 4LLQB 2ID5A 1H9DA 3BIBX 3UZVB 2WINB 5T5FL 4WTQA 5ADPH 1UYWL 3DOHA 2XVLA 1JP5A 1T04A 2G3MA 2DWDA 4D0CA 2ADYA 3CZGA 3UX9B 1AXIB 1YMMD 4UUJB 4CDHA 4X5Q