4FFTA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with mixed-linkage glucan
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Cellulose-binding protein
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fftA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fftA02
4L48A 2PJJA 4JCWA 3X2MA 3SULA 1BW4A 1HD5A 3X2NA 4FG2A 4AVRA 4ENGA 3X2PA 3CZBA 1N10A 3SUKA 3SUJA 2G5DA 4FERA 2HCZX 2G6GA 2JNZA 3X2JA 5GLYA 2ENGA 3ENGA 2PI8A 2GAEA 1L8FA 5GM9A 4JS7A 3M3GA 5H4UA 1WC2A 4JP7A 4FG4A 3X2OA 2VXQA 3X2HA 1OA7A 2BH0A 3X2LA 3FT9A 3SUMA 3X2GA 4JP6A 4FFTA 1WHPA 3X2IA 1WHOA 3D30A 1OA9A 2PICA 5GLXA 3FT1A 1BMWA 3X2KA 4ZM7A 2KQAA 4JJOA 2PNWA 2AE0X 1BW3A
chains in the Genus database with same CATH superfamily
1D5ZB 3QZPA 5DRZA 4ZMTA 5CZVL 5IMMB 5HGBA 4G9DA 1ET8A 3S96B 1ZGLA 1YNTB 2HX9A 1U91B 1R3KB 2VQ4A 3SE6A 4P9ML 2VMJA 4XWGH 5EOCH 1UFGA 3GKWL 4P23D 4HPYH 1GHFH 4DPRA 3PIQA 3GSRA 3PGFL 2ZXEB 3R1GL 3V4UL 3HR5A 5DQ9B 4ABUA 5G55A 1F00I 5CZXC 1NH6A 1UEYA 5E9AA 5DJ8B 1JFQL 2D2CC 2WXHA 4L3AA 3T2QA 4E9LA 2NNAA 3AS3A 4EJ1C 2OMBA 1FZKA 4ODWA 2Z91A 4N8VG 2CJUH 3FOMA 4OSUH 2E8YA 2MOQA 1GR7A 3LRMA 3T5WA 2XV3A 4M3KB 5D7KD 3FU9A 3QC5X 5F1OB 1AKJA 1JYXA 3QEQB 2AGJL 1QTSA 1XGYH 2YZ1A 5J9PA 2BSBA 5IK3A 4J3OG 2GT9A 1E42A 2ZONA 5E2UH 4KKCD 1YEJL 1GAFL 1MVUA 4MCZB 3B5TA 2P26A 5TPWL 4QHLA 3WY1A 4XTRD 2ZXCA 2DWDB 1CK0H 1G4RA 2W80C 2JMRA 1MRCL 5I5IA 1G4MA 1OCRB 3MV8D 2OSXA 2GITA 4K8RC 3SKJH 3KD4A 1P6WA 5C0CA 2BXYA 1WD8A 5T1LD 1NIEA 3VI4F 3MJ9L 1XTLA 2P3YA 1EVUA 2CM6A 3D85A 2G9HB 4CC1A 4OF5A 1YQ2A 3EADA 3F04A 3FSAA 3QC6X 5GJSH 3PV6A 5EU5A 1E6JH 4Y5VA 2VAJA 4MJ4A 1XB6A 4XP9H 2H0JA 2XTJD 4MJ6A 5CEZH 5KSUA 2B0SH 4DW2H 1ADQL 3N06B 4M3HA 1RV6X 1HVXA 1ED3A 1KJVA 3ATAA 4XE0A 3VXOB 4BCZA 4X8JB 2JKRM 1CGWA 4BD4A 1XXFC 3PDGA 1KB9J 2YK1H 3ROOB 1FO0H 1DQQB 1RPKA 2CBPA 2OL3L 5FEBA 3GMMA 5EIIG 5KWYC 4GKZB 4YHIB 5DHYB 3MJ8A 3MLVL 3RWDB 1IB5A 1OQOA 3MUHL 1ZANH 2DM3A 4I3SL 4NUMA 5F1NA 2VTFA 5H94B 1NC2B 2P80D 3DVFA 1WVZA 3H3KA 5J6HB 4PJBA 2HH0H 1ZT1B 2ENJA 4ELMA 2E46A 3G08A 1DVFC 1R5WB 1U3ZA 2EVIA 1T83A 2W07B 5C92A 1KJ2L 1OP5K 4FQLH 5T1DL 4CU7A 2VR3A 1BFOB 5DJ0A 4L48A 3U36A 1YUHA 1WCQA 3SYOA 3TN0B 2QBWA 5HTSA 2JFCA 2G0KA 4D0DB 1EERB 1ZWIA 4PBDA 2Q7YB 3F7PC 3LPOA 3LOWA 5DRXB 1Z66A 3HI6H 4OF6A 4L8DA 4Q2ZB 1CBVL 1P1VA 1J0JA 3RUGF 4QJ4B 1WPCA 4OZHE 3DO7A 4JPVH 5EC1A 1VAHA 4ZUSB 4Q52A 1FL6A 4JM2F 2WQ8A 1TENA 2GTWB 5CEZE 3HC3H 3QXDA 2R9HC 1IGML 3H9ZA 3SYAA 4DAGL 3AG4B 2NY3C 4LOVA 1MY5A 1NFDB 4L8SA 2VMDA 1BYNA 1HE8A 4KV5E 4H4NA 1SBSL 2XVBA 2KLRA 4I88A 4M8UA 3UYRL 3N1PC 1QFWH 3GBDA 4YHMH 5K1JA 4ZXBB 2YMXH 1A7RL 1CGUA 3O2DL 5TQ0H 2Q20A 3GLDA 5KW9L 1ZYRD 5MEPB 5TH2A 1TU2B 1BX2B 3DMMA 2XCMC 4K2UH 3F5WB 1XXDC 3AT9A 3QR2A 5FHAL 3SCMD 3WN5A 1B0IA 4M7ZB 2BO0A 1LEIB 4F8PA 2DQTH 2GJ6A 1RK0A 3GMPA 2X1XR 2J20A 4YHOH 1N68A 3VXRE 1H3TA 2DEXX 4ZD3L 3VRIB 4JPWL 3OR6B 1DR9A 4LQ1A 3DTXB 3NPZB 3K5RA 3KHQA 3NJHA 2BWDA 1OGPA 4GI8A 3G5VA 4J4PA 5AAWC 2L7JA 2QGBA 3D6GA 2WWNA 2VUOA 3DA0A 1NCCH 2QLYA 4PGCA 1FH5H 4PBXA 3CLFL 4BUHA 3IAGC 4R26H 5F7HA 5BW7C 3QPXL 2O5XH 2OR7A 2ERJC 2ZOOA 4GUPB 1IGJA 2EINB 2NQCA 3VFVA 2K3TA 3OAZH 3L48A 2NXYC 3EJCA 1I1AD 3VTMA 1CYWA 4X5XB 3LNHA 2NCMA 1RJCA 1YHPA 1EQWA 3NCXA 4R0LB 2HPTA 2EZ0C 4IRJD 1MRDL 1JGVL 1TSHA 2XKSA 2G2RB 2ESVB 4IMLB 4PR5B 4Y4KD 4B6ZA 1E2VA 1CICC 3TWCH 1KTKE 2DQUH 3SN6N 1G6VK 2EDFA 4NAQA 3FHAA 2I27N 3FUJA 4J3TA 4OIFA 3QSKB 5L9DL 3PL6B 2ITDB 2DI8A 4S1DD 4AC4A 1DMRA 3GINA 2CDEB 3ASOB 4KHTL 5KBPA 1TTRA 3BWZA 4DEPC 2CO2A 3GRWL 1XIWC 4H8WL 1THCA 2VJ0A 4Y9GA 1IGIH 4K7PY 4I2XA 1SJVA 4XODA 5EBWB 4UQDA 1MNUL 3KYKH 1FG9C 1ICTA 1U3YA 5AFAA 3CBJB 3HC4L 3WMSA 1QKZL 3RZCD 4PJAA 1N3NA 2X5PA 2CLZA 4X5WA 4ZNEA 3LVTA 4LSVH 2H8PB 5HDQH 3RBSA 3IBOA 4M00A 1OB1A 1SM3H 2HRGA 2QQKH 3PWPB 1EAPB 4O2EA 4CDGC 4YE4H 3VFMA 4Q97A 3BWAB 2HFTA 3LZOA 1F90L 3MRLA 3X2PA 2HKHL 4ALAC 1E7UA 3L1GA 2X1PA 4DUVA 1TMCB 5F72S 1SMDA 4I18B 4PAZA 3JUZA 4XI5D 1QVOA 1JPTL 5ANME 1XGRA 1XH0A 15C8L 5T3XL 3BX7C 1AQHA 5AW6B 2H3KA 3B5GA 4WNSA 4XPHH 4CC4A 4YSEA 4JJ5A 1PQZA 3EFOA 4ODUA 3ZY7A 1AR1D 1LO0L 4WFEE 5IGXH 3VGFA 4MDIA 5IESH 4Z7UA 1V8HA 3MLXH 3F85A 3PPEA 1ZKAA 5ETUB 2DYSB 3BDBA 2DZEA 5KJRL 3GHEH 3UZQB 4Y5YA 2OMXB 1YG9A 3MRFA 4JZNB 2I32A 3QDME 1LE5B 1DZBA 1S5HA 4UIMA 4AYSA 4Y1AD 2EACA 2VABB 5MI0C 5AVQB 1AIFB 3V0IA 1YJDH 2PP8A 3L5WA 5ISZB 5GZOC 1J12A 4Q6IA 2HT3C 1PZSA 4ZAKC 2ZJSL 4KQ4L 3QWOA 3F3HA 3PHSA 4NQDB 1E3ZA 2E2IA 1Q8MA 1IC7H 3CDZB 1A1NB 3SY0A 2CD0A 2DICA 1CZ8L 3NN8A 1QRNA 3GS0A 3VFGL 4XXCC 3S9DB 2Y36H 3TO4D 3RNQA 3MACL 3F7YA 1MLCA 3SOTA 5IB1A 3WTWA 3KLHC 2W0PA 4HIXH 5I1JL 3ILQD 1E67A 3GUTA 3SY6A 3SQOL 4XZUA 2WXGA 2CWRA 3WFDL 3WBDA 5D1XE 1MVFA 5B38G 3SIKA 1RZGA 3DSNB 5EOTB 2WIIB 2CJTA 4NNPH 3KGRA 2FH8A 2DY2A 4L1SA 4YNYB 5I9QB 4XP4L 1YEKL 3TF4A 4MVBD 4DP4X 1I8IA 3SDXE 5IR1A 5KZCD 1QBML 2P5EA 5LNGA 4MXVE 3Q8EA 1NA8A 4S1QH 5I18L 1A1MB 1MWOA 2QSQA 3SJVD 1BFSA 1I8AA 4ZX5A 3IFPB 1G9NH 3DUUA 2BSTB 2DKMA 4HGWB 2Z6FA 3SQBB 1HHJA 4KZCA 2QKIA 2CK0L 4NENA 4P2OA 5I8CB 3SGEI 4P2QA 4LSDA 3QUXB 3B2XA 1ZDSA 2GSIA 2OMZA 2BP3A 3IKCA 1BBJB 1G6RB 2VR8A 5DS8A 1TOXA 4N2IA 3LXAA 5EUOE 4JFXA 3VX0A 3QIBA 5IMOB 2VSMB 2K1MA 4N68A 3TS8A 4JFPA 1IM3A 4A6YL 4E9SA 1H3UA 4Z3JA 1G8KA 1A7OL 1AMYA 2HRPL 1MIEH 2JKIS 2VDKB 3IU3A 4KJWD 4L1LA 2IPTH 4LCCB 4KY2A 2CE6A 4B96A 3BLBA 3I9GL 4HPOH 3R06A 2XN9A 2K8MA 4KOCA 4X6BA 3QARA 3UO1L 4KK5D 1KWGA 2VLRE 3GSUA 2IG2L 4KDTA 3MV9B 1W72L 4LP4A 5AKVA 5I1AA 1U95B 3LKRA 5KSAC 1XT5A 2LTQC 4F2MB 3GGWB 2RFXB 4OCWH 5K39A 1I53A 1SN2A 4UV7L 4AAYA 1NEPA 3T6WA 1TVHB 1DVZA 3P73B 4YBQD 3MRHA 3B43A 3BUYA 3UTSA 3S4SG 1TZ8A 1PY9A 4GAYB 5J3HC 1TLMA 4HBCH 4KXDA 5FYJH 4PS8A 2WAHA 1FA4A 2C1PA 3LS4L 4JFEB 1HIMH 4BM7A 4UT9L 1CD8A 4M5YH 5FLUA 3ARBC 4ZOEA 1JGUH 4NI6A 4FQJL 1PSKL 3MMEA 1FBIH 4DN3L 4ZFOL 1EIBA 4R97B 2Z1PA 2W0KA 5DVPA 5AEAA 2ZSWA 4D8OA 1IEHA 1YMHB 2NSQA 3UJIL 2JB6A 4G8IB 1KCRH 5E8OB 1M7DB 3RWJB 4Q4EA 4KODA 3MROB 1BZOA 4YBHA 4HKZA 2CLRA 3VFWA 3QNXB 3L7EB 4CW1A 2YJLA 5DVOA 5IOPA 2FVNA 3CQZA 3E3QC 3S2AA 3O8XC 1OK0A 3RPBA 3NCJL 2AANA 4G70B 1UWXH 4FG6D 5D7LB 2GUOB 1WYJA 4XCCL 4PPTA 3FQRB 4QHUB 4R5TA 4OVVA 5IBLC 5DRNA 4NQCD 4WENB 5AZEL 2EH8L 3WXVL 5ADPH 1QI4A 4DFIA 1E4WL 4S11A 4HFUH 1MRFL 3PGDA 5KANI 4FTVD 5C0BA 5HGHA 1AI1H 2XG5B 4HUNB 2GK0A 1OB0A 4QHKJ 1UHVA 1N64H 2P43B 1G0YR 3RDTA 1Q38A 4TRPH 3BKCH 1R5VB 1OP4A 3I74A 4G8GA 4ENEC 1OTSC 1GTNA 4LFHD 1AG0A 4X7DC 4YMPA 3EJPA 1EJOH 1KCBA 5IW3A 2YEVB 5D8JL 4BFEA 2JIXA 1UXLA 3GMNA 3L16A 3D05A 25C8L 3C2AH 3U4EB 4NPYB 1FNSL 5BOJA 3QQDA 2WAQA 2VXQL 1BFVH 2PCFA 2ZCKH 3U6RA 1OAXL 2ZTBA 1ZXQA 5L2JA 4ZMWA 2VXUL 3OB0K 3CFDA 5D4JA 3EOAA 3TPUB 5BVPL 1DBAH 4MWFB 3S97C 4MNGE 4RAUB 5E6IB 3O3EA 5D7SL 4UU9B 4DT2A 2NY0C 3BUBA 1I3UA 1L3WA 1I7RB 1KYOK 5EU7C 4C56A 1Z9NA 2JCWA 2J55A 4AQ8C 3C6LA 3U46B 4R2GB 5FF6B 3RY4A 3C5JB 3H9SA 1Y7VA 5DVNA 1MCHA 1TR7A 3KXFB 3QAZB 2RHEA 1OSZA 2NY1D 5J11C 2CHZA 3ZRSA 2Z92B 2AQ1A 3HMWL 3IEAA 4L0YA 2G4EA 5J6SA 2O6EA 4ORGA 4GRMB 4FERA 2MCG1 1A7BA 2CW0D 5SWSA 1AC6A 4WTZG 4MKTA 4PREA 1LNUA 3RU8H 3BQUC 3FUIA 3X2QB 3ARTA 3BOVA 3ZT7A 1Q9WA 3V5KB 3OMAB 5JTWA 3FC8A 1R3LA 4KXZI 4ZS6C 1SHXA 3FTYA 3TZVD 2BXZA 3B7SA 3WTVA 4WWKB 5FWRA 3W9DA 2P44B 3S7GA 2NXZC 1XFPA 1CE6B 1F4WH 4OZFA 2Z7WA 2R29A 1SOKA 3EJSA 3I75B 5F6IC 3IK2A 2JA7A 5CLYA 1M71B 5MHSE 5F97E 4LIQL 4AMKL 1E5YA 1JD9A 4ZG1A 1UZGA 1UQSB 4Y4HA 4AKOA 3CU1A 3KDPB 4KI5C 4XNMB 4W6WB 4EE2A 3RWCA 3X1EA 3PHQB 4QCIB 4KRPB 2C26A 1D5IL 4BEIA 1DJSA 4KAQL 3WNIA 4WHTB 2AV7B 3KCPB 5G2NA 2WBJC 2ZUXA 3ZSSA 1E65A 4MMZC 4WUUE 3OMNB 2VMCA 5TFSH 3NIFE 4XVJL 3L4UA 2FR4B 5E99H 5CCGE 3P54A 4M1DL 1UWEL 2JELL 3LD8B 3HEIB 4NP4H 4PJ5D 4JRWA 2X9ZA 3FOLB 3GSNA 1HSAB 5AUMB 2GI0A 1HESA 4D8PA 2MRYA 3MOBH 4LSTL 1HJCA 4BV1A 1E0OB 5F88B 4JG9A 2VDPB 1AGFA 4K3HA 1P69B 4EUPA 4L2YA 4NKIL 4HLZG 2WKGA 4Q0XL 3KPRD 1RFDH 2YGQA 1ND0A 1WD9A 3BKML 2FQDA 4ODHH 4QGTA 1IAOB 4PCYA 3FSOA 3HLAB 3M7FB 1UD8A 4BH8A 4U6VH 5KEZA 1NLBH 1GW0A 2E6JA 1A6WL 3E0GA 4U3SB 1K3IA 1SEQH 3PG2A 5F7EH 1RULL 4ELMF 1D9KB 2G4GA 4NXKA 1I7TB 3ABZA 2AFNA 1BQRA 1AO7E 2I24N 3FTVA 3JTSB 2VNCA 4NO2A 4OCXL 4RGOL 3BYTA 5HI4C 2QVKA 4AZDA 2JB5H 3GIVB 2VC2H 2BOCA 4ZSOE 1DJZA 1VSCA 1NFAA 3BGMB 2FD6L 5GRVK 4PJHB 4GRLA 3FQWA 4YN3A 5F3BA 3ZDZE 1FYTD 3QQ4B 1R3IH 4PJEE 5E4AA 3F58H 5D7IB 2XG4A 5AB9A 3S5LB 3H7BB 2PCPB 2V2TB 3DOIA 1FZJA 3CHQA 4AQAB 4HETA 3RPIA 1QSVA 3QFJA 1AACA 4BKLB 4F58L 4APXB 1JZ5A 2EDLA 1E90A 2JE8A 3ZYZA 3HE6D 1QI5A 3JWNG 4DETA 4I48B 5FGBA 4BQ9A 1FDOA 2A69D 3FUHA 5IROA 3IGKA 1RIUL 1MWAB 4LSPL 5E9DB 1CR5A 3AZUA 4XNAA 1D5ZA 5T5MD 2FX7H 3LHPH 1TNNA 3U2JA 1XAKA 4NC1E 4ZTOH 5IMMA 1OT4A 3O9WD 5AYUL 2EDTA 2WN3A 2XA3A 4JHWH 5EBLB 1U91A 1R3KA 1D7DA 5KSBB 5KJ4A 1U6AH 2QL1A 1ORSB 2GB2A 4ENGA 3MNVB 4D7PA 3VM5A 1S8DB 3MRGB 4KRMB 4N3TA 5T3ZE 5DZ9A 1PX8A 1XZWA 1S7UB 4J3BA 1VGEL 5FUZL 3T04D 4OU3A 1BECA 2QGCA 5DQ9A 1NAML 3P0YH 4J3OD 3MOAH 2BOLA 2HTKC 1CL7L 3MRCB 3S8GB 1TTUA 3DXAD 5DJ8A 3LIZH 3FKIA 4PJCE 3WD5L 4OY9A 3WU1A 5A6IA 1KULA 2QTVA 1U93B 4JHAL 5J57B 1HCFX 1BM7A 2D7MA 4PRAB 5FB8B 1KB5H 4R7XA 3MLTA 5JXEA 4OZGE 3QEQA 1AP2B 4LCVA 4KY1H 4O9HL 4NUJB 3SKUD 4PBWD 4RA3A 2ZUQC 5GS0D 2QPDB 1PZ5A 4Q56A 3V4VH 2QQQA 1RLWA 4MCZA 3IU4L 3WNKA 3DPBB 4P23C 3HI1B 4R7NB 2H32B 3EJYC 5ICXB 2DWDA 5LCVL 4M3JA 5DXWA 4G6JH 4ZFGL 2M26A 4MKMA 4XAKD 1ZK9A 2HT4D 1JZGA 3S8FB 3TBTB 4WEBH 4Q9QH 3MNWB 4UOW1 2ITFA 2XWJB 4IMKC 5GGRB 1T0OA 2G9HA 3KWWA 1CWVA 2HKAA 1CFQA 2N7AA 3ETBF 3Q9QA 4KKCC 4P9HL 2E5EA 4TVSa 1SY6A 1JK8B 1CF8H 4K23H 4K7PL 4KDVA 1S7XA 4CN4A 2B2XH 3PE9A 3BAEH 4K8RH 3BFOA 5E8DL 4NI3A 4TQHA 1FL3A 1UM5H 3GO1L 3SE9L 1PJWA 3VXOA 3G6DH 4X8JA 3PQYA 1H5BC 2DWSA 4MCYA 3ZW3A 3ROOA 5D7JA 1DQQA 3AQXA 1X7QB 4FHKA 1O6SB 1WEJL 2ZOKB 4J6IA 1WTLA 2Z31C 2FJUB 4GKZA 1VPOH 4WWOA 2CUIA 1RUML 1XMEB 2HJKB 2ZYHA 5DHYA 3RWDA 1K4CB 3LXBA 5H94A 1NC2A 4DFHA 4G7YH 2Y5TB 5FYLD 5J6HA 3BKYH 5BS0D 1B4JL 1ZT1A 2FK9A 1QYGH 1XSIA 4YQXH 4JPKH 2XTJC 5F0MB 2W07A 2XZCL 4AM0Q 2JH2A 2BC4B 4NNYB 1BFOA 1DBKL 4OLYL 2Y7OA 5DLMH 3DYOA 1EHAA 2OP4L 2Q6WB 3TN0A 1GTFA 4NKQB 4D0DA 5LAXB 1E6OH 5AOMA 2LR4A 2Q7YA 4LQFH 3ABMB 5DRXA 3ZZSA 1OD7A 4Q2ZA 1WBXB 3CN3A 2CXKA 5L6YH 4JFDD 5JA8B 4H8WC 5D4QA 4N8CL 4ZUWB 2CHDA 3VQLA 4ZUSA 4DKAA 3C09B 3BGFB 1PU0A 3VYOA 5JHDE 2GTWA 3APNA 5FKPB 1L4IA 3HZMA 4DQOL 3AAZB 3HN8A 3IE4A 2ED6A 3RURA 1KN4H 4NKMB 4XPAL 4DGYL 1EDHA 1LQSR 4L23A 1NFDA 3KPOB 5MP6H 1FGVH 3ARYA 4JY5H 5TE4H 5GSRB 3ARDB 2VDNL 4M61B 2X6AA 4RMWA 1WE5A 4NJ9L 2J6EH 2SEBA 4IGBB 3SDCB 2X2JA 1G43A 4DIXA 3CXHK 2ED8A 3QUYD 4RESB 2BSSB 1AQKH 1QLRB 5HPOA 1TPXB 1JPFB 3IN2A 4FA8A 2ATAA 4N90E 1EO8L 3P4NB 1QFWI 1BX2A 1E27B 1TU2A 4GINA 1QUPA 3F5WA 4PY8J 1J87A 2BH0A 3K46A 3OB8A 3T2LA 1DLFL 4HUVB 1ZGLM 2PPEA 1LEIA 3RTQC 4PU2A 5JXAL 2UX7A 2OW7A 1R9TA 2UZYB 3PAZA 3VRIA 2ID5A 3OR6A 2WYHA 3C6EA 1Q94B 1MIMH 3DTXA 3MLRL 4IJTA 2RACA 5GS0L 4H8UA 4GEIA 4FZEL 4OLUH 3NSDA 4AVIA 3NCYP 1KXQA 4KDWA 3VRJB 4OCRL 3WTSA 3CHSA 4NPJA 3T0XA 4JHZA 4WW2F 3BT0A 4BSWB 1EGJA 3II2A 2APTA 5I6PA 3CDGB 1KGUA 1OGSA 2FWUA 4RRPM 3OWRA 3WTUA 1AZNA 2L3BA 4P2RD 3AY4A 3ZX1A 1CC3A 1INDL 2B77A 2JSFA 3D3VB 4GUPA 4FKKA 2F8IA 2WHVA 1NFIB 4EI5D 5K5YA 4P5KB 3LKOB 4FFVD 2DLEA 1FLRL 4FXTA 4GIPD 4M43H 3WO3B 4ONFH 4R0LA 1GGIH 4JDVB 2K3HA 4YX2H 4YXHH 1FN4B 3DMRA 1TTAA 4OM1H 3RJQB 3SSGA 2ESVA 3G5ZB 4IMLA 2RBLA 4PR5A 2VPXA 4N9GB 5F93C 1VB9A 4IIQA 5J8OA 4S10A 1NOFA 3CSTA 3T3ME 3U30B 3QQ7A 3QR0A 3ARZA 1PZ2A 1I1YB 4CDHA 2F58L 3PL6A 3G6AB 2ITDA 4TULH 4GXVH 1Q4NX 2CDEA 4N0RA 4WSGA 2DH3A 1QSFD 2WZAA 3HN5A 4HCGA 4X7FC 5IJCC 3LH8A 3EDJA 1A2YB 1I1AC 1NOLA 4G2AA 5CSBA 2GFBA 3OL2A 5D72L 1HHHB 1EXUB 2AABL 4PI2A 1X6LA 2WZ6A 1DSYA 3VNYA 2N0KA 4I1NB 5CUSL 4Y4KC 4HFWB 1K6QH 1RVFH 1OL0A 2QHRL 2KYIA 4DP5X 5DD6A 3D33A 3WXWL 3BVWA 2WXQA 4BXSV 4H8HA 5CFAA 4S1DC 4L4VD 1QWNA 4FJYA 3BWAA 2FB4L 1MFUA 2X09A 3OXSB 4A04A 3PFQA 1ONQB 2ZX9A 2AI0L 4HAFA 1YYLL 1F56A 1YMME 2FLRT 4NC2B 2E9WA 4XR8C 4A7SA 3U48A 3BZEB 2NMSA 4W9LC 1E43A 2O5ZH 2Y1ZA 4KK9C 3O2WH 3U7YH 3GK8L 1MW2A 3RZCC 1QP1A 1W0WB 3QWRD 1IT9H 3IFOB 4XPFL 3UADA 2OK0L 1W16A 1PEWA 4ALAH 1OPGH 5DD1H 2YD9A 2FL5B 5CNHA 2JJTC 3U4BL 5CEXB 1PG7H 3PYCA 5AOJA 3L3IA 4FS0A 2X4TB 1SVBA 4K15A 1BYPA 2WP3T 5ETUA 5IJKA 4BK8A 2VMEA 4NHCH 2H2SD 5HD8D 2P5WE 3UZQA 4U1GB 2ZWLT 2OMXA 4XI5C 2QEJA 4QRPB 4QXWA 2HX7A 4G6KL 4BZ2L 2FATH 3X2HA 3I50H 1WICA 2VABA 2Q8AL 2Y07H 5D5MF 1AIFA 1IGFL 3ZRCC 5ISZA 1XSJA 4WO4B 4PLNC 3B2UC 5J5EA 5MEQB 3ZE0F 2VLJB 1AR1C 3ZPDA 5AWNH 1DQDH 1H6EA 4NQDA 4FNPA 4BFOA 1IBBA 2F53E 2DTSA 1A1NA 3CDZA 4ES8A 5BZDA 3FCUB 2EQDA 4YOKA 1E5AA 1ESOA 1NAKL 5CJOH 4N2MA 2P47B 4EZMA 1KJ2B 1H15B 4M1GL 4PI0A 1JNLL 2BW5A 4U1HA 1MFDH 4GAFB 1OQXA 1C08B 3GTVA 5TGBB 2I9TA 5DS1A 4LASL 5TE7H 5KBNC 1BXUA 2BSCA 2ILLA 2V5TA 2YD7A 2FEEL 1QO3B 4AV0A 2YHGA 3INUH 3NZ8B 3DSNA 5EOTA 2WIIA 3EIFA 4YNYA 1L9RA 1AQMA 1ID5I 3KJ6H 4FEIA 4I0PB 4MXQD 3GJFH 4M5SA 1SOQA 4UTCA 1VA9A 4N2EA 3ATFA 2V5RA 3TURA 2YQ2A 3GSQB 5L0QB 1SF3A 2DJSA 4NWUH 1IFRA 1F3DH 1A1MA 1ZVHA 1I9JH 1ZK5A 3TO4C 1R0AL 4ILDA 4KKAD 3MYJB 4PGBB 5AVRB 3IFPA 4MB1A 4CMHC 2BSTA 4H44C 1AZUA 5B4MC 3BUQA 5AYTA 3SQBA 5LXGL 2ZUQB 3FB8B 4X4XB 4LL4A 2QHLA 5I8CA 1XF3B 5I8OL 1MFVA 3RFZC 1CXEA 1Q9OB 4P23B 2NNXA 3QUXA 2AAVA 2AVFA 2IQAB 4PWEA 1FFRA 4CL7A 4JM2D 4C59B 1BBJA 1G6RA 5LQBL 1QW8A 1V10A 4MVBC 3UGUA 1DJYA 2EYRB 5IMOA 4FKHA 1JRHL 4GW4B 2X40A 4G3YL 3FTZA 4IKKA 3O4LD 4AITA 4EO5A 1JZ3A 5IWLA 4LCCA 2ZOTA 4KZEL 5HHOD 1EEYB 3GUFA 5I66A 2ZXDA 4OLVH 1I8MB 1H3GA 2A7BA 2K45A 1FORL 3MV9A 3TJEL 1JVKA 4XVUD 2CMRL 4HKXA 5A2AA 4F2MA 5KAQF 1K5NB 4OGXL 3TT3H 3GGWA 1J18A 2RFXA 2P4AB 4OVUA 4NQEE 4RZKA 5JPMC 3L2MA 3CK0H 3ZQWA 1TVHA 2W81C 3CZGA 3P73A 3BXNB 2VN7A 4PWHA 4GAYA 1I9RL 1YEHH 3MV8B 5AB2A 4E9YA 1GY2A 3IYLW 3FKUS 2VR6A 3ARGB 3FUKA 5C08D 3UBXB 4KJWC 1J1XL 4XNUL 3WIHL 1HCVA 4PJXE 1BWWA 4Z3FA 1PZDA 1YLEA 3OG4B 4TOYH 5IEKB 4RFOH 2X87A 4WIQA 5F9WC 3EFDH 4KK5C 1V7NH 3LSOA 3OPZL 3ELQA 2X05A 3S2CA 4OJFH 3QWNA 1KEGL 1QATA 5CINL 3K2KA 2CGYA 1BF2A 2A3TA 4YHYC 3DSFH 5GJTL 3T1FB 2GEQA 1YMHA 3H9YA 4LVNC 3RHWK 4G8IA 5E8OA 1M7DA 1QLFA 2XTJB 3LS5L 4NQUA 3MROA 2J8HA 1VFAB 1HE7A 2WOBA 4YBQC 3ZN6A 3QNXA 5IMKB 3ZTEA 1AY1H 3VQMA 4AUUA 1O0VA 4AT6B 5FTNA 3QWZA 2H47C 3FB6B 4D94A 1VJSA 1R5IB 3FO1B 5HI3D 2GUOA 2WXFA 1R34A 2MPAL 1NUFA 3EOBB 3FQRA 2K4WA 4QHUA 5J4MA 1PY4A 1WWBX 5A2IH 4JPIA 2AHIA 5H4YA 4PGEB 4MSWB 4QRRE 5C09E 2HPOA 3ROLB 1QLEH 4X80L 5E8NB 4J39A 3TVMB 4G1MB 4Y9FA 2DQGL 1R5VA 1KN2L 2LAGB 4YJZL 3LRHA 2X53A 5E5UB 5FUOL 2FSEB 4CU8A 3HLKA 4RFEB 1AC0A 4FG6C 1NPNA 4NPYA 2NCEA 4PB9H 2O5NA 1RZ7H 2WLKA 1DJIA 4YDNA 2VDLL 4X4ZA 3VFNB 4AK1A 3BCDA 4YDVB 3C08L 2WXIA 5KYXB 1E32A 4B9CA 3TPUA 4MWFA 4RAUA 4J8QA 4N5ED 5E6IA 2XPYA 4UU9A 5CLZA 4PSPA 4G72B 2IWGA 2Q3ZA 2A6DA 5KVGE 1I7RA 2WO3B 5EZPA 3NSFA 1AQDB 4OCSL 3P3RA 3U46A 5E2TL 3VD0A 3T4YB 1C7SA 3C5JA 3KXFA 1SUJA 1OGTB 4FULA 1JZFA 3JVGC 4OQTA 4I77H 5KVFH 3W37A 2PN5A 2X38A 2Z92A 4FYRA 4ODSH 2JJSA 1LHZA 4IKJA 3QO1B 1BVOA 3SCMB 3VXPB 1JGDB 1AZZC 1EU1A 1ZHLB 2FGWL 3E3QE 4ZX3A 1WFIA 3S6CA 3NFSL 2OMYB 4XP1H 3F2LA 2IH1B 3V5KA 3AWEA 1RIHL 3AW5A 3WIIL 1WA1X 4IRZH 3CMOL 4QXGL 3DTDA 1MCDA 2AEIT 2NR6A 2VLRB 3QK0A 3TT1H 4A63A 4M1CD 4P07A 1CDCA 4PFEA 1L0PA 3LRGA 4L3FA 3KPSE 3BP4B 3NQKA 5F9AC 3G5XB 3OJDB 2NY1C 2YZ8A 1ZTXL 5DT1L 1A6UH 2WNKA 3Q2NA 4ONGH 4OUUA 3ZOAA 5SX5K 5GGSB 3I75A 1F6LL 4IW4C 1M71A 4V1DE 1GS6X 5KYWB 1E4JA 2E75C 5CF3A 4TPRH 1UQSA 2R2BB 4D9RD 4L3ED 5E5RB 2PI8A 5CEYB 3SB3A 4XNMA 1SXSA 1PAZA 2CCVA 5IBUG 3CX5K 5IP4A 4XO9A 5I1GH 4QCIA 1ZS2A 3FFCD 4FQIH 1NCWH 4GKSB 3NCMA 4WHTA 3KCPA 3H3BC 5FK9B 1HK6A 4IOIB 4IRJB 2ZG3A 2VDQH 3LKQB 5JYLA 4GQPH 4FNTA 2FR4A 1TWAA 2G3MA 3D87B 4H8PA 1LO5B 3O3DB 3VVWA 2ADIB 2WMPB 3FO0L 2JQAA 5F21B 2EXSA 2J21A 3FOLA 1HSAA 2DPKA 2K8QA 1IFGA 4N1CA 5AKRA 1LO4L 4KHXL 5AUMA 5HJBA 1HH6A 1E5UI 5F88A 5EU7E 3M8OH 3UJJL 2DQDL 3SKMB 1HC1A 2IOIA 3BVXA 1NJ9A 2IOOA 3OAUL 3GPEA 1IAOA 3HLAA 3O3UN 1PDKB 5I0DA 3AACA 1AYOA 3IDJB 4DHLA 4I9XA 4U3SA 5GGVY 1KLGB 4G7VH 4UTBH 4X6CE 1D9KA 2CO7B 5GS1B 1BM3L 1HD5A 4N5UA 1IW7D 1I7TA 3JTSA 3GBNL 3R4DA 5BV7L 3BPOB 1WJ3A 1MOEA 2ODHA 3L5XL 1IZKA 4G9FE 4XVSL 3RGBA 2H0EA 5IT2L 1YEJH 3GIVA 1L7IH 1T1XB 3FFDB 4X0NA 2R69H 1W72B 2WVVB 4YWGL 2X1QA 2L7EA 4WFFD 3MLPA 1JGEB 1T2JA 5DMYA 1MDTA 4PJHA 3V10A 5JIQA 3QQ4A 2ZSVA 4HIIB 4Z3HA 1G7HB 1SQ2N 2R1XA 3H4HA 4YSQA 5D7IA 1XCTB 3CGTA 3H54A 2YC1B 2JQMA 3H7BA 4EQ2A 2PCPA 1IJNA 2V2TA 1ZLDA 2WXLA 3L3DB 3B2VH 3AJ7A 4KI5E 3V0AC 3CDCA 5IW6A 3BW9B 1MHPL 4BKLA 1IU1A 4KJPC 5HDBB 4BH7B 5DJCB 3UH8A 4I48A 4OTXL 1D5RA 1PLGL 4ZFOB 1MWAA 1D5XB 5E9DA 1IC5L 4OZFG 1N18A 2WUCL 1ADQH 2XIIA 1FJ1B 5AW1B 3DX2A 1OV8A 4HZ1A 5B1CA 4XP6H 3LPFA 5KSBA 3OZKA 5EBLA 2ARWA 2B7DT 1ORSA 3MNVA 1XBDA 1AGBB 1UZ8B 4JUTA 2OL3H 5GGTA 1HJBC 1S8DA 1OSPL 2DV6A 3MRGA 1ZLUK 5I1KH 1F6AB 3LXCA 1S7UA 4H20H 5F0PB 2WLNA 2VZTA 1RSFA 4NM4H 4ODTL 4O02A 4UZSA 3IRZA 3ZIYA 4AUJA 2YUJA 3C8KB 3VWJD 3HAEB 3HE6C 1GGBL 3MRCA 3BSGA 4GT7A 1U8NB 1ID2A 1VFBB 4UYPA 3QVAA 1NICA 3EO0B 3G9AB 1I3GL 2R23B 1BMGA 2BIQA 2VZ3A 2WXOA 2UVEA 3PWJB 5EO1B 2DYPB 1MCKA 1TVDA 1U93A 1I1FB 3V7MA 4Z7WB 4PRAA 5FB8A 3ZO9A 5JW4M 4EUPG 3IJSB 3L9BA 2WV3A 1WFNA 3WY2A 1AP2A 4LEBA 4NUJA 2A0LD 3WMQA 1QR4A 2UZIL 1XSKA 5D7EA 4P0DA 3B9VA 5FTKA 3CH8A 1Y1UA 3H0TB 2VPZA 3HI1A 1COBA 1AXTH 1ML0A 4R7NA 2H32A 2PYEE 5ICXA 3FAWA 5JMOC 5KN5B 1VC3B 1FRGL 4J3OC 2WQAA 3VFTB 4IBVA 2TAAA 1X4XA 4MS6A 1U8QA 5F7DB 1IGMH 4UDUA 4DAGH 1B3IA 2PO6D 4LAJH 5DUML 4N25A 1AD0B 4UQAA 2KUTA 2E7CA 3NIFB 3AWFA 3SDYL 4PYHA 3ZDXE 3TBTA 3FMGL 1SBSH 4RETB 3MNWA 2Q5BA 2XWJA 2Y2TA 4R6UA 4JKKA 4UAHA 2O26U 3T2OA 2OR9L 1DBML 2BRRH 3UYRH 5GGRA 4Q9RL 3RG1C 1U3HB 3K8KA 1XGUB 3SHSA 5GS0C 1MAML 3FSWA 1A7RH 1M2OA 4CADB 2J72A 3BD5A 3O2DH 4ADJA 3WNPA 3R18A 1JK8A 4E9XA 3EDKA 1BJMA 4MAYB 1T22B 1BVNP 2F8XC 3FS9A 4FXKC 2ARJQ 1OAKL 2R7EB 3CNKA 5EEZA 1I85C 4X6DB 3Q7JA 3DX3A 2OV0A 3LN5B 2HT4C 2YPVL 2NYYD 1TQCB 1X7QA 2PCYA 3LTVA 5M7QA 1O6SA 2ZXAA 2ARJA 5I17A 2R0KH 2ZOKA 4L4TA 2PTTB 2HJKA 3MBWA 3OKNA 3UTZB 5A7BA 1MDAA 2EDQA 1K4CA 2AK1H 5D2LA 1JWUA 2H6OA 2ED7A 3CC1A 4R90L 3AITA 2BS71 1LDPL 5DMGC 2VO8A 1CD0A 5GQBA 4EVNB 4FG4A 1RHHB 2BM3A 2F54E 4FFTA 2BC4A 4NNYA 5DD0L 5H37H 3I84A 2XY1A 3F01A 2A5UA 1VEMA 2Q6WA 5J0BA 1RH8A 4BFNA 3OD3A 1GA2A 5LAXA 4FQ2L 1RAMA 3MJ7B 4OZIA 3IPEA 3DVNB 2Q7AA 1WBXA 1GKOA 2ZUUA 4UT6A 4ODBD 3DJTA 4BK5C 2NZ1A 2IDSA 3MCLL 3R7QA 4JCMA 4LOEA 4JFOB 1TEFA 2Y7NA 4HZAA 4JRXE 2AQTA 3B9KA 3U1QA 3BVDB 5FKPA 1TITA 5K59E 4BFJA 4YXLH 2D9QB 3AAZA 1NGYB 2BVYA 5L9DH 3WFEH 5C0CD 3KR3H 1TZHB 3K4DA 2KZ1B 5KVDL 1S9YA 1U8CB 3ARDA 1UM6L 3EDFA 1TG8A 4M61A 5D71L 3GRWH 3D85D 3HBZA 2J43A 4M93C 4H8WH 4OCMC 4IGBA 2ZX5A 3SDCA 2VM4A 1IEBB 1MNUH 4P3WA 4ACPA 2BSSA 3RX7A 1QLRA 1OHQA 5AVVB 1JPFA 4IYKA 2HAZA 5L7XH 4HOXA 2HVBA 3P4NA 4JMXA 4OAWB 4KZDH 1E27A 5DURD 3H0GA 1X9LA 1YNLH 3WFHB 4HUVA 2CXGA 1C16B 1HDMA 4P59H 5GRYA 2XJKA 4XXWC 2E7HA 4LPWA 4JW3A 3WKML 1OE2A 5ESVB 2UZYA 3CXHJ 1CLVA 5CCKL 2BWIA 5HVHC 1UZ6F 2G5UA 2W38A 1FPTL 4X83A 4FD0A 3BISA 5EORL 4A7GF 3V0VB 3RB7A 3VRJA 5I23A 1VFUA 4KQ3L 2QKSA 4HA1A 3TEXA 1TO5A 2DMRA 3WUWB 1VZIA 3T4AB 4PM1A 3IDMA 4AYMC 1JPTH 3CDGA 4PS4L 1SDDA 15C8H 3HR6A 1TYEB 4GT0A 4GJTB 3D3VA 4KUCF 5EPMA 2B4CL 1NEZB 4K3DH 2AXWA 1NFIA 3QZBA 1PFOA 2L8AA 2V3FA 3DOSB 5CIPH 4GMTH 3Q1EA 3NCFB 1B9ZA 4P5KA 3ZE1E 3KWUA 3N43B 4GW1B 3HZKB 1YRKA 1OP3H 4NRZB 5I71C 4JDVA 3D9AH 3PJLA 1FN4A 5KJRH 5DZJA 4Q6YA 1F1DA 1EMTH 4N9GA 2GAZB 1JI2A 1IFHH 3QDGD 3EHBD 4DZ8B 4XN5A 4BGDA 4N9OB 4NGHH 1I1YA 1IM9B 3O45A 4Y19B 4XNZB 1F45A 1S7VA 3G6AA 3ZVVA 3DGDA 2ZICA 5F6HI 1P6AB 2AJXH 4EI5C 5I0WA 1SYVB 1DHKA 1A3QA 1A2YA 2H3XC 4GNKB 4KQ4H 3OAZK 1T89A 1W0YT 3NCCB 4FFVC 3GBMH 1RZIB 1FDLL 3ETTA 3TZVB 3UJTH 2UWEB 1HHHA 1NAMB 4U6YB 5FDYA 1CZ8H 1G8JA 3FB5A 3GLZA 2XWZA 4X6EA 5D70H 3HVDA 1O5PA 3QNYB 4M48L 3AG3B 2EH7L 4HFWA 2DM2A 5EO9B 1OIOA 3MACH 5L8LB 2BIIA 4MMYB 1UA6L 1G1CA 1KGXA 2V33A 3MCG1 1MJUL 1ET7A 4IU2B 5EPPA 3PV7A 2OYLA 5J13C 3OXSA 3R0NA 1ONQA 5BO1L 2YXFA 4J4PD 3VGAB 1G87A 2JF1A 3QQNA 3RVVD 3V4PL 1A14H 3FU7B 5ICUA 1X44A 1I3QA 4TQIA 5E8PB 4JRYE 2OXHB 1WO2A 1KXTB 4BHUI 3HIZA 3BZEA 3BN9D 2VKXA 2Y6TE 3HNTH 5JHLL 4LLUB 5LJYH 1KBPA 1RMFH 3OM3B 4N2NA 2E4FA 1JWSB 3CSBA 1W0WA 3C60B 1IARB 2A9NL 3WG7B 3VD7A 3ZRFC 2KPWA 4G7SB 4N0UB 4TLKA 3MJ9A 1BAGA 2FL5A 1HHIB 4EN3A 3K8LA 1EZVY 1KGCD 2CR3A 3CVHL 3ENEA 5CEXA 1BBDL 5H4UA 2IH9A 3ULUE 3AM8A 2X4TA 2PJJA 3KPRB 2BW4A 4M6AA 3MTRA 4MQ7B 1BREA 5E56A 4MMXC 3APCA 2W9EL 1SQMA 1LJMA 4YZFF 2WLJA 1H8OA 3FUNA 4A6YH 1FZMB 1A7OH 2ATPB 2HRPH 5FV1L 4JK0D 3L3KB 2AZUA 1WLHA 4OLWH 1IVLA 3I9GH 2ZWNA 5IUCA 1UHDA 3MRPB 5F9JB 1BZ7B 3FT9A 2IG2H 4F7PB 4WO4A 3VWKB 4FJZA 3VXRA 3NTCL 4G1EA 2VLJA 2B59A 5C07B 3VGBA 1I7UB 4A38A 1WS7A 4M9OA 4EPSA 1UKQA 3WHE0 5GIRB 5KS9E 1VACB 5B1BB 3ZDYB 2H2SC 2H5UA 5HD8C 2FEJA 1KJ2A 1XCXA 3KYAA 2YA0A 1P0SE 2XBTA 3LS4H 1C08A 4JO4L 4ODVL 6FABL 3O6MH 2DTML 4KNQA 4WGVB 5IG7A 4ZOCA 3CN0A 1P5UB 4MB4A 3B7RL 4TV3A 1PSKH 3NZ8A 4M9PA 4I0PA 3KBHE 5BXFB 2WGXA 1IC4L 4XVTL 1KSRA 1IKOP 5E94B 4ZPVB 1QRKA 1DQVA 1T6WA 5TQ2L 3V7AE 1N10A 1HL4A 3GSQA 1M42A 1KQFA 2HCZX 2WY3B 4PJ8B 4HLEA 3LPWA 3BLKA 4XCFH 3RLSA 1FSKC 3MYJA 3O9WB 4PGBA 3NQIA 2VLMD 2X41A 5C0AB 3UTTB 4KGJA 4TLSA 3NCJH 4X4XA 1LO2H 2VDNB 5AVTB 3UAFA 1U8MB 2XIBA 1ZHKA 4KTYA 4WU5B 5ALBH 1Q9OA 1OM3H 1Z3GH 2IQAA 5AW3B 1F4XL 1CVRA 4DP8X 5AZEH 3HG2A 1G9MC 4M4RB 4XP5L 1U36A 4MXQC 3ULAB 3DNKA 4F91B 3GHBL 1TTBA 4LRNH 5CMAA 5CGYD 1TKWA 2N59A 1A47A 3A67L 4ZBJA 3RIFF 4FA6A 1CE1L 3QQ3A 4HWNA 1RZJC 3SD2A 3A0OA 5DZAA 4F24A 4NHUB 5C0RL 2WCPA 1EEYA 1YYCA 4KKAC 4B50A 5D4HA 1I8MA 2Z4QB 5ADOH 4OFIA 5EZLB 4HPHA 1HX0A 5D8JH 2F5AL 3U25A 3TBBA 25C8H 4KNTA 1H6FA 1FNSH 1K5NA 1OE1A 1F18A 2VXQH 3OHXB 2F1AA 5I30H 3STLB 2VERN 4JM2C 4PIBA 3CV5A 2JJUA 1GRWA 1QRND 3L45A 2OBGA 4JL2A 5CCHE 2EILB 4X8CA 3SO5A 5D7SH 3T0DA 1W9XA 3T0AA 1WFTA 3MRRB 3ARGA 3UBXA 4A7VA 4DUXA 5F9DC 3TBYB 1UJ3B 2WXJA 5IEKA 4Z5RB 3X1NA 4YGVA 2QVMA 3C5ZA 2HA1A 4HJTA 2R2HB 4TLUA 3WSQH 2AJ3B 1OANA 1XH3B 3LN4B 3K0YA 5JORB 4OD1H 3T1FA 3QHFL 1RY7B 4ZW3A 5HDLA 2P5ED 2BRQA 4XN2A 4PLKD 2ICEB 5IOPB 1M4KA 5GGVL 1Z9OA 5D1ZB 4HP5A 5F7KC 2WO2B 1BXAA 1T1ZB 2YO3A 3QDMA 4AT6A 2DBLL 3NJVA 4P2OD 3OPUA 2XFXA 2P8LB 2X10A 4UYQA 5DK3A 4P2QD 5JIKA 1E5VA 3EOBA 4YK4C 3AROA 3CSYB 3CFJB 2QSVA 4F15C 3VSVA 5K9JL 2E76C 2JIPA 3U9WA 3ISYA 3QIBD 4F93B 5LGJA 5BS0B 1IM3D 1SEBB 3B34A 2F53B 1JNJA 4MSWA 1J1PH 1S9VB 1J0KA 2HKFH 4AMKH 3JZ7A 4GA6A 3ROLA 3SJVE 3TVMA 2EIJB 3ML1A 2XN9D 4G1MA 3D2UD 4N0FB 2MEJB 2EDRA 2ZP9A 5H2BB 5IW1B 3SEPA 1AJ7H 1A5FH 4W6YB 3PP3H 4DN4L 3CFKB 2FSEA 2DQCH 4KAQH 2LAAA 4RFEA 4QF1B 3T6XA 1KBKA 5HI3C 4U3HA 5JW5B 2B9AA 1DQLH 1EZUA 2WN2A 1NL0H 1UWXK 3T3PF 1X9UA 4XVJH 4MZRA 5K1VA 5KUKA 3VFNA 4YDVA 2F5BL 1I82A 3UTSD 5KYXA 3Q2WA 2GHZA 3U9PL 3ZHNA 4S1SL 3W11D 4QYOB 5IB4B 3ENGA 4BFKA 5BV7C 4NKIH 3U0TB 1MCEA 1JD7A 3P4OB 1O7DC 3NCBB 1AQDA 1JZ8A 2AJYL 3T4YA 1X4YA 1YEFH 2E7MA 1B6DA 1OGTA 2COVD 2CHNA 2R0WL 1CGVA 3OSKA 4I8DA 4FFYL 3QUYB 1RULH 4L9LC 3QO1A 1HWGB 4IKIA 3VXPA 3F7RA 4RGMB 4ZW6A 2GHWB 4AJ0A 2NZ9D 3MA7B 1ZHLA 3VW3L 1JPSH 2CO1A 2XXMB 4ZMOA 3UROR 5BMFL 4N5EC 2IH1A 1MCLA 3UACA 5AW5B 2XBZA 5E5LA 2GC7C 2BVEA 3IE9A 3HMXH 5E4EB 2FD6H 2VLRA 3RYMA 1DANU 4ETQA 3SKOB 2AEPL 1TQWA 4OI9A 2DLIA 1TEYA 3BP4A 1A4AA 4XMWA 3OJDA 4AVHA 3PWUA 1NPUA 1G7LB 3EH1A 5C3IA 5C0BD 3A4AA 5GGSA 4Y89A 1DJHA 2PNDA 1JCKA 4YDIL 4JDTL 5B8CB 3RDTD 4F58H 2APSA 3VXUB 4G8GD 2G30A 1OAYH 1F97A 4GAGL 5HHNA 4GRWH 1CBJA 1ZCRA 4U0QB 3OLEA 4PJXB 4CUCA 4GKSA 2JIXD 3MR9B 3RGVB 4AVJA 4ZT1A 3NIDE 1CXKA 2JJVA 5FK9A 1ZIAA 4CGUB 1UOVA 4IOIA 5CJXC 2XWRA 4IRJA 2R4RL 3CFCL 3LKQA 4GAJL 4RAVA 1A6ZB 3MZTA 4M1CC 4NQCE 1MG2C 4TUJB 5AYUH 4LHJB 4PUBL 3MODL 3TNMB 1LO5A 3O3DA 4XGZB 1ZJAA 3VFPB 2GJPA 2ADIA 2WMPA 4FTVE 1BDYA 4NZRL 4AJYV 3LN9A 3CX5J 4GI9A 1S7WB 3LEYL 3MLZH 3N1MC 2ZE0A 4HHGA 5A2KH 3QCTL 4AEHH 3QYNA 1JHLH 2GBUA 1WZ1L 3MGAA 4MA7L 5FUZH 1HSBB 4FQXC 3SKMA 4PRHB 2YLKA 1JNNH 4IHOB 4F57H 1ZOXA 3DX6B 2PW2B 3H9SD 4G43A 1PDKA 2NQDA 1VADB 2PR4L 5D2LF 3GIZL 3WD5H 4LL9A 4OGYL 2F18A 3EDDA 2NY4D 3IDJA 4JHAH 2WWKO 1KLGA 2FJHB 1U33A 4G8FB 2CO7A 4ZUUB 5GS1A 2J5WA 5SWSD 4Z0XB 4OLEA 4F3FB 3H6AA 4WAFA 3N40P 3FXIC 4JG1H 1A7NL 5C09B 3S88L 1T1XA 3FFDA 4GRWE 4L4VB 2PPCA 1CLZL 1W72A 2WVVA 4OZIF 2BINA 4OV5B 1JGEA 3KGTA 3G6JF 4PJIE 4X98B 2V4LA 3ZQXA 3WKNA 4Z77B 4HIIA 3BT2H 3QORB 1UTDA 4CVZA 1XCTA 3MREB 4H88L 4XOAA 5LKNA 2YC1A 4MCNA 3JZYA 2R0ZL 1A3LH 2DLGA 2ED9A 3G5WA 4FNRA 1VCBC 3L3DA 4Y4HD 2CH8A 5HHME 3BW9A 2N1TE 4RGNB 4TQEH 1V55B 2XA8L 4UT9A 3BAWA 2VN6A 4BH7A 2ICCA 3JWOL 5DJCA 2FEDC 3EUDA 3MZGB 4FXGA 2BSEA 4X5PA 3EGXB 4G42B 2XZAL 4A2MA 4K7PH 4ZFOA 1D5XA 5CJQL 3MCYA 1CFTB 3V52L 1BIIB 3HPJB 3Q13A 3WLWD 5E00B 5I73C 1FJ1A 4K55A 3JWNC 2MQ3A 3EYOB 5JW3L 1QACA 3SDDC 4DESA 1K4DB 3X3GL 1WT5C 1JS4A 2DKSA 4XPGL 1AGBA 1UZ8A 2D9CA 1ZV2A 4NO0B 2OJEB 3HC0B 4ZX6A 2AQRA 3BSHA 1T4WA 5BRZE 3TA3B 5AOKA 1M7IA 3KW8A 3C8KA 4FRWA 5ESQB 4LB8A 1U8NA 1GW6A 1YY8B 5KG9B 2Z34A 3EO0A 2R23A 4AGQA 3SBQA 5EO1A 3PWJA 2DYPA 3N2JA 4HWUA 5DJAB 1E4KA 3WS6C 3QIUC 1VERA 4Z7WA 5FFLA 4Y9CA 1RUQL 3P77B 4LPVA 1J8HE 1WQVT 3IJSA 4PJ5E 2F8VA 2A74B 3RI5K 1Q9KB 2YARA 3K6FA 4OB5L 4Y16C 3D0AA 4Y9BA 4OM0L 4AUYA 2F7PA 3H0TA 3N0PB 3GMQB 5E0QA 4AEFA 4AGNA 2YBRB 3VMPA 2X0UA 1CGSL 1CFBA 4QWWD 2QMJA 4PW3A 3VFTA 3UC0L 5F7DA 3QG7L 4GRLD 3ATDA 1PNDA 3P1VA 1D2OA 2FT8A 1AD0A 1UXWB 3AB0B 4UANA 1PD0A 5C8JA 5I15L 3ZJAA 4XCEA 4MB5A 3V9FA 3WJJA 1PD1A 1T03H 2DLHA 3QFJD 3P11H 4NJ9H 1U3HA 2A0LC 1XGUA 3RJOA 2CPCA 4CADA 4F8LA 4J3OH 5IROD 1EO8H 2QSTA 3Q2CA 5DQJB 2V6HA 3O6LL 2Z9TA 2AJZB 4MAYA 1T22A 3S5LG 3BAYA 5I16B 3Q6GH 1FYTE 3P4LA 1TJIL 2R7EA 3VXSE 1A0QH 2PO6C 3SZKC 4XO5A 3WCYA 4EOWH 5J6GB 4XZ4A 5INCB 4JR9L 4HCRL 1OVZA 2N1KA 3MLRH 5GS0H 4H1LB 1O6TA 5HHOB 4XVOA 1AO7A 2ZKYA 4KK8D 4Y1SA 4RSYA 2ENYA 5KOMC 3UTZA 1JF6A 4OCRH 4HJGA 2YU9A 4YEEA 2OMTB 3EO1B 4EVNA 4DKEL 1BQKA 3V2AR 3QHZL 1RHHA 4OZHF 1DUZB 4LLVA 3TIEB 3HU2A 4U1MB 5DWUL 3MRNB 4TUKL 3CMGA 3N9GH 3CVBA 5JXED 4PJEA 4CU6A 1MCFA 3QGVA 4E9WA 2ETWA 1SJMA 5ACMA 5C08B 3MJ7A 3HBGA 1PQHA 5FM4A 2WBXA 2O6CA 1PYQA 2PWHA 1AZVA 4KV5F 1J0HA 4TNVK 5GPRA 1BVKB 4JKPL 2DWYA 3QXAB 4N87A 5K93A 4A2DA 1QD0A 4KUZH 4EIBA 5ID1B 1I8UA 3CZFB 4KVCH 4JFOA 4CSPA 3DXAE 3DDFA 3H42H 2Z3FA 5DZVA 1X9RA 3V6OE 2CUHA 3HBPA 4KO5A 4EZLA 3X2GA 1WCBB 2XYCA 3W2DH 4DKDC 1TZHA 3IXAB 3EJRA 2FE0A 3DX7B 4Z7AA 1OCWL 2DQEH 1U8CA 3F6IA 4LCUA 3VE0B 5I6KA 3WIAA 3SE3A 3B7TA 1XO8A 4GMSH 1E9OB 3BP7B 5D72H 1IEBA 4EDWL 3OWEA 4QO1B 1IBHA 2OSYA 2IWKA 3VNZA 2Z7YA 5FYLH 4S1RH 4OAWA 5FGRA 3LH2H 1Q90A 2AF2A 4NBXB 3WFHA 2QHRH 1TTFA 2QZ5A 5FGCB 1C16A 2BZ7A 3MXVL 3PQYD 7FABH 4KPHL 4BQ8A 4M7JH 1WGOA 3Q5YA 1VHPA 5D7JD 2WNXA 3LPGA 2DH2A 2ZAIA 1MEXL 1N12A 2J1KA 2VSKB 3KGSA 4UAOC 5C0FB 1T0MA 3EOYG 4JFZH 4OZGA 5ANHA 4DO5A 1DCEA 1D5MB 1UKTA 2VWEC 1FGNL 1DBBL 3V0VA 4UNVA 5IUSA 1NC2D 2F74B 3A6BL 4LLQB 2ZPKL 2EUXA 3ESMA 1HHGB 4Y5VC 3T4AA 2X70B 4DVRH 1YO4A 3KPMB 4JZOB 3LRSB 2NRDA 2V2XB 35C8H 3TM6A 1FWXA 1NEZA 4ODXB 2OK0H 1WTGT 1PIFA 2XT1B 4KKRA 3DOSA 5JMRA 3ZDXB 4HIEA 1KENH 4GW1A 4XOCA 3HZKA 3OGCB 2YKLL 1GPOH 3GLAA 4NRZA 2ZXBA 1BW4A 1T5XB 3KLQA 1NBYB 4DPCX 3KM1A 4HH9B 5FYLE 2V9TA 1LK3H 5AG8A 2EE0A 3T0ED 5F7FA 5IJDC 5HVFB 5DUPH 1DUYB 2FECI 4DZ8A 5GGQL 3T8MA 1T83C 3LIZA 4FL4C 1IM9A 1CCZA 4Y19A 1S5IL 2Q8AH 1NINA 3E1F1 1Z5HA 5F9OL 1SRDA 1U8HB 4HHAB 2P24B 2HWZH 2NDFA 3VG0H 1SYVA 1BG9A 2XSKA 4MBRA 3B37A 5D96B 1TWCA 4MA8L 2K7PA 3H8NA 1H0DB 2XDHA 4LNRB 1RZIA 3NH7H 4JDZB 2UWEA 1NAMA 1CXFA 2XZQL 2OQJB 5T1KD 1XB3A 3QNYA 1NAKH 1KYDA 2H45A 4YR6B 2J5LC 5EO9A 4CGTA 2YJQA 3LZFL 4MMYA 2IANE 1WAAE 3MUUA 4UNTA 3QCVL 3HBQA 4QAWA 4WJKB 4KFMA 2Z7UA 3TXAA 3EHBC 5F71A 1MNNA 5DO2D 5I74B 5CHNB 4R4FH 4GG8A 2TSAA 2VW7A 2MHAB 1CLOL 2FBJH 2VXVH 4M8QB 3ATEA 4IBZA 4L8SC 2Y2YA 5MERA 4IU2A 1WS8A 3SGKA 1QFOA 3CCHA 2OJZH 4LVOB 4IBQA 1HQ4B 4FABH 1NGPL 1RZKC 2F7IA 4MS8D 3ZYIA 4F1SA 3FU7A 3PNRB 1EWHA 2IAMB 5E8PA 5LCVA 1FFNB 2OXHA 4R3SB 1KXTA 5I75B 1CFVL 4RMTA 2VLKB 5HJGA 3VFUB 2Y1YA 2MTPA 4LLUA 3DMMC 1RZFL 2AXHA 4NJAL 2PPFA 3WN5C 4N26A 3C60A 3DO3A 5ITBL 4MTMA 4N2HA 4UNUA 1P5VB 1D7CA 1A3ZA 2E6PA 4N0UA 3V9CA 1HH9A 3D1MC 3VXME 3F00A 1HHIA 1WDAA 4JGUA 2FYYA 4HISA 1LO3H 4MQ7A 4OD2B 4J4PC 2MH4A 2ZZUT 3RVVC 4G6FB 3PXLA 5DHVH 4CAGA 3HOGA 2D7TH 3RIKA 1FZMA 1JPST 2ATPA 1A4CA 3OKMB 4LDLB 3L3KA 2H2PD 2C3WA 1GXEA 4P2RE 1TMOA 4KZEH 2XIDA 3PL6D 3MRPA 1S78D 5F9JA 1BZ7A 3FTSA 1JTPA 1QFUH 4RAHA 1FORH 3TJEH 4B95C 4F7PA 3V0WH 1TQBB 3GJEB 3VWKA 4NXSA 5JUEH 4JANB 3ZIMA 5C07A 1I7UA 4G83A 4OGXH 3WJLA 2X7LA 1QWUA 2WSKA 5D9SB 5GIRA 2DWTA 4OUOA 1TQUA 3ZTDC 1E30A 1VACA 5HSFA 2AEQL 5KSVB 3NA9H 8FABB 1GIGH 3TBCA 5I0XA 5EDXA 1MI5B 1MHHB 5ICZB 4WI2A 1I9RH 4AOFA 2IPUG 5IHHA 1DVFA 1UA3A 3SDXF 4F7CB 3WIHH 1J1XH 2N3JA 3MGTB 1T0PB 2PYFB 4MXVF 5F3HB 3V55A 1EUTA 4N2FA 5GSVB 4JN1L 3U7WL 1QSFE 1P5UA 1YNJD 3RWIB 3VI3E 3ZKMD 1UACL 5FM5O 4Z6AT 3U2IA 4LSSH 2HZHA 4JO2L 3I3DA 3CPLB 5BXFA 2WM0A 3RVUD 1HKLL 1TJHL 2DQIL 4O58L 1FNFA 3K6SB 5E94A 1YY9D 2IDFA 3KPNA 2NY6B 1EHLL 1BZ9B 4LU5L 1CR9L 5SWZE 4PJ8A 1F1AA 3KLLA 4NOBA 3TH4T 1SLWA 2EKSB 2WSDA 3ZTNL 3IFNL 1HZHL 3GB7B 1JOIA 1LEGB 3H3PL 5C0AA 3PWVB 3BVNB 3UTTA 5I1IH 2B08A 4EIGB 3BO8A 3QS3A 1RZQA 1UXMA 1U8MA 1HXYB 4WU5A 3QZNA 2GVYA 4LSQL 2KHAA 3AXLB 3QDJE 3VWJB 1LTXA 4M4RA 5ID0B 3VSUA 2EIDA 5E70A 4L5FH 4WHYG 2VXTL 4PY7B 3DHPA 3GJFK 2A9AA 4Y0GA 1LK2B 1SMAA 2W8CA 4NFCA 4O51B 4W9HC 4X5LA 4U1NB 2O93L 4ZQKB 4NHUA 1BEYL 2DQGH 5FOBB 4WEEA 1FFPB 4UIKL 3ME0B 2X3AA 4CC4C 2BLFA 2Z4QA 3TGXA 2BDNL 5EZLA 5FUOH 4TVPL 5T1MA 2ZQKA 1MF2L 1CGTA 5TF1L 3QP3A 4NQDD 1G9MH 3OHXA 4YHPA 1BD2E 2PW1B 3FPYA 4F80A 4G59C 2VDLH 2OPCA 4P2AA 5KYYB 2J2ZB 1EGJL 2V45A 1RZJH 1YMMA 3LKPB 5CGYC 3ZLQC 3KYMB 3ARFB 1SDYA 4M4PA 1H3WM 4Y5YC 3VI4E 4TUOB 1HZKA 1UJ3A 3BRGC 4OCSH 3O6FC 4Z5RA 2V5MA 1FP5A 5CLXA 3MN8A 4Q6IC 4ZW8A 1QI3A 2AJ3A 2AK4D 1XH3A 3KAAA 3NVQA 4AXWB 2DWEB 5JORA 1JF1B 2FZ3B 4OLXL 1A21A 2XACC 1E2WA 2ZUYA 5KYUB 5C0ND 4KMTH 1G1OA 1GJWA 1HXKA 1ZXKA 1NGWB 1S7RB 4K3JL 4L5FE 2EEXA 1CICA 1CTOA 4KUCD 2ICEA 4PRPE 4WQOA 5AVWB 5DRZB 4AL8L 2Q9OA 4GIAA 1CDBA 4IRSB 5D1ZA 1KNOA 2GIXA 2KT6A 3JBG7 2AMGA 2MQCA 1WFMA 3D8MA 1HILA 1SN0A 1KCUH 5T5FH 5CJ5A 1RIHH 3MLUH 5GGRY 3WIIH 5CP3H 4JQVC 3HFFA 2QLVB 4ADGA 2P8LA 2VDMB 3QJVB 1EZLA 2CA4A 3GSVB 1O7SA 2B1AL 2CZNA 3VGHA 3AQDA 4PJDB 3CSYA 3CFJA 3GTGA 5FLVA 3Q48A 2IPKB 5BS0A 1NKGA 2F53A 2AE0X 3QDHA 1S9VA 1BZEA 2I85A 1FZKB 4PLKC 4BGLA 3ALWA 1NUDA 2BP5M 4XXDB 1XF4A 1R1CA 1JXGA 4DQAA 4N0FA 5FA4B 3X2JA 5H2BA 3EH4B 3US9A 3H56A 4HEMA 1FZOB 3MV9D 3MJGX 5GM9A 3CFKA 3E8VA 3Q2LA 3CFBB 4P2OC 5IK3B 5LB1A 4AYDC 4QF1A 4EXKA 4C4BA 1X5HA 5JW5A 1UC6A 2W65B 2W92A 3V0FA 3V4PB 5I1EL 1WGVA 3RVTC 1X5LA 4UT7L 1KZQA 3GXIA 3WEMA 4NIYE 5ERWB 4A2LA 5LXVA 3IDYB 2VZSA 2ITEA 3QIBC 3PUCA 1VKXB 4ZJ9A 4RQQA 2VQUA 3O4LE 3I6LD 3UJJH 4QYOA 4NN5C 4PJGE 3LIUA 4JO5A 1WISA 3BWSA 4MAUL 3OX8B 2J88L 2IGFH 3ECBB 3WKYA 3VMOA 1SIWA 4KDTC 1CLYH 1N8ZB 1PG7W 3CVHB 1BV8A 4JQXA 2KL6A 3FU8A 1QFWM 1INQB 3H53A 3B9AA 4OCLC 1UASA 1ZPLA 4N0YL 4KTGA 2X2HA 1HWWA 2ZCHL 3TCLB 5DURB 3UBXG 3X2KA 2J8OA 4ZMAT 4BZ2A 2BSDA 3GBNH 3PLXB 3FW6A 3I6SA 3MA7A 5BV7H 3L5XH 2GEEA 4JAMB 5PAZA 3BIAX 5DHMC 2I5YL 2C4XA 3LXUX 4YHZH 3UP1A 4YWGH 3TCXA 1OWWA 1YPZE 4Y8DC 2Z8SA 3JWOC 5FR3A 4PG9B 5D93B 1I7ZB 5BZWB 4GG6B 4RX4A 4GS7B 4PVBA 2JTYA 5CS7A 4EN2A 4I9WD 4F8TA 1NCTA 4YHNA 3GKZA 1G7LA 2JIMA 3K72B 1W8EA 3G08B 3M45A 4QY8B 3VSTA 4ELMB 4LEXH 2NSMA 1WSST 1BW3A 2ITCA 3E2HB 3NIFF 4F37K 5B8CA 4P3DB 3U36B 2E3VA 3FPXA 4KLNA 3VXUA 2BY0A 4AWJC 4FA7B 2GBTA 3UGXA 2AAAA 4OTXH 4PJXA 1CFSB 4XC1L 1P9MC 4L8DB 3MR9A 3RGVA 1F8TH 3CZNA 2WUCH 1N5AB 4AE0A 3VGDA 1A6ZA 3L4XA 4KKLD 4TUJA 1FCCA 2L4OA 3TNMA 4ZQTA 4XGZA 2Y7QA 1ETJA 3VFPA 4ISVB 3QDGB 4M62L 1CS6A 5E6ID 5TE6H 1S7WA 3TU6A 5G4NA 5ITFB 3A4FA 3H85A 1HSBA 1O7DE 3RDTC 2FO4B 2C1OA 4PRHA 2EDJA 3GQFA 3CXFA 4R2GD 4IHOA 5A40E 2PW2A 1GGBH 2DQJL 3KXFD 4DKFH 1VADA 3MLYL 4B60A 2EE3A 1G6RL 1MELA 5FUCC 2ZKHL 5EEUA 5KVEL 2R15A 2FJHA 3K4AA 1ZHBB 3O81A 2X6CA 4MASA 4G8FA 4ZUUA 3QRGL 3E8UH 2NY5L 4Z0XA 4O2FB 4KKNA 4F3FA 2YBGA 3CJJA 4AH2A 4X99B 3ZDZF 1R27A 1DFBL 4PJEF 4D9QD 5C09A 3PCYA 2NW3B 2FHFA 2IPUK 3PWLB 3G7TA 4UZGA 1X5MA 2X4QB 1XF1A 3QYCA 2R93A 3REVA 3SQRA 3WMPA 5DGQA 3C6LC 4HLZH 1FRGH 1MQKL 4OV5A 2G9KA 3G5VB 4ZMPA 4X98A 1N5YH 1J05B 1MFEL 5I6LA 1W15A 5ILTL 4CBZA 5DUMH 4B41A 4Z77A 3UBFA 3QORA 1YA5A 4XNYL 2BNUA 3RE0A 1QBLL 1OZUA 3SDYH 1MLBB 2A77L 3NZHH 5LG6A 3WDIA 3M1CA 2Q1EA 1WIPA 3IMBA 4F5CA 4HQQL 2J44A 4YLBA 1IGJB 5HYFA 3VFVB 4X9FA 3ZO0A 3RA7L 1NM9A 5IZ7A 4AEIL 4KRPD 3AFLA 3EYSL 3RJDA 1OLLA 5DVMA 2ZUVA 3EGXA 4G42A 4HXAL 2BFVL 2D0GA 4IBTA 3JXAA 4QMEA 2J1YA 1CFTA 1MHCB 2DS4A 4IOFD 4YSUA 1BIIA 2X2IA 3HPJA 4OV6F 4Y2NA 1BQLL 1QHPA 2WQUA 5E00A 1OAKH 4Q14A 3EYOA 4WJ5A 4LRIA 1K4DA 4PJCF 1AHWB 2WZ5A 2WLHA 3OZLA 2G2PA 3STZB 4D9RE 4ZMYA 5E95B 2PWEA 4K4KA 4I4WB 4NO0A 1M6OA 2OJEA 3TA3A 4Y1TA 4OZGF 3FFCE 5ESQA 1A7PL 1LDPH 2QVIA 4GQ9L 5T5ID 5KG9A 1YY8A 5I6OA 4KWUA 1WV7T 2F7RA 3AMKA 3JWNH 4FI8A 2QV4A 1BVLB 3EXJA 3VTTA 5DD0H 5DJAA 3Q05A 3WLWC 2KZKA 4UTAH 1D9KD 3WY3A 3P77A 2IEPA 3CZEA 3NGBB 4X5WB 2A74A 1Q9KA 3TC9A 4FQ2H 2YXVA 2V5YA 4OF7A 4XNBA 4PS7A 1OLZA 2IALB 1G7QB 4O2EB 2ZX7A 3GMQA 3VFMB 1P84J 3MCLH 3N43F 3QCUH 5GISL 3GTJA 1Q0XL 2YBRA 5EZIL 4FADA 3ARUA 2UUDH 3K6IA 5I0YA 5K9QG 1FV1B 1W6LA 1YEWA 3ZL4H 3P0VH 3COOA 3FUFA 3NIDB 4HSAC 3TFKC 1UXWA 4HIHA 4AG4H 1XGRB 5IJBC 5EH1A 3SO3C 1CDIA 1KFAL 2ICWI 4GYBA 4UILL 2XOTA 3UAJA 2EVHA 1Q0YH 4FE9A 1PQZB 3B1TA 5C3TA 4HULB 4LCWE 4QRAA 5F7WC 2EYTB 5C1MB 5FO2A 5DQJA 5E9DD 2UWEF 2R8SH 4IRZA 4ZOAA 4ZFZA 3D39E 4YPGB 2AJZA 3HG1B 4MXWL 4K3EL 4QWWC 3WLBA 3RNKB 1CDHA 5I16A 1T21B 3EKCA 5D2NE 4GRLC 1KYFA 3GZPA 3QUHA 5F1KC 4E9VA 4CJ1A 3WKMH 4X6CA 5HGAA 5INCA 1YVLA 4O00A 1JL8A 4HW6A 5JPNB 4H1LA 2ORBL 2R56L 4Z3IA 5EORH 5A2CA 4E0RB 4DPBX 4G9FA 1JNHB 1TMQA 1MH5B 3DVGB 1P7QB 2OMTA 3EO1A 5FGBC 4KNSA 1T2XA 4ZS7L 3EBAA 5IROC 3KLAB 4U7MA 3BPLC 3EYUH 4LSRL 5L2KE 3NFNB 3TIEA 5C18A 1A64A 2UZXB 3K91A 4XC3L 4U1MA 3MRNA 3FTXA 4LBEB 4XPBL 2CPUA 3RNQB 4B0MB 2XN1A 1W8NA 1GJUA 4X4MA 4HUUB 3GM0A 4LKXB 5C08A 3ESUF 4LSUH 3HAEG 4LF3B 4XZUB 4B9JA 1B0RB 3PJSB 3GTMA 4EBQL 5B22A 2VXSH 5T33L 1SJEA 4KK8C 3QXAA 5ID1A 1H8LA 3CZFA 3SUKA 2WNWA 4U1JB 3UP6A 5E08H 4WW2B 1E4HA 4M5ZL 1FNAA 4BFRA 3OLIA 3HNSL 3X1BA 5IR1B 2XLLA 1XCWA 4N0CD 2D3JA 2GPZA 1WCBA 3HFMH 5DD5L 3RIAF 2X88A 3IXAA 4WSJA 2VH5L 2B3IA 3DX7A 3N40F 3QUKA 2LLLA 3VE0A 4JFFB 5JXEC 2EC9T 1WFJA 3WEOA 1HHJB 1E9OA 3BP7A 2QKIB 3KJ4B 2VZ1A 4NENB 4L29A 2NZIA 1FIEA 5EU3A 2DEYX 4QO1A 5JQ6H 4GI6A 3L7FB 4HEPA 5C0DB 2YN3A 1CG9B 3P9MA 4P05A 1VESA 5C7XL 3FN3A 5A43C 5IV2B 4JG0H 5A1AA 4A68A 4PGZA 1X7SA 3HRZB 3KCWA 3FULA 2O5JD 3QJXA 1MJUH 8PAZA 4NN7B 3MUJA 1MCPL 3ABKB 1J8HB 1Z9MA 5C0FA 3Q0HA 1HQRB 3D2UB 4L4TD 4X9GA 3EH5B 1SMYD 1LILA 1D5MA 3GSUB 4G6ML 3JSSA 1RU9L 2ZCLL 3MNDA 4LLQA 3KMDA 1KB3A 3FHEA 4B7IA 2BVQB 1HHGA 4HUWB 2X70A 4PJ7E 3CIQA 5K39B 3KPMA 4JZOA 4OLZL 3LRSA 5IHBA 3UZEA 4YSDA 4UINL 1RUAL 4HF5L 4N2OA 4OFPA 2A9NH 2VRAA 1N0XL 4ODXA 4X6FB 3BUYB 4DGIL 3EF4A 3GTNA 3REWB 3T3MF 4AKQA 5D7JC 1UUNA 3HA0A 4J1UB 3FFOA 2C9SA 1INEH 1T5XA 4CRYG 3CTTA 1NBYA 3PAUA 2V2WA 3RY5A 4CRPA 4MX7A 3L3HB 4B5EA 4I5BA 4NCC2 4HH9A 3B9KD 1CVSC 5GRZA 1KPUB 4LBAA 3QC8A 2CKBB 7TAAA 4L37B 2Y69B 3HJ0A 3FCTA 5CLWA 3UERA 4AKPA 1OGAB 4QTIL 2C9RA 4WY7L 3VXSB 3L13A 1IQDA 3GSXA 1JP5A 4Z3GA 1U8HA 3BKJH 2P24A 3G9VA 4HHAA 2D8KA 4MFHA 5E1IA 5GGTL 3TN0C 4OI7A 2OLDA 3MBEB 2KPNA 1BQSA 4IGBD 4LNRA 1H0DA 3SDCD 4O02L 1SLUA 3C8HA 4EMZA 1UOKA 5AKTA 4JDZA 5I6MA 3DJSA 3RVWC 2QADB 3DBXB 2OQJA 2FQGA 3UYOD 4ICWA 2IXQA 4YR6A 4F2FA 4XNXH 2HP4A 3N85L 2FX8L 4ZTPL 2MKLC 4WDIB 4WKZB 2VZVA 4GXUN 5B39G 1AKPA 3PGDB 4JO4H 5CHNA 5C0CE 1LQBC 4ODVH 5D5MB 4FCHA 1MFAL 3ILEA 3FT4B 2VUMA 1P2CB 4YXKL 4LCYA 5D6CB 1GJIA 1HQ4A 4R4BB 2VWEE 5EU6B 3B3BA 5I1CH 3ZKXB 3F05A 3FO2B 4YHKH 4ZXBC 4XVTH 2FEEI 2IAMA 1FFNA 3K81A 1E9PB 4WEMB 4ZFQA 1UADC 2PABA 2VLKA 3DRTB 3D50A 3VFUA 4PJFE 3N1QC 5F6HJ 4OF8A 4IBUA 3PDDA 3DIFA 5GGSY 5JIDA 4JRXA 4NAMA 4CMMB 3RPKA 1KIRB 3MC0A 4M7ZC 5I82A 4RWYL 5HHQB 4BFBD 3CXDL 3BH9B 4XAWH 1H3PH 5DO2C 1P5VA 2R4SL 4D3CL 4NM8L 4XBEH 4ERSL 4S0HA 1MW0A 4TSAH 1TETH 4IMKA 1NDMB 1RZKH 1OY3B 5EV7A 2G60L 3WUWG 4KTEH 4PB0H 3JYCA 4OD2A 3JT2A 2B5IB 3H9SB 4PJBE 3A67H 1W8OA 3W39B 2HT2C 4BWTA 1NEZG 1UT2A 5SX5H 3OKMA 2NY4B 4AVRA 2P52A 1OOWA 1E3FA 1FE8L 1UG9A 3NRFA 1EJFA 2RMNA 4PV8B 1B9KA 3J8F7 1BJ1H 4W81A 2YPVA 3SE8H 3V6FB 4J6RH 5C97A 3QEGH 1J5IA 3DV4B 3WO4B 2BZCA 2EDDA 3W5MA 2F5AH 2F1BA 5A3ID 3P3UA 4JP6A 5CN1A 3IR6A 2IC2A 2VITB 1DL7H 2Z31A 5D9SA 2BSRB 4R0LC 2ZKWA 2X9YA 2FRGP 2ZWYA 5AOLA 5KSVA 4UDTB 2VL5B 3S8WA 1MI5A 3ULVC 1ZLSL 4U6XA 2L7QA 5ICZA 3QPQC 1MPAH 2EKJA 5DEGB 5DZPA 5HHVL 3S37L 2CGZA 4AL8C 2FDBP 2ADGB 4WCYH 3GRGA 2DRUA 3MGTA 2PYFA 3PL6C 4M6NL 4YDLB 3HKZA 5GSVA 1S78C 1MCOH 4Y4HB 1LL1A 4LAQL 4YC2B 3RWIA 2B1HH 4MJHA 4RFNB 3FNKA 1AYRA 5C0JB 4FNLL 4N85A 2R7ZA 4PCSA 4RZCB 3CPLA 3ZGIA 3FBKA 1Z0MA 1GOGA 4FQ1L 3K6SA 5JA9A 5T1JA 4PRIB 2FJGB 1BZ9A 2TSBA 5GGVH 2F19L 4H8VA 1OALA 2EKSA 5CEZD 4UB0H 5EUKB 3BD3A 2GJ6E 4HJIA 3X3FH 3AMLA 1M05B 1LEGA 4WEUD 1AE6L 2ENSA 3BVNA 4X9BA 1QBBA 2GCYA 3UCRA 3O4OB 1MCWW 3U1SL 3FQNA 1F4YL 2ZG1A 4EN3D 1HXYA 4MJIB 4NN6C 5FYKE 2H9GB 3J7HA 1ZVSB 5AKSA 3ZKMC 3ZMEA 1F02I 3IFLL 2C9VA 3AXLA 4Y4FB 1KPVB 2EE6A 4JY6A 4JVUA 5ID0A 2WTOA 4I18C 2IGLA 1L7TL 4PY7A 5TK4A 1YY9C 5FECB 1JE6A 4FNUA 1LK2A 4P5TB 4O51A 1MKFA 4U1NA 4ZQKA 3WNOA 1YAZA 1TQSA 3O11B 5FCUH 5H4ZA 2OCCB 5FOBA 1FFPA 1ODUA 4OGAD 5HI5D 1BAFH 3NSCA 2VDOL 2H4EA 2PCXA 5EFIB 1PEZA 4WO4D 4XBGB 4DN4H 4QRUB 3VXRD 3A6CL 2VLJD 4ZUVA 3IJEB 1DEDA 3MO1B 5IIEB 4XX1G 1KIQA 4PJXF 3V5DB 2NSXA 2PW1A 5L88L 1HI6A 1PFCA 1XV8A 5TDPB 5IJKC 3U6XS 5KYYA 1AGDB 2F5BH 2J2ZA 4RH4A 3MV7E 2XQBH 1YEEL 5IQ7L 3IF1B 3LKPA 2AZAA 5EBGA 1UKSA 5KOVC 3KYMA 3ARFA 3C8DA 3P9WB 5D6DC 4S1SH 1MJ8L 4CN6A 5DU7A 1ZLUH 2LFGA 2XG4B 3FTUA 4TUOA 2XHNA 2XRAH 2JKLA 2ATKB 3QULB 4HX1A 4RMSA 5LN4A 1BWMA 3GZOA 1IBGL 4ZMVA 1J8RA 3HB3B 4M7KL 5J1AA 5GRJH 5DMKB 1PW3A 5JNYB 1B0WA 3VFRB 4AXWA 4P3CH 4I0PD 2DWEA 3VXMB 4I2XE 4HWEH 4IDJH 4H25B 4HPYL 1GHFL 5KYUA 2HUEA 1T04B 1K72A 1RK1B 1NGWA 1S7RA 1FF5A 2W88A 4PJAE 4U4IA 3DC0A 5DK2B 4IRSA 1PIGA 1TYJA 2CJUL 4OSUL 3DRQA 3H2PA 3C5SB 2H1PL 4HG4K 3TEYA 2WVSA 3GSVA 3NPSB 4PJDA 1Q1JH 1XGYL 2YN5A 5I9QC 3GD1C 4E5XB 4DGVH 1J0YA 4OJYA 5E2UL 3Q9PA 1PZAA 2IPKA 4LARL 4OIAA 5C0NC 3KNBB 2YEQA 3GSWB 3QZOA 4JPQA 5KS9A 3DOHA 3BDYH 4RRPA 3CFNA 3GF8A 4JDTH 3PXJA 2VJ8A 4XXDA 4AYFB 1MW1A 2VLME 3HI5H 3MLTB 4GAGH 1PT0A 3CF2A 5FA4A 4UQ3B 2DBJA 2NTFB 3P69A 1FZOA 5EU4B 1CXLA 4GKLA 1UEMA 2VQTA 3US1A 3CFBA 1PZ5B 2BP0B 1DP0A 4Z7UE 1RPUA 3DLQR 2W65A 3QUXC 3V4PA 3AS0A 2BIOA 3GYRA 4ZO8A 4DEUA 5GJSL 3KWXA 1WWAX 5ERWA 1YCSA 4Z0BL 5JHLA 1E6JL 1XGZA 5KJ7E 1VKXA 6TAAA 5FO7B 3GTPA 4XP9L 2NY5C 3RP1A 2AKRB 5SWZB 3ARGD 3E80A 5CEZL 5I76B 5IWLC 3HW7A 4LCCC 1NSNL 4DW2L 3FN9A 1UENA 4F7KA 3OX8A 4GSQA 1MFBL 4DOHE 2EO9A 3ECBA 3NACH 3I3EA 1XWVA 3C5ZD 1CJYA 1N8ZA 3CVHA 3KWWB 4FKEA 1FO0L 1IBYA 5HXMA 2R92A 1CFQB 3GIZH 3HHSB 4WFED 3U4AA 3ABLB 1INQA 2WLLB 3PP3K 2X1WL 1WITA 2V5SA 1QRNE 3TCLA 3L1FA 1S7XB 3ZYOA 3TM7B 1FL3B 2HH0L 5K69A 1V3KA 2F9BT 4JAMA 3PQYB 3LNDA 1IKFL 3QDMD 3S88H 3F83A 1SXCA 4MCYB 3QUZB 4LDOB 5EEWA 4FQLL 5D7JB 4X7CC 2FSDA 3ESPA 5JW4R 5CGMA 4N2CA 3M07A 4PG9A 1EFXA 1I7ZA 3NCYS 5BZWA 4GG6A 4B97A 5IB2B 4JFHE 4R97C 1T5KA 3HI6L 2D3NA 4O5LH 3QJRB 2X6UA 5LGKA 1DQMH 4XPTH 1WHPA 1BD2B 1OTUD 3K72A 4FQQA 4H88H 4QY8A 3E6FB 1J0IA 5IEHB 4U6TA 1A4JA 3FUMA 1VEOA 4UQEA 3TVMD 2N56A 4TNWF 3SE4A 4P3DA 2XA8H 2OXGB 3HC3L 5AVUB 5IVXB 4W9DC 1NMCB 1A65A 2RGSA 3JWOH 4AM0B 1DE4B 5E1AB 2VSCA 4AGMA 4QRQB 1CFSA 4X8GA 4P2QE 3MKKA 5CJQH 4N2LA 1N5AA 1YEDB 4Z23A 4WWID 4Y5XB 1QFWL 2HB0A 4YHML 3PP4H 1ETA1 1I1CA 3EGDB 3X3GH 3RKDD 2X9XA 2Y1VA 1N67A 5TQ0L 3HZMB 2ZXWB 3QDGA 4ISVA 3G04B 3T0EB 4WI4A 2Q2EB 5T3XD 1NPJA 4K2UL 1QPKA 5ITFA 1BVZA 1N7MH 4RWHA 4X6CF 2IH8A 2XN9E 4C4UA 3KEHA 2FO4A 3FQ2A 2DQTL 4A7QA 3ML9A 4YHOL 4U3XA 1OE3A 3QJUB 2OCFD 4OIBA 2SEBB 2AEOA 1LEKB 4Q74A 4F20A 3W56A 32C2B 3E1ZA 1YECH 3KYOB 4YDKL 5FW7A 5T1KB 5B7MA 1KUMA 4I13B 4M6OL 3HG3A 1ZHBA 1FVCB 2GY5A 4KKLC 2DQHL 1IVTA 2VO5A 4O2FA 4AOKB 5F3FA 4ZYKB 3LQAL 1FH5L 4X99A 3I2CH 3GXDA 3HG0A 2QDVA 1M56B 5E6IC 1ETZB 4R26L 1JV5B 1UWGL 2NW3A 3PWLA 4JG5A 4KNUA 4Z7VE 3FQTB 1BQHB 2Y06L 2X4QA 2Z7ZA 1E4XH 2R27A 1QSEE 4F9LA 3NK4A 2D3VA 3PFUA 4OR1A 2VLRD 4KI5F 1ROCA 1URIA 4R2GC 5I6NA 1JDDA 2YRLA 3UC0H 1J05A 3ECWA 3QAZC 1RIVH 4U33A 4NIKB 5ES4B 5LWYH 1PZCA 2WKLA 3ISWA 3LZLA 1VGKB 2JJSC 1OCZB 4HJ1A 4X9YA 5I15H 4IBWA 1MLBA