4FFTA

Crystal structure of bacillus subtilis expansin (exlx1) in complex with mixed-linkage glucan
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
207
structure length
207
Chain Sequence
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cellulose-binding protein
molecule keywords Expansin-yoaJ
publication title Structural basis for entropy-driven cellulose binding by a type-A cellulose-binding module (CBM) and bacterial expansin.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 52
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4fftA01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4fftA02
4ENGA 3D30A 4JCWA 5GLXA 2VXQA 3X2PA 4JS7A 1OA7A 1OA9A 2BH0A 4FG2A 2JNZA 5GM9A 3X2LA 3X2MA 4JP6A 2AE0X 3CZBA 5GLYA 1WHPA 2HCZX 2PJJA 5H4UA 1BW4A 3FT9A 3FT1A 1WC2A 4JJOA 3X2GA 4AVRA 4FG4A 2GAEA 2PNWA 1L8FA 3SUJA 2PI8A 4FFTA 3ENGA 3X2NA 2G5DA 4FERA 3X2OA 3M3GA 4JP7A 1BMWA 2KQAA 3X2IA 2ENGA 2G6GA 4L48A 3X2KA 1HD5A 3SULA 1N10A 1WHOA 3X2JA 2PICA 3X2HA 1BW3A 4ZM7A 3SUKA 3SUMA
chains in the Genus database with same CATH superfamily
1UACH 2FX7L 2WQVA 3KJ6L 4E41B 2AERT 1NGWB 4U1HA 1KSRA 3WN5C 2ID5A 3QO1A 2PW1B 3NN8A 2XXMB 5AW2B 4C4BA 4F7TB 1UJ3C 1NEZG 5GS1C 1GW0A 2GBVA 5HYJD 3MJWA 4PAZA 1OTTD 3QZNA 2P3YA 4LT7A 3F58L 5JW4M 1F4WH 3HI6H 5ANMA 3L7FA 3WDIA 4Y5XB 1ZMYA 5H35A 1HU8A 2XQYA 3BKCL 2D7QA 3ATBA 3L1FA 2CRIA 4MYPA 2DL9A 2BY0A 1XR9A 4RMQA 2CLVA 3SE6A 4N2LA 1CDCA 4RGOH 5IY5B 2JKJA 3AFLA 1EEZA 3UJTL 4BZ2A 4CADB 2HRHA 3P77A 2PPFA 1X6NA 3WFHB 4PRBA 2F1BA 5KVEL 1NFDF 4JPWH 3DETC 4KJPD 5AZ2L 1FH2A 2BSDA 4YQXH 3WNKA 4OV5A 3WY4A 4ODBD 4FAAB 5IVXB 3BRFA 1KULA 1QVOA 1JPFA 5T1KD 1H6EA 3ABKB 3U0WH 1G1CA 2NY3D 4UTBL 1BLNA 3AGWA 4NQEA 1DVSA 2UY6B 2XTJB 1E8YA 1KYOK 2Q1EA 2HN7A 1G7QA 1K8DA 4LOUD 3HNVH 3V0WL 2HLAB 4XP6H 3BESR 7FABL 1OCZB 3LKRA 5TQ2H 1A1OB 2WUCL 2D7TL 2E27L 3MRFB 4OZFG 4KKBD 3OG6B 3CV5A 3VXNB 2FSEA 4ZO6A 4U6HA 1QUNB 4N2GA 3BHBA 1BQSA 3D48R 3N85L 3NIGB 1JPTL 3SPJA 3FB7A 1AW8B 3ZOAA 3EDFA 2QJDA 2NY1C 1VPOL 4FFYH 1WA1X 3T6ZA 4AUYA 4RRPA 4N90D 3L5IA 4K0OA 1H3XA 1W72B 1DQQB 4X9HA 1KXVA 1T83C 4ETQB 2CCLA 2WTRA 1MI5D 3F7PC 4IK6A 5TGBB 3TBSA 5IJKC 5EU5B 1YNJD 5CEXB 3CCHB 5EH1A 4QUOA 2EQDA 3OR6A 1W6WA 2UY7B 4GW5A 3A3YB 3BFOA 4TSAH 3AITA 1FQ9C 4WFHE 1NCDL 4AIOA 5KSAA 2B59B 4LSVL 1J7VR 4J3WA 2GABA 4V1DB 3B9DA 4OD1H 2OMWB 2ESVA 3EGDB 1DJXA 3VRLF 4ZO7A 2Q8AH 4DO5A 3EJSA 4GW1B 4Y5YB 5DMJB 4LNRB 2EH8L 1OO2A 1E6OH 1UB5B 4LP5A 4NS0A 1HK6A 1BMWA 4EI5D 1ONQA 3W5NA 1P6WA 4ELME 4U3SA 2ITCB 3MBEA 4OIIL 3VUAA 3LPGA 4FQ1H 4XAWL 3N42F 5KZCB 2EEAA 4X6BA 2NY4B 2C9SA 3RVUC 4QHLA 1QAWA 5CBAA 3ML9A 4ZUUA 1EPFA 1VGEH 3BWUF 4PJ9A 5LUMA 3ZKND 5HJ3B 1OE1A 3TJHD 5FIEA 1ZLDA 3KYNA 4MD5B 3HRPA 4EXPX 2B2XL 4QKXB 1MQ8A 1IC1A 4HFWA 3FPXA 3RG1C 3UTTD 2BCKB 4J3UA 3L9YA 3WIAA 1IGCH 5CJXC 1R5WB 2VDNH 3U1QA 5DQ9B 2XWZA 3SCMA 2EZ0C 1N64L 3VSUA 1KN2H 3KPTA 1Z2KA 4PGZA 4ZNEE 3VGBA 1VC3B 5ALCL 4HH9B 4V11A 3WE1A 3HS0A 1XB6A 4WDIA 2R8SL 1F6FB 3BKMH 3AGVA 1JK8A 4PD4K 2VLRD 4W9FC 3O41A 4UQEA 3UJIL 2XDHA 4QOKA 1FRGH 2WLZA 1VLXA 3T0XA 3LRKA 4HEME 4WFFE 4WEUD 1I82A 4HX1B 2BNQA 2C4FU 1DSWA 3FQXB 2V9RA 2ZSWA 3BN9C 3WFBL 3K71A 4WRLA 1JXJA 1FO0L 1J12A 3MLWL 4NO2A 1S9YA 4H0GA 1X5FA 2YGPA 4G8EA 4MD4A 4HUVB 1NMBH 2C9PA 2GFBA 2ZUWA 5C07D 1AO7E 2UV3A 5C6PB 3SDCD 4UANA 4PRDA 1RVFH 3L5HA 2Z35A 2A4ZA 4YBLB 5D7SH 1UHVA 5JLZB 3AWGA 3D0VB 1UA6L 1RK0A 1PDKB 4UYQA 4Z0BL 2YRPA 1JXFA 1IKFL 1I1YA 4B9IA 2Z31B 4LIQH 4MNQB 4UZUA 1HXMB 3QRFM 2CH8A 2W65A 1P7KB 4MMZB 3CD4A 4OVVA 1P4UA 1R24B 3Q6GH 4NBZB 5DU7A 1JYWA 3SE3C 1F3JA 1M3IA 2OULB 5DZAA 2VC2H 3A6OA 3FU7B 1WCMA 3IJEA 2R1WB 2ERJC 1L9QA 3MLTA 1AQDA 4DKTA 3X2IA 3FO2B 4U6VH 5JDSA 3D1MC 3VW3L 2WBJB 4JN1L 3FTZA 2W8CA 3R7RA 2CKNA 5D1XB 3I6LE 1JPGA 2RJMA 5EORL 2DYSB 4W81A 4GIOA 3FONB 2HT2D 3OHMB 3WKML 4Z78A 5D7JD 4OCWH 3F7YA 1PT1A 3VXMB 3WJMA 1ZEAL 3K0WA 5FGBA 3D4ZA 5DD0L 5BRZB 5I1IL 1WE5A 2XWTB 2FO4A 4QXGL 2Y36H 4A7GF 4QLWA 3WFEH 5IT2H 5DFVC 3IJ7A 1I8IA 4GO8A 1LXMA 2Q7YB 3O6LL 3TJPA 5F3BB 4BK5C 2OZ4L 5F1IB 2YLKA 1KFAH 1O7SA 3QUHA 4X8XA 3JWOL 1PIFA 5FLVA 5I18H 3F6LA 3MOQA 4AEIH 1DSFL 4YS4A 3FCSA 5SX4I 3TCXA 4D0CA 4E9WA 5A7BA 2IFFH 4JHVA 4IU2B 1Y1DA 3T0EE 5A3ID 3IK2A 1CN4A 3KL3A 4YEEA 4OF5A 2HRPL 1W9XA 4FADA 3DX3A 4LCUA 3SODB 1UKTA 5E6ID 5DVNA 4ELMF 2NY2C 5DDHA 5F7DA 4IKNA 2R69L 2NY5L 3G6JF 3SOBL 5IBLD 5F6IB 5D71H 4JREC 8FABB 3P2BA 3TBTA 5LGJA 4KZDH 1RUPH 1KTKE 3RX8A 2B9AA 5SWSB 5E08L 2OTPA 4W68A 4OKVA 1X4YA 3CK0H 3KJ4B 3P3YA 4KVNH 4YDLB 4QTHB 4BZYA 4RMSA 1WT5A 2ZX9A 4Z7UF 3RFZB 4G9FD 5B38B 1GS8A 5HDBE 1VAHA 3CH8A 1MHHA 2JXMB 5ESQA 3RTQA 3DHUA 3QNFA 5IHBA 2CSPA 1DJSA 3GSNH 2O5NA 1MCHA 5MHSE 5TE7H 4FD0A 3S37H 4RA0C 1U6AL 3EYUH 4WCYH 3S3BB 2H6PB 3IETB 4X5QA 3UMNA 2BSED 4JFYB 1QNZH 3K91A 3OQ3B 5KYWA 3QIUB 3QJOA 5AOKA 2ZOOA 2YAQA 1I3GH 1ZHLB 2CJSA 4X99B 2GK0A 1MCWW 2A83B 4N28A 4DK3A 1U58A 1PLGH 3BLBA 1H15B 4K15A 4WEEA 3V4UL 1OALA 2EE3A 1JRHI 4ODVL 4G7QB 1USZA 1LD9B 5SX4H 4PRPD 1DVTA 4Y5XC 1AFVL 1QRNE 3LZFL 2VH5L 2GJ6B 4HCRA 4LCYB 3RWDA 5ADPH 3FB8B 4GXUM 4IM8A 3TBWB 2GTZA 3MV7B 3U0TB 1RU9L 4RAVB 1UXMA 4GUOA 1OTSD 1UA3A 3FQ1A 3OF6D 2BSTB 2H0EA 3KPOB 1NAMH 2X4PA 2A4EA 5IKCB 2VR9A 2LU7A 3SZKC 1F02I 1IC5L 3LRSA 5CFHA 1OP4A 3S36H 4N6RA 1IGJB 2RTTA 5CP7B 3V79C 4DEPB 3T4AB 4E42A 4GMSH 1KB5B 1UB6A 1LE5B 4NC2B 3RY4A 2R0KH 1EK3A 1KLUB 4X8CA 1PJ9A 2XTJC 3MV9E 5SV3A 4P3CL 1MXDA 4LIQE 5GS0H 3REWA 2ENYA 2DQMA 5D1QE 2CNYA 1JHTB 3WSQH 3ZE2F 4O51A 4L3FA 4OTXH 5FO9A 1WIPA 3V4VA 2O1AA 2BMKB 3C60B 1ZDQA 1E60A 1ZC1A 3K81A 3V6OC 4R6UA 5F1OB 2KZKA 3T8VA 3VNZA 1PZBA 4E9SA 2B63A 1R4XA 1VADB 2AI0L 2X7LA 1LVEA 2ZCLL 4MJ6A 4FFVD 1B0IA 3ARXA 4R4ND 2Q7AA 4UBDC 2V17H 4HJGB 5DK0B 4HBQA 4M7LL 1YEWA 2HFEA 4Z3TA 5JOEA 2CHWA 5AFAA 4FNUA 2W9LA 2NNXA 1RUQL 4XMVA 1OGAA 1NBVH 3KWXA 3IE9A 2MPVA 1XTLA 4GG6B 1TZIA 3HB3C 2VMJA 3HZKA 4AYFA 4J6RH 2FBJH 3ZTCC 3CSTA 4ZMYA 4HIJB 3C12A 3M1OA 3LIZL 1AY1H 4AW7A 4WUUA 5T33L 5EF1A 3VMPA 3U36A 3QHTC 3UX9B 4NERA 4DGVH 5DK2A 4ZZKA 1B0WA 4E5XG 3ULVH 5AB9A 4Y5YC 2E7CA 1RK7A 3DHPA 3VD7A 4A7GA 3TU6A 4HUWB 3SO5A 3ULVF 5C0DA 2VLKE 3D2UD 3ESMA 3WTWA 1XF2B 5FA3B 1MCJA 3HBGA 4G8IA 3U1SL 3X1EA 1J0KA 3OM3B 5DJ8B 4OT1H 1EAQA 1TWAA 1GC1L 5DRZA 1OP5H 5IHWA 2NY4C 4FC3E 3V0JA 2HFGH 3BSZL 2AEPL 3CPLA 3DVGB 5EIQA 5E4AA 2GJPA 3L95B 3QI9A 1JTTA 5HDBF 1NOFA 1U8PB 5FYJE 3VFMB 2YWYA 3EOAB 4HC1H 5E1AA 4CC4C 2WZ0A 3G6JA 1LNUB 1MH5A 1RSFA 5AZEH 1CBJA 3TNNB 1MF2L 5EOCL 4WQOA 2FJGA 3MCYA 25C8H 3SHSA 5IQNA 4GSQA 2ZYIA 3B5TA 3C75A 3P3TA 3FU3A 3HCVA 3OAZH 2UYLB 3BT2H 3POHA 3BAXA 7PCYA 5IHHA 4R4FL 5A43C 4Z7UA 3SGKC 2WLIA 3ZHFA 3UTOA 4H8QA 4YPJA 1ZS8B 4O2EA 5FKPB 3LEXA 4M3JA 4IKIA 4MRBA 4E9QA 1QSEE 3K4ZA 1AMYA 4LARL 3NTCL 5J12C 1FVCB 1S7UA 3VWKB 3VXRB 4Z7WB 3MRCA 5C0FA 4YBLC 3LB6D 3VXSA 4M8VA 4BFNA 2PTVA 2APFA 3BMWA 2ZAHA 3SYAA 2VN4A 4GI9A 3GJEA 3HG4A 4UU9B 1E4XL 4YEFA 4KLNA 4JVPA 4LLUB 3LN5A 4QGTA 3WNJA 2Z31C 3LH2H 5EHFA 4K3DL 4GFTB 4U1SB 3SB3A 4X6CB 3VM5A 1PSKL 1UYWH 4MMZC 1XF5B 3TIEA 4OZHE 5AB1A 4U1NB 4GRLB 1LK2A 2O30A 2WLKA 4WHCA 5DWPA 4RNRA 2X05A 4IIQA 1HQ4B 4G11A 3WI9A 4I85A 4WNJA 2VPXA 1FNEA 6FABH 5AVYB 1MFCL 4MDJA 4Q2ZA 3RA7H 3UROR 4N8CL 2K9UA 2E7LC 2YPLE 1K3ZA 3CIQA 4QLRA 3RWHA 3ZRCC 4LDCA 3B3IA 4YUEH 5D1XC 1OLLA 4FQXB 4OB5H 2IAMA 3Q43A 4L1SA 4O2CA 1CWVA 1LEKB 3BP7B 3QQ9C 2A6DA 3PLXB 4ISVB 4U1GC 3AZUA 3RPBA 3CIAA 5KVMC 4YHIB 3MJ6A 3ZYOA 2TRYA 3VG9B 4JO3H 4B7IA 2CIIA 3QUYB 1YY9C 3GTGA 4PBVC 2VWEC 4JFFD 4K94H 3RY6C 1BXXA 1ZT4A 1ZXQA 3LYRA 1IT9L 3DV6B 3WXWH 2V4LA 3PV7A 2J8UA 3LN4B 4IRSC 1O6VA 2WIIB 3P9LA 3TA4D 3T3MB 5FA4A 3K2MC 3MV8D 4KXZI 1QBLL 3ET9F 3GSUA 1UZ6E 3DROA 4PJ5E 5JYMA 3T2NL 3KXFB 3O45B 3QDJB 3RL2B 5JPNA 5E1IA 3TO2B 4LFHD 1JGEB 1UJTA 3UBXA 3A67L 2I60L 4OLUL 2B39A 2C9UA 3ENEA 3L4WA 1MRFH 4G6KH 2VQ4A 1WBYA 1PJWA 2IJ0C 3O3BB 4NQCE 2OMVB 4X7TB 4XCCL 2YBRA 2PWGA 4QTIL 2AV7B 3BT0A 4ABVA 4NHCL 1M9WA 1MJJB 2OP4H 3L17A 2IWEA 3DMMA 4R96B 1UCBL 4BV1A 5TDPA 1NC2A 5D5ME 2FCBA 4OKDA 4P07A 4X4KA 2BIMA 1VEOA 1Y07A 3N91A 4KX7A 2Y1ZA 2DF3A 4ZTEA 5HHXH 3APNA 2LW3A 4JRXD 1FN4B 1NDGB 3RFZC 3TBYA 3LPPA 3ASNB 3JWDC 1NEZB 1U4FA 4XGZB 1KT2A 3P54A 1KTDA 3O0RL 4RMUA 5GGSB 2K1MA 5JXED 1IBGH 3ASWA 4D2NA 1DQLL 4TTGA 4HW6A 4PJXE 1AGBA 4G71B 4PYHA 2CLRA 3STZA 1T6BX 3QIUC 3LV3B 4W9JC 4HEPG 3MLUL 2FD6H 1O7DE 1NH6A 2J6EL 3E9UA 3GUFA 3KGTA 3NIDE 4UZGA 4BFRA 1RQ5A 3NFSH 5LO7A 2TSBA 4ZODA 5KSUB 4A39A 1N19A 1FP5A 3LSOB 5E00B 4AJ0A 1ZTXL 4B9GA 2WYIA 2WBWB 2YMOA 2WVTA 4R5TA 2Y23A 4QO1A 3SQOL 5DJYA 4BH8A 3GBLA 2W9DH 3Q48A 4M1GL 5B8CB 4K2UL 2HJLB 2ATKA 1MHPL 5PCYA 5C7XL 5EDSA 3W56A 1CLOL 4BYHA 4LF3A 4WU7B 2GITB 3OSVA 4OZFB 4OZHF 4W6YB 3NK3A 4M7ZB 5I2IA 3T4AC 4XI5C 3RIFF 3NJVA 1A6TA 1YEHH 2YQGA 2WYZA 3EADA 5C08E 3VVVA 4RETB 4RMTA 2WN2A 1S8DB 2VDNB 4NO0D 3HEIB 5HVHC 4IBZA 2AXGB 2VXSL 1BOYA 4QYOA 3KPSD 5HHPA 1NMAL 1PZ5A 3UTSD 2XI9A 4NUPA 5IB3B 3ZGHA 1J8HD 3RHWK 4FMFA 2PPDA 3C60C 3S2AA 3W2DL 4JGUA 3BUYB 4OCSL 4PS4H 4FJ6A 1N70A 1QRNB 2NQDA 3SDXB 1F97A 1D7BA 4JFUA 3TX4A 3AADB 1YUHA 2YOCA 3MV9A 4HJTA 4F2MB 2OXHB 4KC3B 3FYIB 3BIKB 2Y5EA 4Y2DB 3A4FA 5FOJA 3CLEL 3UBHA 5JHLL 3L5XH 1S7SB 3DTXA 3WDHA 4FTVB 4FP8H 1WAEA 3VWJD 2J2ZB 3DOSA 3KJ6H 3TM6A 4CN4A 2C7FA 4F93B 4PJFE 5C0BB 4EQ3A 3MODL 4ATTA 4LLYA 4F91B 5ID1A 4G70B 4FJYA 3G08A 3LY6A 1N5AB 1S7RB 1VENA 3ARFD 2CO2A 2PXYC 3QPKA 1E28B 3F58H 5DHVA 4TUKL 2BC4A 1T7XA 3TA3D 4F7EB 2X88A 1P6FA 3DPBB 5HY9B 3BKCH 3II3A 1R3LA 3L3HB 3OKNA 4BFJA 2XKSA 5CP3A 4DCQB 2AABL 1UASA 4X6DB 2CDGA 4PRNA 4P2RB 2AJZB 4RZCB 2VC2B 3HI1B 5D5MF 1HHJA 2YPVA 2L04A 3LNHA 4X50A 2X4SA 5KVEH 2XWJA 4ONGL 4QRQA 5AZ2H 1QEWB 1F11A 2EAEA 3W39A 1YN6A 3ZO0A 1JF1A 3IDNA 4UV7H 2JI3A 3MRLB 2VLKA 3F8UB 1U8JA 1MDTA 1WP6A 2NTFB 2FATL 1HC1A 4KJWC 2QQLL 2R2HB 3NZHL 5AVTB 4XBGB 4R8WL 3QG6B 4R2GD 4BHUI 3TWCH 2H2PD 3WY3A 3V0WH 3SPVA 5I73B 3NESA 4PJHF 1CF8L 2WUCH 2D7TH 2E27H 3WJJA 2A6HD 2W0LA 1XIWB 5DWUL 1QG3A 1HH6A 4KDTA 3N85H 4ZX4A 3NIDF 3TWYA 3HE6B 3L9EA 1JPTH 1XGQB 3RWCA 3IBEA 1HTYA 3ZZQA 1BYNA 4B5EA 3UAJA 4F9PC 4LKXB 1VPOH 2ZNXA 4YSDA 2FWLB 2P5WB 1CICD 2BNUA 3RLSA 4P06A 4UOZA 3P2DA 4RWHA 2OMNA 1A47A 1JF6A 3VWKC 3ZDWA 4TQPA 3L3GA 1V5JA 4UT6L 4PVBA 2X1XR 3KPPB 1NIBA 5D9SA 3KLSA 3VM7A 1NCDH 4CS0A 3OB8A 4LSVH 4NRYA 4EN3D 4FXKB 1FI8C 1ZVSA 4IGBB 4HLEA 1LP9E 4LCVA 4WHTB 3UIYA 2IBZX 2O4EA 4QTFA 4KU1A 2XQYG 3M7OA 5K5YA 1UURA 4GRLC 1EANA 5DHEA 4FQJL 1OF2B 2BSRA 5EC2A 4ZFZB 2XQ0A 1KIPA 1ROCA 3GSNB 3GXFA 3KLKA 4XAWH 2HT3C 2C26A 4PREA 3OAYH 5L4MA 3NP4A 4KKAC 5KS9A 3K0YA 4K3JL 3OKMB 4MYWB 3V7AE 3QRBA 4FQXC 5DEFA 1G6RB 1ZHKA 3F64A 2WO3B 4KDVA 4HMCA 2GVYA 3U82B 3VO0A 4HV8A 1XGTA 2ZOWA 2B2XH 3QCUH 1T3FB 1ZVNA 4KMLB 2F54D 1XDTT 3UFIA 2NW2B 3IB4A 4H0IA 4K5MA 4OFKA 5A2FA 3KCWA 1N64H 1G8JA 4YAQB 1XF1A 2R39A 1PYUB 3O6FA 3PWUA 1Q38A 5ALCH 3VG9C 3WJLC 2AZUA 3QUYC 1E4WL 3H2PA 3O4OB 1IBFA 4CJ0A 2R8SH 1KPVA 2IPTH 4JHUA 1GA2A 4HG4J 1S5HB 2RFXA 5B39A 4FLSA 4ABUA 2QADB 4AV4A 2B7DT 3QULA 3K6SA 3E38A 3D18B 3WEOA 2ZYSA 3WFBH 3BD3A 5INDB 4RRPG 3ZR5A 1NAMB 1FO0H 3MLWH 4W70A 4WK0B 5F7LB 5CN3A 5DXWA 3L4YA 2OKMA 4J3OD 4M3KB 1S7QA 4JN2B 4PHZA 4XH2B 2X12A 4YSRA 4ZXBD 4LVOB 4YHLL 3ZKXB 4POZC 4OCYL 1UA6H 5FECB 5LAXB 2A73B 1F6AA 2FB4H 3DKHA 3E7JA 1T21B 5HYSA 1IKFH 4J1UB 1T2JA 2EDBA 3OXRB 3MJ7A 3RIKA 4FG6D 3DUSB 3GMNA 1FFTB 5D72L 3IGAA 1EZSA 3ZYZA 2GT9A 4BFIB 4JS7A 2EYRB 1OA7A 3BE1L 1E9PB 3IJYB 1P4LB 3H56A 4GLRI 5FGCE 5JHMA 5L2JB 1A6AA 1YMHB 5EOTA 1NWPA 2QSCH 5IIEA 4XNXH 5A2JH 3BJ91 2X4TB 5KVEE 4RGND 3NEEA 5HJGA 3HHSB 4PJ5B 3A22A 4FYQA 4P99A 1XB8A 4ERSL 3E9TA 4D8PA 2HTKC 3VW3H 2F58L 4JN1H 1EAPA 5DI8A 4LLDA 4K5OA 3KEDA 5EV7A 3M1BB 3NQKA 4KJYB 2EDMA 4AUJA 3P11L 1U8LA 1GZHC 3JZYA 3WKMH 4WO4B 2WY3B 1DANU 5DS1A 4NQCB 2X4NA 1ZEAH 3EXLA 5IQMA 2IQAB 1X7QA 4DNLA 2IGFH 2XY1A 1AXIB 4PJHA 3U30C 4P5KA 3PL6C 5D2NB 5B8CC 1EVUA 1IEAA 2WXQA 2H2SD 5D96B 3O6LH 5ICXB 1UQSA 4ZW8A 2OZ4H 3G5XA 1SHMA 1SJHB 2DI8A 2YEZB 3PWNB 3JWOH 3CDYA 5E7BA 2JCCB 1V05A 4XPBL 3W9EB 4NUGL 3UCRA 3MNZB 4M7KL 1FL3A 4M61B 1IAIL 1NICA 4PH8A 3PG2A 1TWFA 2W92A 5GSRA 4M7ZC 1NCUA 3F6IA 1Q9WA 2NR6C 2HRPH 4KZCA 2YUZA 1IM3D 4PJXB 5DC9B 4XE0A 1AGEB 3O2DL 3MNVA 4JFDD 5FO2A 4BD4A 1DJGA 5C6TL 3UTQB 2R69H 2NY5H 3SOBH 4JM2B 1LEIB 2EXTA 4P5MB 1JYNA 5G5DA 3H4HA 1MI5E 1Y1UA 5E08H 5GRVL 2FQEA 2LABA 5C08A 4G82A 1UXWB 3UG3A 3CU1A 3FCTB 4MJIA 4MLSA 4BWUA 4N3TA 3JYBA 1S7TA 3I2CL 3L1OL 5C97A 1DCEA 1O6SB 5IROD 2BW4A 4G8FA 5F44A 1URLA 1NWOA 3NCBB 5DJ0A 5DLML 1YMMA 4JRYE 1KGJA 4NO3B 3WGVB 4E5XB 1KGUA 4UT9A 5F9AC 1V55B 43CAB 2OFQA 1RIUL 3MYJA 4FXLA 3CC5B 4A2EA 2HZHA 5C0CD 2X87A 2OXGB 3D3VA 1FNAA 2EEXA 2QSTA 3FN9A 1OTUC 1XB3A 3ECBA 2Y0SA 3EDEA 1TDQA 3MAWA 3D9AH 5HGDA 2E7ZA 3Q3GA 1A9BA 2JA6A 3O8XB 4L3ED 4BZ1A 1OF0A 4GRWF 3V4UH 3DYOA 3HFML 2WK2A 4NYLA 1DVFD 1CDBA 1AFVH 2XFGB 2D4FA 3LZFH 3AXIA 1HNYA 1KCVL 1DLFL 1RU9H 3ATEA 1DBJL 2XWBB 1CL7L 1ZXKA 3NSFA 2AJVL 4HAGA 3ARQA 1TUPA 3ULUC 1RPKA 3RZCC 5HDQL 1KWKA 3LKOA 1IC5H 4M4RA 3RWFA 5BOJA 3IFNL 3W0WB 2AK1L 4AQAB 2VLMD 5KBPA 3ZT6A 4MZRA 4WW2F 4I77L 2XZCL 5JIKA 2VXQA 4PJFB 1D2OA 5IBTH 1ETB1 3DO7A 1EDHA 4B3EA 4AQ1C 3FO9B 4MJ4A 1MVFA 5C07E 5C8JB 5DO2C 1H8OA 3BPLC 3QIBB 4G9DA 5C9JA 2WAQA 1FPTL 1FG2B 2BVPA 2P9RA 3D7PA 3EJZD 1TCMA 4LSSL 3QUXD 3H9HB 1ASOA 3LTVA 2MQ3A 2AI0H 2ZCLH 1WZKA 3PUCA 3KHOA 4Y9BA 4M7LH 2NY0B 2D3JA 4DQOL 1U8IA 2O5YL 3QDMD 5F0LB 1RUQH 3NSJA 3D30A 4K9EC 3LKPA 5KANI 1A3LL 3HE7D 4N8UA 2J1WA 1K5NB 1JJUA 3B6SB 3CZFA 4G8AC 3LIZH 4YNYB 2EDTA 3OZ9L 5HVFB 1IAKA 5DJDA 1EGJA 4FXKC 4HK0A 4IGBC 1IQDA 1ZCRA 1TVBB 2O5ZL 4OJCA 3CSYB 3MJ9L 3D85A 4NKMB 3IKKA 1TJHL 1KBGL 3K4AA 3RBSA 3S5LB 1YJDL 2PICA 2P5EE 2MHAA 3QPQD 1P1ZB 1I85C 2MIZA 2X41A 1P5VA 1E4XI 4CW1A 1CGUA 4IRJC 3UGUA 3N9GL 3WD5L 1MW3A 2AJUL 1GC1H 3DX2A 3ZTJG 1E3FA 2PP8A 1EAOA 3T1WA 3GRWL 3BSZH 3DX4A 4HGKC 2AEPH 4Y7OC 4NHUB 5BO1L 3BAWA 5T3ZL 2ZKYA 1UXLA 1EEYB 5K9QI 4G1EB 1K8IA 1RZPA 3L3JB 3V5DB 4LLQA 5D7IB 1E42A 1WH0A 2BVUA 4NRXB 5E4OA 5AOJA 2ICEC 5B1JA 1HYRC 3HG1E 4AEFA 5AD0A 3OGOE 1N6QL 4JFOA 1FFOB 3W9DB 4HLJA 1GSMA 1FZJA 4LDEB 3P4MA 2OMBA 3O4OC 1IFGA 4JDZA 4AGOA 1MF2H 2ENJA 4ZFFA 5D7KE 3DECA 4OIBA 1LP9B 3MREA 1UKQA 1WDAA 2BM3A 2QADC 4I0KA 4KFZC 1QD0A 1T5KA 3QNYB 2QLVB 3ISWA 4ZNCD 4Y19E 2CO6B 3PGCA 4R4FH 1ULVA 1S5IL 4QNPE 2L3BA 5LN4A 5KAQG 3L3OA 4M8UA 4EZLA 3NIFB 1NGXA 2YRLA 3H0GA 1RZQA 3WE6A 1CR9H 4HCRH 5JOFA 4LARH 3IRPX 3NTCH 4G9FE 4F8LA 2O26U 3ZR6A 3T6QC 4LVOC 3GS4A 3ZKXC 3HIZA 3MR9B 4LMQI 3B5GA 3E6HB 4G7VH 5GS0C 3IR5A 4H8HA 4ZUTA 1N2RB 4ZPVB 1G7LA 1XH1A 5C7ZA 4L4TE 1SLWA 5AALA 3FSVA 2H47C 4Y4FB 1PSKH 4GG8A 4NQVB 5CJBA 3CZEA 3LRHA 3T0VA 4GFXA 1H9DA 2DQIH 4HJSA 5DSCA 5DZPA 4FHKA 2VXQL 1ORQA 3ESOA 5ACMA 4JUSA 2W07B 1TSHA 4JVUA 1XZ0B 1BPVA 4ZAKA 4POYA 1RJLB 1MFCH 1G9NH 4N8CH 2Y2TA 4AGQA 4L8SB 4Q89A 4TNVK 3P4OA 1SDAB 1A64A 3BKJH 1G43A 3REVA 2WXLA 1U8OA 3TH3T 4PJCE 5HYJA 3VFTB 3PWJA 3MRNB 4WW2A 1NLDL 4WO4C 3L2NA 1HKLH 5F72S 3N0PB 3QEQD 3T3PB 3VDAA 4Z18A 1BV8A 3ULVC 2OPCA 1R3HA 1I3QA 1MPAL 5TF1L 5D2NC 5K39A 4XB3A 5EU3A 1JGVL 3LOWA 1RJZB 5A6LA 3B2UC 5D96C 1IT9H 5DGQA 4I4WB 1S3SA 4UDTB 2IBZY 5ESVB 5BW7A 2LFGA 2WXHA 2AJ3B 1QBLH 3HNSL 4L8CB 1SVBA 4OD3L 3B9EA 5EBMB 5LBGA 3T2NH 4W9CC 5T1KA 1NGYB 3R1GL 2X28A 4P2OC 4AONB 4Q9BA 5BZDA 2ZXBA 4HZ1A 4MVBD 5TFSL 2I60H 5EC1B 5IB1A 5AVWB 1AZZC 3MUGA 4Z7OF 5IMKB 3FT3A 2MCMA 2ATPA 2I24N 3C6LA 1ETZA 1BBJB 2XA3A 4JM2C 4OF7A 4XCCH 2OAAA 1CLYL 2PYFA 4QTIH 3MMEA 1UT1A 5GJSL 5E5UB 4NHCH 4F3FB 2I07B 4KTDL 5AOMA 1I1FA 3F65A 1UCBH 1SUHA 4NNYA 1CYWA 4CMMB 4YHPB 4MKMA 5LJYH 4NPYA 4PTTB 4A2DA 4HJJL 5GGVY 3FB6B 2OBGA 1OB1B 4NNXB 3FCGA 3U6RB 4JO4L 2OMYA 3O0RH 3N41F 4OV6F 1CYXA 4N1CA 1WGOA 3FOMB 1U9KA 2GJRA 4K23H 1N59A 1J0YA 1DQLH 3QUZB 2V33A 4ANUA 5KEZA 4GXVL 2CDFA 4QRPD 3QWRD 4B27A 3VD1A 3SQBB 4J3BA 5EO1A 3MLUH 2Z91A 2FECI 2J6EH 4PJ8D 4AC2A 2PWFA 3PDGA 4FULA 1HCYA 2OL3A 1A3RL 1FDLL 3T0AA 3IEAA 4UMGA 4OFIA 3BP4A 1OAUL 3QUKB 1P4BL 1XH0A 4HKBB 3SQOH 5DFAA 1Z6JT 4M1GH 1OP3K 1CURA 2J43A 5IG7B 4K2UH 4WTQA 2JJSA 4LCWA 1MHPH 3EO1B 5C7XH 2XNAB 5EUOF 2YC1A 5E2JA 1CLOH 2X70A 2BZCA 1Y18A 4P8QA 1AZBA 5J4MA 3I3BA 4Z7NB 4JRYB 3UBXG 3UTTA 3DOHA 4GO6B 5AAWC 5I76A 1E2VA 1FFNB 2NDGA 4Y1SA 5D1ZD 3OKDA 4GAYA 3C5ZD 4F80A 3BP6B 3WLWD 1WCBA 2OX5A 5C0JB 4M1CD 2BO0A 4BSJA 4IKKA 1IAOA 1C12A 2VXSH 1XCQB 1YHPA 2VLRA 2W80C 4JM4L 4P4KD 4YMPA 3IFOA 3BUPA 3QIBC 4ZTOH 4HIEA 4K94C 2GSMB 1MCBA 4JE4B 4UNIA 5ACZA 2ZAIA 2IAAC 5DS2A 1OWWA 5ABAA 3W2DH 4PJCF 1UCTA 4OCSH 3O4LA 1KIRA 3QO1B 2O93L 2VSKB 1TCRA 4KY1L 5HI4C 1IFHL 3BYTA 1M71A 2EDYA 1I1RA 5DJAA 1D9KA 2NY0C 3B3BA 3CFBA 4HMEA 3O3EA 4XVSL 3CLEH 1FO0B 4GUPA 1DQJB 5JO5A 3L7FB 3SDCA 3GBEA 3V0VB 1ERNA 5H35B 2CR3A 5I75B 1AXTH 1UATA 3E1ZA 2BP3A 3OPZL 2F74A 3N1QC 4L8BA 4P2AA 1TZHA 3IWUA 3NSXA 2CLVB 2OW7A 3CZGA 4LAQL 4KXBA 3MODH 3PXHA 4UI2A 3GLDA 3P77B 3V6ZA 4BRJA 3ARGA 4HF5L 1HOCA 2EE6A 4EBQH 5J7CC 1Y6KR 4OV5B 3GSQB 3FOLA 1BDYA 4TUKH 3RAJL 3GBDA 1HSBA 4MGXA 4JG1H 1S7WA 1FNFA 2GIMA 5EO9B 1BLNB 5E2VL 1MJ7H 3ZUNC 2AABH 3H4FA 1EWHA 1OW0C 5F0MB 1G7QB 1K8DB 2QPEB 1G7JA 4OM0L 2NYYC 5IOKA 3LKRB 4NAJA 3P2TA 3VXUA 2QR0A 4H1LA 2HFFB 2FSEB 2ICWA 2Z8SA 3LS4L 3B7YA 4HJUA 3BHBB 4G8GD 4ZI8A 3X2MA 4DKEL 2WGNB 1M9SA 1JYXA 2YS4A 1MW1A 3FB7B 2FATH 2F7OA 3SKMB 5I1DB 2QQLH 3NZHH 2EKJA 1BFVH 1UM5L 3AU0A 3JWNH 4WJ5B 1BZ9B 1R46A 2H6UA 4R8WH 4UUJA 3QNXB 1BF8A 2G5DA 4E36A 1L6ZA 2E7DA 2WP3O 3RWGA 1U2YA 1CF8H 1F4XL 5DTFA 2WTRB 4BFBD 3RPIB 2JLLA 3SKUD 4QKTA 4GAJL 2ADJB 3OR6B 4GW5B 5DWUH 2EIJB 4FQHA 3ZBMA 3FFCE 5KSAB 5L4FA 2NUPA 2OL3L 2P5EB 2E2IA 3I02B 3OHXB 1SOKA 3ZKSD 4OBSA 3TN0A 4KJQC 2ESVB 2JQZA 4RMWA 3Q05A 2FUTA 1CFTB 1R3IL 3NFNB 4MZ3A 4F33A 2EC9T 3EYSL 4U1KA 2L7JA 3AVEA 5E6IA 4JRXE 4GJTB 5FFOA 1C9SA 1HHHA 3TBVA 4M6AA 1ONQB 1QP1A 2H41A 4U3SB 1EFXB 2VKXA 3L4UA 1TYRA 3BKYL 4A04A 3HG1B 4X6BB 4Q9CA 1ZTXE 2JIPA 4ZUUB 4PJ9B 2V2XA 2YSTA 2E7HA 3A6CL 3GI8L 3WS6A 2W5PA 4E0RB 4GYBA 5AWNL 1HEHC 2C3GA 1L3WA 4HFWB 3T2OA 4JDVA 5JZ7D 3TGXA 3QXAB 3SCMB 2H9GA 2EIZA 2OTWB 1JF5A 3WEAA 4Y19B 1J0ZA 4LCCA 4WDIB 2AQ3A 4ZQKA 2HG5B 1LO3L 2DWDA 5EUOA 4KKZA 5CCGE 1TTGA 1FSKB 3NPSB 4L8SC 3O41B 4V2CB 1CD8A 5DMIL 3SULA 1LEGA 4NENA 1FHNA 1RZIB 3OD3A 2BNQB 4X9FA 4X4ME 3DVIA 2ZSWB 3WTSA 3K71B 4U1LA 4KUCD 3X1GA 3H3PL 2E47A 3RWIB 1YLEA 4MZ2A 5IQ9A 4PRPA 1S9YB 4PG2C 2K45A 1WD8A 2BVYA 4G8EB 4MD4B 1E4WH 5GGTA 1P7QD 1KYDA 5ICYB 2QV2A 3APCA 2JJVA 4UMSA 4PRDB 1F18A 3IAGC 1M42A 4L4TB 5IF0B 5B3JE 2Z35B 4NUMA 2VZ1A 1RK0B 1HJBC 3KPSE 1TMQA 3UERA 3R06A 3ZDZF 4Y9EA 1OTTC 1J8HE 2YSSA 2JIQA 2YEVB 3BW9A 3FQTA 2B5IB 4HSAC 1K2DA 4Y1AA 5DHVH 5B7EA 4PJBA 5GZND 3OC5A 2W65B 4QPEA 2XXGA 3EAKA 4HISA 4TV3A 5JIQA 1L3NA 1R19A 2B20A 4JM0A 1TYJA 4HDIB 4F15B 1F3JB 2EXWD 3RGVD 3AXLA 3GTVA 4KI1A 1LWJA 4H88H 1MFBH 1LGVA 4OCYH 3L1GA 4AENA 2YPVH 1SBSH 3MLTB 4G42B 4GIPD 3B7TA 1CVRA 3LQZA 4KJPC 5I1LB 4PJAF 2J56A 4NQXA 5D72H 3FKUS 1ZOXA 4RX4A 1JPGB 3MLRL 4Z3GA 4BJLA 1OSYA 3EFOA 1GOGA 3GTQA 2AJSH 2SODB 3D07A 5ECJE 2G3NA 3FFDB 2EC8A 2UUDK 5KYXA 2J5WA 2BS8A 1YPZE 1TO4A 3ARDA 3TBBA 4HT1L 5DVOA 2VMEA 4ZFQA 3WS3B 2FO4B 3QUZC 2X4OA 2RR3A 4LESA 3DX8A 4LLWA 4ERSH 3WO4B 1R3JA 4YFEA 2V9TA 4Z95L 1A22B 1I8IB 2F58H 3EBGA 4AYEC 1QQDB 5K59E 2G6GA 3GIVB 3FO1A 3MGTA 1GYVA 1DBML 3EFDL 1GRWA 3JWNE 3MX0B 3P11H 1M1XB 3HN3A 4Y4KD 1IC4H 3FCSB 4N22A 2ADGA 1TWHA 3B7RL 3JV6A 1ACYL 4D0CB 1KDJA 3D2UA 3GMMA 3VTAA 4MBRA 1NL0L 5HPMA 5AKTA 5B39G 2I26N 1QLRB 4PCTA 2FIKA 4RDQF 3EYQC 2VDKL 3H7LA 2AMGA 4FQPA 2YXMA 5DDHB 1G9EA 3EKCA 5FUOL 1YNTF 4IOSD 4WWID 2AAVA 3TBTB 1BFOA 2YIHA 2F53A 4OLZL 4XPBH 1ML0A 4NUGH 1JZHA 1U3JA 3IPEA 2YOAA 3F7RA 3IJSA 1CD1B 4M7KH 1IAIH 4OKVB 2AZAA 1JNLH 4CU8A 4EI5C 2Z8VC 5ESQB 1MHHB 3RTQB 3TYFA 3X11A 1LJMA 1CL7I 3S4SA 5CN2A 5C6TH 1P69B 2WZ5A 2DMKA 2GUOA 4U6XA 1SRDA 5HYSG 3N42B 1I8LC 4O00A 4FGMA 3NSDA 3GJFH 1EXHA 2YXFA 4RQQA 4OGAC 4B96A 1H0DB 4N68A 5B4MD 1ZA3A 1Y7VA 3R19A 5I5RA 4HOWA 3K3QA 3SKOA 1LE9B 2Y24A 3I2CH 1EBPA 3L1OH 5SWZB 1WO2A 2EACA 4I1PA 2AK4E 1U58B 2BY3A 2UWEF 5GGTL 5DLMH 2CHXA 1DANT 5D93B 1DJZA 1K4CB 1TLMA 3AQXA 4YDJA 5I75C 4YBQD 5B3JF 5J1AB 1RIUH 3NJXA 1AGDA 1WFMA 4MQ7A 2AKRB 1ZDSA 2R23A 1E5BA 4HUXA 5TQ0L 1RY7B 2WSDA 3GSWA 3IFLL 3C2AH 5L2KD 2I9LA 3S5ZA 4AOKB 1I9JL 3ZIYA 4GKNA 4H4NA 2X4PB 1BVKA 4XNBA 3TEZA 2FR4A 1CDJA 3DX7A 4UM8A 3IR7A 3LRSB 5E9NA 4Q58C 1E43A 1D3CA 1BREA 4P9HL 3MRIA 4X0NA 2Z7YA 4MZIA 3DRQA 3LXUX 5E4EC 4E42B 4C4KO 1HL8A 1UB6B 1ODAA 2F54E 1AHKA 1ASPA 3QWOB 4M02A 3ZSTA 4PY8I 1JPSL 5I6MA 1WJ3A 4WHYH 1MHCA 3W81A 2YD5A 4WSGA 3FXIC 1KCVH 1DLFH 4JPIA 5GLYA 3EO0A 4YZFE 1DBJH 3REWB 1P1VA 2Q5BA 5HHOD 3WTYA 4Z8FL 4JQVA 3UO1L 3CXHJ 4ZOBA 1SMOA 3VYNA 5HDQH 1LO5A 1ZV9A 3WIFA 4AJYV 3KYOA 3IFNH 3QJHA 3MXWL 2AK1H 4AZ8B 4JFEA 2X7LB 4MJ6B 4I77H 2HFEB 2XZCH 1HHKA 3ME0A 3MLYL 3V0IA 4JFFA 5D55A 2OSLA 1OGAB 3BH9A 2EE0A 1TZIB 3D0LA 4GEJA 4AYFB 1EZVX 1J87A 2VXUL 4PJAA 4LLVA 5F8RC 5K59F 1FPTH 1JK9A 2KDYA 2QFRA 3S0PA 3MV8A 4LSSH 4YDVB 2BP0B 5KSAC 3OHXC 4IOFD 3JWOC 5D7JC 3U36B 5FWQA 1RULL 4KTYA 5DK2B 1XBRA 1SMAA 2ZD0A 2OYKA 1PY9A 3LNGA 2O5YH 1H6TA 1IGTA 4K3GA 2VLJE 1H3UA 1A3LH 1D5ZB 2QGCA 5GGUB 1AE6L 3LZOA 1GZPB 4GBXD 4RGNE 1T1WB 2NY5C 4JJHA 5L6YL 3DSNA 1WFNA 1OAYL 3ZE0E 3RKDD 2O5ZH 4PBDA 3MJ9H 5A3IC 4HBCH 1Q16A 3TF4A 1TJHH 1KBGH 1JE6A 4LPUA 1C7SA 3HJEA 4BSWB 3PQYD 1I7UB 3K1KC 3DDFA 1BM3L 3MOBL 4M00A 5IBLC 3AG1B 4A38A 3QC5X 3FRPA 3NSCA 5E1AB 2BFGA 1OZUA 1MH5B 4EF3A 3FFCB 1JV5A 5GLXA 1YNTA 3MXVH 3N9GH 3WD5H 4WV1C 3CVHA 4IBWA 2AQ2A 3OKLB 4N5ED 1CTNA 1J9CT 2FJGB 2HSIA 4U7MA 3GRWH 1QCSA 3NPSC 4LEOA 2YGVA 2ADIA 2P8MA 2X0UA 3FL7A 4B9CA 2O6FA 2QGBA 5BO1H 2OV0A 4JO5A 5T3ZH 5DS8A 3DMRA 3EF4A 1ZANL 2VAJA 4W9EC 3AS1A 3OKEB 1SF3A 2WLIB 3ROLA 3I50H 1XD1A 1N6QH 4L48A 4D9RE 2QMKA 4TQEH 4UQDA 4DETA 4OJFH 4GS7B 3LEXB 3TVMD 2AAAA 3D05A 2NY7L 2CRMA 4WI7A 4LHJB 2PO6B 4BCZA 1HXKA 5FGSA 5FEBA 3MRCB 5C0FB 3PABB 1LL1A 3VXSB 4JY5L 4XOBA 1BVLA 5DZVA 1NGQL 3UAAA 1V3KA 3VXTA 1SN5A 4BZ1H 4YFDB 2IPKA 1S5IH 2VLLA 2NQ3A 2DLGA 2UWEA 4XN1A 1AD0B 1MJ8L 4UDUA 3QWZA 3V5HB 2GAZA 4ADIA 1HD5A 1IBBA 1LK2B 4F15C 2ZXDA 3K8LA 4JMXA 5E9DD 5DMYA 2A3TA 4YZFF 4UB0L 4IIQB 3IJ8A 4JQXC 5BS0D 5D7EA 2IXQB 1FNEB 2V5SA 3GM0A 4MDJB 2AV1B 3UTSA 1U0QA 4DP7X 3H7BA 4PRHA 3VMOA 1MFDL 4KH2A 3UJJL 2DN7A 4S11A 3FYEB 1R7RA 5C0CE 3GO1L 3RWHB 4QHMA 2EYTB 2CDEB 4O2CB 2A6DB 1A7OL 2GUYA 3ARBA 3D34A 5F7HA 1FVEA 2VXQH 4DF9A 1Q0XL 3AW5A 4L3EE 4J3OF 3DETD 2BXZA 4KPHL 4BK4A 2RQ8A 1AZCA 3FQUB 2APXA 3QVAA 4G80B 4HSQA 4JB9L 4ONOA 3UEZA 4FABH 2CIIB 1BIIA 5BQ7A 5L7XL 2ZUYA 3GDBA 5E4IA 4KV5F 5IV2A 2LTQB 5MERA 2FQDA 3V2AR 3JBG7 4LHUD 3EO9L 5T5FL 2J8UB 2VSDA 4HKZA 4L23A 1QPXA 3PGDA 3P9LB 5F1KC 3WN6A 3ARFA 1KV7A 1BA9A 1ZRUA 3ARUA 3G3LA 4PP1C 3GSUB 5FK9B 1NLDH 3PU7A 4ZFOL 2QT6A 2A9NL 2WP3T 2H3KA 3NJGA 3QORA 3HNTL 5JPNB 2XYBA 3TA3A 3VXOA 3N43B 1Z5HA 3HFFA 3SDYL 3UBXB 2O61A 2DQHL 2YQBA 3MKKA 5DR5L 4YXHL 1MPAH 2V5MA 5A16A 2GW5A 4H40A 1DE4B 1JGVH 4MCZB 1JBJA 3ETBJ 1SHSA 4H0HB 3U48A 1LK3H 1EGJH 4YE0A 1XGRA 4APQA 2FWOB 3DMMB 1GC1C 3HNSH 5F21B 3BO8A 1NC2B 2OK0L 1LDPL 3SYQA 1TMOA 4L2LA 3E6FA 2X6UA 4Q74A 5CD5C 3CHQA 2E75C 4CRZA 1HESA 3QAZB 5IW6A 3L3IB 5TFSH 5TPWL 3Q6FA 4RIRA 3UTZA 1N5YH 2HRGA 5E5MB 3RDTA 1B4JL 3LRLA 3RTQC 2PF6A 1KTBA 3CVHL 1UD5A 2N7AA 1CPUA 1KT2B 1L9NA 3QDME 2DLEA 4FTDA 1CLYH 1QR4A 2ZKWA 5AL8A 5GJSH 4KTDH 4M62L 2DI9A 5H4YA 3SGJC 1J86A 4EKJA 4RH4A 1M7DA 1AGBB 5C0EA 2EABA 2CLRB 4NCC1 3STZB 2ICWJ 1SY6L 4R3SA 3QFJD 1WA2X 2WC7A 2G3MA 4AV0A 1CICA 5E6SB 4PY7A 1HN1A 1JCVA 2D7OA 1HOEA 5D93C 2VR4A 1KXTA 1Z9LA 5F88A 5HJBA 1HEZA 1I3UA 4AKPA 3SOTA 1EV2E 2UX7A 2ZKHH 5D1ZI 4QO1B 5T3ZE 3IDGA 5DJYB 1JVOA 4B6ZA 3K6NA 4GXVH 1KTLA 1AP2A 4LKCA 4EN3A 2ATKB 3BZFA 1UOLA 2P8LA 3QQ3B 1MFMA 2XXFA 5D6CA 4J23A 4E9TA 3SJVD 1HI6A 3ARZA 4Y88A 2PUQT 4LF3B 3J27A 2CRYA 3P9WB 1A3RH 1FDLH 5A40E 2FHBA 3VTMA 1OAUH 5ALBL 5DD1L 1P4BH 1PLAA 1W91A 3BN9D 4JHZA 1XR8A 4OAWA 2F19L 3F83A 3B5HA 2MMXA 4AIXA 2ZG1A 4G5ZH 2XIBA 3R8BB 3BD4A 5EU6D 1PD1A 3DWTA 5HHPB 1CS6A 2AK4B 1EJ6A 1PZ5B 3M8OL 2AW2A 2KC0A 3CPUA 2DMBA 4BWWA 2VW6A 4IYKA 1UH2A 1SYSA 4JO1L 2F54A 3RTLA 2H1LM 5DHYA 2APWA 3WMSA 3WHE1 1YUHB 1HL9A 4LGSB 3MBXH 1NM4A 1MG3C 3HBPA 4YXKL 1JTOA 2F8OA 3FN3A 3V55A 2JTYA 3H0TA 1QBAA 4FCHA 1Q9OB 5D7HA 3DTXB 4YX2H 1PT0A 3E8UL 2TRHA 1AKJD 4M5YL 4GY4A 4NFCA 3QYCA 1SGKA 2GCYA 4G1MA 5EDXA 2YMXL 5ID1B 3B37A 1JV2A 3CFKB 1YYML 4XVTL 3MGAA 3DLQR 4FI7A 3HC0B 5LWYL 1TEYA 5H8DA 4XVSH 1OM3H 3WGUB 5DHVB 3ZRSA 2BC4B 4F5CA 4J6IA 4N8PA 2J12B 1H8NA 2VL4A 3MBWA 1J8KA 1EO8L 1R3LB 2VW4A 3OKNB 3OPZH 4TS6A 3EGSA 3O3UN 1JWMA 2CDGB 4LAQH 4GKZA 1W0WB 3IKCB 1HHJB 4R4BA 2C3XA 3ML8A 1H5BB 1GGYA 3O6ML 5J5EA 2DQ6A 4HF5H 4QRQB 3KPRD 3Q5OA 1MW2A 3W39B 1YN6B 4L0ZA 4QHKI 4YSPA 4UQIM 2CO7B 1BGXL 1U8JB 2HCZX 3RAJH 3DGCR 2KMWA 4DERA 4FLRA 5DA4A 3QEQE 3F00A 2IWFA 3NCYP 4HZLA 3GZPA 2PR4H 4OM0H 1VKXA 3LEVL 1BQRA 3QQ8A 3QXWA 1FYHB 4GAAA 4AL8H 4A66A 4F7CA 3HZYA 3MPCA 2Y7LA 1A0QL 1HH6B 2VSMB 2YD4A 2VLJB 3I6GB 3UIZA 4DKEH 2G4EA 2PCPB 5I66A 3RWCB 1QX1A 2CJTA 3BP5A 3G6AA 3BPOB 3ZZLA 1T4KB 3CFMA 2MOGA 3MACH 2KQNA 1UM5H 2IG2L 2Q7NA 2NNCA 4OGQC 2JKWA 5FCUL 2VJ8A 2WQRA 3CMGA 2A74A 2JJUA 4W9LC 3RB7A 2PO6C 4HGWB 4UYPA 4EZKA 3ZE0B 2W1NA 1H5NA 1F4XH 1MVUA 2FYYA 3L3GB 4HIIB 4LP4A 4GAJH 1OAQL 4O2FB 1QFWL 2QSVA 4L3CB 1XGPA 1GGBL 3VB9A 4JKNA 2OL3H 4NRYB 2VISB 3CG8A 5I19L 1DN2A 2QQKH 5CF3A 4P23A 4NNPH 4XNQB 4E41D 1T7WA 4TRPL 3GSXB 3F85A 1R3IH 1IM3A 3BQUB 1EIBA 2GC7C 2W0FA 1NKOA 1AIFA 1RMFL 1TEFA 3FQRA 4JFDA 4LSRL 4UIKL 3SDDA 3RY5A 1W0VA 4U33A 5EC2B 2CKBA 3BKYH 5AUMA 1DEDA 2XKUA 15C8L 2GJZB 2WWMD 1PQHA 5KS9B 5AW0B 3VGEA 3LQAL 3GJFB 4FQIL 3A6CH 1QLFB 2K8QA 3GI8H 4FOMA 5AWNH 4FE9A 4P2YA 5IROA 4TOYH 3VI4B 3FZUC 3HC4L 1B4RA 3GTOA 3NAAL 1OOWA 3O6FB 3SZ6A 3PWUB 2HLEB 4RV0A 1MCDA 3BI9X 1FL6A 3C5JA 4FRWA 3KWWB 3WIIL 4ZUVB 1LO3H 1KPVB 3L08A 2WCPA 4H1LG 2LTQC 2RHEA 1DCLA 2RFXB 2VUKA 4Y16B 5B39B 4NO5A 2XTJD 4UT7L 3V0EA 2Y7QB 1SMYD 2EDKA 3CHXA 3K6SB 5AKVA 2YAFA 5FM8A 3GHEL 4CKVX 4P46A 1DEEA 4ZUWB 3I9AA 3IFPA 3KYKH 4QAMB 5BZXA 5A2KH 3H3PH 2HRLA 5JPNC 2BIOA 2DQJL 4CSTA 1BAGA 1EBAA 4UBDD 2A9CA 3VWJC 2GHWB 4F92B 1N3NA 5CCHE 3N50A 4MASA 4R5XA 1NCCL 5KSBE 3QFDA 2VQTA 2IALA 2Q0ZX 4U2ZA 1N6UA 2JJTC 1QFHA 2JQAA 1F6AB 2DKSA 3DIDA 2NX5A 5F7BA 3RGHA 3MJ7B 3NP3A 1OP5K 4NX0A 3GMNB 1MCOL 3MU3A 4FL4B 4UTAA 4XBPA 3RWEA 2ZICA 3UDWA 3FS9A 1C5CL 1GHFL 2BNRA 3IGAB 1IJNA 4F24A 4FKHA 1K4DA 2GT9B 3JTSA 3QAZC 5LBSL 3VI3E 2DPKA 2Z0UA 4MBOA 4V1DD 2V8MA 1W72L 4R7NB 1XCTA 3ORJA 2NTSP 1TENA 4IHOA 2BVOA 4C55A 3JWNC 1IM9B 5F1SA 4D8PB 4IS6A 3EYVA 2AQ1A 3QUXA 3R8QA 5C1BA 1KC5H 1H6FA 4QRRA 5DI8B 3AMKA 4LLDB 5FF6B 2WM0A 1J05B 5SX5H 5KZCD 1U8LB 2XYCA 2NY4D 2Y7MA 4J4PC 3BUTA 1CE1L 2W0KA 4PBXA 4PQXA 4F8NA 3RUGF 4I3SL 1J48A 2E46A 2H2PC 3HE7A 1X7QB 1Q0YL 3LZRA 2J3SA 4P2CG 3IMWA 5H37H 2GTQA 4P5KB 2WVVB 1UEMA 1IEAB 2CLZA 4Z95H 2OJEA 5HYEA 2XCMC 5FW7A 2EEOB 1UQSB 1XO8A 2PYEE 1G0XA 1VCBC 3G5XB 3VXQA 5FO8A 5L8LB 2F6AA 4DP9X 1DBMH 4KROB 3EFDH 2MPAH 3X2KA 2EEDA 3MRDB 1BAFL 2QFPA 1FL3B 1HVXA 5E56A 1L9SA 1ACYH 4WEMB 4G8GE 3QXDB 1Q9WB 2W9EL 1JVKA 2MOQA 1NL0H 1WSST 4FEIA 1CFNA 2R7EB 4KQ4L 3VB8A 3Q8BA 4ZTPH 3MNVB 1G1YA 2VDKH 5FUOH 3TZVA 2IANE 4AEHL 4L29A 3OVUB 4BUQA 5HD8D 4HOZA 5G5DB 5IVZA 3AREA 4MMXB 2KUTA 4XMTA 3VD4A 1UOVA 1F4YH 4OI7A 3ZDYE 4MJIB 4RLDA 3ZDXE 1A14H 3ARWA 3ZVVA 4BQCA 1S7TB 3Q8CA 2EADA 2Z31D 1NCTA 3V0HA 4FG2A 4MNQD 4QRBA 1YMMB 2IPUK 5CEYA 2V5TA 3AQDA 4Q7DA 5J6HA 2YEQA 4ZUSA 2FHCA 3MYJB 1QFUL 3N3EA 2CUHA 3D3VB 2P48B 3ZQXA 1RZFL 2Y7OA 1CDHA 1E50A 2AXFB 3HJ0A 1S3RA 4UNTA 3L3KA 1JXDA 4JZJA 5EN2B 3ECBB 3TO4B 4A2HA 1G1OA 3B1UA 3Q3GB 5T1MA 1WRFA 3MA7A 1U3YA 2WBJD 2ZONA 4OF0A 4ONHA 5D1XD 4AUUA 5GGTH 1MFVA 1S7VA 3QQ9D 4MAYA 1ZA6A 2G3ZA 2BP8A 1QBML 1XL6A 3D52A 4TQHA 4KHTL 1AJ7L 3A23A 4OGXL 3V95A 4IDJL 5DC4B 2R2CA 3VXMD 1MCKA 1IILE 1RCYA 1BYOA 4DZ8B 3IFLH 3PHSA 4CNIA 5BRZD 3JUZA 1A02N 1YY9D 1H3PL 5IB2A 3CBKB 1H5BC 4GB9A 2H26A 3LKOB 5A7EA 4LXFA 1DHKA 3F6JA 4P9HH 5DUML 5AG9A 1DBKL 3VYPA 3L16A 4HQQL 3IGLA 1IBHA 5EZIL 1DQMH 2RACA 4ONFL 5AVSB 4ZXBC 1JPSH 3O3AA 2YWZA 1U36A 4NP4L 4ZG1A 1SBBA 3ECVA 5GHWL 4Z8FH 3BGFB 2VOTA 3B8SA 3MV01 4P57A 4FG6C 1U4EA 2DMHA 4XPTL 4G9DB 4PJ6A 5C9JB 2BVPB 3TFKD 4DO4A 4P04A 3QB7C 1HWHB 3S3PA 5FHAL 2HMIC 3IXAA 4FYRA 5EA0L 2CR0A 3S4SG 5SWSD 1E4KA 4KO7A 3A47A 4RGNC 3TIDA 4ENED 2YAOA 3LKPB 1KJVA 1REIA 1QPKA 1SVCP 5LG1A 5SWQA 2RIKA 2VXUH 2DQFB 4KQ3L 5DJZA 3L5WA 3IDXL 2X9YA 2HKHL 4DOHE 2ZNWA 1EQWA 1SQ2N 4XXDB 1IAKB 5DJDB 4LRNH 1RSYA 3MRQA 3GKWL 2X09A 1RULH 2CO1A 3RUGA 1WAAF 3D85B 3QO0A 4LPCA 3ROOA 2D7PA 1MWAL 4F7MA 1INEH 1BLIA 3U7AA 3BQUC 3QIUD 4ZFGL 4OD2A 4F20A 4BQ9A 1XL4A 5K9QG 4TLTA 1QDNA 1ZYRD 4HJEA 5CINL 4YIQA 3IYLW 1SXNA 3KPMB 2MHAB 4KRMB 3LX9A 1AE6H 2Y22A 5I28A 1P5VB 3PP4L 4XZUA 5AW6B 2ZPKL 4YVUA 3VD9A 1HH9A 2P24A 1I1AA 1INQA 2Z7ZA 4PGDA 4PGBB 4PB9L 3ZTEA 5L6YH 2OMUB 3NGBC 1OAYH 5F9OL 4RFNB 2GJ6D 5C0NC 2JB6B 2IEPA 3ATFA 5F8QC 3VX0A 3MV7D 4U05A 1C16A 2HJKA 3G6DL 1K8IB 1T6WA 2C1OA 4N1HB 5HGBA 4FXGA 4LL4A 4S1DC 2EE9A 3L81A 5I6XB 1BM3H 3MOBH 5AD0B 2KH2B 4JFOB 1DDTA 2X4RA 2D0HA 1WFUA 1FZJB 4JKPL 4E9RA 3NACL 4XI5D 5TD4A 4ZFFB 5MEOA 3E80A 3GQFA 3BWAA 3M46A 1X44A 1YQVL 4R0LA 1JDDA 4PVLA 3SBWA 1Q9KB 4Y16C 2J44A 3QWRA 2WYTA 4KNQA 4PV8A 1VHPA 1T0PB 1Z7JA 3ELAT 1M6UA 2X2UA 1BEYL 4DKAA 1N12A 2VN3A 2OQJA 4PP2B 4RFEB 6PCYA 4B50A 3SKJL 2R1YA 1KB5L 2A6JA 3C60D 4N8VB 5CSZB 1FNSL 2V2TA 4WU5A 2NY7H 4GA6A 3CDGA 1UD3A 2XN9A 5JOFB 2R9HD 2MNJB 3KGUA 3CVBA 3GSRB 3LZQA 2CQVA 3OR7A 3GDCA 3S98A 4BQBA 2QTVA 4JY5H 4XN4A 4DIXA 4FZEL 1NGQH 2G5RA 4LFHG 4A6YL 3GMOB 3WNNA 2JSFA 4OQ1A 3VFUB 4FL4C 4XN9A 1UZGA 4YLCA 5D1ZA 1DVFC 4XP9H 3C5ZA 2ZUTA 1CXLA 4ZMAT 3I9GH 1YCSA 3GC3A 4I48A 4DZBA 3RHWF 5DSCB 5ETUA 1ORQB 3EH2A 5EBLB 4D9QD 1NCNA 2ZOLA 5TDOB 3A21A 1IGIH 3CZJA 4UB0H 4P4KA 1YVLA 4FLQA 5E8EA 1U41A 2Y2YA 4WZ9A 1MFDH 3UJJH 3RL1A 1ZD6A 4W4NA 3GO1H 2NZ9C 5C0AA 4H8WL 5L2KE 4TL5A 4IK7A 1MAKA 1OSPL 3REVB 3SDAA 1U8OB 3GPEA 1A7OH 2QGDA 3PWJB 4RDQG 3SUJA 1Q0XH 5KSBB 3FRPG 5I8KL 5I0YA 2RALA 2NT0A 4KPHH 4NC1E 1Q9LA 2X9XA 5F1NB 3KLDA 4JB9H 4XB8A 3AT0A 4N4YB 1OAXL 5L7XH 1R3HB 2BSCA 4Y1TA 5K39B 4PJGF 2V2WA 4PSPA 4XXCC 3ZE1E 3LVEA 3EO9H 5HI3D 5T5FH 5EZOH 3ZQWA 2BX5A 4UNVA 5C0RH 3VI3B 2CA4A 3C09B 5DEZA 5HHOE 5SV4A 4KROC 3V9CA 2C3HA 5FKAB 2PP9A 1DFBH 3EYFB 1AQHA 1MXGA 3U4EB 2A9NH 4GSUA 3H53A 3HNTH 3KCPB 2O72A 3NRPA 3SDYH 1YJDC 4JFQA 4LPVA 4X7SH 3VRJA 4YHYB 4OFPA 2E9IA 4Q97A 1AXSB 2ATPB 2DKUA 3GLEA 4KTGA 1WHOA 3C6LB 2Y7NA 3GD1C 5JHAA 1ES0A 4HUNB 2PYFB 2Y7SA 3MMEB 2V45A 1KPRB 1UWFA 1T4WA 2F08A 5EZLA 4OGYL 1I1FB 2G5UA 3W82A 4NNYB 3VXRD 3VWKD 3CFNA 1TZ8A 2JNZA 4MMXC 1LDPH 1WAAA 4XWOD 3BGAA 1T03L 2OK0H 4NPYB 1ZK9A 3NCMA 4ELDA 1URIA 3T2PA 3CFEB 2C8NA 1QPPA 1BVNT 2C9RA 2D31B 4LLMB 4LL9A 4IBLT 2GSGA 1JN6A 5TPWH 3ULUH 1BF2A 1JZ4A 1E5YA 2ZSVA 2ADFH 4UF7C 2X89A 4YH6A 2PYEB 3P9MA 3CVHH 3SO3B 4IOIB 5H2BA 1BQHB 1JNNL 4ZX6A 4NSKB 4GRLD 1N59B 4LEXH 4M62H 4PLKC 1OHZA 1CQYA 1QZNA 4KODA 2R15A 4UAHA 3TTYA 1YEGL 4TUJA 3TO4C 3QDGE 4F9LA 3QZBA 2Q10A 2OCCB 4H20L 5EO1B 4MA1C 2ZCKL 3BAIA 4KKAD 5T5MD 2OL3B 4FQXD 3KYMA 2IANB 1IBDA 5CMAB 1QI5A 5JW4Q 2DLHA 1X5LA 5FW8A 4AQ8C 4XN7A 4UCFA 3EOBA 3VGFA 2WVUA 5IHLB 3F01A 2LGNA 3ZDYB 4Q6IB 1TQCB 3HRZB 3QJFA 1OARL 3QUYD 2VN7A 4LCWB 4QJ3B 2FEDD 2WB1A 3PDOA 2W38A 1UACL 2X70B 2XHNA 4L5FL 4N0UA 3ZPDA 3T1FB 3SY6A 1HEJC 4BH7A 4CVZA 4K5NA 3TH4T 1X5GA 2WBXA 2XX1A 1DUZA 4JE0A 3OKDB 5J3HD 1KENL 5DD1H 3VJ6A 3ZHDA 2VCOA 2OX5B 1N9PA 3KXFD 4PJDE 2F19H 2PKDA 1A8JH 3QDJD 4W4OA 5JYLA 2IDSA 1C12B 3E3QE 3ILPB 3BGFC 3IFOB 1F5WA 4HIEB 2DD8H 5ACZB 2VPYA 1HZHH 4JO1H 1ZHBB 2WAHA 2RAMA 1G7PA 3O4LB 4GKSA 4POZD 1KIRB 2ZWZA 2EE2A 1TCRB 3VRIB 1M71B 4BQ6A 5DJAB 1D9KB 3CFBB 1XMEB 3RRQA 5J0BA 5I8EA 1P7QA 1A6PA 4GUPB 1LTXA 1F4HA 3LMJH 3PAZA 3ZE1F 3DO4A 1D5XA 5E9DE 3ARTA 4L8BB 3VFWB 3Q2CA 1WBXA 1TZHB 2WW8A 4LE8A 5BS0E 1S3KL 5JW3L 4X7CC 3VCLA 4Y9CA 2PCFA 1KCWA 3IGKA 2V7HA 2AANA 4HWBL 1YYMH 4XVTH 5C0IA 5GZNA 3ARGB 2H5UA 1HOCB 4RSYA 5LWYH 2Q9OA 2Z92A 4Y5VA 5DQJA 3FOLB 3JT0A 3IE4A 5DK3A 1KYUA 4M8RA 4B5ZA 5KJ7E 4PJGA 3DYMA 4TNFA 1EO8H 4JKMA 2PR9A 3GTKA 1MFNA 1BQUA 4RFNC 3O6MH 3VXUB 4H1LB 5C1MB 4FS0A 2M83A 2ICWB 2ZX8A 4MVBC 4UV4L 5IR1A 3OJDA 4NKOA 3CWGA 4NRZA 1BGXH 4NDMA 3BSGA 2OJ1A 4ZW5A 5I6XC 5KG9A 5IW1A 2VZSA 1ZPUA 4DOHB 1IQWL 1TEGA 5BVJA 2DBLH 1T7ZA 3Q5TA 4XCFL 4NQTA 1UH4A 1E6OL 2NR6D 3LEVH 1T1ZA 4HU2A 3RWGB 2IDTA 2YA2A 5FC9A 5BRPA 2NYZA 3IN2A 1L7TL 4N2MA 1A0QH 4FQHB 5DJ2A 2Q87A 4Y4KA 3NCFB 2AEIT 4I0CC 3SKNA 4UQAA 1LO2L 3MA9L 4FHJA 3TN0B 5T5NF 1A4CA 4PLJD 4Y4HB 5DT1L 3S88L 2IG2H 1ASQA 4F33B 4K9JA 4LL1A 5IFAL 1QRND 4U1KB 1T80A 1WFJA 4IRZA 1KN2L 1HHHB 4OLWL 1R0AL 2GJJA 2WQUA 4Y2DD 4TL4A 1NQBA 1OAQH 3GYRA 1QFWH 2VDKB 1R27A 4PJ8C 3OX8A 1OM9A 4NQDB 2GI0A 4P5RA 3MVSA 1GGBH 4MJ2A 4MXVF 3VFOA 4AG4L 4DEUA 4J3OG 4CU7A 5I19H 3SEPA 4FTVD 3ZZSA 4Y2OA 1QTYT 1RUML 4F2EA 3SUKA 2KKQA 2XG4B 3KPNB 4DPRA 4TRPH 2DEYX 3MO1B 2A2QT 3O2VL 4EI0A 3FT2A 5C0BD 3WNPA 2XUWA 3QFJE 4ACTA 3ABLB 3UPRB 3M7FB 1RMFH 2ZX7A 1JDAA 1L5GA 2OR7A 4MHHI 3JTTA 4LSRH 5HGHA 4F7KA 2F1EA 2NXYB 2EIZB 4XT1C 1E67A 4H26A 3AJ7A 2H0PA 3N2JA 4LCCB 3BCFA 3M17A 2N4IA 3CFDA 1X7TA 1RVFL 1G7MA 3LQAH 4FQIH 3NJFA 4NENB 4UOJA 2WIMA 4P2RD 1M6OA 5AVUB 4QHUB 1ZT1A 2YFOA 1W0YT 2IBBA 3HC4H 3LAFA 4M1CC 3MRPB 3MHZA 1AS7A 4FNLL 4P5TA 4MNGA 5EO0A 4U1IA 2VR6A 5DMKA 5DZJA 5I6NA 2C3VA 4JLRA 1D6EA 1B90A 1IKNC 3N40F 5T1LB 3WIIH 3L8QA 1P9MA 3LZLA 2B4CL 1T89A 4G6AD 5D8JL 4UT7H 3OB0H 4K07A 4DK6A 5J11C 2F5AL 5CKGA 3C09C 5BVPL 4KZEL 2DV6A 3GHEH 4GW4A 4U6VL 2P28B 3T4YA 4LPXA 3OMZA 5DO2D 3R06B 4LCIL 1XV8A 3QEUA 2XC8A 3BW9B 3FQTB 4Y1AB 5G2NA 1K2DB 1XIWD 4G6ML 5GZOA 5LXVA 1J11A 4PJBB 3X1NA 2DQJH 1ZGLA 3HE6D 4AGMA 2HT4C 4I88A 4YHYC 1JS4A 4H25A 4YC2B 4FQQA 2HWZH 4IW4C 1NCCH 3L1EA 1EHXA 1BP3B 3MROA 3PS6A 2XJKA 4NZUL 1A1MB 5HHOA 2P5WD 1ZLEA 3DJTA 4AENB 2QZQA 4HWEH 2ZKMX 5IT2L 1CXHA 3ZUCA 4JP7A 3LQZB 4YDIH 4Z0XA 4BFOA 2X0VA 4WI0B 1MCOH 4HOXA 3FJTA 1T04A 1I7TB 4OZIF 4QGYA 1JL8A 3D4YA 5LBSH 2EDJA 5FOBA 3EFOB 1SN2A 3DUUA 2JIMA 1DN0A 4IGBD 4DGWC 1XX9C 5DVPA 1W72H 2LLGA 3U6XA 4YR6A 4ODSL 1JZ7A 2OYPA 5EWIL 3ARDB 2G9HA 1G8KA 5IW3A 2PETA 5TJWK 1DR9A 2X4OB 4AVRA 4XR8C 5EPMA 4HG4K 1JWUA 1B0RA 5E03A 2YARA 3HPJB 3JV5A 3FT4A 3QCVL 4PWGA 1DZ0A 3FO1B 3MGTB 4TUOA 4CC1A 5J6GA 2ADGB 4I3SH 3AT8A 3KPRE 4KVNL 3CMOL 1CE6A 4LSQL 4NJAL 4XO4A 3RVXC 3S8WA 1JI1A 32C2A 1KJ2A 1Q0YH 4OFDA 4YPGA 5HPMB 3WMQA 1JVLA 4GBXA 4NN5B 1KGCD 3GSNL 1CBVL 5TE7L 2DM4A 4MA3A 4CVXA 4Q6IC 1TQCC 3HRZC 4PWKA 4WCYL 2D8KA 2D73A 3QYMA 1G6RL 1BFOB 2AEOA 5GRYA 2F53B 1PCSA 4OBRA 5MEPB 4I5BA 1I7ZA 3IJSB 3P1VA 4G7YL 4KRNA 4QRTA 2QADD 3PQYA 1DZBA 3EHBB 1DDHA 3RVVC 4PRIA 4FF9A 2C1PB 1RZKL 1SXCA 1CUOA 2W9EH 2ODHA 4Z3IA 5IJVB 5I74B 2BS9A 4PR5A 5FXCH 4MCYB 4YK4C 4KQ4H 1JERA 2DYRB 2EYSA 2LFEA 4PJEE 4URTB 5HBBA 2GB2A 5I17A 2FL5A 3QDGB 3S4SB 4YHKH 2JIRA 5KSVA 5LNEA 2GUOB 4U6XB 1IGYB 2WXOA 4AEHH 2OSXA 2ZXCA 3SPHA 1NANI 4RQQB 2B1OA 3HS9A 5IMOA 3II1A 4IU3A 4A55A 1ZA3B 2OTUA 2KPWA 2BHFA 1LMIA 3DOIA 5GS0D 4Z77A 1D9KC 3NVQA 4AOFA 3WL9A 3NZUA 2Y2WA 3CSBA 4TQ8A 5FTKA 5DVLA 3U7YL 3BIAX 4GMSL 4AY0A 5LGHL 1Z5YD 3HAEH 3HR6A 3PHAA 4P49A 2ROXA 2R0KL 4YDJB 4HALA 4KX9A 5EOQH 1AGDB 4XNZB 3MRMB 5C86A 4DVBB 1RZFH 4OQTA 3GXPA 2I9LB 3C9NA 5GRJL 3W38A 3GZQA 3WSQL 4PJ5D 2AXWA 4GKNB 5E70A 1BVKB 4PJDB 1PIGA 1ZLVH 2FR4B 2HVKA 1IGFL 5J13B 4UM8B 2ZXEB 3WN5A 3TNMB 4ELKB 3MRIB 3D50A 3N44F 4N2OA 3DRQB 4K3HA 1UJ3A 3BZ4B 1XGUB 5KVFL 3RZWA 3X13A 1QBMH 1P84K 4JW3A 4KHTH 2IMMA 1AJ7H 4OGXH 4PGJA 4WO4D 4IDJH 1SFOA 5JUEH 4NQCD 2K8MA 3EO0B 5IVXE 1INDL 4AYSA 5LXGL 1RK1A 3ULVD 2J72A 4P2QE 5DZNA 2IH1A 2FBJL 3GMPA 3KDMA 3PGFL 4NBYB 3ZDZB 1YDPB 1FAKT 1UEYA 1RZGA 2HVJB 1I8AA 2LHAA 5CN1A 5FYLH 3B2UD 4XNUL 5L8JB 1LO5B 1T1XB 3QJHB 4YDKL 1DBKH 1D5BA 4HQQH 1Q1PA 4JFEB 5EZIH 5FFLA 4ZO9A 2EXWC 4ONFH 5AAMC 3RGVC 4ACPA 4TNVF 1U3ZA 2SEBB 4A2FA 4LRIA 2EECA 4NP4H 1WF5A 3ME0B 1JIBA 3RVTC 2OSLB 1V3LA 3ZTNH 5GHWH 4LHUA 2FVNA 4X6FB 4XPTH 4PJAB 4LLVB 3L9RA 3V4PA 2P80A 2Z4QA 4X83A 4OZIA 4JM2D 5FHAH 5IHUH 1YEEL 3ESPA 1DVXA 1UZ8A 3IMVA 2QHLA 3K6FA 3TN0C 1TWCA 4CRYG 4Y4HC 4BINA 4TUUA 2J88L 4R26L 4NXKA 5HJDA 1IGTB 3IJHA 1QHOA 2EKSB 2XSKA 5I1AB 1A9VA 4V1DE 2ZT9C 4KQ3H 1NJ9A 5AZEL 4KY2A 4KK6C 3IDXH 4N2FA 3IVKA 2HKHH 2MEJB 1JZDC 1PYWA 4AYGA 1DYZA 1L9OA 4N25A 3DSNB 3GKWH 4PRAA 3TJEL 1AYOA 3D39A 3RDJA 1G87A 1YECH 1WC7B 4FERA 3HU3A 1MWAH 4QT5A 4ZYKB 4X5RA 4ZFGH 4OFYA 3JVGC 4HXAL 1U91A 4PJEF 1OSZB 2KT6A 2E76C 1AYRA 3O8XD 3FQ4A 5TH2A 2NXYC 4K4KA 2X4QA 2ZPKH 3JV4A 1BX2A 3HPLA 4JFSA 5KUKA 1FNHA 3CVHB 1T7YA 4PS7A 3GHPA 2R92A 4LEOB 5F9OH 3HUJF 3ZT7A 4JQIA 4KUZL 1IL1B 4XN5A 1WPCA 5DS8B 4ANVA 4UM9B 5ICZA 1TO5A 4J7RA 1PQEA 1WWAX 3ROLB 1PLBA 4MWFA 2JKNA 5ICUA 1ZSDA 4HMDA 2FJUB 2ZIDA 1T5XB 4I0PB 3W0WD 1OT2A 4JKPH 4HETA 5CJXA 2G3XA 4TULL 1U8QA 3OZLA 2KZ1B 2WNKA 2W60A 1BVOA 1YQVH 3QJVB 2PJHB 1UKSA 1B6DA 4TPRH 4XMXA 1BEYH 2IDFA 1BVLB 3ATDA 4JFHD 4YO0A 1VACA 5DEGB 3SJVA 2QPDB 5E95B 3QIBD 4GRMA 2IPKB 4DP4X 2K0RA 2VLLB 3ZT5A 4LU5L 1MW0A 2QKIC 4W1TA 5EF0A 1E8WA 5LCVA 4P9HC 4NIKB 2NUTB 3L13A 1WITA 5J8OA 4YC2C 5HI4D 1PG7W 4HHAA 4EKXA 3V7MA 3QW9A 4JKLA 2J8OA 2NY0D 1EXGA 3EJUA 4S2SB 4XCYB 4JO3L 5EU6A 1BW8A 4GXFA 1F8TL 4FZEH 1GZQA 3H7BB 4PRHB 1ECYA 3SY0B 4A6YH 5IB5A 4NC1C 2YPKA 4QHMB 5CWSA 5CEZH 1RUKH 2K3TA 2NDFA 1E3ZA 1JI2A 1RLBA 1MLBA 3ARBB 1PFCA 4P48A 3U0PB 1TVHA 5IEKA 5LGYA 2TSAA 3BDYL 3CFIC 1JUFB 4HJ0D 3NIGF 3ARDC 4LBAA 5AW8B 2RD0A 3SE3A 5BQ7B 4XHJD 3LXAA 1AKJA 1UVQA 3JVFC 5L4IA 4G6KL 2K7QA 5IV2B 1R5VA 4ANKA 3UGXA 3VXME 5BRQA 3K5SA 5GGSY 3QR1A 4HKZB 4H8WH 3MFFA 3OSKA 3PGDB 4DHLA 5BRZE 1OSPH 3ZQ9A 5LNGA 4X0KB 3BVUA 4W93A 2ARJB 5I8KH 4B9FA 3X12B 4NUJA 4F7PA 4YSUA 3QORB 5HHXL 1FE8L 4BK8A 1FLRL 3VXOB 1FYTB 3H1ZA 1UOWA 2CHZA 5H94A 2BJML 4PJIB 2O61B 1OAXH 2ED9A 4DW2L 5A16B 1AR1B 4N2IA 1G7HA 4S0SD 3L6FA 4IOFC 1E6JL 4HOMA 4C4UA 2BHZA 1XGRB 4APQB 1IEHA 1UENA 2J55A 2IC2A 2OMXA 3BO8B 1MY7A 3U4AA 1ADQA 4BK5A 3LDBB 2PJJA 3EHBC 4M29A 3FTYA 4OZ4A 5BV7L 5KOVC 1ZLUH 3S34L 4YSCA 3ISYA 5I74C 3Q6FB 4RIRB 3UTZB 3H9ZA 1A9EA 2ZOKA 3OXSA 3RDTB 3Q0HA 4XMUA 5SWSE 1ZIBA 1M2VB 1GCFA 4HVBA 3G5ZA 2R0WH 4Y9GA 4B0MM 1BZQK 4OGYH 3DTDA 3WTXA 4Q6YA 2JIXB 3LZPA 3BSHA 3U46A 1N0XL 3MRRA 3FF7A 5D7LB 1ACZA 2Z7WA 4R3SB 4KI5C 4KNUA 1JP5A 2WMPA 2Y3NA 4L4VE 3SPGA 3FB5A 4NQUA 3LKQA 1ZS2A 1ID2A 5GISH 1S6NA 3LPWA 3CZNA 3FUNA 5F88B 1KXTB 4Y4FD 4EDXB 1YEHL 2IH3A 1HEZB 1SEBA 4QY8B 5JIMA 3TFBA 3DJRA 1PKOA 3HUJA 2C7UA 4NN7B 4E9VA 3BFQG 1YEGH 5IUCA 1VESA 4LKCB 3HS8A 1S9XB 4MA7H 2BERA 3VGAB 1NEPA 2P8LB 4H20H 4NM8H 3CBRA 4DPBX 4GQRA 4E41A 2ZCKH 1S7XB 3H8NA 2G60L 4KMTH 5D6CB 1HI6B 1NGWA 1YNKH 3CFJB 3VFGL 5DMGD 3TVMC 3MV7E 3E3QC 2E7BA 4M93B 1T5WB 4QXUL 4F7TA 1YEIH 3MLSH 1L8FA 2Y5TB 1NFAA 4RFOL 4ETYA 12E8L 4V2BA 1HHIB 4Y5XA 1JFHA 4KK5C 2D7MA 2JKSA 1MCCA 2ED7A 1OARH 2Z1KA 1YO4A 3AU1B 1AZVA 4HD9A 1Y6NR 2ZCZA 4TNGA 2ZYHA 1JYVA 2WJ7A 4G7RB 4JFWA 3FU6A 3MRJA 4L5FH 3U4BL 4MQXC 3SGEH 4CADA 1SYSB 2DQDL 5DHYB 4HJ1A 1J5HA 3FFOA 1YEDA 1NBQA 1NCIA 3I3DA 3AB0B 3T08A 1KENH 3PWPA 1QFPA 5I0WA 5HHNA 5IBUB 3UYRL 2EDOA 4PCSA 5AVXB 2JKXA 2WXIA 2NYAA 1PKQA 2CWRA 2MJWA 3BWZA 1WZAA 5E94A 5GRWA 4DGUA 4J8RA 1NBZA 1KNOB 2HLAA 2GCYB 1Q90A 1A1OA 3M07A 3MRFA 4G1MB 4GG6E 3VXNA 4ZS7L 2I5YH 3V6OA 4ES8A 5HYIA 4LBEB 4UV7L 3NCCB 3MNDA 3CH1A 2KPNA 4P2QB 2Y69B 2E0PA 4X98A 4D9QE 3MBWB 4YJZL 3QAQA 4DH2A 1P53A 3I85A 3NYKA 4EUPH 4FNQA 1DQQA 3TWCL 1TYEB 1S3KH 5JW3H 3D33A 2ARWA 3W1ZA 4MDIA 4PI2A 5EU5A 1HWWA 3CCHA 3QUZD 4HWBH 5J6SA 1UHDA 2Z7UA 5I6LA 3HR5B 5C3LD 1M05A 4Z23A 4B60A 1HCVA 1EJFA 3U79A 2B59A 4ALAL 1VZIA 1FA4A 1L0XA 2OMWA 1BW4A 3ARVA 1TJXA 1I9IL 2Y25A 4FMKA 4MB5A 3TYGL 1SJXA 4GW1A 4Y5YA 2FNBA 1F41A 1VKXB 1LQBC 2PLTA 2YGNA 3HZYB 1UT9A 2ITCA 2YZ1A 4KX8A 4K55A 1GS7A 3EYQD 3GJFK 1K6QL 3GSOA 4ABQA 3CQFA 4UV4H 5GRVK 3IU4H 2XACC 1X5MA 2DTML 4KVPA 5I66B 2VDOH 1SM3L 5K9KB 5HJ3A 4IMKC 4FQ2L 2V8LA 4MD5A 4QRPA 2WJ5A 4JRYD 2JELL 4XMWA 1JZ8A 4I0PC 1IQWH 2BCKA 4XCFH 5HHVL 5ILTL 2A74B 1RV6X 5DQ9A 4PJ7E 1QLEL 2NSMA 4CC4A 1Z9MA 1MVUB 4MS8D 1L7TH 1E5AA 4PW9A 1OGTB 4Z7VE 4TLSA 4OUUB 5TE6H 4I1RA 1T0OA 1LO0L 1LO2H 3MA9H 4OZFH 4XHQA 3VXRE 2Y72A 4Z7WE 1WS8A 2H32A 4OGAD 4P23B 2VUYA 5DT1H 4HX1A 3TT1H 3S88H 2XPGB 1TFPA 3FQXA 3QCUL 4NWUH 4YOKA 1PQFA 3X17A 5CJ5A 2P47B 3SGKA 2W0FB 4HKJA 1VFAB 1AIFB 3FQRB 3IF1A 4A2GA 1MFUA 2BOCA 4HUKB 3T8XA 3SDDB 4OLWH 4WK4B 1R0AH 1W0VB 1NPNA 4X6CE 3BVNA 3QK0A 1JXGA 2IPTL 4G5AA 5HSFA 2R93A 4AG4H 3CUPB 3FH7A 1N0LA 4HUCA 4PG9A 1RUMH 3D0VA 2UX6A 1ZE3H 4G7SB 1A2YA 3QIWB 3O2VH 3AS2A 2Z31A 5DHMC 2EDQA 3WIHA 4NB7A 1TQWA 5DURB 4MNQA 1WV7T 4IBSA 4MMZA 2GY7B 2WWKT 1FL6B 3C5JB 1S78C 5JHDE 2YJLA 3HAEB 1DUYA 1IEBB 1U2CA 3FU7A 2J73A 2ZWKA 5L8KB 4NO5B 1ADWA 4BZ2L 1I75A 3QUMA 4X7EC 4CAGA 2FB4L 4KHXL 5MENA 2E7LA 4GG6F 3CZLA 3OUGA 4P46B 3EJJX 1DEEB 2KLRA 5D1XA 3QZLA 3IDYB 4PW3A 4FNLH 1QSFA 2P1YA 4X6EA 1Q72H 1HZLA 1O9WA 1WYJA 4WHDA 3FONA 4B0MB 3IDMA 5D4QA 3T3ME 3AY4A 3B9VA 3LNFA 3Q8EA 1N3NB 1AR1C 2QSCL 4XNXL 2B4CH