1PYUB

Processed aspartate decarboxylase mutant with ser25 mutated to cys
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
CCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Constraints on protein self-processing in L-aspartate-alpha-decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase beta chain
total genus 23
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1pyuB00
1PQHA 1Q16A 2JIMA 3CF2A 2NVXA 3GTOA 3IR7A 1DMSA 1WLFA 1PT1A 1R9TA 1Y1WA 1QDNA 1VC3B 1Y5IA 5C1BA 4C2MA 1CZ5A 3GTPA 5EPPA 4RV0A 1TMOA 1PQEA 2DMRA 2JIOA 1E61A 4GA5A 4DMRA 2WAQA 4AAYA 1H5NA 2VPXA 1WCMA 4KO8A 1YLEA 2VPZA 2IV2X 1G8KA 1R27A 5FTNA 1K83A 2NAPA 1AA6A 1TWHA 4CRZA 1TWGA 1E32A 2KI8A 1DMRA 3O5AA 4KDLA 2E2IA 1CR5A 2JA7A 5FTJA 3GTMA 2R7ZA 5T5MD 5FTKA 1S3SA 2EEOB 1TWCA 2R92A 3HU2A 1KQGA 2JA6A 1TWFA 2E7ZA 1H0HA 1UHEA 1PPYA 3CQZA 3IR5A 1FDIA 1QCSA 1G8JA 1UHDA 5FTLA 3TIWA 3OUGA 1IW7D 4AZDA 2E2HA 2PMZA 2NYAA 4AOKB 4GA6A 4AONB 1PQFA 3GTLA 1FDOA 4AYBA 2JIQA 2C45A 3QC8A 1PYQA 3IR6A 4CS0A 3HKZA 5DYIA 2WB1A 2VPWA 2JA5A 5C18A 2NVYA 5T5ID 2PJHB 3PLXB 5B6CA 3GTQA 1PT0A 4KODA 2JIPA 1R7RA 5FTMA 4QIWA 1SIWA 4KLNA 1SFOA 5DYGA 1TWAA 1E5VA 1I50A 1Y1VA 3QQ7A 1I3QA 5GLFA 3QQ8A 1CZ4A 1OGYA 3GTJA 3DMRA 3ML1A 4D7ZB 2B63A 1EU1A 4KDIA 1E18A 1E60A 3HU1A 1AW8B 2V45A 3HU3A 3FKIA 3GTGA 1PYUB 3H0GA 1KQFA 2YU9A 1Y4ZA 2VPYA 3TM7B 3GTKA 2V3VA 2R93A 2VUMA 3QWZA 2JIRA 4CRYG 2Y0SA
chains in the Genus database with same CATH superfamily
1PQHA 1Q16A 2JIMA 3X2JA 3CF2A 2NVXA 3SUMA 3GTOA 3IR7A 1DMSA 4FFTA 1WLFA 1PT1A 2PJJA 1R9TA 1Y1WA 1QDNA 2A6ED 1VC3B 4FG4A 1ZC1A 1Y5IA 5C1BA 4L48A 4C2MA 3X2LA 1CZ5A 4FERA 3GTPA 5EPPA 4RV0A 1TMOA 1L8FA 1PQEA 2DMRA 2JIOA 1E61A 2O5JD 4GA5A 4DMRA 1SMYD 2WAQA 4AAYA 1H5NA 2VPXA 1WCMA 3CZBA 4KO8A 3SUJA 1YLEA 2VPZA 1OA9A 2IV2X 1G8KA 1R27A 5FTNA 2PNWA 1K83A 2NAPA 1AA6A 5H4UA 1TWHA 4AVRA 4CRZA 1TWGA 1E32A 2KI8A 1DMRA 3O5AA 4KDLA 2E2IA 1CR5A 5GM9A 2JA7A 5FTJA 3GTMA 3D30A 2R7ZA 5T5MD 5FTKA 1S3SA 2EEOB 1TWCA 2R92A 2GAEA 2KQAA 2CW0D 3HU2A 3ENGA 3SUKA 1TWFA 2E7ZA 1KQGA 1H0HA 2JA6A 2PI8A 1UHEA 3X2OA 1PPYA 3CQZA 1YNND 3IR5A 4NOHA 1FDIA 2HCZX 1QCSA 1G8JA 1UHDA 5FTLA 3TIWA 3OUGA 1IW7D 4AZDA 2E2HA 2PMZA 2PICA 2YUJA 2NYAA 4AOKB 4GA6A 2ENGA 4AONB 1PQFA 3GTLA 1FDOA 4AYBA 4ENGA 2JIQA 2C45A 3QC8A 2A69D 1PYQA 2AE0X 3IR6A 3HKZA 3QWZA 4CS0A 5DYIA 2WB1A 2VPWA 2JA5A 5C18A 1HD5A 2NVYA 5T5ID 2A68D 2PJHB 3PLXB 5B6CA 3X2PA 3GTQA 3X2NA 1PT0A 4KODA 2G5DA 2JIPA 1R7RA 5FTMA 4QIWA 3SULA 3X2KA 1OA7A 1SIWA 4KLNA 2A6HD 1SFOA 4JJOA 5DYGA 5GLYA 4JS7A 3X2GA 3X2IA 3X2HA 4JP7A 1ZYRD 1TWAA 1E5VA 1I50A 1Y1VA 3QQ7A 1I3QA 5GLFA 3QQ8A 1CZ4A 1OGYA 4ZM7A 3DMRA 3ML1A 3GTJA 4D7ZB 2B63A 1EU1A 3M3GA 4KDIA 1E18A 1E60A 3HU1A 1AW8B 2V45A 3HU3A 3FKIA 5GLXA 1BW4A 1YNJD 3GTGA 4FG2A 1PYUB 4JCWA 1BW3A 1WC2A 3H0GA 1KQFA 2YU9A 1Y4ZA 2VPYA 3TM7B 1N10A 3GTKA 2V3VA 3X2MA 2BH0A 2G6GA 4JP6A 2R93A 2VUMA 2BE5D 2JIRA 4CRYG 2Y0SA
chains in the Genus database with same CATH topology
1PQHA 1Q16A 2JIMA 3CF2A 2NVXA 3GTOA 3IR7A 1DMSA 1WLFA 1PT1A 2PJJA 1R9TA 1Y1WA 1QDNA 2A6ED 1VC3B 1ZC1A 1Y5IA 5C1BA 4C2MA 1CZ5A 3GTPA 5EPPA 4RV0A 1TMOA 1PQEA 2DMRA 2JIOA 1E61A 2O5JD 4GA5A 4DMRA 1SMYD 2WAQA 4AAYA 1H5NA 2VPXA 1WCMA 3CZBA 4KO8A 1YLEA 2VPZA 2IV2X 1G8KA 1R27A 5FTNA 2PNWA 1K83A 2NAPA 1AA6A 1TWHA 4CRZA 1TWGA 1E32A 2KI8A 1DMRA 3O5AA 4KDLA 2E2IA 1CR5A 2JA7A 5FTJA 3GTMA 2R7ZA 5T5MD 5FTKA 1S3SA 2EEOB 1TWCA 2R92A 2GAEA 2CW0D 3HU2A 1KQGA 2JA6A 1TWFA 2E7ZA 1H0HA 2PI8A 1UHEA 1PPYA 3CQZA 1YNND 3IR5A 4NOHA 1FDIA 1QCSA 1G8JA 1UHDA 5FTLA 3TIWA 3OUGA 1IW7D 4AZDA 2E2HA 2PMZA 2PICA 2YUJA 2NYAA 4AOKB 4GA6A 4AONB 1PQFA 3GTLA 1FDOA 4AYBA 2JIQA 2C45A 3QC8A 2A69D 1PYQA 2AE0X 3IR6A 3HKZA 3QWZA 4CS0A 5DYIA 2WB1A 2VPWA 2JA5A 5C18A 2NVYA 5T5ID 2A68D 2PJHB 3PLXB 5B6CA 3GTQA 1PT0A 4KODA 2G5DA 2JIPA 1R7RA 5FTMA 4QIWA 1SIWA 4KLNA 2A6HD 1SFOA 5DYGA 1ZYRD 1TWAA 1E5VA 1I50A 1Y1VA 3QQ7A 1I3QA 5GLFA 3QQ8A 1CZ4A 1OGYA 3GTJA 3DMRA 3ML1A 4D7ZB 2B63A 1EU1A 4KDIA 1E18A 1E60A 3HU1A 1AW8B 2V45A 3HU3A 3FKIA 1YNJD 3GTGA 1PYUB 3H0GA 1KQFA 2YU9A 1Y4ZA 2VPYA 3TM7B 3GTKA 2V3VA 2G6GA 2R93A 2VUMA 2BE5D 2JIRA 4CRYG 2Y0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQH A;  1Q16 A;  2JIM A;  3CF2 A;  2NVX A;  3GTO A;  3IR7 A;  1DMS A;  1WLF A;  1PT1 A;  1R9T A;  1Y1W A;  1QDN A;  1VC3 B;  1Y5I A;  5C1B A;  4C2M A;  1CZ5 A;  3GTP A;  5EPP A;  4RV0 A;  1TMO A;  1PQE A;  2DMR A;  2JIO A;  1E61 A;  4GA5 A;  4DMR A;  2WAQ A;  4AAY A;  1H5N A;  2VPX A;  1WCM A;  4KO8 A;  1YLE A;  2VPZ A;  2IV2 X;  1G8K A;  1R27 A;  5FTN A;  1K83 A;  2NAP A;  1AA6 A;  1TWH A;  4CRZ A;  1TWG A;  1E32 A;  2KI8 A;  1DMR A;  3O5A A;  4KDL A;  2E2I A;  1CR5 A;  2JA7 A;  5FTJ A;  3GTM A;  2R7Z A;  5T5M D;  5FTK A;  1S3S A;  2EEO B;  1TWC A;  2R92 A;  3HU2 A;  1KQG A;  2JA6 A;  1TWF A;  2E7Z A;  1H0H A;  1UHE A;  1PPY A;  3CQZ A;  3IR5 A;  1FDI A;  1QCS A;  1G8J A;  1UHD A;  5FTL A;  3TIW A;  3OUG A;  1IW7 D;  4AZD A;  2E2H A;  2PMZ A;  2NYA A;  4AOK B;  4GA6 A;  4AON B;  1PQF A;  3GTL A;  1FDO A;  4AYB A;  2JIQ A;  2C45 A;  3QC8 A;  1PYQ A;  3IR6 A;  4CS0 A;  3HKZ A;  5DYI A;  2WB1 A;  2VPW A;  2JA5 A;  5C18 A;  2NVY A;  5T5I D;  2PJH B;  3PLX B;  5B6C A;  3GTQ A;  1PT0 A;  4KOD A;  2JIP A;  1R7R A;  5FTM A;  4QIW A;  1SIW A;  4KLN A;  1SFO A;  5DYG A;  1TWA A;  1E5V A;  1I50 A;  1Y1V A;  3QQ7 A;  1I3Q A;  5GLF A;  3QQ8 A;  1CZ4 A;  1OGY A;  3GTJ A;  3DMR A;  3ML1 A;  4D7Z B;  2B63 A;  1EU1 A;  4KDI A;  1E18 A;  1E60 A;  3HU1 A;  1AW8 B;  2V45 A;  3HU3 A;  3FKI A;  3GTG A;  1PYU B;  3H0G A;  1KQF A;  2YU9 A;  1Y4Z A;  2VPY A;  3TM7 B;  3GTK A;  2V3V A;  2R93 A;  2VUM A;  3QWZ A;  2JIR A;  4CRY G;  2Y0S A; 
#chains in the Genus database with same CATH topology
 1PQH A;  1Q16 A;  2JIM A;  3X2J A;  3CF2 A;  2NVX A;  3SUM A;  3GTO A;  3IR7 A;  1DMS A;  4FFT A;  1WLF A;  1PT1 A;  2PJJ A;  1R9T A;  1Y1W A;  1QDN A;  2A6E D;  1VC3 B;  4FG4 A;  1ZC1 A;  1Y5I A;  5C1B A;  4L48 A;  4C2M A;  3X2L A;  1CZ5 A;  4FER A;  3GTP A;  5EPP A;  4RV0 A;  1TMO A;  1L8F A;  1PQE A;  2DMR A;  2JIO A;  1E61 A;  2O5J D;  4GA5 A;  4DMR A;  1SMY D;  2WAQ A;  4AAY A;  1H5N A;  2VPX A;  1WCM A;  3CZB A;  4KO8 A;  3SUJ A;  1YLE A;  2VPZ A;  1OA9 A;  2IV2 X;  1G8K A;  1R27 A;  5FTN A;  2PNW A;  1K83 A;  2NAP A;  1AA6 A;  5H4U A;  1TWH A;  4AVR A;  4CRZ A;  1TWG A;  1E32 A;  2KI8 A;  1DMR A;  3O5A A;  4KDL A;  2E2I A;  1CR5 A;  5GM9 A;  2JA7 A;  5FTJ A;  3GTM A;  3D30 A;  2R7Z A;  5T5M D;  5FTK A;  1S3S A;  2EEO B;  1TWC A;  2R92 A;  2GAE A;  2KQA A;  2CW0 D;  3HU2 A;  3ENG A;  3SUK A;  1TWF A;  2E7Z A;  1KQG A;  1H0H A;  2JA6 A;  2PI8 A;  1UHE A;  3X2O A;  1PPY A;  3CQZ A;  1YNN D;  3IR5 A;  4NOH A;  1FDI A;  2HCZ X;  1QCS A;  1G8J A;  1UHD A;  5FTL A;  3TIW A;  3OUG A;  1IW7 D;  4AZD A;  2E2H A;  2PMZ A;  2PIC A;  2YUJ A;  2NYA A;  4AOK B;  4GA6 A;  2ENG A;  4AON B;  1PQF A;  3GTL A;  1FDO A;  4AYB A;  4ENG A;  2JIQ A;  2C45 A;  3QC8 A;  2A69 D;  1PYQ A;  2AE0 X;  3IR6 A;  3HKZ A;  3QWZ A;  4CS0 A;  5DYI A;  2WB1 A;  2VPW A;  2JA5 A;  5C18 A;  1HD5 A;  2NVY A;  5T5I D;  2A68 D;  2PJH B;  3PLX B;  5B6C A;  3X2P A;  3GTQ A;  3X2N A;  1PT0 A;  4KOD A;  2G5D A;  2JIP A;  1R7R A;  5FTM A;  4QIW A;  3SUL A;  3X2K A;  1OA7 A;  1SIW A;  4KLN A;  2A6H D;  1SFO A;  4JJO A;  5DYG A;  5GLY A;  4JS7 A;  3X2G A;  3X2I A;  3X2H A;  4JP7 A;  1ZYR D;  1TWA A;  1E5V A;  1I50 A;  1Y1V A;  3QQ7 A;  1I3Q A;  5GLF A;  3QQ8 A;  1CZ4 A;  1OGY A;  4ZM7 A;  3DMR A;  3ML1 A;  3GTJ A;  4D7Z B;  2B63 A;  1EU1 A;  3M3G A;  4KDI A;  1E18 A;  1E60 A;  3HU1 A;  1AW8 B;  2V45 A;  3HU3 A;  3FKI A;  5GLX A;  1BW4 A;  1YNJ D;  3GTG A;  4FG2 A;  1PYU B;  4JCW A;  1BW3 A;  1WC2 A;  3H0G A;  1KQF A;  2YU9 A;  1Y4Z A;  2VPY A;  3TM7 B;  1N10 A;  3GTK A;  2V3V A;  3X2M A;  2BH0 A;  2G6G A;  4JP6 A;  2R93 A;  2VUM A;  2BE5 D;  2JIR A;  4CRY G;  2Y0S A; 
#chains in the Genus database with same CATH homology
 1PQH A;  1Q16 A;  2JIM A;  3CF2 A;  2NVX A;  3GTO A;  3IR7 A;  1DMS A;  1WLF A;  1PT1 A;  2PJJ A;  1R9T A;  1Y1W A;  1QDN A;  2A6E D;  1VC3 B;  1ZC1 A;  1Y5I A;  5C1B A;  4C2M A;  1CZ5 A;  3GTP A;  5EPP A;  4RV0 A;  1TMO A;  1PQE A;  2DMR A;  2JIO A;  1E61 A;  2O5J D;  4GA5 A;  4DMR A;  1SMY D;  2WAQ A;  4AAY A;  1H5N A;  2VPX A;  1WCM A;  3CZB A;  4KO8 A;  1YLE A;  2VPZ A;  2IV2 X;  1G8K A;  1R27 A;  5FTN A;  2PNW A;  1K83 A;  2NAP A;  1AA6 A;  1TWH A;  4CRZ A;  1TWG A;  1E32 A;  2KI8 A;  1DMR A;  3O5A A;  4KDL A;  2E2I A;  1CR5 A;  2JA7 A;  5FTJ A;  3GTM A;  2R7Z A;  5T5M D;  5FTK A;  1S3S A;  2EEO B;  1TWC A;  2R92 A;  2GAE A;  2CW0 D;  3HU2 A;  1KQG A;  2JA6 A;  1TWF A;  2E7Z A;  1H0H A;  2PI8 A;  1UHE A;  1PPY A;  3CQZ A;  1YNN D;  3IR5 A;  4NOH A;  1FDI A;  1QCS A;  1G8J A;  1UHD A;  5FTL A;  3TIW A;  3OUG A;  1IW7 D;  4AZD A;  2E2H A;  2PMZ A;  2PIC A;  2YUJ A;  2NYA A;  4AOK B;  4GA6 A;  4AON B;  1PQF A;  3GTL A;  1FDO A;  4AYB A;  2JIQ A;  2C45 A;  3QC8 A;  2A69 D;  1PYQ A;  2AE0 X;  3IR6 A;  3HKZ A;  3QWZ A;  4CS0 A;  5DYI A;  2WB1 A;  2VPW A;  2JA5 A;  5C18 A;  2NVY A;  5T5I D;  2A68 D;  2PJH B;  3PLX B;  5B6C A;  3GTQ A;  1PT0 A;  4KOD A;  2G5D A;  2JIP A;  1R7R A;  5FTM A;  4QIW A;  1SIW A;  4KLN A;  2A6H D;  1SFO A;  5DYG A;  1ZYR D;  1TWA A;  1E5V A;  1I50 A;  1Y1V A;  3QQ7 A;  1I3Q A;  5GLF A;  3QQ8 A;  1CZ4 A;  1OGY A;  3GTJ A;  3DMR A;  3ML1 A;  4D7Z B;  2B63 A;  1EU1 A;  4KDI A;  1E18 A;  1E60 A;  3HU1 A;  1AW8 B;  2V45 A;  3HU3 A;  3FKI A;  1YNJ D;  3GTG A;  1PYU B;  3H0G A;  1KQF A;  2YU9 A;  1Y4Z A;  2VPY A;  3TM7 B;  3GTK A;  2V3V A;  2G6G A;  2R93 A;  2VUM A;  2BE5 D;  2JIR A;  4CRY G;  2Y0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...