1PYUB

Processed aspartate decarboxylase mutant with ser25 mutated to cys
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
b'CCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Structural Constraints on protein self-processing in L-aspartate-alpha-decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 23
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1pyuB00
5DYGA 1PPYA 5B6CA 4CS0A 1PQEA 3HKZA 1DMSA 4AOKB 5FTMA 1CZ5A 1PT1A 5EPPA 2R93A 5T5MD 5GLFA 3H0GA 4GA5A 1K83A 1OGYA 2EEOB 1WLFA 2V45A 1AW8B 1TWCA 3OUGA 2R92A 2IV2X 1S3SA 3GTPA 1Y1WA 3TIWA 1Y1VA 1Y4ZA 3HU1A 2R7ZA 3GTOA 2E2IA 3HU2A 4AZDA 2KI8A 2DMRA 3IR7A 2C45A 1R27A 1TMOA 3IR6A 1FDIA 2WAQA 4RV0A 2VUMA 5FTNA 2JIMA 5C18A 1KQGA 3QC8A 4KLNA 3GTMA 1TWHA 2NVYA 2JIQA 2JA7A 4CRYG 1E61A 3CF2A 2VPXA 4C2MA 1H5NA 1IW7D 1G8JA 3CQZA 2JIRA 1EU1A 1E5VA 1PYUB 5C1BA 3GTJA 1TWFA 2NAPA 1G8KA 1Y5IA 1FDOA 2JIOA 4AONB 4AAYA 4GA6A 3QWZA 2VPYA 2VPWA 1QDNA 5DYIA 2Y0SA 1R9TA 1CZ4A 1PT0A 2B63A 1R7RA 1UHEA 1H0HA 2JA5A 2V3VA 3HU3A 1AA6A 5FTKA 2JA6A 2E2HA 3GTLA 4KDLA 1SIWA 2PJHB 3IR5A 1VC3B 1KQFA 3TM7B 3GTGA 2JIPA 2NYAA 1PYQA 2NVXA 1QCSA 1TWGA 1PQHA 4KO8A 1CR5A 1YLEA 2VPZA 3DMRA 4QIWA 1I3QA 1E18A 5T5ID 4DMRA 4D7ZB 3GTQA 2PMZA 1E60A 1E32A 1TWAA 1SFOA 5FTLA 3QQ8A 3PLXB 1UHDA 1DMRA 3QQ7A 5FTJA 3GTKA 3FKIA 4KODA 2YU9A 4KDIA 4AYBA 4CRZA 1I50A 1PQFA 3ML1A 1Q16A 1WCMA 2WB1A 2E7ZA 3O5AA
chains in the Genus database with same CATH superfamily
2A6ED 5GM9A 5DYGA 1PPYA 5B6CA 4CS0A 3X2PA 1PQEA 3HKZA 1SMYD 1DMSA 4AOKB 5FTMA 1CZ5A 2A68D 1PT1A 5EPPA 2R93A 5T5MD 5GLFA 3H0GA 4GA5A 5H4UA 4AVRA 1K83A 1N10A 1OGYA 2EEOB 1WLFA 2V45A 2GAEA 1AW8B 3X2OA 1TWCA 3OUGA 2PICA 2R92A 2IV2X 1S3SA 3GTPA 1Y1WA 3SUMA 4FG4A 3D30A 2BH0A 5GLXA 3TIWA 1Y1VA 1Y4ZA 3X2LA 3HU1A 2BE5D 2R7ZA 3X2HA 3GTOA 2E2IA 2HCZX 3HU2A 4AZDA 2KI8A 2DMRA 3IR7A 2C45A 1BW4A 1BW3A 1R27A 1TMOA 3IR6A 1FDIA 2WAQA 4RV0A 2VUMA 5FTNA 2JIMA 5C18A 1KQGA 3QC8A 4KLNA 3GTMA 1OA7A 1TWHA 2NVYA 2JIQA 2A6HD 2JA7A 3X2NA 4CRYG 1E61A 3CF2A 2VPXA 3M3GA 1H5NA 4C2MA 1IW7D 1G8JA 3CQZA 4JCWA 2JIRA 1EU1A 1E5VA 1PYUB 5C1BA 3GTJA 1TWFA 2NAPA 1G8KA 2PNWA 4NOHA 3X2GA 1Y5IA 1FDOA 1ZYRD 2JIOA 4AONB 4AAYA 4GA6A 3QWZA 1YNJD 2VPWA 2VPYA 3SUJA 1QDNA 5DYIA 2Y0SA 2AE0X 1R9TA 1CZ4A 3CZBA 1PT0A 2B63A 1R7RA 2PJJA 4FG2A 4ENGA 1UHEA 1H0HA 4JS7A 2JA5A 1ZC1A 1YNND 2V3VA 3HU3A 1AA6A 4FERA 5FTKA 2JA6A 3SUKA 2E2HA 2PI8A 4ZM7A 3GTLA 4KDLA 2CW0D 2A69D 1SIWA 2PJHB 1OA9A 2ENGA 2G6GA 3IR5A 2YUJA 1VC3B 1KQFA 3TM7B 3SULA 2O5JD 4JJOA 4FFTA 3GTGA 2JIPA 2NYAA 3X2JA 1PYQA 3X2KA 1L8FA 2NVXA 4JP7A 1QCSA 1TWGA 1HD5A 2KQAA 1PQHA 4KO8A 1CR5A 1YLEA 3X2IA 2VPZA 3DMRA 4QIWA 1I3QA 3ENGA 1E18A 5T5ID 4DMRA 4D7ZB 4L48A 3GTQA 2PMZA 5GLYA 1E60A 1E32A 1TWAA 2G5DA 5FTLA 1SFOA 3QQ8A 3PLXB 1UHDA 1DMRA 3QQ7A 4JP6A 5FTJA 3GTKA 3FKIA 4KODA 2YU9A 4KDIA 4AYBA 4CRZA 1I50A 1PQFA 3ML1A 1Q16A 1WCMA 2WB1A 3X2MA 2E7ZA 3O5AA 1WC2A
chains in the Genus database with same CATH topology
2A6ED 5DYGA 1PPYA 5B6CA 4CS0A 1PQEA 3HKZA 1SMYD 1DMSA 4AOKB 5FTMA 1CZ5A 2A68D 1PT1A 5EPPA 2R93A 5T5MD 5GLFA 3H0GA 4GA5A 1K83A 1OGYA 2EEOB 1WLFA 2V45A 2GAEA 1AW8B 1TWCA 3OUGA 2PICA 2R92A 2IV2X 1S3SA 3GTPA 1Y1WA 3TIWA 1Y1VA 1Y4ZA 3HU1A 2BE5D 2R7ZA 3GTOA 2E2IA 3HU2A 4AZDA 2KI8A 2DMRA 3IR7A 2C45A 1R27A 1TMOA 3IR6A 1FDIA 2WAQA 4RV0A 2VUMA 5FTNA 2JIMA 5C18A 1KQGA 3QC8A 4KLNA 3GTMA 1TWHA 2NVYA 2JIQA 2A6HD 2JA7A 4CRYG 1E61A 3CF2A 2VPXA 4C2MA 1H5NA 1IW7D 1G8JA 3CQZA 2JIRA 1EU1A 1E5VA 1PYUB 5C1BA 3GTJA 1TWFA 2NAPA 1G8KA 2PNWA 4NOHA 1Y5IA 1FDOA 1ZYRD 2JIOA 4AONB 4AAYA 4GA6A 3QWZA 1YNJD 2VPWA 2VPYA 1QDNA 5DYIA 2Y0SA 2AE0X 1R9TA 1CZ4A 3CZBA 1PT0A 2B63A 1R7RA 2PJJA 1UHEA 1H0HA 2JA5A 1ZC1A 1YNND 2V3VA 3HU3A 1AA6A 5FTKA 2JA6A 2E2HA 2PI8A 3GTLA 4KDLA 2CW0D 2A69D 1SIWA 2PJHB 2G6GA 3IR5A 2YUJA 1VC3B 1KQFA 3TM7B 2O5JD 3GTGA 2JIPA 2NYAA 1PYQA 2NVXA 1QCSA 1TWGA 1PQHA 4KO8A 1CR5A 1YLEA 2VPZA 3DMRA 4QIWA 1I3QA 1E18A 5T5ID 4DMRA 4D7ZB 3GTQA 2PMZA 1E60A 1E32A 1TWAA 2G5DA 5FTLA 1SFOA 3QQ8A 3PLXB 1UHDA 1DMRA 3QQ7A 5FTJA 3GTKA 3FKIA 4KODA 2YU9A 4KDIA 4AYBA 4CRZA 1I50A 1PQFA 3ML1A 1Q16A 1WCMA 2WB1A 2E7ZA 3O5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYG A;  1PPY A;  5B6C A;  4CS0 A;  1PQE A;  3HKZ A;  1DMS A;  4AOK B;  5FTM A;  1CZ5 A;  1PT1 A;  5EPP A;  2R93 A;  5T5M D;  5GLF A;  3H0G A;  4GA5 A;  1K83 A;  1OGY A;  2EEO B;  1WLF A;  2V45 A;  1AW8 B;  1TWC A;  3OUG A;  2R92 A;  2IV2 X;  1S3S A;  3GTP A;  1Y1W A;  3TIW A;  1Y1V A;  1Y4Z A;  3HU1 A;  2R7Z A;  3GTO A;  2E2I A;  3HU2 A;  4AZD A;  2KI8 A;  2DMR A;  3IR7 A;  2C45 A;  1R27 A;  1TMO A;  3IR6 A;  1FDI A;  2WAQ A;  4RV0 A;  2VUM A;  5FTN A;  2JIM A;  5C18 A;  1KQG A;  3QC8 A;  4KLN A;  3GTM A;  1TWH A;  2NVY A;  2JIQ A;  2JA7 A;  4CRY G;  1E61 A;  3CF2 A;  2VPX A;  4C2M A;  1H5N A;  1IW7 D;  1G8J A;  3CQZ A;  2JIR A;  1EU1 A;  1E5V A;  1PYU B;  5C1B A;  3GTJ A;  1TWF A;  2NAP A;  1G8K A;  1Y5I A;  1FDO A;  2JIO A;  4AON B;  4AAY A;  4GA6 A;  3QWZ A;  2VPY A;  2VPW A;  1QDN A;  5DYI A;  2Y0S A;  1R9T A;  1CZ4 A;  1PT0 A;  2B63 A;  1R7R A;  1UHE A;  1H0H A;  2JA5 A;  2V3V A;  3HU3 A;  1AA6 A;  5FTK A;  2JA6 A;  2E2H A;  3GTL A;  4KDL A;  1SIW A;  2PJH B;  3IR5 A;  1VC3 B;  1KQF A;  3TM7 B;  3GTG A;  2JIP A;  2NYA A;  1PYQ A;  2NVX A;  1QCS A;  1TWG A;  1PQH A;  4KO8 A;  1CR5 A;  1YLE A;  2VPZ A;  3DMR A;  4QIW A;  1I3Q A;  1E18 A;  5T5I D;  4DMR A;  4D7Z B;  3GTQ A;  2PMZ A;  1E60 A;  1E32 A;  1TWA A;  1SFO A;  5FTL A;  3QQ8 A;  3PLX B;  1UHD A;  1DMR A;  3QQ7 A;  5FTJ A;  3GTK A;  3FKI A;  4KOD A;  2YU9 A;  4KDI A;  4AYB A;  4CRZ A;  1I50 A;  1PQF A;  3ML1 A;  1Q16 A;  1WCM A;  2WB1 A;  2E7Z A;  3O5A A; 
#chains in the Genus database with same CATH topology
 2A6E D;  5GM9 A;  5DYG A;  1PPY A;  5B6C A;  4CS0 A;  3X2P A;  1PQE A;  3HKZ A;  1SMY D;  1DMS A;  4AOK B;  5FTM A;  1CZ5 A;  2A68 D;  1PT1 A;  5EPP A;  2R93 A;  5T5M D;  5GLF A;  3H0G A;  4GA5 A;  5H4U A;  4AVR A;  1K83 A;  1N10 A;  1OGY A;  2EEO B;  1WLF A;  2V45 A;  2GAE A;  1AW8 B;  3X2O A;  1TWC A;  3OUG A;  2PIC A;  2R92 A;  2IV2 X;  1S3S A;  3GTP A;  1Y1W A;  3SUM A;  4FG4 A;  3D30 A;  2BH0 A;  5GLX A;  3TIW A;  1Y1V A;  1Y4Z A;  3X2L A;  3HU1 A;  2BE5 D;  2R7Z A;  3X2H A;  3GTO A;  2E2I A;  2HCZ X;  3HU2 A;  4AZD A;  2KI8 A;  2DMR A;  3IR7 A;  2C45 A;  1BW4 A;  1BW3 A;  1R27 A;  1TMO A;  3IR6 A;  1FDI A;  2WAQ A;  4RV0 A;  2VUM A;  5FTN A;  2JIM A;  5C18 A;  1KQG A;  3QC8 A;  4KLN A;  3GTM A;  1OA7 A;  1TWH A;  2NVY A;  2JIQ A;  2A6H D;  2JA7 A;  3X2N A;  4CRY G;  1E61 A;  3CF2 A;  2VPX A;  3M3G A;  1H5N A;  4C2M A;  1IW7 D;  1G8J A;  3CQZ A;  4JCW A;  2JIR A;  1EU1 A;  1E5V A;  1PYU B;  5C1B A;  3GTJ A;  1TWF A;  2NAP A;  1G8K A;  2PNW A;  4NOH A;  3X2G A;  1Y5I A;  1FDO A;  1ZYR D;  2JIO A;  4AON B;  4AAY A;  4GA6 A;  3QWZ A;  1YNJ D;  2VPW A;  2VPY A;  3SUJ A;  1QDN A;  5DYI A;  2Y0S A;  2AE0 X;  1R9T A;  1CZ4 A;  3CZB A;  1PT0 A;  2B63 A;  1R7R A;  2PJJ A;  4FG2 A;  4ENG A;  1UHE A;  1H0H A;  4JS7 A;  2JA5 A;  1ZC1 A;  1YNN D;  2V3V A;  3HU3 A;  1AA6 A;  4FER A;  5FTK A;  2JA6 A;  3SUK A;  2E2H A;  2PI8 A;  4ZM7 A;  3GTL A;  4KDL A;  2CW0 D;  2A69 D;  1SIW A;  2PJH B;  1OA9 A;  2ENG A;  2G6G A;  3IR5 A;  2YUJ A;  1VC3 B;  1KQF A;  3TM7 B;  3SUL A;  2O5J D;  4JJO A;  4FFT A;  3GTG A;  2JIP A;  2NYA A;  3X2J A;  1PYQ A;  3X2K A;  1L8F A;  2NVX A;  4JP7 A;  1QCS A;  1TWG A;  1HD5 A;  2KQA A;  1PQH A;  4KO8 A;  1CR5 A;  1YLE A;  3X2I A;  2VPZ A;  3DMR A;  4QIW A;  1I3Q A;  3ENG A;  1E18 A;  5T5I D;  4DMR A;  4D7Z B;  4L48 A;  3GTQ A;  2PMZ A;  5GLY A;  1E60 A;  1E32 A;  1TWA A;  2G5D A;  5FTL A;  1SFO A;  3QQ8 A;  3PLX B;  1UHD A;  1DMR A;  3QQ7 A;  4JP6 A;  5FTJ A;  3GTK A;  3FKI A;  4KOD A;  2YU9 A;  4KDI A;  4AYB A;  4CRZ A;  1I50 A;  1PQF A;  3ML1 A;  1Q16 A;  1WCM A;  2WB1 A;  3X2M A;  2E7Z A;  3O5A A;  1WC2 A; 
#chains in the Genus database with same CATH homology
 2A6E D;  5DYG A;  1PPY A;  5B6C A;  4CS0 A;  1PQE A;  3HKZ A;  1SMY D;  1DMS A;  4AOK B;  5FTM A;  1CZ5 A;  2A68 D;  1PT1 A;  5EPP A;  2R93 A;  5T5M D;  5GLF A;  3H0G A;  4GA5 A;  1K83 A;  1OGY A;  2EEO B;  1WLF A;  2V45 A;  2GAE A;  1AW8 B;  1TWC A;  3OUG A;  2PIC A;  2R92 A;  2IV2 X;  1S3S A;  3GTP A;  1Y1W A;  3TIW A;  1Y1V A;  1Y4Z A;  3HU1 A;  2BE5 D;  2R7Z A;  3GTO A;  2E2I A;  3HU2 A;  4AZD A;  2KI8 A;  2DMR A;  3IR7 A;  2C45 A;  1R27 A;  1TMO A;  3IR6 A;  1FDI A;  2WAQ A;  4RV0 A;  2VUM A;  5FTN A;  2JIM A;  5C18 A;  1KQG A;  3QC8 A;  4KLN A;  3GTM A;  1TWH A;  2NVY A;  2JIQ A;  2A6H D;  2JA7 A;  4CRY G;  1E61 A;  3CF2 A;  2VPX A;  4C2M A;  1H5N A;  1IW7 D;  1G8J A;  3CQZ A;  2JIR A;  1EU1 A;  1E5V A;  1PYU B;  5C1B A;  3GTJ A;  1TWF A;  2NAP A;  1G8K A;  2PNW A;  4NOH A;  1Y5I A;  1FDO A;  1ZYR D;  2JIO A;  4AON B;  4AAY A;  4GA6 A;  3QWZ A;  1YNJ D;  2VPW A;  2VPY A;  1QDN A;  5DYI A;  2Y0S A;  2AE0 X;  1R9T A;  1CZ4 A;  3CZB A;  1PT0 A;  2B63 A;  1R7R A;  2PJJ A;  1UHE A;  1H0H A;  2JA5 A;  1ZC1 A;  1YNN D;  2V3V A;  3HU3 A;  1AA6 A;  5FTK A;  2JA6 A;  2E2H A;  2PI8 A;  3GTL A;  4KDL A;  2CW0 D;  2A69 D;  1SIW A;  2PJH B;  2G6G A;  3IR5 A;  2YUJ A;  1VC3 B;  1KQF A;  3TM7 B;  2O5J D;  3GTG A;  2JIP A;  2NYA A;  1PYQ A;  2NVX A;  1QCS A;  1TWG A;  1PQH A;  4KO8 A;  1CR5 A;  1YLE A;  2VPZ A;  3DMR A;  4QIW A;  1I3Q A;  1E18 A;  5T5I D;  4DMR A;  4D7Z B;  3GTQ A;  2PMZ A;  1E60 A;  1E32 A;  1TWA A;  2G5D A;  5FTL A;  1SFO A;  3QQ8 A;  3PLX B;  1UHD A;  1DMR A;  3QQ7 A;  5FTJ A;  3GTK A;  3FKI A;  4KOD A;  2YU9 A;  4KDI A;  4AYB A;  4CRZ A;  1I50 A;  1PQF A;  3ML1 A;  1Q16 A;  1WCM A;  2WB1 A;  2E7Z A;  3O5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...