1PYUB

Processed aspartate decarboxylase mutant with ser25 mutated to cys
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
CCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Constraints on protein self-processing in L-aspartate-alpha-decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase beta chain
total genus 23
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1pyuB00
2JA6A 1TWCA 1G8JA 1TMOA 2IV2X 1SIWA 5T5ID 3TIWA 4KDIA 1DMSA 4CRYG 1H0HA 1UHDA 4D7ZB 2NYAA 1IW7D 1QCSA 5FTKA 2VPZA 2JIMA 5DYGA 4QIWA 2VUMA 1FDOA 5FTLA 4AONB 1Y1VA 1QDNA 2KI8A 1K83A 1R27A 3GTGA 1E18A 4DMRA 1FDIA 1OGYA 3HKZA 1PYQA 4GA6A 3H0GA 2WAQA 3QWZA 3O5AA 3HU1A 1AW8B 2VPYA 2C45A 4AAYA 5C1BA 3QQ8A 1EU1A 4CS0A 1PQHA 2NVXA 1DMRA 2R7ZA 2JIPA 3IR7A 1R9TA 3GTJA 3TM7B 2E2HA 5FTNA 1E32A 3IR6A 3HU3A 1E60A 2EEOB 5EPPA 5FTMA 4KDLA 3GTKA 3QQ7A 4CRZA 1Y1WA 2WB1A 2E7ZA 2YU9A 3GTLA 1S3SA 3IR5A 3ML1A 2JIQA 2JA7A 1I50A 2VPWA 2JA5A 1VC3B 3GTMA 5B6CA 3FKIA 1R7RA 1TWGA 2PMZA 1TWHA 1PPYA 1Q16A 2PJHB 4RV0A 2JIOA 4KO8A 1WLFA 2V45A 2Y0SA 2E2IA 1H5NA 3GTQA 1G8KA 3CQZA 1UHEA 3OUGA 3CF2A 1TWFA 1SFOA 3HU2A 5T5MD 1PYUB 2NAPA 1KQGA 2JIRA 5FTJA 2R93A 1CR5A 3GTOA 1PT0A 2R92A 2V3VA 3PLXB 4AZDA 1WCMA 4KODA 3GTPA 1CZ4A 1KQFA 1TWAA 1PQEA 1CZ5A 4GA5A 2B63A 1PT1A 2NVYA 1YLEA 4AYBA 4C2MA 4KLNA 3DMRA 1AA6A 1E61A 2VPXA 1I3QA 5GLFA 1E5VA 1Y4ZA 3QC8A 1Y5IA 5DYIA 5C18A 1PQFA 2DMRA 4AOKB
chains in the Genus database with same CATH superfamily
2JA6A 1TWCA 1G8JA 1TMOA 2AE0X 2IV2X 1L8FA 3M3GA 1SIWA 2A68D 5T5ID 4FG4A 3TIWA 4KDIA 1DMSA 4CRYG 1H0HA 1UHDA 4D7ZB 2NYAA 1IW7D 1QCSA 5FTKA 2VPZA 2JIMA 5DYGA 3SUMA 4QIWA 2PI8A 2PNWA 3X2GA 2VUMA 1FDOA 5H4UA 5FTLA 4AONB 1Y1VA 4ENGA 1QDNA 4JS7A 3X2LA 2KI8A 1K83A 1R27A 2G6GA 3GTGA 1E18A 4DMRA 1FDIA 3X2IA 1OGYA 3HKZA 1PYQA 2BH0A 4GA6A 2HCZX 3H0GA 1BW4A 2ENGA 2WAQA 3QWZA 3O5AA 2CW0D 1OA7A 3HU1A 1AW8B 2VPYA 2C45A 4AAYA 5C1BA 3QQ8A 1EU1A 4CS0A 1PQHA 4JP6A 2NVXA 1DMRA 2R7ZA 2JIPA 3IR7A 3CZBA 1R9TA 3GTJA 3X2NA 4FFTA 3TM7B 2E2HA 5FTNA 1E32A 1YNJD 3IR6A 4L48A 4AVRA 1BW3A 3HU3A 1E60A 2EEOB 5EPPA 5FTMA 4KDLA 2PICA 3QQ7A 5GLYA 4CRZA 2A6ED 4ZM7A 3X2MA 3GTKA 1Y1WA 2WB1A 2E7ZA 2YU9A 1ZC1A 1S3SA 3IR5A 3GTLA 3ML1A 2JIQA 2JA7A 2GAEA 1I50A 2VPWA 2JA5A 1VC3B 3X2KA 3X2PA 3GTMA 5B6CA 5GLXA 3FKIA 1R7RA 1TWGA 1WC2A 2PMZA 3X2JA 1TWHA 1PPYA 1SMYD 3SUKA 3SULA 1Q16A 2BE5D 2PJHB 4NOHA 4RV0A 2JIOA 4KO8A 1WLFA 2V45A 2Y0SA 2E2IA 1H5NA 3GTQA 1G8KA 3CQZA 1UHEA 3OUGA 3CF2A 4FG2A 1YNND 1TWFA 1SFOA 3HU2A 5T5MD 1PYUB 2NAPA 1KQGA 2JIRA 2O5JD 5FTJA 2R93A 3D30A 1N10A 1CR5A 1HD5A 3GTOA 2YUJA 3ENGA 1PT0A 4FERA 2V3VA 3PLXB 2R92A 5GM9A 4JP7A 1WCMA 2A69D 4KODA 4AZDA 1CZ4A 1KQFA 3GTPA 1TWAA 1PQEA 1CZ5A 3X2HA 2A6HD 4GA5A 2B63A 4JCWA 1PT1A 1OA9A 4JJOA 2G5DA 2NVYA 1YLEA 4AYBA 4C2MA 4KLNA 3SUJA 3DMRA 1AA6A 1E61A 2VPXA 1I3QA 5GLFA 1E5VA 2PJJA 1Y4ZA 3QC8A 1Y5IA 3X2OA 5DYIA 5C18A 2KQAA 1PQFA 1ZYRD 2DMRA 4AOKB
chains in the Genus database with same CATH topology
2JA6A 1TWCA 1G8JA 1TMOA 2AE0X 2IV2X 1SIWA 2A68D 5T5ID 3TIWA 4KDIA 1DMSA 4CRYG 1H0HA 1UHDA 4D7ZB 2NYAA 1IW7D 1QCSA 5FTKA 2VPZA 2JIMA 5DYGA 4QIWA 2PI8A 2PNWA 2VUMA 1FDOA 5FTLA 4AONB 1Y1VA 1QDNA 2KI8A 1K83A 1R27A 2G6GA 3GTGA 1E18A 4DMRA 1FDIA 1OGYA 3HKZA 1PYQA 4GA6A 3H0GA 2WAQA 3QWZA 3O5AA 2CW0D 3HU1A 1AW8B 2VPYA 2C45A 4AAYA 5C1BA 3QQ8A 1EU1A 4CS0A 1PQHA 2NVXA 1DMRA 2R7ZA 2JIPA 3IR7A 3CZBA 1R9TA 3GTJA 3TM7B 2E2HA 5FTNA 1E32A 1YNJD 3IR6A 3HU3A 1E60A 2EEOB 5EPPA 5FTMA 4KDLA 2PICA 3QQ7A 4CRZA 3GTKA 2A6ED 1Y1WA 2WB1A 2E7ZA 2YU9A 1ZC1A 1S3SA 3IR5A 3GTLA 3ML1A 2JIQA 2JA7A 2GAEA 1I50A 2VPWA 2JA5A 1VC3B 3GTMA 5B6CA 3FKIA 1R7RA 1TWGA 2PMZA 1TWHA 1PPYA 1SMYD 1Q16A 2BE5D 2PJHB 4NOHA 4RV0A 2JIOA 4KO8A 1WLFA 2V45A 2Y0SA 2E2IA 1H5NA 3GTQA 1G8KA 3CQZA 1UHEA 3OUGA 3CF2A 1YNND 1TWFA 1SFOA 3HU2A 5T5MD 1PYUB 2NAPA 1KQGA 2JIRA 2O5JD 5FTJA 2R93A 1CR5A 3GTOA 2YUJA 1PT0A 2R92A 2V3VA 3PLXB 4AZDA 1WCMA 2A69D 4KODA 3GTPA 1CZ4A 1KQFA 1TWAA 1PQEA 1CZ5A 2A6HD 4GA5A 2B63A 1PT1A 2G5DA 2NVYA 1YLEA 4AYBA 4C2MA 4KLNA 3DMRA 1AA6A 1E61A 2VPXA 1I3QA 5GLFA 1E5VA 2PJJA 1Y4ZA 3QC8A 1Y5IA 5DYIA 5C18A 1PQFA 1ZYRD 2DMRA 4AOKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 A;  1TWC A;  1G8J A;  1TMO A;  2IV2 X;  1SIW A;  5T5I D;  3TIW A;  4KDI A;  1DMS A;  4CRY G;  1H0H A;  1UHD A;  4D7Z B;  2NYA A;  1IW7 D;  1QCS A;  5FTK A;  2VPZ A;  2JIM A;  5DYG A;  4QIW A;  2VUM A;  1FDO A;  5FTL A;  4AON B;  1Y1V A;  1QDN A;  2KI8 A;  1K83 A;  1R27 A;  3GTG A;  1E18 A;  4DMR A;  1FDI A;  1OGY A;  3HKZ A;  1PYQ A;  4GA6 A;  3H0G A;  2WAQ A;  3QWZ A;  3O5A A;  3HU1 A;  1AW8 B;  2VPY A;  2C45 A;  4AAY A;  5C1B A;  3QQ8 A;  1EU1 A;  4CS0 A;  1PQH A;  2NVX A;  1DMR A;  2R7Z A;  2JIP A;  3IR7 A;  1R9T A;  3GTJ A;  3TM7 B;  2E2H A;  5FTN A;  1E32 A;  3IR6 A;  3HU3 A;  1E60 A;  2EEO B;  5EPP A;  5FTM A;  4KDL A;  3GTK A;  3QQ7 A;  4CRZ A;  1Y1W A;  2WB1 A;  2E7Z A;  2YU9 A;  3GTL A;  1S3S A;  3IR5 A;  3ML1 A;  2JIQ A;  2JA7 A;  1I50 A;  2VPW A;  2JA5 A;  1VC3 B;  3GTM A;  5B6C A;  3FKI A;  1R7R A;  1TWG A;  2PMZ A;  1TWH A;  1PPY A;  1Q16 A;  2PJH B;  4RV0 A;  2JIO A;  4KO8 A;  1WLF A;  2V45 A;  2Y0S A;  2E2I A;  1H5N A;  3GTQ A;  1G8K A;  3CQZ A;  1UHE A;  3OUG A;  3CF2 A;  1TWF A;  1SFO A;  3HU2 A;  5T5M D;  1PYU B;  2NAP A;  1KQG A;  2JIR A;  5FTJ A;  2R93 A;  1CR5 A;  3GTO A;  1PT0 A;  2R92 A;  2V3V A;  3PLX B;  4AZD A;  1WCM A;  4KOD A;  3GTP A;  1CZ4 A;  1KQF A;  1TWA A;  1PQE A;  1CZ5 A;  4GA5 A;  2B63 A;  1PT1 A;  2NVY A;  1YLE A;  4AYB A;  4C2M A;  4KLN A;  3DMR A;  1AA6 A;  1E61 A;  2VPX A;  1I3Q A;  5GLF A;  1E5V A;  1Y4Z A;  3QC8 A;  1Y5I A;  5DYI A;  5C18 A;  1PQF A;  2DMR A;  4AOK B; 
#chains in the Genus database with same CATH topology
 2JA6 A;  1TWC A;  1G8J A;  1TMO A;  2AE0 X;  2IV2 X;  1L8F A;  3M3G A;  1SIW A;  2A68 D;  5T5I D;  4FG4 A;  3TIW A;  4KDI A;  1DMS A;  4CRY G;  1H0H A;  1UHD A;  4D7Z B;  2NYA A;  1IW7 D;  1QCS A;  5FTK A;  2VPZ A;  2JIM A;  5DYG A;  3SUM A;  4QIW A;  2PI8 A;  2PNW A;  3X2G A;  2VUM A;  1FDO A;  5H4U A;  5FTL A;  4AON B;  1Y1V A;  4ENG A;  1QDN A;  4JS7 A;  3X2L A;  2KI8 A;  1K83 A;  1R27 A;  2G6G A;  3GTG A;  1E18 A;  4DMR A;  1FDI A;  3X2I A;  1OGY A;  3HKZ A;  1PYQ A;  2BH0 A;  4GA6 A;  2HCZ X;  3H0G A;  1BW4 A;  2ENG A;  2WAQ A;  3QWZ A;  3O5A A;  2CW0 D;  1OA7 A;  3HU1 A;  1AW8 B;  2VPY A;  2C45 A;  4AAY A;  5C1B A;  3QQ8 A;  1EU1 A;  4CS0 A;  1PQH A;  4JP6 A;  2NVX A;  1DMR A;  2R7Z A;  2JIP A;  3IR7 A;  3CZB A;  1R9T A;  3GTJ A;  3X2N A;  4FFT A;  3TM7 B;  2E2H A;  5FTN A;  1E32 A;  1YNJ D;  3IR6 A;  4L48 A;  4AVR A;  1BW3 A;  3HU3 A;  1E60 A;  2EEO B;  5EPP A;  5FTM A;  4KDL A;  2PIC A;  3QQ7 A;  5GLY A;  4CRZ A;  2A6E D;  4ZM7 A;  3X2M A;  3GTK A;  1Y1W A;  2WB1 A;  2E7Z A;  2YU9 A;  1ZC1 A;  1S3S A;  3IR5 A;  3GTL A;  3ML1 A;  2JIQ A;  2JA7 A;  2GAE A;  1I50 A;  2VPW A;  2JA5 A;  1VC3 B;  3X2K A;  3X2P A;  3GTM A;  5B6C A;  5GLX A;  3FKI A;  1R7R A;  1TWG A;  1WC2 A;  2PMZ A;  3X2J A;  1TWH A;  1PPY A;  1SMY D;  3SUK A;  3SUL A;  1Q16 A;  2BE5 D;  2PJH B;  4NOH A;  4RV0 A;  2JIO A;  4KO8 A;  1WLF A;  2V45 A;  2Y0S A;  2E2I A;  1H5N A;  3GTQ A;  1G8K A;  3CQZ A;  1UHE A;  3OUG A;  3CF2 A;  4FG2 A;  1YNN D;  1TWF A;  1SFO A;  3HU2 A;  5T5M D;  1PYU B;  2NAP A;  1KQG A;  2JIR A;  2O5J D;  5FTJ A;  2R93 A;  3D30 A;  1N10 A;  1CR5 A;  1HD5 A;  3GTO A;  2YUJ A;  3ENG A;  1PT0 A;  4FER A;  2V3V A;  3PLX B;  2R92 A;  5GM9 A;  4JP7 A;  1WCM A;  2A69 D;  4KOD A;  4AZD A;  1CZ4 A;  1KQF A;  3GTP A;  1TWA A;  1PQE A;  1CZ5 A;  3X2H A;  2A6H D;  4GA5 A;  2B63 A;  4JCW A;  1PT1 A;  1OA9 A;  4JJO A;  2G5D A;  2NVY A;  1YLE A;  4AYB A;  4C2M A;  4KLN A;  3SUJ A;  3DMR A;  1AA6 A;  1E61 A;  2VPX A;  1I3Q A;  5GLF A;  1E5V A;  2PJJ A;  1Y4Z A;  3QC8 A;  1Y5I A;  3X2O A;  5DYI A;  5C18 A;  2KQA A;  1PQF A;  1ZYR D;  2DMR A;  4AOK B; 
#chains in the Genus database with same CATH homology
 2JA6 A;  1TWC A;  1G8J A;  1TMO A;  2AE0 X;  2IV2 X;  1SIW A;  2A68 D;  5T5I D;  3TIW A;  4KDI A;  1DMS A;  4CRY G;  1H0H A;  1UHD A;  4D7Z B;  2NYA A;  1IW7 D;  1QCS A;  5FTK A;  2VPZ A;  2JIM A;  5DYG A;  4QIW A;  2PI8 A;  2PNW A;  2VUM A;  1FDO A;  5FTL A;  4AON B;  1Y1V A;  1QDN A;  2KI8 A;  1K83 A;  1R27 A;  2G6G A;  3GTG A;  1E18 A;  4DMR A;  1FDI A;  1OGY A;  3HKZ A;  1PYQ A;  4GA6 A;  3H0G A;  2WAQ A;  3QWZ A;  3O5A A;  2CW0 D;  3HU1 A;  1AW8 B;  2VPY A;  2C45 A;  4AAY A;  5C1B A;  3QQ8 A;  1EU1 A;  4CS0 A;  1PQH A;  2NVX A;  1DMR A;  2R7Z A;  2JIP A;  3IR7 A;  3CZB A;  1R9T A;  3GTJ A;  3TM7 B;  2E2H A;  5FTN A;  1E32 A;  1YNJ D;  3IR6 A;  3HU3 A;  1E60 A;  2EEO B;  5EPP A;  5FTM A;  4KDL A;  2PIC A;  3QQ7 A;  4CRZ A;  3GTK A;  2A6E D;  1Y1W A;  2WB1 A;  2E7Z A;  2YU9 A;  1ZC1 A;  1S3S A;  3IR5 A;  3GTL A;  3ML1 A;  2JIQ A;  2JA7 A;  2GAE A;  1I50 A;  2VPW A;  2JA5 A;  1VC3 B;  3GTM A;  5B6C A;  3FKI A;  1R7R A;  1TWG A;  2PMZ A;  1TWH A;  1PPY A;  1SMY D;  1Q16 A;  2BE5 D;  2PJH B;  4NOH A;  4RV0 A;  2JIO A;  4KO8 A;  1WLF A;  2V45 A;  2Y0S A;  2E2I A;  1H5N A;  3GTQ A;  1G8K A;  3CQZ A;  1UHE A;  3OUG A;  3CF2 A;  1YNN D;  1TWF A;  1SFO A;  3HU2 A;  5T5M D;  1PYU B;  2NAP A;  1KQG A;  2JIR A;  2O5J D;  5FTJ A;  2R93 A;  1CR5 A;  3GTO A;  2YUJ A;  1PT0 A;  2R92 A;  2V3V A;  3PLX B;  4AZD A;  1WCM A;  2A69 D;  4KOD A;  3GTP A;  1CZ4 A;  1KQF A;  1TWA A;  1PQE A;  1CZ5 A;  2A6H D;  4GA5 A;  2B63 A;  1PT1 A;  2G5D A;  2NVY A;  1YLE A;  4AYB A;  4C2M A;  4KLN A;  3DMR A;  1AA6 A;  1E61 A;  2VPX A;  1I3Q A;  5GLF A;  1E5V A;  2PJJ A;  1Y4Z A;  3QC8 A;  1Y5I A;  5DYI A;  5C18 A;  1PQF A;  1ZYR D;  2DMR A;  4AOK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...