1VC3B

Crystal structure of l-aspartate-alpha-decarboxylase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of L-Aspartate-alpha-Decarboxylase
rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords L-Aspartate-alpha-Decarboxylase light chain
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1vc3B00
2JIQA 1Y5IA 3QC8A 2NAPA 4AONB 4AZDA 2WAQA 1PYQA 1UHDA 2R92A 1Y1VA 3FKIA 2NYAA 2VUMA 1CZ4A 1PQHA 2DMRA 1SIWA 5FTLA 1FDOA 2V45A 2E7ZA 5DYGA 2JA7A 1TWHA 2EEOB 1I3QA 4KLNA 5T5ID 5C18A 4D7ZB 1Y4ZA 1YLEA 4KDLA 1UHEA 2Y0SA 1AA6A 1CZ5A 1PPYA 3QQ8A 1I50A 4AYBA 2E2IA 1K83A 3HU3A 2IV2X 4GA6A 2YU9A 1S3SA 1E60A 3GTJA 5FTJA 1Q16A 3ML1A 1R9TA 1PYUB 1QDNA 1WCMA 3DMRA 5C1BA 1TWCA 2R93A 2C45A 3IR6A 4RV0A 1FDIA 3TIWA 2JA6A 2VPYA 2NVYA 4AAYA 4CRYG 1G8JA 1OGYA 1DMSA 1TMOA 3GTMA 3QQ7A 1CR5A 5DYIA 1PQFA 3CQZA 1Y1WA 2VPWA 1VC3B 3IR7A 4KO8A 3QWZA 1WLFA 2JIRA 2JIMA 3H0GA 1PT0A 2JIPA 1QCSA 1AW8B 5B6CA 2VPXA 1IW7D 1TWGA 1SFOA 2R7ZA 3HKZA 1E18A 2NVXA 5FTNA 1DMRA 1G8KA 2JIOA 1H0HA 3PLXB 3GTOA 3GTGA 1KQFA 4KDIA 5T5MD 2VPZA 3IR5A 1E61A 2WB1A 2E2HA 1E5VA 3OUGA 5FTKA 4KODA 3GTQA 4AOKB 1E32A 1EU1A 5FTMA 4C2MA 1H5NA 3GTKA 4DMRA 3GTLA 1R27A 2KI8A 3HU1A 3TM7B 2PMZA 2B63A 3HU2A 2PJHB 4CS0A 1PT1A 3O5AA 3CF2A 3GTPA 2JA5A 5GLFA 1TWFA 4CRZA 1R7RA 5EPPA 2V3VA 4GA5A 4QIWA 1KQGA 1PQEA 1TWAA
chains in the Genus database with same CATH superfamily
2JIQA 1Y5IA 3QC8A 2NAPA 5GLXA 4AONB 4AZDA 2WAQA 2GAEA 1PYQA 3X2PA 1UHDA 2R92A 1Y1VA 3FKIA 2NYAA 3ENGA 2G5DA 2VUMA 4JP7A 2HCZX 1CZ4A 5GM9A 2PNWA 1PQHA 2DMRA 1SIWA 5FTLA 1FDOA 2V45A 3D30A 2E7ZA 5DYGA 2JA7A 1TWHA 3X2GA 2EEOB 3M3GA 4KLNA 5T5ID 4FG4A 1I3QA 5C18A 2KQAA 1OA7A 4D7ZB 1Y4ZA 3X2OA 1Y1WA 1YLEA 4KDLA 1UHEA 2Y0SA 1AA6A 1SMYD 1CZ5A 1PPYA 3QQ8A 4FERA 1I50A 3SULA 2BH0A 4AYBA 2E2IA 2PJJA 3SUMA 3HU3A 1K83A 2IV2X 2PICA 4GA6A 5GLYA 2YU9A 1S3SA 1E60A 1YNND 3X2JA 3GTJA 2A69D 1BW4A 1YNJD 5FTJA 1ZYRD 4ENGA 1Q16A 3ML1A 1R9TA 4FG2A 1PYUB 1QDNA 1WCMA 2A6HD 3DMRA 5C1BA 1TWCA 2R93A 4JS7A 2C45A 3IR6A 4RV0A 3X2MA 1FDIA 3TIWA 2JA6A 2VPYA 2NVYA 4AAYA 4CRYG 1G8JA 1OGYA 1DMSA 1TMOA 3GTMA 3QQ7A 1CR5A 5DYIA 1PQFA 3CQZA 3X2IA 3X2LA 2O5JD 1VC3B 2VPWA 3IR7A 4JCWA 4KO8A 3QWZA 1WLFA 2G6GA 1OA9A 2JIRA 2A68D 2A6ED 3X2KA 4AVRA 2JIMA 3H0GA 1PT0A 1HD5A 3X2NA 4ZM7A 2JIPA 1QCSA 1WC2A 1AW8B 5B6CA 2PI8A 2VPXA 1IW7D 1TWGA 1SFOA 3CZBA 2R7ZA 3HKZA 1E18A 2NVXA 5FTNA 1DMRA 1G8KA 2JIOA 1H0HA 3PLXB 3GTOA 3GTGA 1KQFA 1ZC1A 4KDIA 5T5MD 2VPZA 3IR5A 1E61A 2WB1A 2E2HA 3SUKA 1E5VA 3OUGA 5FTKA 4KODA 3GTQA 4AOKB 1E32A 1EU1A 2BE5D 5FTMA 2CW0D 4C2MA 1H5NA 5H4UA 2ENGA 3GTKA 4DMRA 3GTLA 1R27A 2KI8A 2YUJA 3HU1A 3TM7B 4JP6A 2PMZA 2AE0X 1L8FA 2B63A 3HU2A 2PJHB 4CS0A 1PT1A 4JJOA 1N10A 3O5AA 3CF2A 4FFTA 3GTPA 2JA5A 5GLFA 1BW3A 1TWFA 4CRZA 1R7RA 5EPPA 2V3VA 4GA5A 4NOHA 4QIWA 4L48A 1KQGA 1PQEA 3SUJA 3X2HA 1TWAA
chains in the Genus database with same CATH topology
2JIQA 1Y5IA 3QC8A 2NAPA 4AONB 4AZDA 2WAQA 2GAEA 1PYQA 1UHDA 2R92A 1Y1VA 3FKIA 2NYAA 2G5DA 2VUMA 1CZ4A 2PNWA 1PQHA 2DMRA 1SIWA 5FTLA 1FDOA 2V45A 2E7ZA 5DYGA 2JA7A 1TWHA 2EEOB 1I3QA 4KLNA 5T5ID 5C18A 4D7ZB 1Y4ZA 1YLEA 4KDLA 1UHEA 2Y0SA 1AA6A 1SMYD 1CZ5A 1PPYA 3QQ8A 1I50A 4AYBA 2E2IA 2PJJA 1K83A 3HU3A 2IV2X 2PICA 4GA6A 2YU9A 1S3SA 1E60A 1YNND 3GTJA 2A69D 1YNJD 5FTJA 1ZYRD 1Q16A 3ML1A 1R9TA 1PYUB 1QDNA 1WCMA 2A6HD 3DMRA 5C1BA 1TWCA 2R93A 2C45A 3IR6A 4RV0A 1FDIA 3TIWA 2JA6A 2VPYA 2NVYA 4AAYA 4CRYG 1G8JA 1OGYA 1DMSA 1TMOA 3GTMA 3QQ7A 1CR5A 5DYIA 1PQFA 3CQZA 2O5JD 1Y1WA 1VC3B 2VPWA 3IR7A 4KO8A 3QWZA 1WLFA 2G6GA 2JIRA 2A68D 2A6ED 2JIMA 3H0GA 1PT0A 2JIPA 1QCSA 1AW8B 5B6CA 2PI8A 2VPXA 1IW7D 1TWGA 1SFOA 3CZBA 2R7ZA 3HKZA 1E18A 2NVXA 5FTNA 1DMRA 1G8KA 2JIOA 1H0HA 3PLXB 3GTOA 3GTGA 1KQFA 1ZC1A 4KDIA 5T5MD 2VPZA 3IR5A 1E61A 2WB1A 2E2HA 1E5VA 3OUGA 5FTKA 4KODA 3GTQA 4AOKB 1E32A 1EU1A 2BE5D 5FTMA 2CW0D 4C2MA 1H5NA 3GTKA 4DMRA 3GTLA 1R27A 2KI8A 2YUJA 3HU1A 3TM7B 2PMZA 2AE0X 2B63A 3HU2A 2PJHB 4CS0A 1PT1A 3O5AA 3CF2A 3GTPA 2JA5A 5GLFA 1TWFA 4CRZA 1R7RA 5EPPA 2V3VA 4GA5A 4NOHA 4QIWA 1KQGA 1PQEA 1TWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JIQ A;  1Y5I A;  3QC8 A;  2NAP A;  4AON B;  4AZD A;  2WAQ A;  1PYQ A;  1UHD A;  2R92 A;  1Y1V A;  3FKI A;  2NYA A;  2VUM A;  1CZ4 A;  1PQH A;  2DMR A;  1SIW A;  5FTL A;  1FDO A;  2V45 A;  2E7Z A;  5DYG A;  2JA7 A;  1TWH A;  2EEO B;  1I3Q A;  4KLN A;  5T5I D;  5C18 A;  4D7Z B;  1Y4Z A;  1YLE A;  4KDL A;  1UHE A;  2Y0S A;  1AA6 A;  1CZ5 A;  1PPY A;  3QQ8 A;  1I50 A;  4AYB A;  2E2I A;  1K83 A;  3HU3 A;  2IV2 X;  4GA6 A;  2YU9 A;  1S3S A;  1E60 A;  3GTJ A;  5FTJ A;  1Q16 A;  3ML1 A;  1R9T A;  1PYU B;  1QDN A;  1WCM A;  3DMR A;  5C1B A;  1TWC A;  2R93 A;  2C45 A;  3IR6 A;  4RV0 A;  1FDI A;  3TIW A;  2JA6 A;  2VPY A;  2NVY A;  4AAY A;  4CRY G;  1G8J A;  1OGY A;  1DMS A;  1TMO A;  3GTM A;  3QQ7 A;  1CR5 A;  5DYI A;  1PQF A;  3CQZ A;  1Y1W A;  2VPW A;  1VC3 B;  3IR7 A;  4KO8 A;  3QWZ A;  1WLF A;  2JIR A;  2JIM A;  3H0G A;  1PT0 A;  2JIP A;  1QCS A;  1AW8 B;  5B6C A;  2VPX A;  1IW7 D;  1TWG A;  1SFO A;  2R7Z A;  3HKZ A;  1E18 A;  2NVX A;  5FTN A;  1DMR A;  1G8K A;  2JIO A;  1H0H A;  3PLX B;  3GTO A;  3GTG A;  1KQF A;  4KDI A;  5T5M D;  2VPZ A;  3IR5 A;  1E61 A;  2WB1 A;  2E2H A;  1E5V A;  3OUG A;  5FTK A;  4KOD A;  3GTQ A;  4AOK B;  1E32 A;  1EU1 A;  5FTM A;  4C2M A;  1H5N A;  3GTK A;  4DMR A;  3GTL A;  1R27 A;  2KI8 A;  3HU1 A;  3TM7 B;  2PMZ A;  2B63 A;  3HU2 A;  2PJH B;  4CS0 A;  1PT1 A;  3O5A A;  3CF2 A;  3GTP A;  2JA5 A;  5GLF A;  1TWF A;  4CRZ A;  1R7R A;  5EPP A;  2V3V A;  4GA5 A;  4QIW A;  1KQG A;  1PQE A;  1TWA A; 
#chains in the Genus database with same CATH topology
 2JIQ A;  1Y5I A;  3QC8 A;  2NAP A;  5GLX A;  4AON B;  4AZD A;  2WAQ A;  2GAE A;  1PYQ A;  3X2P A;  1UHD A;  2R92 A;  1Y1V A;  3FKI A;  2NYA A;  3ENG A;  2G5D A;  2VUM A;  4JP7 A;  2HCZ X;  1CZ4 A;  5GM9 A;  2PNW A;  1PQH A;  2DMR A;  1SIW A;  5FTL A;  1FDO A;  2V45 A;  3D30 A;  2E7Z A;  5DYG A;  2JA7 A;  1TWH A;  3X2G A;  2EEO B;  3M3G A;  4KLN A;  5T5I D;  4FG4 A;  1I3Q A;  5C18 A;  2KQA A;  1OA7 A;  4D7Z B;  1Y4Z A;  3X2O A;  1Y1W A;  1YLE A;  4KDL A;  1UHE A;  2Y0S A;  1AA6 A;  1SMY D;  1CZ5 A;  1PPY A;  3QQ8 A;  4FER A;  1I50 A;  3SUL A;  2BH0 A;  4AYB A;  2E2I A;  2PJJ A;  3SUM A;  3HU3 A;  1K83 A;  2IV2 X;  2PIC A;  4GA6 A;  5GLY A;  2YU9 A;  1S3S A;  1E60 A;  1YNN D;  3X2J A;  3GTJ A;  2A69 D;  1BW4 A;  1YNJ D;  5FTJ A;  1ZYR D;  4ENG A;  1Q16 A;  3ML1 A;  1R9T A;  4FG2 A;  1PYU B;  1QDN A;  1WCM A;  2A6H D;  3DMR A;  5C1B A;  1TWC A;  2R93 A;  4JS7 A;  2C45 A;  3IR6 A;  4RV0 A;  3X2M A;  1FDI A;  3TIW A;  2JA6 A;  2VPY A;  2NVY A;  4AAY A;  4CRY G;  1G8J A;  1OGY A;  1DMS A;  1TMO A;  3GTM A;  3QQ7 A;  1CR5 A;  5DYI A;  1PQF A;  3CQZ A;  3X2I A;  3X2L A;  2O5J D;  1VC3 B;  2VPW A;  3IR7 A;  4JCW A;  4KO8 A;  3QWZ A;  1WLF A;  2G6G A;  1OA9 A;  2JIR A;  2A68 D;  2A6E D;  3X2K A;  4AVR A;  2JIM A;  3H0G A;  1PT0 A;  1HD5 A;  3X2N A;  4ZM7 A;  2JIP A;  1QCS A;  1WC2 A;  1AW8 B;  5B6C A;  2PI8 A;  2VPX A;  1IW7 D;  1TWG A;  1SFO A;  3CZB A;  2R7Z A;  3HKZ A;  1E18 A;  2NVX A;  5FTN A;  1DMR A;  1G8K A;  2JIO A;  1H0H A;  3PLX B;  3GTO A;  3GTG A;  1KQF A;  1ZC1 A;  4KDI A;  5T5M D;  2VPZ A;  3IR5 A;  1E61 A;  2WB1 A;  2E2H A;  3SUK A;  1E5V A;  3OUG A;  5FTK A;  4KOD A;  3GTQ A;  4AOK B;  1E32 A;  1EU1 A;  2BE5 D;  5FTM A;  2CW0 D;  4C2M A;  1H5N A;  5H4U A;  2ENG A;  3GTK A;  4DMR A;  3GTL A;  1R27 A;  2KI8 A;  2YUJ A;  3HU1 A;  3TM7 B;  4JP6 A;  2PMZ A;  2AE0 X;  1L8F A;  2B63 A;  3HU2 A;  2PJH B;  4CS0 A;  1PT1 A;  4JJO A;  1N10 A;  3O5A A;  3CF2 A;  4FFT A;  3GTP A;  2JA5 A;  5GLF A;  1BW3 A;  1TWF A;  4CRZ A;  1R7R A;  5EPP A;  2V3V A;  4GA5 A;  4NOH A;  4QIW A;  4L48 A;  1KQG A;  1PQE A;  3SUJ A;  3X2H A;  1TWA A; 
#chains in the Genus database with same CATH homology
 2JIQ A;  1Y5I A;  3QC8 A;  2NAP A;  4AON B;  4AZD A;  2WAQ A;  2GAE A;  1PYQ A;  1UHD A;  2R92 A;  1Y1V A;  3FKI A;  2NYA A;  2G5D A;  2VUM A;  1CZ4 A;  2PNW A;  1PQH A;  2DMR A;  1SIW A;  5FTL A;  1FDO A;  2V45 A;  2E7Z A;  5DYG A;  2JA7 A;  1TWH A;  2EEO B;  1I3Q A;  4KLN A;  5T5I D;  5C18 A;  4D7Z B;  1Y4Z A;  1YLE A;  4KDL A;  1UHE A;  2Y0S A;  1AA6 A;  1SMY D;  1CZ5 A;  1PPY A;  3QQ8 A;  1I50 A;  4AYB A;  2E2I A;  2PJJ A;  1K83 A;  3HU3 A;  2IV2 X;  2PIC A;  4GA6 A;  2YU9 A;  1S3S A;  1E60 A;  1YNN D;  3GTJ A;  2A69 D;  1YNJ D;  5FTJ A;  1ZYR D;  1Q16 A;  3ML1 A;  1R9T A;  1PYU B;  1QDN A;  1WCM A;  2A6H D;  3DMR A;  5C1B A;  1TWC A;  2R93 A;  2C45 A;  3IR6 A;  4RV0 A;  1FDI A;  3TIW A;  2JA6 A;  2VPY A;  2NVY A;  4AAY A;  4CRY G;  1G8J A;  1OGY A;  1DMS A;  1TMO A;  3GTM A;  3QQ7 A;  1CR5 A;  5DYI A;  1PQF A;  3CQZ A;  2O5J D;  1Y1W A;  1VC3 B;  2VPW A;  3IR7 A;  4KO8 A;  3QWZ A;  1WLF A;  2G6G A;  2JIR A;  2A68 D;  2A6E D;  2JIM A;  3H0G A;  1PT0 A;  2JIP A;  1QCS A;  1AW8 B;  5B6C A;  2PI8 A;  2VPX A;  1IW7 D;  1TWG A;  1SFO A;  3CZB A;  2R7Z A;  3HKZ A;  1E18 A;  2NVX A;  5FTN A;  1DMR A;  1G8K A;  2JIO A;  1H0H A;  3PLX B;  3GTO A;  3GTG A;  1KQF A;  1ZC1 A;  4KDI A;  5T5M D;  2VPZ A;  3IR5 A;  1E61 A;  2WB1 A;  2E2H A;  1E5V A;  3OUG A;  5FTK A;  4KOD A;  3GTQ A;  4AOK B;  1E32 A;  1EU1 A;  2BE5 D;  5FTM A;  2CW0 D;  4C2M A;  1H5N A;  3GTK A;  4DMR A;  3GTL A;  1R27 A;  2KI8 A;  2YUJ A;  3HU1 A;  3TM7 B;  2PMZ A;  2AE0 X;  2B63 A;  3HU2 A;  2PJH B;  4CS0 A;  1PT1 A;  3O5A A;  3CF2 A;  3GTP A;  2JA5 A;  5GLF A;  1TWF A;  4CRZ A;  1R7R A;  5EPP A;  2V3V A;  4GA5 A;  4NOH A;  4QIW A;  1KQG A;  1PQE A;  1TWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...