1VC3B

Crystal structure of l-aspartate-alpha-decarboxylase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-Aspartate-alpha-Decarboxylase light chain
publication title Crystal Structure of L-Aspartate-alpha-Decarboxylase
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1vc3B00
2PJHB 1TWGA 1SIWA 2NYAA 3QWZA 3CQZA 2JIMA 4D7ZB 2C45A 1E5VA 5FTMA 1WCMA 4KO8A 2E2HA 1TWHA 1DMSA 5FTLA 4C2MA 2Y0SA 2IV2X 1FDOA 2R92A 3ML1A 3HU2A 3H0GA 2E7ZA 3QQ8A 2NVXA 1K83A 2JA6A 1E60A 1Y1VA 1TWAA 3HU3A 5C18A 1OGYA 2R93A 3TM7B 5DYGA 2JA7A 1H5NA 3GTQA 4RV0A 4KDLA 4GA6A 3IR7A 2PMZA 5FTKA 4AZDA 2E2IA 2VPYA 3QC8A 2JA5A 5GLFA 1Q16A 3GTJA 1PPYA 3PLXB 1CZ4A 2V3VA 2VPZA 5B6CA 1E61A 4CRYG 1S3SA 3IR6A 3HKZA 4AONB 1PYUB 4KODA 3GTKA 1R27A 4AYBA 2VUMA 3QQ7A 4DMRA 1PQEA 1E18A 4KDIA 5EPPA 1I3QA 1FDIA 3DMRA 3IR5A 4KLNA 1TMOA 1QCSA 1KQFA 1UHDA 3GTOA 2VPWA 1SFOA 3OUGA 1AA6A 3CF2A 1PQHA 2JIRA 5T5ID 2NAPA 2WAQA 2WB1A 1DMRA 1PQFA 2EEOB 1R7RA 1R9TA 2NVYA 1Y5IA 5T5MD 1KQGA 2YU9A 1YLEA 1CZ5A 2DMRA 1VC3B 4QIWA 4CRZA 1WLFA 2KI8A 2JIQA 1PT1A 5FTNA 4AOKB 1Y1WA 3O5AA 3GTMA 1AW8B 1G8JA 1E32A 1TWCA 2JIPA 3GTLA 1TWFA 2R7ZA 2JIOA 3FKIA 3TIWA 5DYIA 1G8KA 3GTPA 1H0HA 2V45A 1PT0A 1IW7D 1CR5A 1EU1A 2VPXA 4CS0A 4GA5A 5C1BA 3GTGA 1QDNA 1Y4ZA 1PYQA 2B63A 3HU1A 4AAYA 5FTJA 1I50A 1UHEA
chains in the Genus database with same CATH superfamily
2PJHB 1TWGA 1SIWA 2NYAA 3ENGA 3QWZA 2PI8A 3CQZA 2JIMA 1HD5A 4JCWA 3X2PA 4D7ZB 4ZM7A 2C45A 1BW4A 1E5VA 2HCZX 5FTMA 1WCMA 4KO8A 2E2HA 1YNJD 1TWHA 1DMSA 1WC2A 1YNND 3X2LA 5FTLA 2A6ED 4JP7A 4C2MA 2Y0SA 2AE0X 4JJOA 2BH0A 2IV2X 1BW3A 3X2IA 1FDOA 2R92A 3ML1A 2YUJA 2PJJA 3HU2A 3H0GA 2E7ZA 3QQ8A 4FFTA 2NVXA 1K83A 2JA6A 1E60A 1Y1VA 1TWAA 3HU3A 5C18A 1OGYA 2KQAA 2R93A 3TM7B 2O5JD 5DYGA 4NOHA 1H5NA 2JA7A 3GTQA 3X2MA 4RV0A 4KDLA 4GA6A 3IR7A 2PMZA 4JP6A 5FTKA 4AZDA 2E2IA 2VPYA 3QC8A 2JA5A 2CW0D 1Q16A 5GLFA 3GTJA 1PPYA 3X2KA 2A68D 4FG2A 1ZYRD 1CZ4A 3PLXB 4JS7A 2A6HD 2V3VA 2VPZA 5B6CA 1E61A 4CRYG 4L48A 1S3SA 3IR6A 3HKZA 4AONB 1PYUB 2PICA 4KODA 3GTKA 1R27A 4AYBA 3CZBA 2VUMA 3QQ7A 2A69D 2BE5D 2PNWA 1PQEA 1E18A 4KDIA 4DMRA 5EPPA 1I3QA 1FDIA 3DMRA 4FERA 4ENGA 3IR5A 4KLNA 3SUJA 3SUMA 3SUKA 1TMOA 1OA9A 3M3GA 1QCSA 1KQFA 1UHDA 3GTOA 2VPWA 1SFOA 3OUGA 1AA6A 3CF2A 3X2JA 1PQHA 2JIRA 5GLXA 5T5ID 2NAPA 5H4UA 2WAQA 2WB1A 3X2OA 1DMRA 1PQFA 2EEOB 1R7RA 1R9TA 2NVYA 1Y5IA 5T5MD 1KQGA 2YU9A 1YLEA 3D30A 1CZ5A 1ZC1A 2DMRA 1VC3B 1L8FA 4QIWA 4CRZA 2GAEA 5GLYA 1WLFA 2G6GA 1SMYD 2KI8A 2JIQA 1PT1A 5FTNA 4AOKB 1Y1WA 3O5AA 3X2HA 3GTMA 1AW8B 1G8JA 1E32A 1TWCA 2G5DA 4AVRA 2JIPA 3GTLA 1TWFA 2R7ZA 2JIOA 3FKIA 3TIWA 5DYIA 1G8KA 3GTPA 1N10A 4FG4A 1H0HA 2V45A 1PT0A 1IW7D 1CR5A 1EU1A 2ENGA 2VPXA 3X2NA 3X2GA 4CS0A 3SULA 4GA5A 5C1BA 3GTGA 1QDNA 1Y4ZA 1PYQA 1OA7A 5GM9A 2B63A 3HU1A 4AAYA 5FTJA 1I50A 1UHEA
chains in the Genus database with same CATH topology
2PJHB 1TWGA 1SIWA 2NYAA 3QWZA 2PI8A 3CQZA 2JIMA 4D7ZB 2C45A 1E5VA 5FTMA 1WCMA 4KO8A 2E2HA 1YNJD 1TWHA 1DMSA 1YNND 5FTLA 2A6ED 4C2MA 2Y0SA 2AE0X 2IV2X 1FDOA 2R92A 3ML1A 2YUJA 2PJJA 3HU2A 3H0GA 2E7ZA 3QQ8A 2NVXA 1K83A 2JA6A 1E60A 1Y1VA 1TWAA 3HU3A 5C18A 1OGYA 2R93A 3TM7B 2O5JD 5DYGA 4NOHA 1H5NA 2JA7A 3GTQA 4RV0A 4KDLA 4GA6A 3IR7A 2PMZA 5FTKA 4AZDA 2E2IA 2VPYA 3QC8A 2JA5A 2CW0D 1Q16A 5GLFA 3GTJA 1PPYA 2A68D 1ZYRD 1CZ4A 3PLXB 2A6HD 2V3VA 2VPZA 5B6CA 1E61A 4CRYG 1S3SA 3IR6A 3HKZA 4AONB 1PYUB 2PICA 4KODA 3GTKA 1R27A 4AYBA 3CZBA 2VUMA 3QQ7A 2A69D 2BE5D 2PNWA 1PQEA 1E18A 4KDIA 4DMRA 5EPPA 1I3QA 1FDIA 3DMRA 3IR5A 4KLNA 1TMOA 1QCSA 1KQFA 1UHDA 3GTOA 2VPWA 1SFOA 3OUGA 1AA6A 3CF2A 1PQHA 2JIRA 5T5ID 2NAPA 2WAQA 2WB1A 1DMRA 1PQFA 2EEOB 1R7RA 1R9TA 2NVYA 1Y5IA 5T5MD 1KQGA 2YU9A 1YLEA 1CZ5A 1ZC1A 2DMRA 1VC3B 4QIWA 4CRZA 2GAEA 1WLFA 2G6GA 1SMYD 2KI8A 2JIQA 1PT1A 5FTNA 4AOKB 1Y1WA 3O5AA 3GTMA 1AW8B 1G8JA 1E32A 1TWCA 2G5DA 2JIPA 3GTLA 1TWFA 2R7ZA 2JIOA 3FKIA 3TIWA 5DYIA 1G8KA 3GTPA 1H0HA 2V45A 1PT0A 1IW7D 1CR5A 1EU1A 2VPXA 4CS0A 4GA5A 5C1BA 3GTGA 1QDNA 1Y4ZA 1PYQA 2B63A 3HU1A 4AAYA 5FTJA 1I50A 1UHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJH B;  1TWG A;  1SIW A;  2NYA A;  3QWZ A;  3CQZ A;  2JIM A;  4D7Z B;  2C45 A;  1E5V A;  5FTM A;  1WCM A;  4KO8 A;  2E2H A;  1TWH A;  1DMS A;  5FTL A;  4C2M A;  2Y0S A;  2IV2 X;  1FDO A;  2R92 A;  3ML1 A;  3HU2 A;  3H0G A;  2E7Z A;  3QQ8 A;  2NVX A;  1K83 A;  2JA6 A;  1E60 A;  1Y1V A;  1TWA A;  3HU3 A;  5C18 A;  1OGY A;  2R93 A;  3TM7 B;  5DYG A;  2JA7 A;  1H5N A;  3GTQ A;  4RV0 A;  4KDL A;  4GA6 A;  3IR7 A;  2PMZ A;  5FTK A;  4AZD A;  2E2I A;  2VPY A;  3QC8 A;  2JA5 A;  5GLF A;  1Q16 A;  3GTJ A;  1PPY A;  3PLX B;  1CZ4 A;  2V3V A;  2VPZ A;  5B6C A;  1E61 A;  4CRY G;  1S3S A;  3IR6 A;  3HKZ A;  4AON B;  1PYU B;  4KOD A;  3GTK A;  1R27 A;  4AYB A;  2VUM A;  3QQ7 A;  4DMR A;  1PQE A;  1E18 A;  4KDI A;  5EPP A;  1I3Q A;  1FDI A;  3DMR A;  3IR5 A;  4KLN A;  1TMO A;  1QCS A;  1KQF A;  1UHD A;  3GTO A;  2VPW A;  1SFO A;  3OUG A;  1AA6 A;  3CF2 A;  1PQH A;  2JIR A;  5T5I D;  2NAP A;  2WAQ A;  2WB1 A;  1DMR A;  1PQF A;  2EEO B;  1R7R A;  1R9T A;  2NVY A;  1Y5I A;  5T5M D;  1KQG A;  2YU9 A;  1YLE A;  1CZ5 A;  2DMR A;  1VC3 B;  4QIW A;  4CRZ A;  1WLF A;  2KI8 A;  2JIQ A;  1PT1 A;  5FTN A;  4AOK B;  1Y1W A;  3O5A A;  3GTM A;  1AW8 B;  1G8J A;  1E32 A;  1TWC A;  2JIP A;  3GTL A;  1TWF A;  2R7Z A;  2JIO A;  3FKI A;  3TIW A;  5DYI A;  1G8K A;  3GTP A;  1H0H A;  2V45 A;  1PT0 A;  1IW7 D;  1CR5 A;  1EU1 A;  2VPX A;  4CS0 A;  4GA5 A;  5C1B A;  3GTG A;  1QDN A;  1Y4Z A;  1PYQ A;  2B63 A;  3HU1 A;  4AAY A;  5FTJ A;  1I50 A;  1UHE A; 
#chains in the Genus database with same CATH topology
 2PJH B;  1TWG A;  1SIW A;  2NYA A;  3ENG A;  3QWZ A;  2PI8 A;  3CQZ A;  2JIM A;  1HD5 A;  4JCW A;  3X2P A;  4D7Z B;  4ZM7 A;  2C45 A;  1BW4 A;  1E5V A;  2HCZ X;  5FTM A;  1WCM A;  4KO8 A;  2E2H A;  1YNJ D;  1TWH A;  1DMS A;  1WC2 A;  1YNN D;  3X2L A;  5FTL A;  2A6E D;  4JP7 A;  4C2M A;  2Y0S A;  2AE0 X;  4JJO A;  2BH0 A;  2IV2 X;  1BW3 A;  3X2I A;  1FDO A;  2R92 A;  3ML1 A;  2YUJ A;  2PJJ A;  3HU2 A;  3H0G A;  2E7Z A;  3QQ8 A;  4FFT A;  2NVX A;  1K83 A;  2JA6 A;  1E60 A;  1Y1V A;  1TWA A;  3HU3 A;  5C18 A;  1OGY A;  2KQA A;  2R93 A;  3TM7 B;  2O5J D;  5DYG A;  4NOH A;  1H5N A;  2JA7 A;  3GTQ A;  3X2M A;  4RV0 A;  4KDL A;  4GA6 A;  3IR7 A;  2PMZ A;  4JP6 A;  5FTK A;  4AZD A;  2E2I A;  2VPY A;  3QC8 A;  2JA5 A;  2CW0 D;  1Q16 A;  5GLF A;  3GTJ A;  1PPY A;  3X2K A;  2A68 D;  4FG2 A;  1ZYR D;  1CZ4 A;  3PLX B;  4JS7 A;  2A6H D;  2V3V A;  2VPZ A;  5B6C A;  1E61 A;  4CRY G;  4L48 A;  1S3S A;  3IR6 A;  3HKZ A;  4AON B;  1PYU B;  2PIC A;  4KOD A;  3GTK A;  1R27 A;  4AYB A;  3CZB A;  2VUM A;  3QQ7 A;  2A69 D;  2BE5 D;  2PNW A;  1PQE A;  1E18 A;  4KDI A;  4DMR A;  5EPP A;  1I3Q A;  1FDI A;  3DMR A;  4FER A;  4ENG A;  3IR5 A;  4KLN A;  3SUJ A;  3SUM A;  3SUK A;  1TMO A;  1OA9 A;  3M3G A;  1QCS A;  1KQF A;  1UHD A;  3GTO A;  2VPW A;  1SFO A;  3OUG A;  1AA6 A;  3CF2 A;  3X2J A;  1PQH A;  2JIR A;  5GLX A;  5T5I D;  2NAP A;  5H4U A;  2WAQ A;  2WB1 A;  3X2O A;  1DMR A;  1PQF A;  2EEO B;  1R7R A;  1R9T A;  2NVY A;  1Y5I A;  5T5M D;  1KQG A;  2YU9 A;  1YLE A;  3D30 A;  1CZ5 A;  1ZC1 A;  2DMR A;  1VC3 B;  1L8F A;  4QIW A;  4CRZ A;  2GAE A;  5GLY A;  1WLF A;  2G6G A;  1SMY D;  2KI8 A;  2JIQ A;  1PT1 A;  5FTN A;  4AOK B;  1Y1W A;  3O5A A;  3X2H A;  3GTM A;  1AW8 B;  1G8J A;  1E32 A;  1TWC A;  2G5D A;  4AVR A;  2JIP A;  3GTL A;  1TWF A;  2R7Z A;  2JIO A;  3FKI A;  3TIW A;  5DYI A;  1G8K A;  3GTP A;  1N10 A;  4FG4 A;  1H0H A;  2V45 A;  1PT0 A;  1IW7 D;  1CR5 A;  1EU1 A;  2ENG A;  2VPX A;  3X2N A;  3X2G A;  4CS0 A;  3SUL A;  4GA5 A;  5C1B A;  3GTG A;  1QDN A;  1Y4Z A;  1PYQ A;  1OA7 A;  5GM9 A;  2B63 A;  3HU1 A;  4AAY A;  5FTJ A;  1I50 A;  1UHE A; 
#chains in the Genus database with same CATH homology
 2PJH B;  1TWG A;  1SIW A;  2NYA A;  3QWZ A;  2PI8 A;  3CQZ A;  2JIM A;  4D7Z B;  2C45 A;  1E5V A;  5FTM A;  1WCM A;  4KO8 A;  2E2H A;  1YNJ D;  1TWH A;  1DMS A;  1YNN D;  5FTL A;  2A6E D;  4C2M A;  2Y0S A;  2AE0 X;  2IV2 X;  1FDO A;  2R92 A;  3ML1 A;  2YUJ A;  2PJJ A;  3HU2 A;  3H0G A;  2E7Z A;  3QQ8 A;  2NVX A;  1K83 A;  2JA6 A;  1E60 A;  1Y1V A;  1TWA A;  3HU3 A;  5C18 A;  1OGY A;  2R93 A;  3TM7 B;  2O5J D;  5DYG A;  4NOH A;  1H5N A;  2JA7 A;  3GTQ A;  4RV0 A;  4KDL A;  4GA6 A;  3IR7 A;  2PMZ A;  5FTK A;  4AZD A;  2E2I A;  2VPY A;  3QC8 A;  2JA5 A;  2CW0 D;  1Q16 A;  5GLF A;  3GTJ A;  1PPY A;  2A68 D;  1ZYR D;  1CZ4 A;  3PLX B;  2A6H D;  2V3V A;  2VPZ A;  5B6C A;  1E61 A;  4CRY G;  1S3S A;  3IR6 A;  3HKZ A;  4AON B;  1PYU B;  2PIC A;  4KOD A;  3GTK A;  1R27 A;  4AYB A;  3CZB A;  2VUM A;  3QQ7 A;  2A69 D;  2BE5 D;  2PNW A;  1PQE A;  1E18 A;  4KDI A;  4DMR A;  5EPP A;  1I3Q A;  1FDI A;  3DMR A;  3IR5 A;  4KLN A;  1TMO A;  1QCS A;  1KQF A;  1UHD A;  3GTO A;  2VPW A;  1SFO A;  3OUG A;  1AA6 A;  3CF2 A;  1PQH A;  2JIR A;  5T5I D;  2NAP A;  2WAQ A;  2WB1 A;  1DMR A;  1PQF A;  2EEO B;  1R7R A;  1R9T A;  2NVY A;  1Y5I A;  5T5M D;  1KQG A;  2YU9 A;  1YLE A;  1CZ5 A;  1ZC1 A;  2DMR A;  1VC3 B;  4QIW A;  4CRZ A;  2GAE A;  1WLF A;  2G6G A;  1SMY D;  2KI8 A;  2JIQ A;  1PT1 A;  5FTN A;  4AOK B;  1Y1W A;  3O5A A;  3GTM A;  1AW8 B;  1G8J A;  1E32 A;  1TWC A;  2G5D A;  2JIP A;  3GTL A;  1TWF A;  2R7Z A;  2JIO A;  3FKI A;  3TIW A;  5DYI A;  1G8K A;  3GTP A;  1H0H A;  2V45 A;  1PT0 A;  1IW7 D;  1CR5 A;  1EU1 A;  2VPX A;  4CS0 A;  4GA5 A;  5C1B A;  3GTG A;  1QDN A;  1Y4Z A;  1PYQ A;  2B63 A;  3HU1 A;  4AAY A;  5FTJ A;  1I50 A;  1UHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...