1VC3B

Crystal structure of l-aspartate-alpha-decarboxylase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-Aspartate-alpha-Decarboxylase light chain
publication title Crystal Structure of L-Aspartate-alpha-Decarboxylase
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1vc3B00
3DMRA 2C45A 1TWHA 5FTLA 2PMZA 1TWFA 1SFOA 3QC8A 1E18A 1CZ4A 2JIPA 2VPXA 2JIMA 4AAYA 1R27A 3GTGA 2IV2X 4GA5A 1S3SA 1E60A 2V45A 3PLXB 1IW7D 1UHEA 2V3VA 4AZDA 2NVYA 1Y5IA 2NAPA 1E5VA 1AA6A 4GA6A 4D7ZB 2JIRA 2VPZA 1PQEA 5C1BA 1H0HA 1Y1WA 4CS0A 1K83A 2Y0SA 2E7ZA 1PYQA 5GLFA 5DYIA 1EU1A 2KI8A 2JA6A 1VC3B 1E32A 2R92A 4CRYG 3GTQA 2R7ZA 4DMRA 4AONB 1PQHA 2JIQA 1QDNA 1I3QA 3QWZA 3IR7A 1R7RA 2YU9A 1UHDA 5T5ID 1I50A 4KODA 3OUGA 5FTMA 1E61A 4QIWA 1Q16A 1Y4ZA 3HKZA 2JA5A 1PPYA 4C2MA 2PJHB 1FDIA 1DMSA 4KLNA 1AW8B 3H0GA 2JA7A 4KO8A 4KDLA 1PT0A 1CR5A 2B63A 3QQ7A 1PT1A 2E2IA 2NYAA 2WAQA 4AYBA 3GTPA 1TWGA 4RV0A 1OGYA 2EEOB 5B6CA 3IR6A 1TWCA 2VUMA 1QCSA 1TWAA 5T5MD 3FKIA 3QQ8A 3GTKA 2JIOA 1PQFA 2VPYA 1R9TA 5FTKA 1KQGA 2DMRA 2VPWA 3HU2A 2WB1A 5DYGA 3HU3A 3O5AA 3GTJA 3CF2A 2E2HA 3TM7B 4CRZA 2NVXA 1DMRA 1KQFA 3TIWA 1G8JA 3GTLA 3HU1A 3GTMA 1CZ5A 1TMOA 1SIWA 3GTOA 1YLEA 5C18A 1PYUB 5FTJA 1H5NA 1G8KA 1WCMA 3CQZA 1Y1VA 5FTNA 5EPPA 4AOKB 3ML1A 1FDOA 2R93A 3IR5A 1WLFA 4KDIA
chains in the Genus database with same CATH superfamily
3DMRA 2C45A 4JP6A 1TWHA 5FTLA 2BE5D 2PMZA 1TWFA 1YNND 1SFOA 3QC8A 1E18A 1HD5A 1CZ4A 2JIPA 2VPXA 3X2KA 2JIMA 4FG4A 1R27A 2A6ED 4AAYA 2IV2X 3GTGA 2GAEA 4GA5A 1S3SA 1E60A 2V45A 3PLXB 1IW7D 1UHEA 2V3VA 1L8FA 4AZDA 2BH0A 2NVYA 1Y5IA 2NAPA 1E5VA 1AA6A 4GA6A 4D7ZB 2JIRA 2VPZA 1PQEA 2O5JD 5C1BA 1H0HA 1Y1WA 4CS0A 1K83A 4NOHA 2Y0SA 2E7ZA 1PYQA 5GLFA 2PI8A 4JJOA 5DYIA 1EU1A 2KI8A 2JA6A 4JCWA 1VC3B 1E32A 2R92A 4CRYG 3GTQA 2R7ZA 4DMRA 4AONB 1PQHA 3X2JA 3CZBA 2JIQA 1QDNA 1ZYRD 1I3QA 3QWZA 3IR7A 1R7RA 2YU9A 1UHDA 2G6GA 5T5ID 1I50A 4KODA 3OUGA 5FTMA 1BW3A 1E61A 4QIWA 1ZC1A 3X2PA 1Q16A 1Y4ZA 3HKZA 2JA5A 1PPYA 3X2LA 2PJHB 3ENGA 4FG2A 4JS7A 3X2HA 4C2MA 1FDIA 1DMSA 2A69D 1AW8B 2KQAA 3H0GA 4JP7A 4KLNA 2HCZX 2JA7A 4KO8A 4KDLA 1PT0A 1CR5A 2B63A 3QQ7A 3SULA 1OA7A 2PJJA 1PT1A 1OA9A 2ENGA 5GLXA 3SUMA 2NYAA 2WAQA 4AYBA 5GM9A 3GTPA 1TWGA 4RV0A 1OGYA 2E2IA 2EEOB 5B6CA 3IR6A 3X2GA 4FERA 1TWCA 2VUMA 1QCSA 1TWAA 5T5MD 3FKIA 3QQ8A 3SUJA 3GTKA 2JIOA 1PQFA 2VPYA 1R9TA 5GLYA 1SMYD 5FTKA 1KQGA 2DMRA 2VPWA 3HU2A 2WB1A 4L48A 5DYGA 3HU3A 3O5AA 3X2OA 3CF2A 3GTJA 2E2HA 3TM7B 3D30A 4CRZA 2NVXA 2CW0D 3X2MA 1DMRA 1KQFA 3TIWA 1G8JA 2AE0X 1N10A 2G5DA 5H4UA 3M3GA 3GTLA 3HU1A 3GTMA 1CZ5A 1TMOA 1SIWA 1BW4A 3GTOA 2A68D 1YLEA 1YNJD 5C18A 1PYUB 5FTJA 3SUKA 4ENGA 1H5NA 1G8KA 1WCMA 4ZM7A 3CQZA 1Y1VA 2PICA 4FFTA 5EPPA 2PNWA 5FTNA 4AOKB 4AVRA 3ML1A 1FDOA 1WC2A 2R93A 3X2IA 3IR5A 1WLFA 2YUJA 4KDIA 3X2NA 2A6HD
chains in the Genus database with same CATH topology
3DMRA 2C45A 1TWHA 5FTLA 2BE5D 2PMZA 1TWFA 1YNND 1SFOA 3QC8A 1E18A 1CZ4A 2JIPA 2VPXA 2JIMA 4AAYA 1R27A 2A6ED 3GTGA 2IV2X 2GAEA 4GA5A 1S3SA 1E60A 2V45A 3PLXB 1IW7D 1UHEA 2V3VA 4AZDA 2NVYA 1Y5IA 2NAPA 1E5VA 1AA6A 4GA6A 4D7ZB 2JIRA 2VPZA 1PQEA 2O5JD 5C1BA 1H0HA 1Y1WA 4CS0A 1K83A 4NOHA 2Y0SA 2E7ZA 1PYQA 5GLFA 2PI8A 5DYIA 1EU1A 2KI8A 2JA6A 1VC3B 1E32A 2R92A 4CRYG 3GTQA 2R7ZA 4DMRA 4AONB 1PQHA 3CZBA 2JIQA 1QDNA 1ZYRD 1I3QA 3QWZA 3IR7A 1R7RA 2YU9A 1UHDA 2G6GA 5T5ID 1I50A 4KODA 3OUGA 5FTMA 1E61A 4QIWA 1ZC1A 1Q16A 1Y4ZA 3HKZA 2JA5A 1PPYA 4C2MA 2PJHB 1FDIA 1DMSA 2A69D 1AW8B 4KLNA 3H0GA 2JA7A 4KO8A 4KDLA 1PT0A 1CR5A 2B63A 3QQ7A 2PJJA 1PT1A 2E2IA 2NYAA 2WAQA 4AYBA 3GTPA 1TWGA 4RV0A 1OGYA 2EEOB 5B6CA 3IR6A 1TWCA 2VUMA 1QCSA 1TWAA 5T5MD 3FKIA 3QQ8A 3GTKA 2JIOA 1PQFA 2VPYA 1R9TA 1SMYD 5FTKA 1KQGA 2DMRA 2VPWA 3HU2A 2WB1A 5DYGA 3HU3A 3O5AA 3GTJA 3CF2A 2E2HA 3TM7B 4CRZA 2NVXA 2CW0D 1DMRA 1KQFA 3TIWA 1G8JA 2AE0X 2G5DA 3GTLA 3HU1A 3GTMA 1CZ5A 1TMOA 1SIWA 3GTOA 2A68D 1YLEA 1YNJD 5C18A 1PYUB 5FTJA 1H5NA 1G8KA 1WCMA 3CQZA 1Y1VA 2PICA 5FTNA 5EPPA 2PNWA 4AOKB 3ML1A 1FDOA 2R93A 3IR5A 1WLFA 2YUJA 4KDIA 2A6HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMR A;  2C45 A;  1TWH A;  5FTL A;  2PMZ A;  1TWF A;  1SFO A;  3QC8 A;  1E18 A;  1CZ4 A;  2JIP A;  2VPX A;  2JIM A;  4AAY A;  1R27 A;  3GTG A;  2IV2 X;  4GA5 A;  1S3S A;  1E60 A;  2V45 A;  3PLX B;  1IW7 D;  1UHE A;  2V3V A;  4AZD A;  2NVY A;  1Y5I A;  2NAP A;  1E5V A;  1AA6 A;  4GA6 A;  4D7Z B;  2JIR A;  2VPZ A;  1PQE A;  5C1B A;  1H0H A;  1Y1W A;  4CS0 A;  1K83 A;  2Y0S A;  2E7Z A;  1PYQ A;  5GLF A;  5DYI A;  1EU1 A;  2KI8 A;  2JA6 A;  1VC3 B;  1E32 A;  2R92 A;  4CRY G;  3GTQ A;  2R7Z A;  4DMR A;  4AON B;  1PQH A;  2JIQ A;  1QDN A;  1I3Q A;  3QWZ A;  3IR7 A;  1R7R A;  2YU9 A;  1UHD A;  5T5I D;  1I50 A;  4KOD A;  3OUG A;  5FTM A;  1E61 A;  4QIW A;  1Q16 A;  1Y4Z A;  3HKZ A;  2JA5 A;  1PPY A;  4C2M A;  2PJH B;  1FDI A;  1DMS A;  4KLN A;  1AW8 B;  3H0G A;  2JA7 A;  4KO8 A;  4KDL A;  1PT0 A;  1CR5 A;  2B63 A;  3QQ7 A;  1PT1 A;  2E2I A;  2NYA A;  2WAQ A;  4AYB A;  3GTP A;  1TWG A;  4RV0 A;  1OGY A;  2EEO B;  5B6C A;  3IR6 A;  1TWC A;  2VUM A;  1QCS A;  1TWA A;  5T5M D;  3FKI A;  3QQ8 A;  3GTK A;  2JIO A;  1PQF A;  2VPY A;  1R9T A;  5FTK A;  1KQG A;  2DMR A;  2VPW A;  3HU2 A;  2WB1 A;  5DYG A;  3HU3 A;  3O5A A;  3GTJ A;  3CF2 A;  2E2H A;  3TM7 B;  4CRZ A;  2NVX A;  1DMR A;  1KQF A;  3TIW A;  1G8J A;  3GTL A;  3HU1 A;  3GTM A;  1CZ5 A;  1TMO A;  1SIW A;  3GTO A;  1YLE A;  5C18 A;  1PYU B;  5FTJ A;  1H5N A;  1G8K A;  1WCM A;  3CQZ A;  1Y1V A;  5FTN A;  5EPP A;  4AOK B;  3ML1 A;  1FDO A;  2R93 A;  3IR5 A;  1WLF A;  4KDI A; 
#chains in the Genus database with same CATH topology
 3DMR A;  2C45 A;  4JP6 A;  1TWH A;  5FTL A;  2BE5 D;  2PMZ A;  1TWF A;  1YNN D;  1SFO A;  3QC8 A;  1E18 A;  1HD5 A;  1CZ4 A;  2JIP A;  2VPX A;  3X2K A;  2JIM A;  4FG4 A;  1R27 A;  2A6E D;  4AAY A;  2IV2 X;  3GTG A;  2GAE A;  4GA5 A;  1S3S A;  1E60 A;  2V45 A;  3PLX B;  1IW7 D;  1UHE A;  2V3V A;  1L8F A;  4AZD A;  2BH0 A;  2NVY A;  1Y5I A;  2NAP A;  1E5V A;  1AA6 A;  4GA6 A;  4D7Z B;  2JIR A;  2VPZ A;  1PQE A;  2O5J D;  5C1B A;  1H0H A;  1Y1W A;  4CS0 A;  1K83 A;  4NOH A;  2Y0S A;  2E7Z A;  1PYQ A;  5GLF A;  2PI8 A;  4JJO A;  5DYI A;  1EU1 A;  2KI8 A;  2JA6 A;  4JCW A;  1VC3 B;  1E32 A;  2R92 A;  4CRY G;  3GTQ A;  2R7Z A;  4DMR A;  4AON B;  1PQH A;  3X2J A;  3CZB A;  2JIQ A;  1QDN A;  1ZYR D;  1I3Q A;  3QWZ A;  3IR7 A;  1R7R A;  2YU9 A;  1UHD A;  2G6G A;  5T5I D;  1I50 A;  4KOD A;  3OUG A;  5FTM A;  1BW3 A;  1E61 A;  4QIW A;  1ZC1 A;  3X2P A;  1Q16 A;  1Y4Z A;  3HKZ A;  2JA5 A;  1PPY A;  3X2L A;  2PJH B;  3ENG A;  4FG2 A;  4JS7 A;  3X2H A;  4C2M A;  1FDI A;  1DMS A;  2A69 D;  1AW8 B;  2KQA A;  3H0G A;  4JP7 A;  4KLN A;  2HCZ X;  2JA7 A;  4KO8 A;  4KDL A;  1PT0 A;  1CR5 A;  2B63 A;  3QQ7 A;  3SUL A;  1OA7 A;  2PJJ A;  1PT1 A;  1OA9 A;  2ENG A;  5GLX A;  3SUM A;  2NYA A;  2WAQ A;  4AYB A;  5GM9 A;  3GTP A;  1TWG A;  4RV0 A;  1OGY A;  2E2I A;  2EEO B;  5B6C A;  3IR6 A;  3X2G A;  4FER A;  1TWC A;  2VUM A;  1QCS A;  1TWA A;  5T5M D;  3FKI A;  3QQ8 A;  3SUJ A;  3GTK A;  2JIO A;  1PQF A;  2VPY A;  1R9T A;  5GLY A;  1SMY D;  5FTK A;  1KQG A;  2DMR A;  2VPW A;  3HU2 A;  2WB1 A;  4L48 A;  5DYG A;  3HU3 A;  3O5A A;  3X2O A;  3CF2 A;  3GTJ A;  2E2H A;  3TM7 B;  3D30 A;  4CRZ A;  2NVX A;  2CW0 D;  3X2M A;  1DMR A;  1KQF A;  3TIW A;  1G8J A;  2AE0 X;  1N10 A;  2G5D A;  5H4U A;  3M3G A;  3GTL A;  3HU1 A;  3GTM A;  1CZ5 A;  1TMO A;  1SIW A;  1BW4 A;  3GTO A;  2A68 D;  1YLE A;  1YNJ D;  5C18 A;  1PYU B;  5FTJ A;  3SUK A;  4ENG A;  1H5N A;  1G8K A;  1WCM A;  4ZM7 A;  3CQZ A;  1Y1V A;  2PIC A;  4FFT A;  5EPP A;  2PNW A;  5FTN A;  4AOK B;  4AVR A;  3ML1 A;  1FDO A;  1WC2 A;  2R93 A;  3X2I A;  3IR5 A;  1WLF A;  2YUJ A;  4KDI A;  3X2N A;  2A6H D; 
#chains in the Genus database with same CATH homology
 3DMR A;  2C45 A;  1TWH A;  5FTL A;  2BE5 D;  2PMZ A;  1TWF A;  1YNN D;  1SFO A;  3QC8 A;  1E18 A;  1CZ4 A;  2JIP A;  2VPX A;  2JIM A;  4AAY A;  1R27 A;  2A6E D;  3GTG A;  2IV2 X;  2GAE A;  4GA5 A;  1S3S A;  1E60 A;  2V45 A;  3PLX B;  1IW7 D;  1UHE A;  2V3V A;  4AZD A;  2NVY A;  1Y5I A;  2NAP A;  1E5V A;  1AA6 A;  4GA6 A;  4D7Z B;  2JIR A;  2VPZ A;  1PQE A;  2O5J D;  5C1B A;  1H0H A;  1Y1W A;  4CS0 A;  1K83 A;  4NOH A;  2Y0S A;  2E7Z A;  1PYQ A;  5GLF A;  2PI8 A;  5DYI A;  1EU1 A;  2KI8 A;  2JA6 A;  1VC3 B;  1E32 A;  2R92 A;  4CRY G;  3GTQ A;  2R7Z A;  4DMR A;  4AON B;  1PQH A;  3CZB A;  2JIQ A;  1QDN A;  1ZYR D;  1I3Q A;  3QWZ A;  3IR7 A;  1R7R A;  2YU9 A;  1UHD A;  2G6G A;  5T5I D;  1I50 A;  4KOD A;  3OUG A;  5FTM A;  1E61 A;  4QIW A;  1ZC1 A;  1Q16 A;  1Y4Z A;  3HKZ A;  2JA5 A;  1PPY A;  4C2M A;  2PJH B;  1FDI A;  1DMS A;  2A69 D;  1AW8 B;  4KLN A;  3H0G A;  2JA7 A;  4KO8 A;  4KDL A;  1PT0 A;  1CR5 A;  2B63 A;  3QQ7 A;  2PJJ A;  1PT1 A;  2E2I A;  2NYA A;  2WAQ A;  4AYB A;  3GTP A;  1TWG A;  4RV0 A;  1OGY A;  2EEO B;  5B6C A;  3IR6 A;  1TWC A;  2VUM A;  1QCS A;  1TWA A;  5T5M D;  3FKI A;  3QQ8 A;  3GTK A;  2JIO A;  1PQF A;  2VPY A;  1R9T A;  1SMY D;  5FTK A;  1KQG A;  2DMR A;  2VPW A;  3HU2 A;  2WB1 A;  5DYG A;  3HU3 A;  3O5A A;  3GTJ A;  3CF2 A;  2E2H A;  3TM7 B;  4CRZ A;  2NVX A;  2CW0 D;  1DMR A;  1KQF A;  3TIW A;  1G8J A;  2AE0 X;  2G5D A;  3GTL A;  3HU1 A;  3GTM A;  1CZ5 A;  1TMO A;  1SIW A;  3GTO A;  2A68 D;  1YLE A;  1YNJ D;  5C18 A;  1PYU B;  5FTJ A;  1H5N A;  1G8K A;  1WCM A;  3CQZ A;  1Y1V A;  2PIC A;  5FTN A;  5EPP A;  2PNW A;  4AOK B;  3ML1 A;  1FDO A;  2R93 A;  3IR5 A;  1WLF A;  2YUJ A;  4KDI A;  2A6H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...