1VC3B

Crystal structure of l-aspartate-alpha-decarboxylase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of L-Aspartate-alpha-Decarboxylase
rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords L-Aspartate-alpha-Decarboxylase light chain
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1vc3B00
4RV0A 3CQZA 1G8KA 2WB1A 1E61A 4QIWA 1PYUB 3HU3A 3PLXB 1PQFA 1Y1VA 1PT0A 2PMZA 3GTGA 5C1BA 1Y1WA 5DYGA 5FTKA 3GTQA 1KQFA 2C45A 1H0HA 2NAPA 2IV2X 3H0GA 5C18A 5FTMA 1TMOA 1YLEA 3QC8A 2R7ZA 1UHEA 1UHDA 1S3SA 3GTLA 3GTJA 4KODA 3QWZA 2VPXA 4AONB 4C2MA 4CRZA 2Y0SA 1Q16A 1PYQA 5EPPA 1PQHA 1CZ5A 1FDIA 2WAQA 2JA6A 1WLFA 1SFOA 4KO8A 2R92A 4GA6A 1Y4ZA 1QCSA 1E18A 2JA7A 4AOKB 2KI8A 2DMRA 3TM7B 1EU1A 2VUMA 4KDLA 1I3QA 3GTMA 1DMRA 1TWHA 4KDIA 4CRYG 2E2HA 2JIQA 1CZ4A 1G8JA 4D7ZB 2R93A 1WCMA 2EEOB 1E5VA 3HU1A 4AAYA 2VPYA 1R7RA 3GTOA 1TWCA 5T5ID 1TWAA 2JIPA 5GLFA 3QQ8A 5DYIA 1E60A 3CF2A 1I50A 2JIRA 4AZDA 1PPYA 1TWFA 2V3VA 3OUGA 3GTPA 1OGYA 3ML1A 3IR5A 3IR7A 1PT1A 4AYBA 2JIOA 2VPWA 3FKIA 1H5NA 2JIMA 2E7ZA 1FDOA 4DMRA 3O5AA 1R27A 3IR6A 1K83A 1PQEA 5T5MD 5FTLA 1VC3B 2JA5A 1AA6A 1AW8B 1E32A 2NYAA 1DMSA 1Y5IA 3QQ7A 5FTNA 3GTKA 2B63A 3DMRA 5B6CA 4KLNA 2YU9A 1TWGA 2E2IA 1QDNA 1CR5A 2NVYA 1IW7D 3HU2A 2NVXA 3HKZA 3TIWA 4CS0A 1KQGA 4GA5A 2VPZA 2PJHB 1R9TA 1SIWA 2V45A 5FTJA
chains in the Genus database with same CATH superfamily
4RV0A 3CQZA 1G8KA 2WB1A 3X2IA 1E61A 1OA7A 4QIWA 1PYUB 3HU3A 3PLXB 3X2OA 1PQFA 1Y1VA 1PT0A 2PMZA 2GAEA 3GTGA 4FFTA 5C1BA 1ZYRD 1Y1WA 5DYGA 3SULA 2HCZX 5FTKA 4ENGA 3GTQA 4FG4A 1KQFA 2C45A 4JP6A 1H0HA 2NAPA 2IV2X 3H0GA 5C18A 5FTMA 1TMOA 1YLEA 3QC8A 2R7ZA 2PI8A 1UHEA 1UHDA 1S3SA 3GTLA 3GTJA 2PJJA 4KODA 3QWZA 2VPXA 4AONB 4C2MA 2O5JD 4CRZA 2Y0SA 1BW4A 1Q16A 3D30A 1PYQA 5EPPA 1PQHA 2A6HD 1CZ5A 3X2LA 1YNND 3SUMA 1N10A 1FDIA 2WAQA 2JA6A 1WLFA 1SFOA 4KO8A 2R92A 2ENGA 1Y4ZA 4GA6A 1QCSA 1E18A 3CZBA 3ENGA 2JA7A 4AOKB 3X2HA 2KI8A 2DMRA 3TM7B 2PNWA 4L48A 3SUKA 1EU1A 2VUMA 4KDLA 1I3QA 3GTMA 1DMRA 1TWHA 4KDIA 4CRYG 1L8FA 3X2PA 2E2HA 2JIQA 1CZ4A 1G8JA 2KQAA 4D7ZB 2R93A 1WCMA 2A6ED 2BE5D 2EEOB 1E5VA 3HU1A 4NOHA 4AAYA 2VPYA 1R7RA 3GTOA 2G5DA 1TWCA 3X2JA 5T5ID 1TWAA 2JIPA 5GLFA 2AE0X 3QQ8A 5DYIA 3X2MA 1E60A 3CF2A 1I50A 2JIRA 1WC2A 4AZDA 2YUJA 5GLYA 1YNJD 1PPYA 1TWFA 2V3VA 3OUGA 4ZM7A 1OGYA 3GTPA 2A69D 2CW0D 3ML1A 3IR5A 3IR7A 1PT1A 4AYBA 2JIOA 2VPWA 3FKIA 1H5NA 2BH0A 2JIMA 2A68D 1SMYD 1HD5A 2E7ZA 1FDOA 4DMRA 4FG2A 3O5AA 5H4UA 1R27A 3IR6A 1K83A 1PQEA 5T5MD 5FTLA 1VC3B 2JA5A 1AA6A 1AW8B 1OA9A 1E32A 2NYAA 3SUJA 1DMSA 1Y5IA 3M3GA 3QQ7A 5FTNA 3GTKA 2B63A 3DMRA 5B6CA 4JJOA 4JP7A 4KLNA 5GM9A 1BW3A 2YU9A 1TWGA 4JCWA 2E2IA 1QDNA 1CR5A 2NVYA 1IW7D 3HU2A 3X2NA 3X2GA 2NVXA 2PICA 4JS7A 3X2KA 3HKZA 3TIWA 4CS0A 1KQGA 1ZC1A 4GA5A 5GLXA 4FERA 2VPZA 2G6GA 2PJHB 1R9TA 1SIWA 2V45A 5FTJA 4AVRA
chains in the Genus database with same CATH topology
4RV0A 3CQZA 1G8KA 2WB1A 1E61A 4QIWA 1PYUB 3HU3A 3PLXB 1PQFA 1Y1VA 1PT0A 2PMZA 2GAEA 3GTGA 5C1BA 1ZYRD 1Y1WA 5DYGA 5FTKA 3GTQA 1KQFA 2C45A 1H0HA 2NAPA 2IV2X 3H0GA 5C18A 5FTMA 1TMOA 1YLEA 3QC8A 2R7ZA 2PI8A 1UHEA 1UHDA 1S3SA 3GTLA 3GTJA 2PJJA 4KODA 3QWZA 2VPXA 4AONB 4C2MA 2O5JD 4CRZA 2Y0SA 1Q16A 1PYQA 5EPPA 1PQHA 2A6HD 1CZ5A 1YNND 1FDIA 2WAQA 2JA6A 1WLFA 1SFOA 4KO8A 2R92A 4GA6A 1Y4ZA 1QCSA 1E18A 3CZBA 2JA7A 4AOKB 2KI8A 2DMRA 3TM7B 2PNWA 1EU1A 2VUMA 4KDLA 1I3QA 3GTMA 1DMRA 1TWHA 4KDIA 4CRYG 2E2HA 2JIQA 1CZ4A 1G8JA 4D7ZB 2R93A 1WCMA 2A6ED 2BE5D 2EEOB 1E5VA 3HU1A 4NOHA 4AAYA 2VPYA 1R7RA 3GTOA 2G5DA 1TWCA 5T5ID 1TWAA 2JIPA 5GLFA 2AE0X 3QQ8A 5DYIA 1E60A 3CF2A 1I50A 2JIRA 4AZDA 2YUJA 1YNJD 1PPYA 1TWFA 2V3VA 3OUGA 3GTPA 1OGYA 2A69D 2CW0D 3ML1A 3IR5A 3IR7A 1PT1A 4AYBA 2JIOA 2VPWA 3FKIA 1H5NA 2JIMA 2A68D 1SMYD 2E7ZA 1FDOA 4DMRA 3O5AA 1R27A 3IR6A 1K83A 1PQEA 5T5MD 5FTLA 1VC3B 2JA5A 1AA6A 1AW8B 1E32A 2NYAA 1DMSA 1Y5IA 3QQ7A 5FTNA 3GTKA 2B63A 3DMRA 5B6CA 4KLNA 2YU9A 1TWGA 2E2IA 1QDNA 1CR5A 2NVYA 1IW7D 3HU2A 2NVXA 2PICA 3HKZA 3TIWA 4CS0A 1KQGA 1ZC1A 4GA5A 2VPZA 2G6GA 2PJHB 1R9TA 1SIWA 2V45A 5FTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RV0 A;  3CQZ A;  1G8K A;  2WB1 A;  1E61 A;  4QIW A;  1PYU B;  3HU3 A;  3PLX B;  1PQF A;  1Y1V A;  1PT0 A;  2PMZ A;  3GTG A;  5C1B A;  1Y1W A;  5DYG A;  5FTK A;  3GTQ A;  1KQF A;  2C45 A;  1H0H A;  2NAP A;  2IV2 X;  3H0G A;  5C18 A;  5FTM A;  1TMO A;  1YLE A;  3QC8 A;  2R7Z A;  1UHE A;  1UHD A;  1S3S A;  3GTL A;  3GTJ A;  4KOD A;  3QWZ A;  2VPX A;  4AON B;  4C2M A;  4CRZ A;  2Y0S A;  1Q16 A;  1PYQ A;  5EPP A;  1PQH A;  1CZ5 A;  1FDI A;  2WAQ A;  2JA6 A;  1WLF A;  1SFO A;  4KO8 A;  2R92 A;  4GA6 A;  1Y4Z A;  1QCS A;  1E18 A;  2JA7 A;  4AOK B;  2KI8 A;  2DMR A;  3TM7 B;  1EU1 A;  2VUM A;  4KDL A;  1I3Q A;  3GTM A;  1DMR A;  1TWH A;  4KDI A;  4CRY G;  2E2H A;  2JIQ A;  1CZ4 A;  1G8J A;  4D7Z B;  2R93 A;  1WCM A;  2EEO B;  1E5V A;  3HU1 A;  4AAY A;  2VPY A;  1R7R A;  3GTO A;  1TWC A;  5T5I D;  1TWA A;  2JIP A;  5GLF A;  3QQ8 A;  5DYI A;  1E60 A;  3CF2 A;  1I50 A;  2JIR A;  4AZD A;  1PPY A;  1TWF A;  2V3V A;  3OUG A;  3GTP A;  1OGY A;  3ML1 A;  3IR5 A;  3IR7 A;  1PT1 A;  4AYB A;  2JIO A;  2VPW A;  3FKI A;  1H5N A;  2JIM A;  2E7Z A;  1FDO A;  4DMR A;  3O5A A;  1R27 A;  3IR6 A;  1K83 A;  1PQE A;  5T5M D;  5FTL A;  1VC3 B;  2JA5 A;  1AA6 A;  1AW8 B;  1E32 A;  2NYA A;  1DMS A;  1Y5I A;  3QQ7 A;  5FTN A;  3GTK A;  2B63 A;  3DMR A;  5B6C A;  4KLN A;  2YU9 A;  1TWG A;  2E2I A;  1QDN A;  1CR5 A;  2NVY A;  1IW7 D;  3HU2 A;  2NVX A;  3HKZ A;  3TIW A;  4CS0 A;  1KQG A;  4GA5 A;  2VPZ A;  2PJH B;  1R9T A;  1SIW A;  2V45 A;  5FTJ A; 
#chains in the Genus database with same CATH topology
 4RV0 A;  3CQZ A;  1G8K A;  2WB1 A;  3X2I A;  1E61 A;  1OA7 A;  4QIW A;  1PYU B;  3HU3 A;  3PLX B;  3X2O A;  1PQF A;  1Y1V A;  1PT0 A;  2PMZ A;  2GAE A;  3GTG A;  4FFT A;  5C1B A;  1ZYR D;  1Y1W A;  5DYG A;  3SUL A;  2HCZ X;  5FTK A;  4ENG A;  3GTQ A;  4FG4 A;  1KQF A;  2C45 A;  4JP6 A;  1H0H A;  2NAP A;  2IV2 X;  3H0G A;  5C18 A;  5FTM A;  1TMO A;  1YLE A;  3QC8 A;  2R7Z A;  2PI8 A;  1UHE A;  1UHD A;  1S3S A;  3GTL A;  3GTJ A;  2PJJ A;  4KOD A;  3QWZ A;  2VPX A;  4AON B;  4C2M A;  2O5J D;  4CRZ A;  2Y0S A;  1BW4 A;  1Q16 A;  3D30 A;  1PYQ A;  5EPP A;  1PQH A;  2A6H D;  1CZ5 A;  3X2L A;  1YNN D;  3SUM A;  1N10 A;  1FDI A;  2WAQ A;  2JA6 A;  1WLF A;  1SFO A;  4KO8 A;  2R92 A;  2ENG A;  1Y4Z A;  4GA6 A;  1QCS A;  1E18 A;  3CZB A;  3ENG A;  2JA7 A;  4AOK B;  3X2H A;  2KI8 A;  2DMR A;  3TM7 B;  2PNW A;  4L48 A;  3SUK A;  1EU1 A;  2VUM A;  4KDL A;  1I3Q A;  3GTM A;  1DMR A;  1TWH A;  4KDI A;  4CRY G;  1L8F A;  3X2P A;  2E2H A;  2JIQ A;  1CZ4 A;  1G8J A;  2KQA A;  4D7Z B;  2R93 A;  1WCM A;  2A6E D;  2BE5 D;  2EEO B;  1E5V A;  3HU1 A;  4NOH A;  4AAY A;  2VPY A;  1R7R A;  3GTO A;  2G5D A;  1TWC A;  3X2J A;  5T5I D;  1TWA A;  2JIP A;  5GLF A;  2AE0 X;  3QQ8 A;  5DYI A;  3X2M A;  1E60 A;  3CF2 A;  1I50 A;  2JIR A;  1WC2 A;  4AZD A;  2YUJ A;  5GLY A;  1YNJ D;  1PPY A;  1TWF A;  2V3V A;  3OUG A;  4ZM7 A;  1OGY A;  3GTP A;  2A69 D;  2CW0 D;  3ML1 A;  3IR5 A;  3IR7 A;  1PT1 A;  4AYB A;  2JIO A;  2VPW A;  3FKI A;  1H5N A;  2BH0 A;  2JIM A;  2A68 D;  1SMY D;  1HD5 A;  2E7Z A;  1FDO A;  4DMR A;  4FG2 A;  3O5A A;  5H4U A;  1R27 A;  3IR6 A;  1K83 A;  1PQE A;  5T5M D;  5FTL A;  1VC3 B;  2JA5 A;  1AA6 A;  1AW8 B;  1OA9 A;  1E32 A;  2NYA A;  3SUJ A;  1DMS A;  1Y5I A;  3M3G A;  3QQ7 A;  5FTN A;  3GTK A;  2B63 A;  3DMR A;  5B6C A;  4JJO A;  4JP7 A;  4KLN A;  5GM9 A;  1BW3 A;  2YU9 A;  1TWG A;  4JCW A;  2E2I A;  1QDN A;  1CR5 A;  2NVY A;  1IW7 D;  3HU2 A;  3X2N A;  3X2G A;  2NVX A;  2PIC A;  4JS7 A;  3X2K A;  3HKZ A;  3TIW A;  4CS0 A;  1KQG A;  1ZC1 A;  4GA5 A;  5GLX A;  4FER A;  2VPZ A;  2G6G A;  2PJH B;  1R9T A;  1SIW A;  2V45 A;  5FTJ A;  4AVR A; 
#chains in the Genus database with same CATH homology
 4RV0 A;  3CQZ A;  1G8K A;  2WB1 A;  1E61 A;  4QIW A;  1PYU B;  3HU3 A;  3PLX B;  1PQF A;  1Y1V A;  1PT0 A;  2PMZ A;  2GAE A;  3GTG A;  5C1B A;  1ZYR D;  1Y1W A;  5DYG A;  5FTK A;  3GTQ A;  1KQF A;  2C45 A;  1H0H A;  2NAP A;  2IV2 X;  3H0G A;  5C18 A;  5FTM A;  1TMO A;  1YLE A;  3QC8 A;  2R7Z A;  2PI8 A;  1UHE A;  1UHD A;  1S3S A;  3GTL A;  3GTJ A;  2PJJ A;  4KOD A;  3QWZ A;  2VPX A;  4AON B;  4C2M A;  2O5J D;  4CRZ A;  2Y0S A;  1Q16 A;  1PYQ A;  5EPP A;  1PQH A;  2A6H D;  1CZ5 A;  1YNN D;  1FDI A;  2WAQ A;  2JA6 A;  1WLF A;  1SFO A;  4KO8 A;  2R92 A;  4GA6 A;  1Y4Z A;  1QCS A;  1E18 A;  3CZB A;  2JA7 A;  4AOK B;  2KI8 A;  2DMR A;  3TM7 B;  2PNW A;  1EU1 A;  2VUM A;  4KDL A;  1I3Q A;  3GTM A;  1DMR A;  1TWH A;  4KDI A;  4CRY G;  2E2H A;  2JIQ A;  1CZ4 A;  1G8J A;  4D7Z B;  2R93 A;  1WCM A;  2A6E D;  2BE5 D;  2EEO B;  1E5V A;  3HU1 A;  4NOH A;  4AAY A;  2VPY A;  1R7R A;  3GTO A;  2G5D A;  1TWC A;  5T5I D;  1TWA A;  2JIP A;  5GLF A;  2AE0 X;  3QQ8 A;  5DYI A;  1E60 A;  3CF2 A;  1I50 A;  2JIR A;  4AZD A;  2YUJ A;  1YNJ D;  1PPY A;  1TWF A;  2V3V A;  3OUG A;  3GTP A;  1OGY A;  2A69 D;  2CW0 D;  3ML1 A;  3IR5 A;  3IR7 A;  1PT1 A;  4AYB A;  2JIO A;  2VPW A;  3FKI A;  1H5N A;  2JIM A;  2A68 D;  1SMY D;  2E7Z A;  1FDO A;  4DMR A;  3O5A A;  1R27 A;  3IR6 A;  1K83 A;  1PQE A;  5T5M D;  5FTL A;  1VC3 B;  2JA5 A;  1AA6 A;  1AW8 B;  1E32 A;  2NYA A;  1DMS A;  1Y5I A;  3QQ7 A;  5FTN A;  3GTK A;  2B63 A;  3DMR A;  5B6C A;  4KLN A;  2YU9 A;  1TWG A;  2E2I A;  1QDN A;  1CR5 A;  2NVY A;  1IW7 D;  3HU2 A;  2NVX A;  2PIC A;  3HKZ A;  3TIW A;  4CS0 A;  1KQG A;  1ZC1 A;  4GA5 A;  2VPZ A;  2G6G A;  2PJH B;  1R9T A;  1SIW A;  2V45 A;  5FTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...