1VC3B

Crystal structure of l-aspartate-alpha-decarboxylase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-Aspartate-alpha-Decarboxylase light chain
molecule tags Lyase
source organism Thermus thermophilus
publication title Crystal Structure of L-Aspartate-alpha-Decarboxylase
rcsb
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1vc3B00
4AONB 1WLFA 1CZ4A 1KQGA 3QQ8A 2E2IA 3H0GA 5T5MD 3DMRA 2JIRA 4AYBA 2YU9A 1PQEA 1OGYA 2WB1A 4GA6A 1PT0A 2IV2X 3QC8A 5FTJA 2C45A 3FKIA 1DMSA 1UHEA 1TMOA 5DYGA 3OUGA 4C2MA 1TWAA 2NYAA 4AAYA 2R93A 1FDOA 2EEOB 2B63A 1PT1A 2VPZA 4KDLA 4KDIA 1PQHA 1SFOA 1I3QA 2JIQA 4DMRA 3GTLA 1AW8B 1YLEA 2VPXA 2E2HA 1PPYA 4KO8A 3GTQA 3IR7A 1PQFA 3GTKA 3QWZA 1WCMA 3HU2A 1DMRA 1UHDA 2VPYA 2VUMA 1Y1VA 2KI8A 4CRYG 3O5AA 1TWFA 2R7ZA 2PJHB 1K83A 1Y5IA 1H0HA 3CQZA 1Q16A 2JA7A 3HKZA 1SIWA 1PYQA 3GTPA 1E32A 4RV0A 2NVXA 1E61A 1R9TA 1R7RA 1Y4ZA 5C18A 1KQFA 1QDNA 4KLNA 1I50A 3HU1A 2E7ZA 1G8KA 1PYUB 2WAQA 5FTNA 5T5ID 1TWCA 1IW7D 2DMRA 1H5NA 4CRZA 1TWHA 2Y0SA 2JA6A 1E60A 3GTJA 1CZ5A 3TIWA 3GTOA 3GTMA 5FTKA 3IR5A 1TWGA 4KODA 4QIWA 4GA5A 2NAPA 5FTLA 3PLXB 1S3SA 3IR6A 1Y1WA 2NVYA 4CS0A 2JIMA 5B6CA 1E18A 3QQ7A 3TM7B 3GTGA 2JIPA 2V3VA 1R27A 2VPWA 5DYIA 1VC3B 1E5VA 2PMZA 1AA6A 4AOKB 3ML1A 1EU1A 1FDIA 5C1BA 1CR5A 4AZDA 2V45A 1G8JA 5FTMA 4D7ZB 3CF2A 2JIOA 5GLFA 1QCSA 2R92A 3HU3A 2JA5A 5EPPA
chains in the Genus database with same CATH superfamily
2A68D 4AONB 1WLFA 1CZ4A 1KQGA 3QQ8A 2E2IA 5GLXA 3H0GA 5T5MD 3DMRA 3X2MA 2JIRA 4AYBA 2YU9A 4FFTA 2ENGA 1PQEA 4JJOA 1OGYA 2WB1A 4GA6A 1PT0A 2IV2X 3QC8A 3ENGA 5FTJA 2C45A 3FKIA 5GM9A 2YUJA 1DMSA 1UHEA 1TMOA 5DYGA 3OUGA 1BW3A 2A69D 4C2MA 1TWAA 2AE0X 2BE5D 4AVRA 2NYAA 4L48A 4AAYA 2R93A 1FDOA 1YNJD 1ZYRD 2EEOB 3CZBA 2B63A 1PT1A 2VPZA 4KDLA 4KDIA 1PQHA 1BW4A 1SFOA 1I3QA 2PI8A 2JIQA 4DMRA 4JCWA 5H4UA 3GTLA 1AW8B 1YLEA 2G5DA 2VPXA 2A6HD 4FG4A 2E2HA 1PPYA 4KO8A 3GTQA 3IR7A 1PQFA 3GTKA 3QWZA 1WCMA 4JS7A 3HU2A 4FG2A 2G6GA 1DMRA 1UHDA 2VPYA 2VUMA 1Y1VA 2KI8A 4CRYG 3O5AA 1TWFA 2GAEA 2R7ZA 2PJHB 1K83A 4FERA 1Y5IA 1H0HA 3CQZA 1Q16A 2JA7A 3X2JA 3HKZA 1SIWA 1PYQA 5GLYA 3GTPA 2KQAA 1E32A 4RV0A 2NVXA 1E61A 1R9TA 1R7RA 1Y4ZA 5C18A 1HD5A 1KQFA 1QDNA 3X2GA 4KLNA 1I50A 3X2LA 3HU1A 2E7ZA 1G8KA 1PYUB 1OA7A 1N10A 2WAQA 4NOHA 5FTNA 5T5ID 1TWCA 2PJJA 1IW7D 1ZC1A 3M3GA 2DMRA 1H5NA 4CRZA 1TWHA 2Y0SA 2JA6A 2PNWA 1E60A 3GTJA 2O5JD 1CZ5A 3TIWA 3GTOA 3GTMA 5FTKA 3IR5A 1TWGA 4KODA 3X2KA 4QIWA 4GA5A 3X2PA 2PICA 2NAPA 5FTLA 3PLXB 3X2OA 1S3SA 3IR6A 1Y1WA 2NVYA 3SUMA 4CS0A 2JIMA 5B6CA 1E18A 1YNND 3QQ7A 3TM7B 1WC2A 3GTGA 2JIPA 3X2IA 2BH0A 2V3VA 2CW0D 3SUKA 2HCZX 1R27A 2VPWA 5DYIA 1VC3B 1E5VA 2PMZA 4ENGA 4AOKB 3SUJA 3ML1A 4ZM7A 1EU1A 1AA6A 1FDIA 5C1BA 1SMYD 1CR5A 4AZDA 2V45A 1G8JA 5FTMA 4D7ZB 4JP7A 3CF2A 2JIOA 5GLFA 3X2HA 3SULA 1L8FA 1QCSA 2A6ED 2R92A 1OA9A 3HU3A 3X2NA 3D30A 2JA5A 4JP6A 5EPPA
chains in the Genus database with same CATH topology
2A68D 4AONB 1WLFA 1CZ4A 1KQGA 3QQ8A 2E2IA 3H0GA 5T5MD 3DMRA 2JIRA 4AYBA 2YU9A 1PQEA 1OGYA 2WB1A 4GA6A 1PT0A 2IV2X 3QC8A 5FTJA 2C45A 3FKIA 2YUJA 1DMSA 1UHEA 1TMOA 5DYGA 3OUGA 2A69D 4C2MA 1TWAA 2AE0X 2BE5D 2NYAA 4AAYA 2R93A 1FDOA 1YNJD 1ZYRD 2EEOB 3CZBA 2B63A 1PT1A 2VPZA 4KDLA 4KDIA 1PQHA 1SFOA 1I3QA 2PI8A 2JIQA 4DMRA 3GTLA 1AW8B 1YLEA 2G5DA 2VPXA 2A6HD 2E2HA 1PPYA 4KO8A 3GTQA 3IR7A 1PQFA 3GTKA 3QWZA 1WCMA 3HU2A 2G6GA 1DMRA 1UHDA 2VPYA 2VUMA 1Y1VA 2KI8A 4CRYG 3O5AA 1TWFA 2GAEA 2R7ZA 2PJHB 1K83A 1Y5IA 1H0HA 3CQZA 1Q16A 2JA7A 3HKZA 1SIWA 1PYQA 3GTPA 1E32A 4RV0A 2NVXA 1E61A 1R9TA 1R7RA 1Y4ZA 5C18A 1KQFA 1QDNA 4KLNA 1I50A 3HU1A 2E7ZA 1G8KA 1PYUB 2WAQA 4NOHA 5FTNA 5T5ID 1TWCA 2PJJA 1IW7D 1ZC1A 2DMRA 1H5NA 4CRZA 1TWHA 2Y0SA 2JA6A 2PNWA 1E60A 3GTJA 2O5JD 1CZ5A 3TIWA 3GTOA 3GTMA 5FTKA 3IR5A 1TWGA 4KODA 4QIWA 4GA5A 2PICA 2NAPA 5FTLA 3PLXB 1S3SA 3IR6A 1Y1WA 2NVYA 4CS0A 2JIMA 5B6CA 1E18A 1YNND 3QQ7A 3TM7B 3GTGA 2JIPA 2V3VA 2CW0D 1R27A 2VPWA 5DYIA 1VC3B 1E5VA 2PMZA 1AA6A 4AOKB 3ML1A 1EU1A 1FDIA 5C1BA 1SMYD 1CR5A 4AZDA 2V45A 1G8JA 5FTMA 4D7ZB 3CF2A 2JIOA 5GLFA 1QCSA 2A6ED 2R92A 3HU3A 2JA5A 5EPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AON B;  1WLF A;  1CZ4 A;  1KQG A;  3QQ8 A;  2E2I A;  3H0G A;  5T5M D;  3DMR A;  2JIR A;  4AYB A;  2YU9 A;  1PQE A;  1OGY A;  2WB1 A;  4GA6 A;  1PT0 A;  2IV2 X;  3QC8 A;  5FTJ A;  2C45 A;  3FKI A;  1DMS A;  1UHE A;  1TMO A;  5DYG A;  3OUG A;  4C2M A;  1TWA A;  2NYA A;  4AAY A;  2R93 A;  1FDO A;  2EEO B;  2B63 A;  1PT1 A;  2VPZ A;  4KDL A;  4KDI A;  1PQH A;  1SFO A;  1I3Q A;  2JIQ A;  4DMR A;  3GTL A;  1AW8 B;  1YLE A;  2VPX A;  2E2H A;  1PPY A;  4KO8 A;  3GTQ A;  3IR7 A;  1PQF A;  3GTK A;  3QWZ A;  1WCM A;  3HU2 A;  1DMR A;  1UHD A;  2VPY A;  2VUM A;  1Y1V A;  2KI8 A;  4CRY G;  3O5A A;  1TWF A;  2R7Z A;  2PJH B;  1K83 A;  1Y5I A;  1H0H A;  3CQZ A;  1Q16 A;  2JA7 A;  3HKZ A;  1SIW A;  1PYQ A;  3GTP A;  1E32 A;  4RV0 A;  2NVX A;  1E61 A;  1R9T A;  1R7R A;  1Y4Z A;  5C18 A;  1KQF A;  1QDN A;  4KLN A;  1I50 A;  3HU1 A;  2E7Z A;  1G8K A;  1PYU B;  2WAQ A;  5FTN A;  5T5I D;  1TWC A;  1IW7 D;  2DMR A;  1H5N A;  4CRZ A;  1TWH A;  2Y0S A;  2JA6 A;  1E60 A;  3GTJ A;  1CZ5 A;  3TIW A;  3GTO A;  3GTM A;  5FTK A;  3IR5 A;  1TWG A;  4KOD A;  4QIW A;  4GA5 A;  2NAP A;  5FTL A;  3PLX B;  1S3S A;  3IR6 A;  1Y1W A;  2NVY A;  4CS0 A;  2JIM A;  5B6C A;  1E18 A;  3QQ7 A;  3TM7 B;  3GTG A;  2JIP A;  2V3V A;  1R27 A;  2VPW A;  5DYI A;  1VC3 B;  1E5V A;  2PMZ A;  1AA6 A;  4AOK B;  3ML1 A;  1EU1 A;  1FDI A;  5C1B A;  1CR5 A;  4AZD A;  2V45 A;  1G8J A;  5FTM A;  4D7Z B;  3CF2 A;  2JIO A;  5GLF A;  1QCS A;  2R92 A;  3HU3 A;  2JA5 A;  5EPP A; 
#chains in the Genus database with same CATH topology
 2A68 D;  4AON B;  1WLF A;  1CZ4 A;  1KQG A;  3QQ8 A;  2E2I A;  5GLX A;  3H0G A;  5T5M D;  3DMR A;  3X2M A;  2JIR A;  4AYB A;  2YU9 A;  4FFT A;  2ENG A;  1PQE A;  4JJO A;  1OGY A;  2WB1 A;  4GA6 A;  1PT0 A;  2IV2 X;  3QC8 A;  3ENG A;  5FTJ A;  2C45 A;  3FKI A;  5GM9 A;  2YUJ A;  1DMS A;  1UHE A;  1TMO A;  5DYG A;  3OUG A;  1BW3 A;  2A69 D;  4C2M A;  1TWA A;  2AE0 X;  2BE5 D;  4AVR A;  2NYA A;  4L48 A;  4AAY A;  2R93 A;  1FDO A;  1YNJ D;  1ZYR D;  2EEO B;  3CZB A;  2B63 A;  1PT1 A;  2VPZ A;  4KDL A;  4KDI A;  1PQH A;  1BW4 A;  1SFO A;  1I3Q A;  2PI8 A;  2JIQ A;  4DMR A;  4JCW A;  5H4U A;  3GTL A;  1AW8 B;  1YLE A;  2G5D A;  2VPX A;  2A6H D;  4FG4 A;  2E2H A;  1PPY A;  4KO8 A;  3GTQ A;  3IR7 A;  1PQF A;  3GTK A;  3QWZ A;  1WCM A;  4JS7 A;  3HU2 A;  4FG2 A;  2G6G A;  1DMR A;  1UHD A;  2VPY A;  2VUM A;  1Y1V A;  2KI8 A;  4CRY G;  3O5A A;  1TWF A;  2GAE A;  2R7Z A;  2PJH B;  1K83 A;  4FER A;  1Y5I A;  1H0H A;  3CQZ A;  1Q16 A;  2JA7 A;  3X2J A;  3HKZ A;  1SIW A;  1PYQ A;  5GLY A;  3GTP A;  2KQA A;  1E32 A;  4RV0 A;  2NVX A;  1E61 A;  1R9T A;  1R7R A;  1Y4Z A;  5C18 A;  1HD5 A;  1KQF A;  1QDN A;  3X2G A;  4KLN A;  1I50 A;  3X2L A;  3HU1 A;  2E7Z A;  1G8K A;  1PYU B;  1OA7 A;  1N10 A;  2WAQ A;  4NOH A;  5FTN A;  5T5I D;  1TWC A;  2PJJ A;  1IW7 D;  1ZC1 A;  3M3G A;  2DMR A;  1H5N A;  4CRZ A;  1TWH A;  2Y0S A;  2JA6 A;  2PNW A;  1E60 A;  3GTJ A;  2O5J D;  1CZ5 A;  3TIW A;  3GTO A;  3GTM A;  5FTK A;  3IR5 A;  1TWG A;  4KOD A;  3X2K A;  4QIW A;  4GA5 A;  3X2P A;  2PIC A;  2NAP A;  5FTL A;  3PLX B;  3X2O A;  1S3S A;  3IR6 A;  1Y1W A;  2NVY A;  3SUM A;  4CS0 A;  2JIM A;  5B6C A;  1E18 A;  1YNN D;  3QQ7 A;  3TM7 B;  1WC2 A;  3GTG A;  2JIP A;  3X2I A;  2BH0 A;  2V3V A;  2CW0 D;  3SUK A;  2HCZ X;  1R27 A;  2VPW A;  5DYI A;  1VC3 B;  1E5V A;  2PMZ A;  4ENG A;  4AOK B;  3SUJ A;  3ML1 A;  4ZM7 A;  1EU1 A;  1AA6 A;  1FDI A;  5C1B A;  1SMY D;  1CR5 A;  4AZD A;  2V45 A;  1G8J A;  5FTM A;  4D7Z B;  4JP7 A;  3CF2 A;  2JIO A;  5GLF A;  3X2H A;  3SUL A;  1L8F A;  1QCS A;  2A6E D;  2R92 A;  1OA9 A;  3HU3 A;  3X2N A;  3D30 A;  2JA5 A;  4JP6 A;  5EPP A; 
#chains in the Genus database with same CATH homology
 2A68 D;  4AON B;  1WLF A;  1CZ4 A;  1KQG A;  3QQ8 A;  2E2I A;  3H0G A;  5T5M D;  3DMR A;  2JIR A;  4AYB A;  2YU9 A;  1PQE A;  1OGY A;  2WB1 A;  4GA6 A;  1PT0 A;  2IV2 X;  3QC8 A;  5FTJ A;  2C45 A;  3FKI A;  2YUJ A;  1DMS A;  1UHE A;  1TMO A;  5DYG A;  3OUG A;  2A69 D;  4C2M A;  1TWA A;  2AE0 X;  2BE5 D;  2NYA A;  4AAY A;  2R93 A;  1FDO A;  1YNJ D;  1ZYR D;  2EEO B;  3CZB A;  2B63 A;  1PT1 A;  2VPZ A;  4KDL A;  4KDI A;  1PQH A;  1SFO A;  1I3Q A;  2PI8 A;  2JIQ A;  4DMR A;  3GTL A;  1AW8 B;  1YLE A;  2G5D A;  2VPX A;  2A6H D;  2E2H A;  1PPY A;  4KO8 A;  3GTQ A;  3IR7 A;  1PQF A;  3GTK A;  3QWZ A;  1WCM A;  3HU2 A;  2G6G A;  1DMR A;  1UHD A;  2VPY A;  2VUM A;  1Y1V A;  2KI8 A;  4CRY G;  3O5A A;  1TWF A;  2GAE A;  2R7Z A;  2PJH B;  1K83 A;  1Y5I A;  1H0H A;  3CQZ A;  1Q16 A;  2JA7 A;  3HKZ A;  1SIW A;  1PYQ A;  3GTP A;  1E32 A;  4RV0 A;  2NVX A;  1E61 A;  1R9T A;  1R7R A;  1Y4Z A;  5C18 A;  1KQF A;  1QDN A;  4KLN A;  1I50 A;  3HU1 A;  2E7Z A;  1G8K A;  1PYU B;  2WAQ A;  4NOH A;  5FTN A;  5T5I D;  1TWC A;  2PJJ A;  1IW7 D;  1ZC1 A;  2DMR A;  1H5N A;  4CRZ A;  1TWH A;  2Y0S A;  2JA6 A;  2PNW A;  1E60 A;  3GTJ A;  2O5J D;  1CZ5 A;  3TIW A;  3GTO A;  3GTM A;  5FTK A;  3IR5 A;  1TWG A;  4KOD A;  4QIW A;  4GA5 A;  2PIC A;  2NAP A;  5FTL A;  3PLX B;  1S3S A;  3IR6 A;  1Y1W A;  2NVY A;  4CS0 A;  2JIM A;  5B6C A;  1E18 A;  1YNN D;  3QQ7 A;  3TM7 B;  3GTG A;  2JIP A;  2V3V A;  2CW0 D;  1R27 A;  2VPW A;  5DYI A;  1VC3 B;  1E5V A;  2PMZ A;  1AA6 A;  4AOK B;  3ML1 A;  1EU1 A;  1FDI A;  5C1B A;  1SMY D;  1CR5 A;  4AZD A;  2V45 A;  1G8J A;  5FTM A;  4D7Z B;  3CF2 A;  2JIO A;  5GLF A;  1QCS A;  2A6E D;  2R92 A;  3HU3 A;  2JA5 A;  5EPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...