3SULA

Crystal structure of cerato-platanin 3 from m. perniciosa (mpcp3)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
121
Chain Sequence
VAVQLQYDPVYDNADQSFGTVACSDGPNGMLTKGYSTFGSVPSYVGAVDTITGWNSESCGTCYQITWSGTGKTIHVVGVDVAGNGFNVGQRAMDDLTNGQAVALGNIDVTATLVDKSACRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Unknown function
molecule keywords Cerato-platanin-like protein
total genus 38
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sulA00
2PI8A 5GLYA 3SUMA 3X2IA 3CZBA 5H4UA 3SULA 4FERA 4JP7A 3X2KA 3X2MA 4JP6A 3ENGA 2GAEA 4FG2A 1N10A 2G6GA 2KQAA 4FFTA 1L8FA 3X2HA 2PICA 3X2NA 3X2OA 3X2GA 4ENGA 1OA9A 2PNWA 2HCZX 2G5DA 2BH0A 3M3GA 4JS7A 2PJJA 5GM9A 3SUKA 2AE0X 4L48A 4ZM7A 1BW4A 3X2LA 3D30A 4JJOA 1HD5A 4AVRA 3X2JA 1OA7A 1WC2A 2ENGA 4JCWA 1BW3A 4FG4A 5GLXA 3X2PA 3SUJA
chains in the Genus database with same CATH superfamily
1K83A 4KO8A 3X2IA 2E7ZA 5FTMA 1PT0A 1QCSA 2E2HA 5FTNA 1WLFA 5H4UA 1SFOA 3SULA 2R7ZA 2A69D 2R92A 3DMRA 3O5AA 1CR5A 3QQ7A 4CRZA 2CW0D 1G8KA 1N10A 2NVYA 2R93A 2VUMA 2KQAA 4CS0A 3HU3A 2PJHB 3GTQA 3GTMA 3QWZA 2YU9A 3X2OA 1FDOA 4ENGA 1DMSA 2HCZX 2G5DA 4JS7A 3SUKA 5B6CA 3GTJA 2E2IA 1CZ4A 2A6HD 2KI8A 1KQFA 4GA6A 3X2JA 5FTKA 1PQHA 1Y5IA 5T5MD 1YLEA 2ENGA 3HU1A 3HKZA 4JCWA 1IW7D 1VC3B 2JA7A 2JIMA 1PT1A 3H0GA 1AW8B 5GLYA 2V45A 3SUMA 1E60A 4KDLA 4DMRA 2V3VA 1EU1A 1PYUB 4JP7A 1H0HA 3X2KA 1AA6A 3X2MA 2O5JD 1E5VA 2EEOB 1E32A 3ENGA 4FG2A 2NVXA 1DMRA 2NAPA 1Y1WA 5C18A 4NOHA 1ZYRD 2IV2X 2A6ED 3GTOA 3M3GA 5GM9A 4ZM7A 2PJJA 4CRYG 5EPPA 1YNND 1E18A 1YNJD 4C2MA 3QQ8A 3X2LA 3D30A 2WB1A 4JJOA 1FDIA 1OA7A 1R9TA 2VPWA 1UHDA 1TMOA 2A68D 2BE5D 1TWCA 4FG4A 5GLXA 5T5ID 3X2PA 2VPXA 3HU2A 1Y1VA 3CZBA 3OUGA 4KDIA 1ZC1A 4FERA 1OGYA 4JP6A 2VPYA 3QC8A 3IR7A 3PLXB 2JA5A 4AOKB 5GLFA 1L8FA 1SMYD 4RV0A 2PICA 4GA5A 2PMZA 1I3QA 3X2GA 1OA9A 2PNWA 1TWFA 1PQEA 2BH0A 1E61A 4KODA 3TIWA 2AE0X 2JIPA 1R7RA 1QDNA 1BW4A 1TWGA 1WC2A 2JIQA 3IR6A 2NYAA 1PQFA 1Q16A 2VPZA 2Y0SA 1KQGA 3CQZA 3GTGA 1CZ5A 1BW3A 1H5NA 2PI8A 4AONB 4AZDA 5C1BA 3GTKA 3TM7B 1I50A 3GTPA 4D7ZB 3CF2A 1SIWA 4AYBA 1TWAA 1Y4ZA 5FTLA 2GAEA 2YUJA 2G6GA 1TWHA 5DYIA 4FFTA 1S3SA 2JIRA 3X2HA 3X2NA 1R27A 3ML1A 3FKIA 5DYGA 2C45A 1WCMA 2B63A 4L48A 3IR5A 2DMRA 1G8JA 2WAQA 4KLNA 1UHEA 1PPYA 3GTLA 1HD5A 4AVRA 1PYQA 2JIOA 2JA6A 4AAYA 4QIWA 5FTJA 3SUJA
chains in the Genus database with same CATH topology
2PI8A 5GLYA 3SUMA 3X2IA 3CZBA 5H4UA 3SULA 4FERA 4JP7A 3X2KA 3X2MA 4JP6A 3ENGA 2GAEA 4FG2A 1N10A 2G6GA 2KQAA 4FFTA 1L8FA 3X2HA 2PICA 3X2NA 3X2OA 3X2GA 4ENGA 1OA9A 2PNWA 2HCZX 2G5DA 2BH0A 3M3GA 4JS7A 2PJJA 5GM9A 3SUKA 2AE0X 4L48A 4ZM7A 1BW4A 3X2LA 3D30A 4JJOA 1HD5A 4AVRA 3X2JA 1OA7A 1WC2A 2ENGA 4JCWA 1BW3A 4FG4A 5GLXA 3X2PA 3SUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI8 A;  5GLY A;  3SUM A;  3X2I A;  3CZB A;  5H4U A;  3SUL A;  4FER A;  4JP7 A;  3X2K A;  3X2M A;  4JP6 A;  3ENG A;  2GAE A;  4FG2 A;  1N10 A;  2G6G A;  2KQA A;  4FFT A;  1L8F A;  3X2H A;  2PIC A;  3X2N A;  3X2O A;  3X2G A;  4ENG A;  1OA9 A;  2PNW A;  2HCZ X;  2G5D A;  2BH0 A;  3M3G A;  4JS7 A;  2PJJ A;  5GM9 A;  3SUK A;  2AE0 X;  4L48 A;  4ZM7 A;  1BW4 A;  3X2L A;  3D30 A;  4JJO A;  1HD5 A;  4AVR A;  3X2J A;  1OA7 A;  1WC2 A;  2ENG A;  4JCW A;  1BW3 A;  4FG4 A;  5GLX A;  3X2P A;  3SUJ A; 
#chains in the Genus database with same CATH topology
 1K83 A;  4KO8 A;  3X2I A;  2E7Z A;  5FTM A;  1PT0 A;  1QCS A;  2E2H A;  5FTN A;  1WLF A;  5H4U A;  1SFO A;  3SUL A;  2R7Z A;  2A69 D;  2R92 A;  3DMR A;  3O5A A;  1CR5 A;  3QQ7 A;  4CRZ A;  2CW0 D;  1G8K A;  1N10 A;  2NVY A;  2R93 A;  2VUM A;  2KQA A;  4CS0 A;  3HU3 A;  2PJH B;  3GTQ A;  3GTM A;  3QWZ A;  2YU9 A;  3X2O A;  1FDO A;  4ENG A;  1DMS A;  2HCZ X;  2G5D A;  4JS7 A;  3SUK A;  5B6C A;  3GTJ A;  2E2I A;  1CZ4 A;  2A6H D;  2KI8 A;  1KQF A;  4GA6 A;  3X2J A;  5FTK A;  1PQH A;  1Y5I A;  5T5M D;  1YLE A;  2ENG A;  3HU1 A;  3HKZ A;  4JCW A;  1IW7 D;  1VC3 B;  2JA7 A;  2JIM A;  1PT1 A;  3H0G A;  1AW8 B;  5GLY A;  2V45 A;  3SUM A;  1E60 A;  4KDL A;  4DMR A;  2V3V A;  1EU1 A;  1PYU B;  4JP7 A;  1H0H A;  3X2K A;  1AA6 A;  3X2M A;  2O5J D;  1E5V A;  2EEO B;  1E32 A;  3ENG A;  4FG2 A;  2NVX A;  1DMR A;  2NAP A;  1Y1W A;  5C18 A;  4NOH A;  1ZYR D;  2IV2 X;  2A6E D;  3GTO A;  3M3G A;  5GM9 A;  4ZM7 A;  2PJJ A;  4CRY G;  5EPP A;  1YNN D;  1E18 A;  1YNJ D;  4C2M A;  3QQ8 A;  3X2L A;  3D30 A;  2WB1 A;  4JJO A;  1FDI A;  1OA7 A;  1R9T A;  2VPW A;  1UHD A;  1TMO A;  2A68 D;  2BE5 D;  1TWC A;  4FG4 A;  5GLX A;  5T5I D;  3X2P A;  2VPX A;  3HU2 A;  1Y1V A;  3CZB A;  3OUG A;  4KDI A;  1ZC1 A;  4FER A;  1OGY A;  4JP6 A;  2VPY A;  3QC8 A;  3IR7 A;  3PLX B;  2JA5 A;  4AOK B;  5GLF A;  1L8F A;  1SMY D;  4RV0 A;  2PIC A;  4GA5 A;  2PMZ A;  1I3Q A;  3X2G A;  1OA9 A;  2PNW A;  1TWF A;  1PQE A;  2BH0 A;  1E61 A;  4KOD A;  3TIW A;  2AE0 X;  2JIP A;  1R7R A;  1QDN A;  1BW4 A;  1TWG A;  1WC2 A;  2JIQ A;  3IR6 A;  2NYA A;  1PQF A;  1Q16 A;  2VPZ A;  2Y0S A;  1KQG A;  3CQZ A;  3GTG A;  1CZ5 A;  1BW3 A;  1H5N A;  2PI8 A;  4AON B;  4AZD A;  5C1B A;  3GTK A;  3TM7 B;  1I50 A;  3GTP A;  4D7Z B;  3CF2 A;  1SIW A;  4AYB A;  1TWA A;  1Y4Z A;  5FTL A;  2GAE A;  2YUJ A;  2G6G A;  1TWH A;  5DYI A;  4FFT A;  1S3S A;  2JIR A;  3X2H A;  3X2N A;  1R27 A;  3ML1 A;  3FKI A;  5DYG A;  2C45 A;  1WCM A;  2B63 A;  4L48 A;  3IR5 A;  2DMR A;  1G8J A;  2WAQ A;  4KLN A;  1UHE A;  1PPY A;  3GTL A;  1HD5 A;  4AVR A;  1PYQ A;  2JIO A;  2JA6 A;  4AAY A;  4QIW A;  5FTJ A;  3SUJ A; 
#chains in the Genus database with same CATH homology
 2PI8 A;  5GLY A;  3SUM A;  3X2I A;  3CZB A;  5H4U A;  3SUL A;  4FER A;  4JP7 A;  3X2K A;  3X2M A;  4JP6 A;  3ENG A;  2GAE A;  4FG2 A;  1N10 A;  2G6G A;  2KQA A;  4FFT A;  1L8F A;  3X2H A;  2PIC A;  3X2N A;  3X2O A;  3X2G A;  4ENG A;  1OA9 A;  2PNW A;  2HCZ X;  2G5D A;  2BH0 A;  3M3G A;  4JS7 A;  2PJJ A;  5GM9 A;  3SUK A;  2AE0 X;  4L48 A;  4ZM7 A;  1BW4 A;  3X2L A;  3D30 A;  4JJO A;  1HD5 A;  4AVR A;  3X2J A;  1OA7 A;  1WC2 A;  2ENG A;  4JCW A;  1BW3 A;  4FG4 A;  5GLX A;  3X2P A;  3SUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...