3SULA

Crystal structure of cerato-platanin 3 from m. perniciosa (mpcp3)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
121
Chain Sequence
VAVQLQYDPVYDNADQSFGTVACSDGPNGMLTKGYSTFGSVPSYVGAVDTITGWNSESCGTCYQITWSGTGKTIHVVGVDVAGNGFNVGQRAMDDLTNGQAVALGNIDVTATLVDKSACRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin-like protein
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Unknown function
total genus 38
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sulA00
2AE0X 5H4UA 2PICA 1L8FA 3SUJA 3D30A 4JCWA 3M3GA 4FFTA 3X2LA 3X2OA 2HCZX 3X2GA 1N10A 2PI8A 4ENGA 1OA9A 5GLXA 2G6GA 1BW3A 4JS7A 3SUMA 3X2NA 2PJJA 3X2HA 2G5DA 3CZBA 4ZM7A 4FG2A 3SUKA 5GLYA 4AVRA 1OA7A 1WC2A 3X2KA 4JJOA 4L48A 2PNWA 4JP7A 1HD5A 3X2PA 2BH0A 5GM9A 2KQAA 4JP6A 1BW4A 4FERA 2GAEA 4FG4A 3X2MA 2ENGA 3X2IA 3SULA 3ENGA 3X2JA
chains in the Genus database with same CATH superfamily
4RV0A 3SUJA 3D30A 1E60A 1Y1VA 4FFTA 3CF2A 1R27A 3HU1A 5FTJA 3H0GA 2VPZA 4KO8A 2V45A 1E32A 2PJHB 3TM7B 4JS7A 3OUGA 3X2NA 3QWZA 2PJJA 3GTGA 2E7ZA 2VPXA 5C1BA 4GA5A 2JA5A 3O5AA 3CZBA 4ZM7A 4FG2A 5GLYA 2IV2X 1WC2A 2YUJA 1TWFA 1R9TA 1HD5A 1SFOA 2NYAA 3GTJA 4AAYA 5GM9A 2KQAA 3GTOA 1BW4A 2EEOB 1OGYA 3X2MA 1Q16A 3X2IA 5T5ID 3SULA 2NVXA 2A68D 4KLNA 2PMZA 1I3QA 1G8JA 5H4UA 1TWGA 2JA7A 3GTPA 3X2GA 1DMSA 1YNJD 1KQGA 4ENGA 1AA6A 1PQFA 4AONB 1DMRA 1K83A 1VC3B 1R7RA 5FTKA 2G6GA 1S3SA 3ML1A 4NOHA 2B63A 1KQFA 1YLEA 2JIRA 2JIMA 4CRZA 2NAPA 1ZC1A 2R92A 3TIWA 2C45A 2JIOA 2JIQA 4C2MA 5FTLA 1AW8B 5FTMA 1Y5IA 2KI8A 1E5VA 2CW0D 4CRYG 2VPYA 4L48A 2PNWA 1E61A 2BE5D 1YNND 4CS0A 4KODA 5C18A 3HU3A 1TWHA 3GTMA 5EPPA 5B6CA 3CQZA 1QCSA 1TWCA 4KDIA 1QDNA 1Y1WA 1PYQA 2VUMA 2NVYA 2A6HD 3X2LA 4JCWA 3X2OA 4DMRA 1FDOA 5DYIA 4GA6A 3DMRA 1ZYRD 1TMOA 4AZDA 4D7ZB 4AOKB 1OA9A 2R7ZA 2A69D 1G8KA 3SUMA 1TWAA 4KDLA 2O5JD 3X2HA 2G5DA 1EU1A 1I50A 1WLFA 3FKIA 3QC8A 1FDIA 2Y0SA 3HU2A 1OA7A 5FTNA 1IW7D 3QQ7A 1CZ5A 4JP7A 1E18A 2R93A 2BH0A 4JP6A 2ENGA 1CR5A 3ENGA 2AE0X 1PYUB 2PICA 1L8FA 3M3GA 1H0HA 2E2IA 2HCZX 1UHDA 1N10A 1UHEA 2PI8A 3IR5A 5GLXA 2WAQA 2VPWA 1SMYD 2JIPA 4QIWA 2E2HA 1BW3A 5T5MD 2YU9A 3GTLA 5GLFA 1WCMA 1Y4ZA 1PQEA 4AYBA 5DYGA 3SUKA 3IR6A 1PPYA 3X2KA 1PT0A 3HKZA 4AVRA 1PT1A 1CZ4A 4JJOA 2WB1A 3X2PA 4FERA 2GAEA 4FG4A 3GTQA 3QQ8A 1PQHA 2V3VA 2A6ED 2DMRA 3IR7A 3PLXB 3GTKA 1H5NA 2JA6A 1SIWA 3X2JA
chains in the Genus database with same CATH topology
2AE0X 5H4UA 2PICA 1L8FA 3SUJA 3D30A 4JCWA 3M3GA 4FFTA 3X2LA 3X2OA 2HCZX 3X2GA 1N10A 2PI8A 4ENGA 1OA9A 5GLXA 2G6GA 1BW3A 4JS7A 3SUMA 3X2NA 2PJJA 3X2HA 2G5DA 3CZBA 4ZM7A 4FG2A 3SUKA 5GLYA 4AVRA 1OA7A 1WC2A 3X2KA 4JJOA 4L48A 2PNWA 4JP7A 1HD5A 3X2PA 2BH0A 5GM9A 2KQAA 4JP6A 1BW4A 4FERA 2GAEA 4FG4A 3X2MA 2ENGA 3X2IA 3SULA 3ENGA 3X2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AE0 X;  5H4U A;  2PIC A;  1L8F A;  3SUJ A;  3D30 A;  4JCW A;  3M3G A;  4FFT A;  3X2L A;  3X2O A;  2HCZ X;  3X2G A;  1N10 A;  2PI8 A;  4ENG A;  1OA9 A;  5GLX A;  2G6G A;  1BW3 A;  4JS7 A;  3SUM A;  3X2N A;  2PJJ A;  3X2H A;  2G5D A;  3CZB A;  4ZM7 A;  4FG2 A;  3SUK A;  5GLY A;  4AVR A;  1OA7 A;  1WC2 A;  3X2K A;  4JJO A;  4L48 A;  2PNW A;  4JP7 A;  1HD5 A;  3X2P A;  2BH0 A;  5GM9 A;  2KQA A;  4JP6 A;  1BW4 A;  4FER A;  2GAE A;  4FG4 A;  3X2M A;  2ENG A;  3X2I A;  3SUL A;  3ENG A;  3X2J A; 
#chains in the Genus database with same CATH topology
 4RV0 A;  3SUJ A;  3D30 A;  1E60 A;  1Y1V A;  4FFT A;  3CF2 A;  1R27 A;  3HU1 A;  5FTJ A;  3H0G A;  2VPZ A;  4KO8 A;  2V45 A;  1E32 A;  2PJH B;  3TM7 B;  4JS7 A;  3OUG A;  3X2N A;  3QWZ A;  2PJJ A;  3GTG A;  2E7Z A;  2VPX A;  5C1B A;  4GA5 A;  2JA5 A;  3O5A A;  3CZB A;  4ZM7 A;  4FG2 A;  5GLY A;  2IV2 X;  1WC2 A;  2YUJ A;  1TWF A;  1R9T A;  1HD5 A;  1SFO A;  2NYA A;  3GTJ A;  4AAY A;  5GM9 A;  2KQA A;  3GTO A;  1BW4 A;  2EEO B;  1OGY A;  3X2M A;  1Q16 A;  3X2I A;  5T5I D;  3SUL A;  2NVX A;  2A68 D;  4KLN A;  2PMZ A;  1I3Q A;  1G8J A;  5H4U A;  1TWG A;  2JA7 A;  3GTP A;  3X2G A;  1DMS A;  1YNJ D;  1KQG A;  4ENG A;  1AA6 A;  1PQF A;  4AON B;  1DMR A;  1K83 A;  1VC3 B;  1R7R A;  5FTK A;  2G6G A;  1S3S A;  3ML1 A;  4NOH A;  2B63 A;  1KQF A;  1YLE A;  2JIR A;  2JIM A;  4CRZ A;  2NAP A;  1ZC1 A;  2R92 A;  3TIW A;  2C45 A;  2JIO A;  2JIQ A;  4C2M A;  5FTL A;  1AW8 B;  5FTM A;  1Y5I A;  2KI8 A;  1E5V A;  2CW0 D;  4CRY G;  2VPY A;  4L48 A;  2PNW A;  1E61 A;  2BE5 D;  1YNN D;  4CS0 A;  4KOD A;  5C18 A;  3HU3 A;  1TWH A;  3GTM A;  5EPP A;  5B6C A;  3CQZ A;  1QCS A;  1TWC A;  4KDI A;  1QDN A;  1Y1W A;  1PYQ A;  2VUM A;  2NVY A;  2A6H D;  3X2L A;  4JCW A;  3X2O A;  4DMR A;  1FDO A;  5DYI A;  4GA6 A;  3DMR A;  1ZYR D;  1TMO A;  4AZD A;  4D7Z B;  4AOK B;  1OA9 A;  2R7Z A;  2A69 D;  1G8K A;  3SUM A;  1TWA A;  4KDL A;  2O5J D;  3X2H A;  2G5D A;  1EU1 A;  1I50 A;  1WLF A;  3FKI A;  3QC8 A;  1FDI A;  2Y0S A;  3HU2 A;  1OA7 A;  5FTN A;  1IW7 D;  3QQ7 A;  1CZ5 A;  4JP7 A;  1E18 A;  2R93 A;  2BH0 A;  4JP6 A;  2ENG A;  1CR5 A;  3ENG A;  2AE0 X;  1PYU B;  2PIC A;  1L8F A;  3M3G A;  1H0H A;  2E2I A;  2HCZ X;  1UHD A;  1N10 A;  1UHE A;  2PI8 A;  3IR5 A;  5GLX A;  2WAQ A;  2VPW A;  1SMY D;  2JIP A;  4QIW A;  2E2H A;  1BW3 A;  5T5M D;  2YU9 A;  3GTL A;  5GLF A;  1WCM A;  1Y4Z A;  1PQE A;  4AYB A;  5DYG A;  3SUK A;  3IR6 A;  1PPY A;  3X2K A;  1PT0 A;  3HKZ A;  4AVR A;  1PT1 A;  1CZ4 A;  4JJO A;  2WB1 A;  3X2P A;  4FER A;  2GAE A;  4FG4 A;  3GTQ A;  3QQ8 A;  1PQH A;  2V3V A;  2A6E D;  2DMR A;  3IR7 A;  3PLX B;  3GTK A;  1H5N A;  2JA6 A;  1SIW A;  3X2J A; 
#chains in the Genus database with same CATH homology
 2AE0 X;  5H4U A;  2PIC A;  1L8F A;  3SUJ A;  3D30 A;  4JCW A;  3M3G A;  4FFT A;  3X2L A;  3X2O A;  2HCZ X;  3X2G A;  1N10 A;  2PI8 A;  4ENG A;  1OA9 A;  5GLX A;  2G6G A;  1BW3 A;  4JS7 A;  3SUM A;  3X2N A;  2PJJ A;  3X2H A;  2G5D A;  3CZB A;  4ZM7 A;  4FG2 A;  3SUK A;  5GLY A;  4AVR A;  1OA7 A;  1WC2 A;  3X2K A;  4JJO A;  4L48 A;  2PNW A;  4JP7 A;  1HD5 A;  3X2P A;  2BH0 A;  5GM9 A;  2KQA A;  4JP6 A;  1BW4 A;  4FER A;  2GAE A;  4FG4 A;  3X2M A;  2ENG A;  3X2I A;  3SUL A;  3ENG A;  3X2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...