3SULA

Crystal structure of cerato-platanin 3 from m. perniciosa (mpcp3)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
121
Chain Sequence
b'VAVQLQYDPVYDNADQSFGTVACSDGPNGMLTKGYSTFGSVPSYVGAVDTITGWNSESCGTCYQITWSGTGKTIHVVGVDVAGNGFNVGQRAMDDLTNGQAVALGNIDVTATLVDKSACRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin-like protein
molecule tags Unknown function
source organism Moniliophthora perniciosa
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
total genus 38
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sulA00
3ENGA 4ZM7A 2BH0A 3M3GA 4ENGA 3SULA 4FG2A 2KQAA 1OA7A 3X2MA 3X2PA 2GAEA 3D30A 4FFTA 3X2NA 4FG4A 4JP7A 4JP6A 3X2LA 3SUKA 3X2IA 2G6GA 3SUMA 4JS7A 2HCZX 2PNWA 5GLXA 2ENGA 4AVRA 2PICA 5GLYA 5H4UA 1BW3A 4JJOA 3X2HA 3X2JA 1BW4A 1HD5A 1OA9A 2PI8A 5GM9A 3X2KA 4L48A 4JCWA 1N10A 3X2GA 4FERA 3CZBA 1WC2A 2G5DA 2PJJA 2AE0X 3SUJA 1L8FA 3X2OA
chains in the Genus database with same CATH superfamily
1PQHA 1CZ4A 2A6ED 1ZYRD 4CRZA 3HU1A 2PJHB 1TWCA 1Y1WA 1QDNA 3QC8A 5DYIA 4JP6A 2B63A 1TWGA 3IR7A 1PT1A 3X2LA 4AONB 3TIWA 3PLXB 4AZDA 1AA6A 3X2IA 1SFOA 3GTOA 4DMRA 2YU9A 2V3VA 5B6CA 2PNWA 3QWZA 5FTMA 1YLEA 4KLNA 2EEOB 2E2HA 5H4UA 4NOHA 5GM9A 3ML1A 1ZC1A 2DMRA 3X2GA 1N10A 4GA5A 2NVXA 3CZBA 3GTLA 2VPWA 4KO8A 4AOKB 1FDIA 2AE0X 3M3GA 1DMSA 3QQ7A 2A6HD 1G8KA 1KQFA 2VUMA 4KDIA 2BH0A 1G8JA 2YUJA 2C45A 1Y1VA 1OA7A 1CR5A 1UHEA 3IR6A 4GA6A 5T5MD 3D30A 5T5ID 4JP7A 2A69D 3O5AA 1PYQA 2A68D 1PQFA 5GLFA 3SUKA 2IV2X 1EU1A 1S3SA 1SMYD 1R9TA 1OGYA 2JIMA 5C18A 5FTNA 3OUGA 2PICA 1PYUB 3HU2A 5EPPA 1BW3A 4JJOA 3X2JA 1VC3B 1AW8B 1DMRA 2Y0SA 5FTLA 3H0GA 2V45A 3QQ8A 1SIWA 1I50A 4JCWA 4CS0A 4FERA 1UHDA 2PJJA 1H0HA 1KQGA 1Q16A 1TMOA 1L8FA 3ENGA 3GTJA 3FKIA 1TWFA 4ENGA 2CW0D 3SULA 2PMZA 2VPZA 4FG2A 1YNND 1PT0A 1E32A 2JIQA 3GTKA 2R92A 4FG4A 1Y5IA 4RV0A 2JA7A 5C1BA 2NVYA 4C2MA 1E60A 3SUMA 4JS7A 2JIRA 5GLXA 2ENGA 4KODA 5GLYA 4AAYA 1TWAA 1BW4A 3X2HA 4D7ZB 1HD5A 2VPXA 5FTJA 1TWHA 1IW7D 3X2KA 2JA6A 2VPYA 3GTGA 2BE5D 3HU3A 2WB1A 3SUJA 1K83A 1PQEA 2NAPA 3X2OA 4ZM7A 4KDLA 2NYAA 1Y4ZA 2KQAA 5FTKA 1R27A 3X2MA 3X2PA 2GAEA 4FFTA 2R7ZA 3X2NA 1E5VA 4AYBA 4CRYG 2JA5A 3HKZA 1R7RA 2KI8A 3DMRA 1E61A 2G6GA 1WLFA 3GTQA 1E18A 2HCZX 3CF2A 3GTPA 1YNJD 5DYGA 4AVRA 2E7ZA 2E2IA 2JIOA 1QCSA 2WAQA 3CQZA 1WCMA 1OA9A 2PI8A 1I3QA 4QIWA 4L48A 2JIPA 1H5NA 3TM7B 3GTMA 1WC2A 2G5DA 1CZ5A 2O5JD 1FDOA 2R93A 3IR5A 1PPYA
chains in the Genus database with same CATH topology
3ENGA 4ZM7A 2BH0A 3M3GA 4ENGA 3SULA 4FG2A 2KQAA 1OA7A 3X2MA 3X2PA 2GAEA 3D30A 4FFTA 3X2NA 4FG4A 4JP7A 4JP6A 3X2LA 3SUKA 3X2IA 2G6GA 3SUMA 4JS7A 2HCZX 2PNWA 5GLXA 2ENGA 4AVRA 2PICA 5GLYA 5H4UA 1BW3A 4JJOA 3X2HA 3X2JA 1BW4A 1HD5A 1OA9A 2PI8A 5GM9A 3X2KA 4L48A 4JCWA 1N10A 3X2GA 4FERA 3CZBA 1WC2A 2G5DA 2PJJA 2AE0X 3SUJA 1L8FA 3X2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ENG A;  4ZM7 A;  2BH0 A;  3M3G A;  4ENG A;  3SUL A;  4FG2 A;  2KQA A;  1OA7 A;  3X2M A;  3X2P A;  2GAE A;  3D30 A;  4FFT A;  3X2N A;  4FG4 A;  4JP7 A;  4JP6 A;  3X2L A;  3SUK A;  3X2I A;  2G6G A;  3SUM A;  4JS7 A;  2HCZ X;  2PNW A;  5GLX A;  2ENG A;  4AVR A;  2PIC A;  5GLY A;  5H4U A;  1BW3 A;  4JJO A;  3X2H A;  3X2J A;  1BW4 A;  1HD5 A;  1OA9 A;  2PI8 A;  5GM9 A;  3X2K A;  4L48 A;  4JCW A;  1N10 A;  3X2G A;  4FER A;  3CZB A;  1WC2 A;  2G5D A;  2PJJ A;  2AE0 X;  3SUJ A;  1L8F A;  3X2O A; 
#chains in the Genus database with same CATH topology
 1PQH A;  1CZ4 A;  2A6E D;  1ZYR D;  4CRZ A;  3HU1 A;  2PJH B;  1TWC A;  1Y1W A;  1QDN A;  3QC8 A;  5DYI A;  4JP6 A;  2B63 A;  1TWG A;  3IR7 A;  1PT1 A;  3X2L A;  4AON B;  3TIW A;  3PLX B;  4AZD A;  1AA6 A;  3X2I A;  1SFO A;  3GTO A;  4DMR A;  2YU9 A;  2V3V A;  5B6C A;  2PNW A;  3QWZ A;  5FTM A;  1YLE A;  4KLN A;  2EEO B;  2E2H A;  5H4U A;  4NOH A;  5GM9 A;  3ML1 A;  1ZC1 A;  2DMR A;  3X2G A;  1N10 A;  4GA5 A;  2NVX A;  3CZB A;  3GTL A;  2VPW A;  4KO8 A;  4AOK B;  1FDI A;  2AE0 X;  3M3G A;  1DMS A;  3QQ7 A;  2A6H D;  1G8K A;  1KQF A;  2VUM A;  4KDI A;  2BH0 A;  1G8J A;  2YUJ A;  2C45 A;  1Y1V A;  1OA7 A;  1CR5 A;  1UHE A;  3IR6 A;  4GA6 A;  5T5M D;  3D30 A;  5T5I D;  4JP7 A;  2A69 D;  3O5A A;  1PYQ A;  2A68 D;  1PQF A;  5GLF A;  3SUK A;  2IV2 X;  1EU1 A;  1S3S A;  1SMY D;  1R9T A;  1OGY A;  2JIM A;  5C18 A;  5FTN A;  3OUG A;  2PIC A;  1PYU B;  3HU2 A;  5EPP A;  1BW3 A;  4JJO A;  3X2J A;  1VC3 B;  1AW8 B;  1DMR A;  2Y0S A;  5FTL A;  3H0G A;  2V45 A;  3QQ8 A;  1SIW A;  1I50 A;  4JCW A;  4CS0 A;  4FER A;  1UHD A;  2PJJ A;  1H0H A;  1KQG A;  1Q16 A;  1TMO A;  1L8F A;  3ENG A;  3GTJ A;  3FKI A;  1TWF A;  4ENG A;  2CW0 D;  3SUL A;  2PMZ A;  2VPZ A;  4FG2 A;  1YNN D;  1PT0 A;  1E32 A;  2JIQ A;  3GTK A;  2R92 A;  4FG4 A;  1Y5I A;  4RV0 A;  2JA7 A;  5C1B A;  2NVY A;  4C2M A;  1E60 A;  3SUM A;  4JS7 A;  2JIR A;  5GLX A;  2ENG A;  4KOD A;  5GLY A;  4AAY A;  1TWA A;  1BW4 A;  3X2H A;  4D7Z B;  1HD5 A;  2VPX A;  5FTJ A;  1TWH A;  1IW7 D;  3X2K A;  2JA6 A;  2VPY A;  3GTG A;  2BE5 D;  3HU3 A;  2WB1 A;  3SUJ A;  1K83 A;  1PQE A;  2NAP A;  3X2O A;  4ZM7 A;  4KDL A;  2NYA A;  1Y4Z A;  2KQA A;  5FTK A;  1R27 A;  3X2M A;  3X2P A;  2GAE A;  4FFT A;  2R7Z A;  3X2N A;  1E5V A;  4AYB A;  4CRY G;  2JA5 A;  3HKZ A;  1R7R A;  2KI8 A;  3DMR A;  1E61 A;  2G6G A;  1WLF A;  3GTQ A;  1E18 A;  2HCZ X;  3CF2 A;  3GTP A;  1YNJ D;  5DYG A;  4AVR A;  2E7Z A;  2E2I A;  2JIO A;  1QCS A;  2WAQ A;  3CQZ A;  1WCM A;  1OA9 A;  2PI8 A;  1I3Q A;  4QIW A;  4L48 A;  2JIP A;  1H5N A;  3TM7 B;  3GTM A;  1WC2 A;  2G5D A;  1CZ5 A;  2O5J D;  1FDO A;  2R93 A;  3IR5 A;  1PPY A; 
#chains in the Genus database with same CATH homology
 3ENG A;  4ZM7 A;  2BH0 A;  3M3G A;  4ENG A;  3SUL A;  4FG2 A;  2KQA A;  1OA7 A;  3X2M A;  3X2P A;  2GAE A;  3D30 A;  4FFT A;  3X2N A;  4FG4 A;  4JP7 A;  4JP6 A;  3X2L A;  3SUK A;  3X2I A;  2G6G A;  3SUM A;  4JS7 A;  2HCZ X;  2PNW A;  5GLX A;  2ENG A;  4AVR A;  2PIC A;  5GLY A;  5H4U A;  1BW3 A;  4JJO A;  3X2H A;  3X2J A;  1BW4 A;  1HD5 A;  1OA9 A;  2PI8 A;  5GM9 A;  3X2K A;  4L48 A;  4JCW A;  1N10 A;  3X2G A;  4FER A;  3CZB A;  1WC2 A;  2G5D A;  2PJJ A;  2AE0 X;  3SUJ A;  1L8F A;  3X2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...