3SULA

Crystal structure of cerato-platanin 3 from m. perniciosa (mpcp3)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
121
Chain Sequence
b'VAVQLQYDPVYDNADQSFGTVACSDGPNGMLTKGYSTFGSVPSYVGAVDTITGWNSESCGTCYQITWSGTGKTIHVVGVDVAGNGFNVGQRAMDDLTNGQAVALGNIDVTATLVDKSACRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin-like protein
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Unknown function
total genus 38
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sulA00
2HCZX 4JJOA 4ENGA 3CZBA 4JS7A 3SUMA 4L48A 2ENGA 3SUJA 1BW4A 2G6GA 2G5DA 1OA9A 4FG4A 4FERA 3X2MA 5GLYA 3X2IA 3X2GA 1L8FA 4ZM7A 3X2PA 3SULA 1N10A 2KQAA 1WC2A 2PICA 3SUKA 4FG2A 5GLXA 3M3GA 3ENGA 5GM9A 3X2NA 4FFTA 2BH0A 2PJJA 1OA7A 2GAEA 3X2JA 4AVRA 3X2LA 3X2HA 4JP7A 5H4UA 1HD5A 2PI8A 2AE0X 4JP6A 2PNWA 3D30A 4JCWA 3X2KA 3X2OA 1BW3A
chains in the Genus database with same CATH superfamily
4JJOA 1FDOA 1H0HA 1OGYA 1VC3B 2PMZA 3CZBA 5DYIA 5FTMA 2CW0D 2A6ED 2ENGA 2KI8A 2E7ZA 2NYAA 4QIWA 2E2HA 3IR6A 1TWFA 4FG4A 4FERA 1CZ4A 1Y1VA 4KO8A 1YNND 5FTKA 2R92A 3QWZA 3X2PA 1N10A 1TWHA 1AA6A 1PT0A 3M3GA 1PYUB 3ENGA 4AONB 1WCMA 5DYGA 3IR5A 3X2NA 1ZYRD 2WAQA 4FFTA 1Y1WA 2PJJA 1G8JA 5T5ID 1OA7A 1CR5A 3TM7B 1PQHA 1ZC1A 4JP7A 4JP6A 2PI8A 1I50A 4JCWA 3HU1A 3GTGA 1KQGA 2HCZX 2V3VA 3ML1A 4KLNA 3GTPA 3SUJA 3HKZA 1DMRA 2JIPA 3GTJA 2BE5D 3X2MA 3CQZA 5GLFA 4CRYG 1L8FA 4ZM7A 1QDNA 2YU9A 1Y5IA 1E32A 1KQFA 3SULA 4AAYA 5C18A 3O5AA 4FG2A 5GLXA 3CF2A 2VPZA 2JIMA 2V45A 2VPYA 2GAEA 2WB1A 5T5MD 1E61A 3X2HA 5EPPA 1PQEA 5FTJA 5H4UA 3GTMA 2JIRA 2PJHB 1I3QA 3D30A 3IR7A 3GTKA 4GA5A 2O5JD 2R7ZA 1PQFA 1Y4ZA 2JIQA 4KODA 2R93A 5FTNA 2JA5A 1TWCA 1AW8B 5GLYA 2NAPA 2VPXA 2NVXA 1PYQA 4DMRA 1S3SA 3QC8A 3HU3A 3GTOA 2KQAA 1Q16A 1WC2A 2NVYA 2Y0SA 3SUKA 4D7ZB 3HU2A 3H0GA 3QQ8A 3OUGA 1H5NA 5GM9A 1R7RA 4AOKB 4AYBA 1UHEA 1PPYA 1E60A 3X2LA 4CS0A 2IV2X 2JA7A 1EU1A 1G8KA 3PLXB 2DMRA 4KDIA 4NOHA 1WLFA 5FTLA 1SMYD 1DMSA 1QCSA 3X2KA 3X2OA 1K83A 1IW7D 2JIOA 4ENGA 4C2MA 3SUMA 1TMOA 4JS7A 3GTLA 4L48A 1BW4A 3FKIA 1YNJD 2G6GA 4RV0A 1FDIA 5C1BA 2VUMA 1CZ5A 2YUJA 1OA9A 2G5DA 2B63A 4CRZA 3X2IA 3X2GA 2JA6A 1YLEA 1UHDA 2PICA 3TIWA 1SIWA 2EEOB 1TWAA 2VPWA 4KDLA 2A68D 1R27A 1TWGA 2A6HD 2BH0A 1E5VA 1PT1A 4AZDA 3QQ7A 3DMRA 3X2JA 2C45A 1E18A 4AVRA 2E2IA 4GA6A 1SFOA 1HD5A 2AE0X 2A69D 2PNWA 5B6CA 3GTQA 1R9TA 1BW3A
chains in the Genus database with same CATH topology
2HCZX 4JJOA 4ENGA 3CZBA 4JS7A 3SUMA 4L48A 2ENGA 3SUJA 1BW4A 2G6GA 2G5DA 1OA9A 4FG4A 4FERA 3X2MA 5GLYA 3X2IA 3X2GA 1L8FA 4ZM7A 3X2PA 3SULA 1N10A 2KQAA 1WC2A 2PICA 3SUKA 4FG2A 5GLXA 3M3GA 3ENGA 5GM9A 3X2NA 4FFTA 2BH0A 2PJJA 1OA7A 2GAEA 3X2JA 4AVRA 3X2LA 3X2HA 4JP7A 5H4UA 1HD5A 2PI8A 2AE0X 4JP6A 2PNWA 3D30A 4JCWA 3X2KA 3X2OA 1BW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCZ X;  4JJO A;  4ENG A;  3CZB A;  4JS7 A;  3SUM A;  4L48 A;  2ENG A;  3SUJ A;  1BW4 A;  2G6G A;  2G5D A;  1OA9 A;  4FG4 A;  4FER A;  3X2M A;  5GLY A;  3X2I A;  3X2G A;  1L8F A;  4ZM7 A;  3X2P A;  3SUL A;  1N10 A;  2KQA A;  1WC2 A;  2PIC A;  3SUK A;  4FG2 A;  5GLX A;  3M3G A;  3ENG A;  5GM9 A;  3X2N A;  4FFT A;  2BH0 A;  2PJJ A;  1OA7 A;  2GAE A;  3X2J A;  4AVR A;  3X2L A;  3X2H A;  4JP7 A;  5H4U A;  1HD5 A;  2PI8 A;  2AE0 X;  4JP6 A;  2PNW A;  3D30 A;  4JCW A;  3X2K A;  3X2O A;  1BW3 A; 
#chains in the Genus database with same CATH topology
 4JJO A;  1FDO A;  1H0H A;  1OGY A;  1VC3 B;  2PMZ A;  3CZB A;  5DYI A;  5FTM A;  2CW0 D;  2A6E D;  2ENG A;  2KI8 A;  2E7Z A;  2NYA A;  4QIW A;  2E2H A;  3IR6 A;  1TWF A;  4FG4 A;  4FER A;  1CZ4 A;  1Y1V A;  4KO8 A;  1YNN D;  5FTK A;  2R92 A;  3QWZ A;  3X2P A;  1N10 A;  1TWH A;  1AA6 A;  1PT0 A;  3M3G A;  1PYU B;  3ENG A;  4AON B;  1WCM A;  5DYG A;  3IR5 A;  3X2N A;  1ZYR D;  2WAQ A;  4FFT A;  1Y1W A;  2PJJ A;  1G8J A;  5T5I D;  1OA7 A;  1CR5 A;  3TM7 B;  1PQH A;  1ZC1 A;  4JP7 A;  4JP6 A;  2PI8 A;  1I50 A;  4JCW A;  3HU1 A;  3GTG A;  1KQG A;  2HCZ X;  2V3V A;  3ML1 A;  4KLN A;  3GTP A;  3SUJ A;  3HKZ A;  1DMR A;  2JIP A;  3GTJ A;  2BE5 D;  3X2M A;  3CQZ A;  5GLF A;  4CRY G;  1L8F A;  4ZM7 A;  1QDN A;  2YU9 A;  1Y5I A;  1E32 A;  1KQF A;  3SUL A;  4AAY A;  5C18 A;  3O5A A;  4FG2 A;  5GLX A;  3CF2 A;  2VPZ A;  2JIM A;  2V45 A;  2VPY A;  2GAE A;  2WB1 A;  5T5M D;  1E61 A;  3X2H A;  5EPP A;  1PQE A;  5FTJ A;  5H4U A;  3GTM A;  2JIR A;  2PJH B;  1I3Q A;  3D30 A;  3IR7 A;  3GTK A;  4GA5 A;  2O5J D;  2R7Z A;  1PQF A;  1Y4Z A;  2JIQ A;  4KOD A;  2R93 A;  5FTN A;  2JA5 A;  1TWC A;  1AW8 B;  5GLY A;  2NAP A;  2VPX A;  2NVX A;  1PYQ A;  4DMR A;  1S3S A;  3QC8 A;  3HU3 A;  3GTO A;  2KQA A;  1Q16 A;  1WC2 A;  2NVY A;  2Y0S A;  3SUK A;  4D7Z B;  3HU2 A;  3H0G A;  3QQ8 A;  3OUG A;  1H5N A;  5GM9 A;  1R7R A;  4AOK B;  4AYB A;  1UHE A;  1PPY A;  1E60 A;  3X2L A;  4CS0 A;  2IV2 X;  2JA7 A;  1EU1 A;  1G8K A;  3PLX B;  2DMR A;  4KDI A;  4NOH A;  1WLF A;  5FTL A;  1SMY D;  1DMS A;  1QCS A;  3X2K A;  3X2O A;  1K83 A;  1IW7 D;  2JIO A;  4ENG A;  4C2M A;  3SUM A;  1TMO A;  4JS7 A;  3GTL A;  4L48 A;  1BW4 A;  3FKI A;  1YNJ D;  2G6G A;  4RV0 A;  1FDI A;  5C1B A;  2VUM A;  1CZ5 A;  2YUJ A;  1OA9 A;  2G5D A;  2B63 A;  4CRZ A;  3X2I A;  3X2G A;  2JA6 A;  1YLE A;  1UHD A;  2PIC A;  3TIW A;  1SIW A;  2EEO B;  1TWA A;  2VPW A;  4KDL A;  2A68 D;  1R27 A;  1TWG A;  2A6H D;  2BH0 A;  1E5V A;  1PT1 A;  4AZD A;  3QQ7 A;  3DMR A;  3X2J A;  2C45 A;  1E18 A;  4AVR A;  2E2I A;  4GA6 A;  1SFO A;  1HD5 A;  2AE0 X;  2A69 D;  2PNW A;  5B6C A;  3GTQ A;  1R9T A;  1BW3 A; 
#chains in the Genus database with same CATH homology
 2HCZ X;  4JJO A;  4ENG A;  3CZB A;  4JS7 A;  3SUM A;  4L48 A;  2ENG A;  3SUJ A;  1BW4 A;  2G6G A;  2G5D A;  1OA9 A;  4FG4 A;  4FER A;  3X2M A;  5GLY A;  3X2I A;  3X2G A;  1L8F A;  4ZM7 A;  3X2P A;  3SUL A;  1N10 A;  2KQA A;  1WC2 A;  2PIC A;  3SUK A;  4FG2 A;  5GLX A;  3M3G A;  3ENG A;  5GM9 A;  3X2N A;  4FFT A;  2BH0 A;  2PJJ A;  1OA7 A;  2GAE A;  3X2J A;  4AVR A;  3X2L A;  3X2H A;  4JP7 A;  5H4U A;  1HD5 A;  2PI8 A;  2AE0 X;  4JP6 A;  2PNW A;  3D30 A;  4JCW A;  3X2K A;  3X2O A;  1BW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...