1WC2A

Beta-1,4-d-endoglucanase cel45a from blue mussel mytilus edulis at 1.2a
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
NQKCSGNPRRYNGKSCASTTNYHDSHKGACGCGPASGDAQFGWNAGSFVAAASQMYFDSGNKGWCGQHCGQCIKLTTTGGYVPGQGGPVREGLSKTFMITNLCPNIYPNQDWCNQGSQYGGHNKYGYELHLDLENGRSQVTGMGWNNPETTWEVVNCDSEHNHDHRTPSNSMYGQCQCAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
publication title The Crystal Structure of the Beta-1,4-D-Endoglucanase Cel45A from Blue Mussel Mytilus Edulis at 1.2A
rcsb
total genus 61
structure length 180
sequence length 180
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1wc2A00
2G5DA 3X2IA 2PNWA 4L48A 1BW4A 4FFTA 3CZBA 4JP6A 3X2JA 2BH0A 2PICA 1N10A 3X2NA 4AVRA 4JS7A 1WC2A 3D30A 3SUJA 4JCWA 2PJJA 4ENGA 4FERA 1L8FA 3M3GA 1OA7A 4JJOA 3X2GA 2AE0X 2GAEA 5GLYA 1HD5A 3X2HA 3SULA 2G6GA 5H4UA 3X2LA 3X2MA 2PI8A 2HCZX 3ENGA 2KQAA 3SUMA 1BW3A 5GLXA 4FG2A 1OA9A 2ENGA 3X2OA 4FG4A 4JP7A 3X2PA 3SUKA 3X2KA 5GM9A 4ZM7A
chains in the Genus database with same CATH superfamily
1KQGA 4DMRA 4L48A 1ZC1A 4FFTA 3IR6A 1Y1VA 2WAQA 2BH0A 2VPWA 4JS7A 4CRZA 3D30A 1AW8B 1SFOA 1G8JA 1PT0A 2A6HD 1E18A 3X2HA 1PPYA 2VPZA 2A69D 2JIRA 3X2LA 2NVYA 5DYGA 3GTGA 2PI8A 1BW3A 1TWFA 2KI8A 1OGYA 1PT1A 3PLXB 2V3VA 5FTKA 4FG4A 4JP7A 3TM7B 2R93A 3X2PA 2JIQA 2IV2X 4QIWA 2C45A 4AAYA 4NOHA 2CW0D 4GA6A 2G5DA 1PYUB 1TMOA 1QCSA 1G8KA 1R7RA 2E7ZA 1I3QA 1BW4A 3IR5A 4AONB 3CZBA 3FKIA 1VC3B 5DYIA 3X2JA 1AA6A 1N10A 2JIPA 5C1BA 1WC2A 3CQZA 1E61A 2PJJA 1E5VA 3GTLA 2JA7A 2DMRA 2R7ZA 3M3GA 3QC8A 3GTMA 2JA6A 1H0HA 4KDIA 2GAEA 1H5NA 2PMZA 5GLYA 1CZ5A 1HD5A 1SIWA 1WCMA 5GLFA 1QDNA 4AZDA 1Y1WA 2G6GA 2EEOB 3HU1A 2VPYA 5EPPA 1PQFA 2A68D 4FG2A 1IW7D 1OA9A 2ENGA 2WB1A 4C2MA 1YLEA 3HKZA 3QWZA 5FTNA 3X2KA 2Y0SA 5GM9A 1Y4ZA 3IR7A 4ZM7A 3X2IA 1KQFA 1PQEA 2PNWA 2NVXA 4KDLA 1CR5A 2PJHB 4JP6A 3X2NA 1Y5IA 2YU9A 1E32A 3HU3A 1S3SA 4FERA 3X2GA 2JIOA 3HU2A 5T5MD 5FTMA 3SULA 3OUGA 4KO8A 3GTKA 3QQ7A 3X2MA 1TWHA 1K83A 3GTPA 2NYAA 3SUMA 2E2IA 1YNJD 1FDIA 2R92A 5T5ID 4AOKB 2VUMA 1FDOA 1YNND 1E60A 3O5AA 3ML1A 4KLNA 4CRYG 4AYBA 1TWCA 2BE5D 1R9TA 4RV0A 5C18A 1CZ4A 2YUJA 2E2HA 1PQHA 5FTLA 2PICA 1SMYD 4AVRA 2JIMA 2JA5A 1ZYRD 3SUJA 2NAPA 1I50A 4JCWA 4ENGA 1L8FA 1UHDA 1PYQA 1OA7A 4JJOA 1UHEA 2AE0X 2A6ED 3QQ8A 2B63A 5FTJA 1R27A 2VPXA 5H4UA 3GTQA 1DMRA 3GTOA 1TWGA 1TWAA 2V45A 5B6CA 2O5JD 2HCZX 1DMSA 1EU1A 2KQAA 3DMRA 3ENGA 4GA5A 5GLXA 3TIWA 3GTJA 3CF2A 4D7ZB 3X2OA 3H0GA 4CS0A 4KODA 3SUKA 1Q16A 1WLFA
chains in the Genus database with same CATH topology
2G5DA 3X2IA 2PNWA 4L48A 1BW4A 4FFTA 3CZBA 4JP6A 3X2JA 2BH0A 2PICA 1N10A 3X2NA 4AVRA 4JS7A 1WC2A 3D30A 3SUJA 4JCWA 2PJJA 4ENGA 4FERA 1L8FA 3M3GA 1OA7A 4JJOA 3X2GA 2AE0X 2GAEA 5GLYA 1HD5A 3X2HA 3SULA 2G6GA 5H4UA 3X2LA 3X2MA 2PI8A 2HCZX 3ENGA 2KQAA 3SUMA 1BW3A 5GLXA 4FG2A 1OA9A 2ENGA 3X2OA 4FG4A 4JP7A 3X2PA 3SUKA 3X2KA 5GM9A 4ZM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5D A;  3X2I A;  2PNW A;  4L48 A;  1BW4 A;  4FFT A;  3CZB A;  4JP6 A;  3X2J A;  2BH0 A;  2PIC A;  1N10 A;  3X2N A;  4AVR A;  4JS7 A;  1WC2 A;  3D30 A;  3SUJ A;  4JCW A;  2PJJ A;  4ENG A;  4FER A;  1L8F A;  3M3G A;  1OA7 A;  4JJO A;  3X2G A;  2AE0 X;  2GAE A;  5GLY A;  1HD5 A;  3X2H A;  3SUL A;  2G6G A;  5H4U A;  3X2L A;  3X2M A;  2PI8 A;  2HCZ X;  3ENG A;  2KQA A;  3SUM A;  1BW3 A;  5GLX A;  4FG2 A;  1OA9 A;  2ENG A;  3X2O A;  4FG4 A;  4JP7 A;  3X2P A;  3SUK A;  3X2K A;  5GM9 A;  4ZM7 A; 
#chains in the Genus database with same CATH topology
 1KQG A;  4DMR A;  4L48 A;  1ZC1 A;  4FFT A;  3IR6 A;  1Y1V A;  2WAQ A;  2BH0 A;  2VPW A;  4JS7 A;  4CRZ A;  3D30 A;  1AW8 B;  1SFO A;  1G8J A;  1PT0 A;  2A6H D;  1E18 A;  3X2H A;  1PPY A;  2VPZ A;  2A69 D;  2JIR A;  3X2L A;  2NVY A;  5DYG A;  3GTG A;  2PI8 A;  1BW3 A;  1TWF A;  2KI8 A;  1OGY A;  1PT1 A;  3PLX B;  2V3V A;  5FTK A;  4FG4 A;  4JP7 A;  3TM7 B;  2R93 A;  3X2P A;  2JIQ A;  2IV2 X;  4QIW A;  2C45 A;  4AAY A;  4NOH A;  2CW0 D;  4GA6 A;  2G5D A;  1PYU B;  1TMO A;  1QCS A;  1G8K A;  1R7R A;  2E7Z A;  1I3Q A;  1BW4 A;  3IR5 A;  4AON B;  3CZB A;  3FKI A;  1VC3 B;  5DYI A;  3X2J A;  1AA6 A;  1N10 A;  2JIP A;  5C1B A;  1WC2 A;  3CQZ A;  1E61 A;  2PJJ A;  1E5V A;  3GTL A;  2JA7 A;  2DMR A;  2R7Z A;  3M3G A;  3QC8 A;  3GTM A;  2JA6 A;  1H0H A;  4KDI A;  2GAE A;  1H5N A;  2PMZ A;  5GLY A;  1CZ5 A;  1HD5 A;  1SIW A;  1WCM A;  5GLF A;  1QDN A;  4AZD A;  1Y1W A;  2G6G A;  2EEO B;  3HU1 A;  2VPY A;  5EPP A;  1PQF A;  2A68 D;  4FG2 A;  1IW7 D;  1OA9 A;  2ENG A;  2WB1 A;  4C2M A;  1YLE A;  3HKZ A;  3QWZ A;  5FTN A;  3X2K A;  2Y0S A;  5GM9 A;  1Y4Z A;  3IR7 A;  4ZM7 A;  3X2I A;  1KQF A;  1PQE A;  2PNW A;  2NVX A;  4KDL A;  1CR5 A;  2PJH B;  4JP6 A;  3X2N A;  1Y5I A;  2YU9 A;  1E32 A;  3HU3 A;  1S3S A;  4FER A;  3X2G A;  2JIO A;  3HU2 A;  5T5M D;  5FTM A;  3SUL A;  3OUG A;  4KO8 A;  3GTK A;  3QQ7 A;  3X2M A;  1TWH A;  1K83 A;  3GTP A;  2NYA A;  3SUM A;  2E2I A;  1YNJ D;  1FDI A;  2R92 A;  5T5I D;  4AOK B;  2VUM A;  1FDO A;  1YNN D;  1E60 A;  3O5A A;  3ML1 A;  4KLN A;  4CRY G;  4AYB A;  1TWC A;  2BE5 D;  1R9T A;  4RV0 A;  5C18 A;  1CZ4 A;  2YUJ A;  2E2H A;  1PQH A;  5FTL A;  2PIC A;  1SMY D;  4AVR A;  2JIM A;  2JA5 A;  1ZYR D;  3SUJ A;  2NAP A;  1I50 A;  4JCW A;  4ENG A;  1L8F A;  1UHD A;  1PYQ A;  1OA7 A;  4JJO A;  1UHE A;  2AE0 X;  2A6E D;  3QQ8 A;  2B63 A;  5FTJ A;  1R27 A;  2VPX A;  5H4U A;  3GTQ A;  1DMR A;  3GTO A;  1TWG A;  1TWA A;  2V45 A;  5B6C A;  2O5J D;  2HCZ X;  1DMS A;  1EU1 A;  2KQA A;  3DMR A;  3ENG A;  4GA5 A;  5GLX A;  3TIW A;  3GTJ A;  3CF2 A;  4D7Z B;  3X2O A;  3H0G A;  4CS0 A;  4KOD A;  3SUK A;  1Q16 A;  1WLF A; 
#chains in the Genus database with same CATH homology
 2G5D A;  3X2I A;  2PNW A;  4L48 A;  1BW4 A;  4FFT A;  3CZB A;  4JP6 A;  3X2J A;  2BH0 A;  2PIC A;  1N10 A;  3X2N A;  4AVR A;  4JS7 A;  1WC2 A;  3D30 A;  3SUJ A;  4JCW A;  2PJJ A;  4ENG A;  4FER A;  1L8F A;  3M3G A;  1OA7 A;  4JJO A;  3X2G A;  2AE0 X;  2GAE A;  5GLY A;  1HD5 A;  3X2H A;  3SUL A;  2G6G A;  5H4U A;  3X2L A;  3X2M A;  2PI8 A;  2HCZ X;  3ENG A;  2KQA A;  3SUM A;  1BW3 A;  5GLX A;  4FG2 A;  1OA9 A;  2ENG A;  3X2O A;  4FG4 A;  4JP7 A;  3X2P A;  3SUK A;  3X2K A;  5GM9 A;  4ZM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...