1WC2A

Beta-1,4-d-endoglucanase cel45a from blue mussel mytilus edulis at 1.2a
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
b'NQKCSGNPRRYNGKSCASTTNYHDSHKGACGCGPASGDAQFGWNAGSFVAAASQMYFDSGNKGWCGQHCGQCIKLTTTGGYVPGQGGPVREGLSKTFMITNLCPNIYPNQDWCNQGSQYGGHNKYGYELHLDLENGRSQVTGMGWNNPETTWEVVNCDSEHNHDHRTPSNSMYGQCQCAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
molecule tags Hydrolase
publication title The Crystal Structure of the Beta-1,4-D-Endoglucanase Cel45A from Blue Mussel Mytilus Edulis at 1.2A
rcsb
total genus 61
structure length 180
sequence length 180
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1wc2A00
1HD5A 4FG4A 4JP6A 3X2HA 4JCWA 5GLXA 4ZM7A 5GM9A 4JP7A 3X2GA 3X2NA 2PJJA 2GAEA 3M3GA 2KQAA 4FG2A 1WC2A 2HCZX 3D30A 3SUMA 3X2KA 3X2LA 3X2OA 3X2JA 2BH0A 2PNWA 3CZBA 4FFTA 1BW3A 4L48A 2G6GA 5H4UA 5GLYA 1BW4A 4AVRA 3SUJA 1N10A 2PICA 3SUKA 3ENGA 1OA7A 2AE0X 2ENGA 4JS7A 3X2MA 4ENGA 1L8FA 2G5DA 4JJOA 3X2PA 3SULA 3X2IA 4FERA 1OA9A 2PI8A
chains in the Genus database with same CATH superfamily
3HU2A 2DMRA 3O5AA 5FTNA 3X2HA 2JA5A 4JCWA 2R92A 5DYIA 5FTJA 3GTJA 5B6CA 4ZM7A 5GM9A 1CR5A 1PT1A 2HCZX 3D30A 4KLNA 1SFOA 1PPYA 4FFTA 2NVYA 1OGYA 3TIWA 1KQGA 3GTQA 2A69D 1N10A 2PICA 1OA7A 1WCMA 5FTKA 1PQFA 1G8JA 2G5DA 4DMRA 3TM7B 3PLXB 3SULA 3CQZA 5T5MD 1TWCA 1PT0A 1QCSA 1YLEA 1AA6A 4FG4A 4JP6A 2VPXA 1PQEA 4KO8A 2JIRA 4QIWA 1CZ5A 2VPWA 2WAQA 2R7ZA 3X2GA 2EEOB 3OUGA 1R7RA 1TWFA 3HKZA 1DMRA 4KDIA 1WC2A 3X2LA 5EPPA 2BH0A 2YUJA 3CZBA 1BW3A 3GTGA 4AAYA 2B63A 1R9TA 5H4UA 5GLYA 4AVRA 1E5VA 1E60A 1E61A 1Y5IA 4KODA 3HU3A 3ENGA 1ZC1A 4JS7A 1WLFA 5GLFA 4ENGA 3IR5A 1SMYD 1VC3B 2E2IA 1H5NA 2A6ED 2JIMA 1OA9A 1ZYRD 2A6HD 2VPZA 4CRZA 1FDOA 1HD5A 4CRYG 1TWHA 1AW8B 1PYUB 1TMOA 1H0HA 5FTMA 2V45A 3HU1A 2PJHB 3FKIA 3X2NA 1Q16A 3ML1A 4FG2A 3GTLA 1PYQA 2KI8A 2C45A 1I50A 3X2JA 3SUMA 2E2HA 3X2KA 1G8KA 2PNWA 2WB1A 4NOHA 4L48A 3DMRA 3CF2A 2G6GA 3IR6A 5DYGA 2VUMA 1BW4A 2Y0SA 3H0GA 3QQ7A 4GA6A 2PMZA 1IW7D 3X2MA 2ENGA 1YNND 4KDLA 2JA6A 1EU1A 5C18A 1KQFA 4JJOA 2BE5D 4RV0A 2PI8A 1TWGA 1Y1VA 1E18A 5C1BA 3GTOA 3GTMA 1TWAA 5GLXA 1UHEA 1Y1WA 4JP7A 1DMSA 2A68D 2NVXA 2PJJA 2GAEA 3M3GA 2KQAA 5T5ID 3X2OA 5FTLA 1UHDA 1S3SA 1K83A 4AONB 3QC8A 2R93A 4GA5A 1Y4ZA 1FDIA 4CS0A 2NYAA 3GTKA 3SUJA 1SIWA 4C2MA 4AYBA 2E7ZA 2CW0D 2YU9A 1R27A 2JIOA 3SUKA 3IR7A 1E32A 2AE0X 3QWZA 1I3QA 3QQ8A 2O5JD 1CZ4A 2NAPA 1L8FA 4AOKB 3X2PA 2JA7A 3GTPA 2IV2X 2JIPA 4D7ZB 3X2IA 2V3VA 1QDNA 1YNJD 1PQHA 2VPYA 4FERA 2JIQA 4AZDA
chains in the Genus database with same CATH topology
1HD5A 4FG4A 4JP6A 3X2HA 4JCWA 5GLXA 4ZM7A 5GM9A 4JP7A 3X2GA 3X2NA 2PJJA 2GAEA 3M3GA 2KQAA 4FG2A 1WC2A 2HCZX 3D30A 3SUMA 3X2KA 3X2LA 3X2OA 3X2JA 2BH0A 2PNWA 3CZBA 4FFTA 1BW3A 4L48A 2G6GA 5H4UA 5GLYA 1BW4A 4AVRA 3SUJA 1N10A 2PICA 3SUKA 3ENGA 1OA7A 2AE0X 2ENGA 4JS7A 3X2MA 4ENGA 1L8FA 2G5DA 4JJOA 3X2PA 3SULA 3X2IA 4FERA 1OA9A 2PI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD5 A;  4FG4 A;  4JP6 A;  3X2H A;  4JCW A;  5GLX A;  4ZM7 A;  5GM9 A;  4JP7 A;  3X2G A;  3X2N A;  2PJJ A;  2GAE A;  3M3G A;  2KQA A;  4FG2 A;  1WC2 A;  2HCZ X;  3D30 A;  3SUM A;  3X2K A;  3X2L A;  3X2O A;  3X2J A;  2BH0 A;  2PNW A;  3CZB A;  4FFT A;  1BW3 A;  4L48 A;  2G6G A;  5H4U A;  5GLY A;  1BW4 A;  4AVR A;  3SUJ A;  1N10 A;  2PIC A;  3SUK A;  3ENG A;  1OA7 A;  2AE0 X;  2ENG A;  4JS7 A;  3X2M A;  4ENG A;  1L8F A;  2G5D A;  4JJO A;  3X2P A;  3SUL A;  3X2I A;  4FER A;  1OA9 A;  2PI8 A; 
#chains in the Genus database with same CATH topology
 3HU2 A;  2DMR A;  3O5A A;  5FTN A;  3X2H A;  2JA5 A;  4JCW A;  2R92 A;  5DYI A;  5FTJ A;  3GTJ A;  5B6C A;  4ZM7 A;  5GM9 A;  1CR5 A;  1PT1 A;  2HCZ X;  3D30 A;  4KLN A;  1SFO A;  1PPY A;  4FFT A;  2NVY A;  1OGY A;  3TIW A;  1KQG A;  3GTQ A;  2A69 D;  1N10 A;  2PIC A;  1OA7 A;  1WCM A;  5FTK A;  1PQF A;  1G8J A;  2G5D A;  4DMR A;  3TM7 B;  3PLX B;  3SUL A;  3CQZ A;  5T5M D;  1TWC A;  1PT0 A;  1QCS A;  1YLE A;  1AA6 A;  4FG4 A;  4JP6 A;  2VPX A;  1PQE A;  4KO8 A;  2JIR A;  4QIW A;  1CZ5 A;  2VPW A;  2WAQ A;  2R7Z A;  3X2G A;  2EEO B;  3OUG A;  1R7R A;  1TWF A;  3HKZ A;  1DMR A;  4KDI A;  1WC2 A;  3X2L A;  5EPP A;  2BH0 A;  2YUJ A;  3CZB A;  1BW3 A;  3GTG A;  4AAY A;  2B63 A;  1R9T A;  5H4U A;  5GLY A;  4AVR A;  1E5V A;  1E60 A;  1E61 A;  1Y5I A;  4KOD A;  3HU3 A;  3ENG A;  1ZC1 A;  4JS7 A;  1WLF A;  5GLF A;  4ENG A;  3IR5 A;  1SMY D;  1VC3 B;  2E2I A;  1H5N A;  2A6E D;  2JIM A;  1OA9 A;  1ZYR D;  2A6H D;  2VPZ A;  4CRZ A;  1FDO A;  1HD5 A;  4CRY G;  1TWH A;  1AW8 B;  1PYU B;  1TMO A;  1H0H A;  5FTM A;  2V45 A;  3HU1 A;  2PJH B;  3FKI A;  3X2N A;  1Q16 A;  3ML1 A;  4FG2 A;  3GTL A;  1PYQ A;  2KI8 A;  2C45 A;  1I50 A;  3X2J A;  3SUM A;  2E2H A;  3X2K A;  1G8K A;  2PNW A;  2WB1 A;  4NOH A;  4L48 A;  3DMR A;  3CF2 A;  2G6G A;  3IR6 A;  5DYG A;  2VUM A;  1BW4 A;  2Y0S A;  3H0G A;  3QQ7 A;  4GA6 A;  2PMZ A;  1IW7 D;  3X2M A;  2ENG A;  1YNN D;  4KDL A;  2JA6 A;  1EU1 A;  5C18 A;  1KQF A;  4JJO A;  2BE5 D;  4RV0 A;  2PI8 A;  1TWG A;  1Y1V A;  1E18 A;  5C1B A;  3GTO A;  3GTM A;  1TWA A;  5GLX A;  1UHE A;  1Y1W A;  4JP7 A;  1DMS A;  2A68 D;  2NVX A;  2PJJ A;  2GAE A;  3M3G A;  2KQA A;  5T5I D;  3X2O A;  5FTL A;  1UHD A;  1S3S A;  1K83 A;  4AON B;  3QC8 A;  2R93 A;  4GA5 A;  1Y4Z A;  1FDI A;  4CS0 A;  2NYA A;  3GTK A;  3SUJ A;  1SIW A;  4C2M A;  4AYB A;  2E7Z A;  2CW0 D;  2YU9 A;  1R27 A;  2JIO A;  3SUK A;  3IR7 A;  1E32 A;  2AE0 X;  3QWZ A;  1I3Q A;  3QQ8 A;  2O5J D;  1CZ4 A;  2NAP A;  1L8F A;  4AOK B;  3X2P A;  2JA7 A;  3GTP A;  2IV2 X;  2JIP A;  4D7Z B;  3X2I A;  2V3V A;  1QDN A;  1YNJ D;  1PQH A;  2VPY A;  4FER A;  2JIQ A;  4AZD A; 
#chains in the Genus database with same CATH homology
 1HD5 A;  4FG4 A;  4JP6 A;  3X2H A;  4JCW A;  5GLX A;  4ZM7 A;  5GM9 A;  4JP7 A;  3X2G A;  3X2N A;  2PJJ A;  2GAE A;  3M3G A;  2KQA A;  4FG2 A;  1WC2 A;  2HCZ X;  3D30 A;  3SUM A;  3X2K A;  3X2L A;  3X2O A;  3X2J A;  2BH0 A;  2PNW A;  3CZB A;  4FFT A;  1BW3 A;  4L48 A;  2G6G A;  5H4U A;  5GLY A;  1BW4 A;  4AVR A;  3SUJ A;  1N10 A;  2PIC A;  3SUK A;  3ENG A;  1OA7 A;  2AE0 X;  2ENG A;  4JS7 A;  3X2M A;  4ENG A;  1L8F A;  2G5D A;  4JJO A;  3X2P A;  3SUL A;  3X2I A;  4FER A;  1OA9 A;  2PI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...