1WC2A

Beta-1,4-d-endoglucanase cel45a from blue mussel mytilus edulis at 1.2a
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
NQKCSGNPRRYNGKSCASTTNYHDSHKGACGCGPASGDAQFGWNAGSFVAAASQMYFDSGNKGWCGQHCGQCIKLTTTGGYVPGQGGPVREGLSKTFMITNLCPNIYPNQDWCNQGSQYGGHNKYGYELHLDLENGRSQVTGMGWNNPETTWEVVNCDSEHNHDHRTPSNSMYGQCQCAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Beta-1,4-D-Endoglucanase Cel45A from Blue Mussel Mytilus Edulis at 1.2A
rcsb
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
total genus 61
structure length 180
sequence length 180
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1wc2A00
4JJOA 2PNWA 5GLYA 2PI8A 4JP6A 1OA9A 1HD5A 2G5DA 3ENGA 2GAEA 2ENGA 3SUKA 4JP7A 3X2OA 3SUJA 3X2MA 1WC2A 2PICA 4ENGA 1N10A 4FG2A 3X2PA 2BH0A 3X2HA 1BW3A 4ZM7A 3X2LA 3CZBA 2KQAA 4L48A 3X2GA 3X2IA 1BW4A 4FERA 5GM9A 3X2KA 3M3GA 3SULA 4FG4A 2AE0X 3X2JA 2HCZX 4JS7A 3SUMA 4FFTA 4AVRA 3D30A 4JCWA 2PJJA 5GLXA 1OA7A 5H4UA 3X2NA 1L8FA 2G6GA
chains in the Genus database with same CATH superfamily
1OGYA 4AONB 3GTKA 1CZ5A 4AAYA 2VPZA 4KDLA 1SFOA 1Y5IA 1ZYRD 3TM7B 2G5DA 1PT1A 3ENGA 5C1BA 1PYUB 1PPYA 2ENGA 3GTPA 4C2MA 1KQGA 1R27A 2PMZA 3X2MA 1H0HA 1N10A 1UHEA 1ZC1A 3X2PA 3X2HA 1YNJD 3HU3A 4AYBA 2JA5A 4AZDA 5T5ID 4NOHA 1VC3B 1SMYD 2R92A 4FERA 1YLEA 1TWFA 2VPXA 2DMRA 1Y1WA 2VUMA 2JIRA 3O5AA 3HKZA 3X2JA 2HCZX 4JS7A 1AW8B 4GA6A 2IV2X 3GTGA 4CS0A 5GLXA 2A6ED 3GTLA 2NVYA 4JJOA 2A6HD 5GLYA 2KI8A 1PYQA 3OUGA 3QQ7A 1HD5A 1KQFA 5DYGA 3SUKA 5EPPA 2YUJA 1FDIA 1WLFA 1PQEA 2JIQA 4JP7A 3SUJA 1PT0A 2PICA 4FG2A 4ZM7A 3X2LA 1K83A 5GLFA 2KQAA 2V45A 2EEOB 3CQZA 3IR7A 3TIWA 5FTLA 3X2GA 2JIPA 4KO8A 3ML1A 1E61A 2C45A 1E60A 3M3GA 3SULA 3HU1A 2R93A 3GTMA 3SUMA 2JA7A 2NVXA 2WB1A 4FFTA 4AVRA 4JCWA 1I3QA 5FTMA 5H4UA 3GTJA 1G8KA 1E32A 1L8FA 3X2NA 1QDNA 2VPWA 2PNWA 2Y0SA 4GA5A 4D7ZB 2B63A 5C18A 2A69D 3QC8A 4JP6A 4QIWA 4CRYG 3DMRA 1SIWA 2GAEA 3HU2A 2NAPA 3FKIA 1PQFA 1PQHA 1WC2A 1BW3A 1E5VA 3IR5A 2WAQA 4KODA 3CZBA 2JIMA 1Y1VA 3X2IA 1EU1A 1TWGA 5FTJA 1FDOA 5GM9A 1R9TA 1Q16A 3H0GA 5FTKA 1TWHA 3X2KA 2R7ZA 2AE0X 2NYAA 1QCSA 4KLNA 3GTQA 3D30A 4KDIA 2JA6A 3GTOA 1G8JA 4DMRA 1CZ4A 4AOKB 1YNND 3IR6A 1UHDA 5T5MD 1WCMA 2PI8A 1I50A 1OA9A 1TWAA 1CR5A 2JIOA 5DYIA 3X2OA 2E2HA 4ENGA 1E18A 1R7RA 2BH0A 2V3VA 2E7ZA 2YU9A 3QQ8A 5FTNA 3CF2A 4L48A 2BE5D 4RV0A 1H5NA 1S3SA 2VPYA 1AA6A 1BW4A 1DMRA 2PJHB 1TWCA 2E2IA 1TMOA 4FG4A 3QWZA 4CRZA 5B6CA 2O5JD 3PLXB 1DMSA 2PJJA 1OA7A 1Y4ZA 2CW0D 1IW7D 2A68D 2G6GA
chains in the Genus database with same CATH topology
4JJOA 2PNWA 5GLYA 2PI8A 4JP6A 1OA9A 1HD5A 2G5DA 3ENGA 2GAEA 2ENGA 3SUKA 4JP7A 3X2OA 3SUJA 3X2MA 1WC2A 2PICA 4ENGA 1N10A 4FG2A 3X2PA 2BH0A 3X2HA 1BW3A 4ZM7A 3X2LA 3CZBA 2KQAA 4L48A 3X2GA 3X2IA 1BW4A 4FERA 5GM9A 3X2KA 3M3GA 3SULA 4FG4A 2AE0X 3X2JA 2HCZX 4JS7A 3SUMA 4FFTA 4AVRA 3D30A 4JCWA 2PJJA 5GLXA 1OA7A 5H4UA 3X2NA 1L8FA 2G6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJO A;  2PNW A;  5GLY A;  2PI8 A;  4JP6 A;  1OA9 A;  1HD5 A;  2G5D A;  3ENG A;  2GAE A;  2ENG A;  3SUK A;  4JP7 A;  3X2O A;  3SUJ A;  3X2M A;  1WC2 A;  2PIC A;  4ENG A;  1N10 A;  4FG2 A;  3X2P A;  2BH0 A;  3X2H A;  1BW3 A;  4ZM7 A;  3X2L A;  3CZB A;  2KQA A;  4L48 A;  3X2G A;  3X2I A;  1BW4 A;  4FER A;  5GM9 A;  3X2K A;  3M3G A;  3SUL A;  4FG4 A;  2AE0 X;  3X2J A;  2HCZ X;  4JS7 A;  3SUM A;  4FFT A;  4AVR A;  3D30 A;  4JCW A;  2PJJ A;  5GLX A;  1OA7 A;  5H4U A;  3X2N A;  1L8F A;  2G6G A; 
#chains in the Genus database with same CATH topology
 1OGY A;  4AON B;  3GTK A;  1CZ5 A;  4AAY A;  2VPZ A;  4KDL A;  1SFO A;  1Y5I A;  1ZYR D;  3TM7 B;  2G5D A;  1PT1 A;  3ENG A;  5C1B A;  1PYU B;  1PPY A;  2ENG A;  3GTP A;  4C2M A;  1KQG A;  1R27 A;  2PMZ A;  3X2M A;  1H0H A;  1N10 A;  1UHE A;  1ZC1 A;  3X2P A;  3X2H A;  1YNJ D;  3HU3 A;  4AYB A;  2JA5 A;  4AZD A;  5T5I D;  4NOH A;  1VC3 B;  1SMY D;  2R92 A;  4FER A;  1YLE A;  1TWF A;  2VPX A;  2DMR A;  1Y1W A;  2VUM A;  2JIR A;  3O5A A;  3HKZ A;  3X2J A;  2HCZ X;  4JS7 A;  1AW8 B;  4GA6 A;  2IV2 X;  3GTG A;  4CS0 A;  5GLX A;  2A6E D;  3GTL A;  2NVY A;  4JJO A;  2A6H D;  5GLY A;  2KI8 A;  1PYQ A;  3OUG A;  3QQ7 A;  1HD5 A;  1KQF A;  5DYG A;  3SUK A;  5EPP A;  2YUJ A;  1FDI A;  1WLF A;  1PQE A;  2JIQ A;  4JP7 A;  3SUJ A;  1PT0 A;  2PIC A;  4FG2 A;  4ZM7 A;  3X2L A;  1K83 A;  5GLF A;  2KQA A;  2V45 A;  2EEO B;  3CQZ A;  3IR7 A;  3TIW A;  5FTL A;  3X2G A;  2JIP A;  4KO8 A;  3ML1 A;  1E61 A;  2C45 A;  1E60 A;  3M3G A;  3SUL A;  3HU1 A;  2R93 A;  3GTM A;  3SUM A;  2JA7 A;  2NVX A;  2WB1 A;  4FFT A;  4AVR A;  4JCW A;  1I3Q A;  5FTM A;  5H4U A;  3GTJ A;  1G8K A;  1E32 A;  1L8F A;  3X2N A;  1QDN A;  2VPW A;  2PNW A;  2Y0S A;  4GA5 A;  4D7Z B;  2B63 A;  5C18 A;  2A69 D;  3QC8 A;  4JP6 A;  4QIW A;  4CRY G;  3DMR A;  1SIW A;  2GAE A;  3HU2 A;  2NAP A;  3FKI A;  1PQF A;  1PQH A;  1WC2 A;  1BW3 A;  1E5V A;  3IR5 A;  2WAQ A;  4KOD A;  3CZB A;  2JIM A;  1Y1V A;  3X2I A;  1EU1 A;  1TWG A;  5FTJ A;  1FDO A;  5GM9 A;  1R9T A;  1Q16 A;  3H0G A;  5FTK A;  1TWH A;  3X2K A;  2R7Z A;  2AE0 X;  2NYA A;  1QCS A;  4KLN A;  3GTQ A;  3D30 A;  4KDI A;  2JA6 A;  3GTO A;  1G8J A;  4DMR A;  1CZ4 A;  4AOK B;  1YNN D;  3IR6 A;  1UHD A;  5T5M D;  1WCM A;  2PI8 A;  1I50 A;  1OA9 A;  1TWA A;  1CR5 A;  2JIO A;  5DYI A;  3X2O A;  2E2H A;  4ENG A;  1E18 A;  1R7R A;  2BH0 A;  2V3V A;  2E7Z A;  2YU9 A;  3QQ8 A;  5FTN A;  3CF2 A;  4L48 A;  2BE5 D;  4RV0 A;  1H5N A;  1S3S A;  2VPY A;  1AA6 A;  1BW4 A;  1DMR A;  2PJH B;  1TWC A;  2E2I A;  1TMO A;  4FG4 A;  3QWZ A;  4CRZ A;  5B6C A;  2O5J D;  3PLX B;  1DMS A;  2PJJ A;  1OA7 A;  1Y4Z A;  2CW0 D;  1IW7 D;  2A68 D;  2G6G A; 
#chains in the Genus database with same CATH homology
 4JJO A;  2PNW A;  5GLY A;  2PI8 A;  4JP6 A;  1OA9 A;  1HD5 A;  2G5D A;  3ENG A;  2GAE A;  2ENG A;  3SUK A;  4JP7 A;  3X2O A;  3SUJ A;  3X2M A;  1WC2 A;  2PIC A;  4ENG A;  1N10 A;  4FG2 A;  3X2P A;  2BH0 A;  3X2H A;  1BW3 A;  4ZM7 A;  3X2L A;  3CZB A;  2KQA A;  4L48 A;  3X2G A;  3X2I A;  1BW4 A;  4FER A;  5GM9 A;  3X2K A;  3M3G A;  3SUL A;  4FG4 A;  2AE0 X;  3X2J A;  2HCZ X;  4JS7 A;  3SUM A;  4FFT A;  4AVR A;  3D30 A;  4JCW A;  2PJJ A;  5GLX A;  1OA7 A;  5H4U A;  3X2N A;  1L8F A;  2G6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...