4L48A

Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild type and d78n mutant clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
total genus 44
structure length 202
sequence length 202
chains with identical sequence C
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4l48A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4l48A02
5GLYA 1N10A 2G6GA 3X2PA 3X2NA 3X2LA 4JS7A 2BH0A 2PNWA 2PJJA 4L48A 3M3GA 4AVRA 3D30A 3X2JA 4FG4A 4ENGA 1WHPA 1BMWA 1BW3A 2VXQA 3X2GA 1OA7A 2G5DA 2ENGA 5H4UA 3SUJA 3CZBA 2KQAA 1HD5A 4FG2A 4JP6A 1OA9A 5GLXA 2GAEA 5GM9A 2PICA 3FT9A 1L8FA 3FT1A 3ENGA 2JNZA 3X2MA 1WHOA 1WC2A 3X2KA 3SUKA 2PI8A 3SUMA 3X2IA 2AE0X 2HCZX 4JCWA 4JJOA 4FFTA 3X2OA 4FERA 1BW4A 3X2HA 3SULA 4JP7A 4ZM7A
chains in the Genus database with same CATH superfamily
4LLMB 3CHXA 2DQIH 3EJZC 4W4OC 3CQPA 2E9BA 4X6CB 3BYYA 4X42A 1JRHH 1A8JH 3PQYE 4OCMC 4EZKA 2DWDB 2HFFB 2G5BB 2LT9A 4FLHA 4JPKL 4XNYH 3IJHB 4WSKA 4BDVA 2YZ8A 4PB0L 4QHLA 3QVAA 4RGNE 4BBWA 4ZS7L 2EIZB 4EJ1C 1MCFA 3B7UX 4JJHA 5GSVB 5MERB 1BZ7B 3O6KL 4J3UA 3FRPA 4Z7NE 5ID1B 4AL8C 3IDIA 5I0DA 5FS5A 2DWEB 2AK4B 1MWAH 1I31A 1T1XB 1OAZL 1JN6A 4UNIA 4PQXA 3C5ZB 1DQQB 3WIFB 1XIWA 2YIHA 4Y5YC 5AVXB 4LOEA 4LL1A 3HZVB 1UJ3B 3K2KA 1T4KA 4HLZG 4PU2A 3WE6A 4HHAA 3OAZH 2ZAIA 4JFFD 5I0YA 2ED7A 1NCUA 3ZIMA 5CJ5A 1X3DA 3BDYL 4CMHC 4LARH 1Y1VA 4DP7X 1RK0A 4NP4H 4ANUA 4M8QB 3DWTA 4GSRA 2WZPD 3EGSB 4NHUB 4OF8A 3O6FC 5E2JA 5EUOB 2IAMA 3MC0A 4GUQA 2GK0B 2DQHL 3TIWA 1E4KC 2XI9A 2IWKA 4IK6A 3W57A 1PZUB 5DZVA 2AVGA 5DZJA 3ARDC 3VYPA 1X5LA 1FLRH 2ZCKL 4XNQA 1J9TA 3NIFB 5AW3B 1KYOJ 1QP1A 3CAFA 3NACH 3PL6D 2ZUYA 4AZDA 2Z35A 3BUTA 5T1JA 2DMKA 1JZ2A 2J5WA 3LD8B 2RBLA 5F3HB 3AACA 1W2KT 2H0FA 1FJ1A 4NUJB 4P23C 2JA5A 3IMWA 1E4HA 5B1BB 4XVOA 4G70B 4Y4FC 4PBWD 2DRUA 4EBQL 4JY5H 4FQXC 1QHQA 3DLQR 5I9QB 3OSKA 1EJFA 1K4DA 1U21A 2P43B 4GUPB 4M9OA 1J1XL 4GIAA 1XQ4A 2A9MH 3BN3B 4AEIH 1SM3H 3NJJA 2VJ8A 1CF1A 1NMBH 2UXFA 3GSVA 3RDTA 4IEFB 4GT0A 4J28A 3STLA 1PY0A 4OQTH 4EIBA 1UOVA 1OPGH 3IWVA 3AGVA 1II4E 4OIIL 5H2BA 3ZDZE 3TO4C 4L4TA 2FE0A 5KVDE 2NNXA 5ESAB 3VFPA 4BA0A 2FWOB 1E67A 3ZDYE 2VN5A 1WD9A 3MJ6A 5C0RH 4NUPA 2CO3A 1K72A 5ECGA 3A4EA 4JPVL 2VL4A 2W65B 1M57B 1VZGA 4JPKH 4XNYL 2YD8A 3V9EA 4BM7A 5D7LD 4Z76A 4WWPA 5E1AB 5KAQF 5D7IE 3QEQB 1IFRA 1NUFA 1RZFH 4XO9A 4B9GA 3H9ZA 1INQA 2GHWB 3BKMH 3DX9A 3AT8A 2FT7A 1ITBB 3DUUB 3T6ZA 4HC1H 3TBVB 1FV1B 1L9PA 5KBMA 2ZX6A 4A6YA 3UGUA 4N6RB 4KDWA 1Z9LA 1CMOA 3FCGA 4KY1H 8CGTA 2CZNA 1K2DB 1QBAA 4FZ8H 4LCUB 2V3DA 3VWKA 4A68A 1KLFA 4MQTB 2H9GB 3IGKA 3PYCA 5C6TL 5T5MD 5B38G 3KLHC 2FJGB 2ZKHL 1SFDA 4OCWH 3FS9A 2D7MA 5KVEH 5HDBF 1KPVA 2A4ZA 4OI8A 3A22A 3RI5F 5B8CB 3M1BA 1G7QA 4AK2A 4BE6A 4MA8L 4Y16C 5JDSA 3MODH 2QVTA 3D18B 3AQXA 1LD9B 4L29A 3X2MA 4TL5A 5FDWB 4PRDA 4ZDHB 2FHCA 4UDTA 1UXWA 2NCEA 1ZY9A 3APNA 4UQAA 1N6QL 5E8PB 1YEEL 4MA1C 5ANMB 3SCMD 3VFMA 3ULVL 3TURA 1I82A 4WFFD 3KYNB 4LVOC 2W9LA 4DH2A 4Y19A 3VQLA 5JIQA 3FT2A 3GRWA 4N2OA 3X11B 3OAYK 2PWDA 4BWUA 2I26N 5F0PB 3FHEA 3GTLA 1F45A 2WLYA 4X9YA 5F21B 4EEEA 1WZKA 2WIIB 2XT1B 5CD5D 5I66B 4OGZA 1K4CA 2AJSL 3HZVA 3FH7A 2Y69B 1SMAA 3BSZL 3FSAA 5ABAA 2A74B 1DZBA 1YY8B 4PJ8C 2OCFD 3ARWA 3APCA 3O11A 5J06A 1SFOA 2W81C 1WT5C 3ZYZA 3W37A 2QHLA 1CZ8L 2Y9RT 1QD0A 5IMLB 4FP8L 3SDAA 1E3XA 4X6DA 4AL8H 1GYUA 4XO4A 1CFNB 2V3FA 3DUSA 2OZ4A 5DO8A 1G6RB 4QY8B 2ZXEB 5C9JA 4AYFA 1HWGB 1EHLL 3GZQA 4DPBX 1NGPL 3PFQA 3SPGA 4Z77B 4AM0A 1Q9OB 4PJAB 5DUPL 2UZXA 2EDYA 3VX1A 4LGPB 4NN6B 3FB8A 5FECB 2JNZA 5AZEH 4MCNA 5IVXE 1YMMB 2JCCB 2WBJA 1J1OH 3LN5A 1F58L 3SKJL 3GBML 4YSTA 1U8PA 1CF8H 2BFVL 3BEVA 2OW7A 3KGUA 1BLIA 5FO7B 4NERA 1S7QB 5BVJB 5DDHB 2OKMA 5JW4Q 1BZ9A 3QXUA 5HY9A 4DGYL 3GM0A 3MJ7B 5ISZE 1TCMA 5IBTL 1CICD 4C4UA 3CFTA 2NOYA 4X8JB 3MNMA 1N5YL 3BHBB 3EG9B 4JFOB 3IMUA 3QPXL 4HKXA 2NY6D 4L9LA 5ICZA 4OGYH 3WFCH 4MS8D 4XPFH 4YPGA 4D0BA 4EAEA 1NINA 4AUUA 3VXPB 3CDZA 1SJHA 4WENB 4PY7A 1HN1A 4HFWA 4XAWL 3RA7H 4APXB 2HKFH 5F7DA 2ROYA 1EMTH 3GNMH 3S34H 1Z9PA 1FYTA 4FXTA 4PJ7B 2VRKA 1DN2A 4EN3C 3MLPA 1D5MB 1GMEA 2WZ6A 3CBJB 1WITA 5ADPH 1IKFH 3PL6C 4PJEF 4KX9A 1ZA3A 2GJ6B 2WKLA 2OJZH 1XGPA 3KJ4B 4BXVA 3HPJB 3TBTA 1E4XL 2NXZB 4HGKC 4HS8L 4DN4L 1NDTA 4CW1A 1HCZA 2OTPA 3QR0A 5FTNA 4UM8B 1KGXA 3L6FB 1L9MA 1JZFA 1MNNA 1RD6A 4FCHA 1IGJB 1FJ1B 1SHWA 3KHOA 3P69A 4NUJA 3RB7A 1YYML 1VC3B 3S97C 1JZ7A 3KAAA 2OULB 5E6YA 2NVXA 3MMEA 5IB2A 3GXTA 4HSQA 3SDCD 4FABL 2JJVA 3BSZH 3K6SB 1WFMA 1OGYA 1A4KA 1YDPA 5HVHC 1ONQB 3GGWA 5BV7H 5L7XH 3OPZL 4LAJH 4TRPL 1MREH 3MBWA 1O0VA 4TNVK 1P4BH 4DKAA 5IIEB 4YE4H 2A4CA 2JMRA 1ZLUH 1KPRA 2YQ2A 2A77L 2DOCA 3LMJH 4OVUA 4NQED 2NY5L 1BBJB 4N1EA 1RK0B 3WNJA 4P2CG 4MD0B 5CFHA 3TH4T 3NPSB 3MV8A 4HXBL 4OD3H 2JIPA 4UILL 1S6NA 2B1AL 3QUGA 4GRLB 1JZGA 3DX6B 4N86A 2Q86B 4GJTB 2HT3C 4MHHI 4BUQA 1ORSA 4KJQD 3KBPA 1DBMH 3OHXB 1DBJH 3FFOA 4NZFA 4UDUA 1T1ZB 3QIWA 3SGKA 3ZO0A 4O02B 4P99A 4URKA 5F9OH 1MJ8H 1ZT7B 5FKPA 4AGQA 2CPUA 3NRPA 2VQ1B 4AH2B 4AQZA 4LF3A 4AYBA 1B6DA 2W07A 2DKUA 1AO7B 2BNRD 5JUEH 3HBPA 2MOGA 3L1OH 3BZ5A 1FI8C 5KEZA 3ZRCC 5EORL 2R0WL 1PKQA 3LRMA 2CD0A 4PMEA 5CBEA 1WD8A 2YEZB 1HEJC 4KO8A 2VISA 3PDOA 4NQVA 3A4FA 3IDYC 4G7QB 4WI4A 1EFXB 3OLEA 5DEZA 1ZMYA 2GYSA 4AEEA 1FVEA 2J88H 5DT1L 2JKTM 1NJ9A 1BMZA 1FORH 3WFZA 2WZ5A 3KMDA 1SLWA 3LZOA 4IRJB 3RDTC 2QVKA 4G9DA 1FVCA 3QIUC 7CGTA 4CSPA 2AS5M 5EZJB 4JPQA 4FEIA 4DP6X 2ADGA 5LGJB 4A6YL 1CGTA 5FA4A 2E7HA 4R7XA 4UOQA 1XWVA 4K07A 3UYOD 1NGWA 3UTOA 1E4XH 4PGEB 1K5WA 2K6YA 4CU7A 1KNOA 2VPWA 1MELA 4MA1B 5DS1A 4ADIA 4ZNEA 1KG0B 2FD6L 3SQBB 1NCBL 4JFQB 5KVEE 4LESA 2YGQA 2FO1A 1E18A 3OKKA 4XP4H 1MCEA 2XWXA 1XGYL 4C56B 2WXHA 1T66D 1JZ6A 1CFSA 1S78D 1AXIB 4G8EA 1NC4B 3ARBB 4ACTA 4EI6B 2LR4A 4F7EA 2BSRB 3QJVB 4J2XA 1M4KA 2FYVA 3TN0C 1P5UA 4A2DA 1T5XB 5IWLA 2DQMA 2P42B 1KGUA 2DQTH 1A7PH 1SJHB 1XB8A 2XU9A 3KLQA 3ZSTA 5BO0D 1LP9A 1AIZA 3CK0L 2D0FA 4NAJA 2H6PA 3VI4A 2VLME 4GKSA 2Q8BH 1ND0A 1U3JA 3O3BB 5IB3B 1KGCD 3MBEB 4HQQL 2F7OA 2BFGA 4N8VA 1KWGA 1JAEA 4X6BB 1GGUA 4PG2C 2YWYA 3FTVA 2GJ6D 2N7SA 1J48A 3MUGB 4R6UA 2F19L 1FSKC 4EIZC 1KCLA 3T0EC 3TGXA 3GSWA 1R3JB 3QIUD 1TZHB 5D70L 2P9RA 3HG0A 3PNWB 1KLGB 1EHNA 4GG6A 3U4EA 3S2AA 2JKRM 1AKJD 5T5ID 4N2LA 1OA9A 1SEBB 5FTJA 4RMUA 3TA3A 3BP6A 5FB8B 4G43B 4JFEA 4LCWD 1Q0YH 1G0YR 4L1BA 4Q9RH 4I0CC 4PJ5A 4UAHA 5CN3A 3S2CA 2NY7L 1F4HA 5A2IH 2ADJB 4S1QH 2J55A 1PD1A 2VOTA 2ZXQA 5JYMA 2PXYC 4G8EB 1IE5A 4MJ6B 1GIGH 2E74C 1MIML 3ASNB 5HDOA 2C7UB 3QQ3A 4MMXC 1QI4A 4UT6H 5IV2B 3QUXC 1CG9B 1QWHA 4U1MA 4BFRA 4D8PB 1MAMH 1K3ZA 5I1JH 3V4PA 3OJDA 4AIXA 4JGJA 4MAYD 4QHUB 4YXKL 3BUYA 1L9OA 3ET9F 3ULSB 3M86A 2NY2D 2ZJSH 3D2UA 3VI4B 1NANH 4N0UB 2ITCA 4GMTH 3CN3A 5C0CA 4LK4A 2VLKE 4X5QA 3O4LA 3X14A 1GS8A 3T2NL 1JPSL 1AIFB 4LLWA 2DM3A 1WDAA 2WXOA 4LEOA 3DOSA 3O3UN 5B1JA 4PGJA 4ZOAA 1UH4A 1RPKA 4H25A 5I8KH 3RWIB 1QWUA 3UTQA 1CTOA 5KW9L 1JWMA 4AV5A 2LFEA 1YNTA 3LN9A 2FD6H 2L4OA 4JFED 2ZUTA 4M6AA 4KMQA 1SPDA 5T1KA 1E6OH 1KG0A 3ARPA 1YAIA 5K59F 2VLKA 4GLRI 3EOTL 1HSAB 1A7RL 4P2QB 1HZKA 1IFGA 4D9RE 1G84A 5J12B 4P2OC 1GZQB 1TCRB 3W1ZA 4XNXL 2JJTC 2YXFA 4UQ3A 3CCHB 1OSPL 3O2DA 3BAXA 5D96B 5TF1L 3U7YH 6CGTA 4HV8A 3X12B 5LGHL 4MZRA 1IM3D 4L5FL 3QIWB 4OLXL 1UT9A 1H3PL 4PJAE 3GLDA 2QR0A 3AMKA 3QDME 4G9DB 5GM9A 3P0YL 3QULB 1JXKA 3DROA 5A2BA 4PJDA 2XN0A 1ZK9A 1BVZA 4K2UL 3WXWL 1NM4A 1OTTC 1AQ8A 1MPAL 2JCCE 5IB1A 1JUFA 4JO3H 1A1NB 1YYCA 1URLA 1SDAB 4XHJD 2A83B 2FO4B 4QF1B 5DZAA 3SDCC 3IFOA 3RWFA 2WQSA 4MXQC 2B14A 4MJ2A 3K2MC 4FI8A 4N5ED 2OMUB 5FF6B 3NT0A 2VABB 1OM3H 2WLMA 2UXTA 1LMIA 4HF5L 2AQPA 2L3BA 5DWPA 5C0IA 5DUJA 5CP7A 3O8XB 1GGBH 1ETZA 3QCVH 2C8NA 1NCGA 1DQJB 3L54A 1XXFC 1CD8A 4F92B 3QHZH 3L5JA 4MB5A 1S3KL 4J2QA 5DMKA 2FX8H 3K5RA 1I9IL 4OKVB 3HE7B 3WEXB 3FB5B 5KYXB 3WFHA 3WNPA 4URTB 3JUYA 4NN7C 3H0TA 5HJBA 5D2NA 3D30A 2VZOA 4E68A 3UJTL 1HL5A 5BZDB 1IC4H 3LHPH 1CLCA 4NN5B 2KYIA 4RESB 3GZKA 3HKFA 4P5KB 3CIAA 3ULUH 1J8HB 3WS3A 1C1EH 1YO4A 1MRFH 2CKBH 3MYJA 2Z31B 2P7TB 3OUGA 1JPSH 5TPWL 3BW9B 3QNFA 4OM1H 5IB4A 3VD2A 4QTFA 1Q0XL 2AEOA 4PJGF 1AMXA 1JHLL 3CN0A 5I18H 2LOEA 4KXBA 3HBZA 8FABA 1EDQA 5FPIA 1UH2A 3KYKH 5JW4M 3S3DB 4JRXB 3QGVA 3PG2A 3MUUA 3RG1C 4Z78B 3O8XD 2OP4L 1C5DB 2I85A 1E6OL 2I9LA 1J88A 4JLRB 1HQ4B 1AHWB 3CVHH 2VLLB 1Y6NR 2NT1A 3V6BR 4KI5C 4DFIA 2VQ4A 3NSFA 5IJCC 3MLWL 5HHVL 3ESNA 4G8GB 3SOBH 3O6MH 3MLUL 2WBJD 3TVMC 3FTWA 4OM0L 2EDHA 1PS3A 2QMJA 5HY9B 4XNZC 2R1XA 3TN0B 4GSDL 3ROLB 1LO3H 5CIPH 4DAGL 2VDNH 4YHNB 2DWXA 2XWCA 4H4NA 2BY1A 3T0DA 2YLHA 2Y36L 1U6AH 3MCG1 2WYIA 4E9XA 1MI5D 1YEIH 2Z91B 4NJAL 3OLGA 3MOAH 3RU8H 3VXUD 1BGXH 2WTOA 4MAUL 5J1TC 1R3IL 3Q3GB 4PRAA 4U1LB 2EKSB 5DQ9B 1ZSDA 3T0WA 3JUZA 4ZS7H 3JWNC 4MMXA 3CFNA 4FXGC 3CJJA 4DCQA 2H2SC 3IDIB 5I1EL 5IG7B 2BNUA 3H42H 3CZEA 1F3JB 2X1PA 1PT0A 3SDDC 1JWUB 1X7TA 3E2HB 2G2RB 4FCAA 3RIFK 4A67A 4OKDA 1A6UH 4XP9H 4JP7A 5I1IL 1JYVA 5FTLA 5C8JB 5H37H 5IF0B 4ZPVB 4HOZA 3CDGB 3S37L 3P2BA 1JWSA 4JFDE 1FAKT 4OSUL 3H7BA 2C5DC 4AM0Q 5DJ8B 5J89A 3BYTA 3I6LD 1NFIA 3EYQD 3GJEA 1FGVH 4TTDD 1XGUB 3CXDH 3P4MA 5SWZD 1SGKA 2NSMA 1G7JB 1HEZB 4GAYA 2EDJA 3AWEA 3TPUA 3WLBA 3P4OB 1QPXA 4BH8B 3IXTB 2CALA 2WD0A 2YOAA 3T3MB 4MDIA 4YSCA 2YGOA 3DA0A 1LO4L 4KX8A 5J6SA 3OX8A 2IDTA 35C8L 5I16A 2XTJE 2KS0A 1AA6A 3EYUL 5D6DA 1HHHB 2EDWA 1UZ8A 1WH0A 1HOCB 5DWUH 2GBTA 5GZOD 4QRRA 2JI2A 3P77A 4QTIL 1PGRB 5GZOC 3RPKA 1LO0L 1A1MB 2ED8A 1AGDB 2D73A 5LBGA 5KVFH 3SDAC 4LSPH 1HILA 3F58L 5IFHL 2WY3B 4QRUB 1T1YA 3KJ6L 4YVUA 3T3PE 4FLOA 4XN1A 1L6XA 3I6KA 1ZWIB 3ZTCC 4ZMAT 4CS0A 2E8ZA 4Y5XB 3RNQB 4GRMB 4OFIA 2VXUL 3EH1A 2V2XB 1MFAH 2ZCZA 5CEYA 3RPBA 2NUPA 3V0AC 3FCBA 2JK5B 4PWGA 5G5DA 1MCLA 3SUJA 4R4BA 4X9FA 1FV1A 4PRNA 2APVA 5FYJL 1DCLA 3TLRA 3TIEB 1EJ8A 3QZWB 4FG0A 3S4SB 1DQLL 1QRKA 2G3MA 3VJ6A 2O72A 3QEQA 4B7LA 4JR9H 1H8SA 2ID5A 5B4MC 5B8CA 2A0LC 5K69A 5HPMB 2YBRA 2W65A 3IMTA 1ZJBA 1A9BA 2ZKMX 4M1DH 4OIBA 4E9RA 5GZOA 1T03H 4YXHH 2NR6A 1RXLA 2O5JD 2FJGA 5ISZD 2BW4A 2PW2A 5IQ9B 1ZSHA 4GLRH 2XA8H 3QNYB 3RJOA 2R0LH 2W5PA 2NY3C 4X4MA 5EC1B 5KVGH 2XFGB 2R93A 1JI2A 4Y4KC 3WV0A 3BPLB 1EANA 4MNQD 1G94A 1NANI 3LZRA 4WUUB 2GAEA 4XTRC 4P5MA 4HIHB 4HC1L 3S36X 1OW0C 4W4NA 4ZRGA 2QADC 4PAZA 3KPMB 2QADD 2IQAB 1LNUA 4QRBA 4IEFA 4JANB 3NCYS 3B5TA 2EEBA 5FK9A 1YQVL 3ULUC 2XN9A 2Y3NA 3L08A 4KMTL 3VGEA 4BSVA 2XKNB 1FC2D 1N0LA 3TBYA 4DKFL 4KPHL 1T80A 4L1TA 4L23A 4Z76B 1S9XB 3PWUB 5JOPE 1YUKB 5EEZA 2E76C 4G8AC 5EBWB 1M7XA 3H9SD 3IT8D 3QRLA 5CO1A 5BVPH 3IRZA 1HOCA 3HE7C 4X8CA 1UUSA 4UAOC 3TYFA 5ESAA 3ECBA 5A3ID 1NFDB 1FIGH 1GJUA 5M7QA 1CYXA 2OMXB 5E5MB 5ABDE 4HUXA 1G9MH 4YDKL 5J4MA 1DLHA 5EIVA 5IHZB 2EIEA 4Z7QF 4NEHB 2AC0A 4B9CA 4ANXA 3RYMA 4MRCA 4E36A 3W0WD 4RAUA 2PWFA 1BJMA 1QTSA 1XF4B 3MKKA 4M5YL 4DTGH 2B59A 3ARTA 3ZGHA 4J1UA 2JELH 1PIFA 3BISA 4PJ9B 1EBPA 2NXYD 3B9DA 3A6CH 4G9FB 3BUPA 4MDJB 4AVIA 3L13A 4OLVL 3NCFB 4M93B 1VGKA 1FN4B 4KC3B 1A7NH 4N2IA 5FOBB 1YUHA 2EICA 2VLRD 3HB3B 2J25A 4K3EH 3ZT5A 1X9UA 2P28B 3RDTD 3F00A 3TX4A 2HFEA 4PRHD 4XBPB 3UTZA 3CZFA 4POZC 1KGIA 1R24B 5D1QE 2V33A 3K81A 5HYJB 1I8MB 2BNQD 5ERWB 4GQ9H 5SWZB 3TVMB 2WKGA 4MRBA 3VWJB 1BEXA 1R5WA 2CG9X 3TA3D 1TJXA 5D93C 2BOCB 1OOWA 3LH8A 1H6FA 1NAMB 3T1FA 2Y7MA 4TNWF 3PUCA 1KN4L 4PREA 1FFQA 5T33L 3QZBA 4HOWA 5EIIB 4LAQL 4NKMA 5CLTA 3VVWA 3W0WA 2Q5BA 2HFFA 4PUBH 2XPZA 3B9KD 5E03A 1L9TA 5BUGA 1IX2A 3MXWH 4L3CB 3V4PH 2E7ZA 3IGAA 1M1XA 4LEOB 1G43A 1X5AA 3KLKA 3BI9X 4F2EA 4R26H 4YEFA 4AOFA 3HHMA 1H8LA 2WP3T 4XVSH 3SE9L 4DOHB 3IVKB 3DYOA 3FULA 3I50H 4M3HA 4Y2DC 1B9ZA 3ESPA 4YDJB 4RWYH 1NCDL 2NTSP 4DZBA 5HI3D 3BUYB 4NSKB 2XWEA 3W56A 1S3RA 3EIFA 3FO0H 4NN7B 4WFHD 3CD4A 5FO9A 2DMGA 3WS6C 3VFUB 4FNQA 4OJYA 3TU6A 2IVFC 3QYCA 3AC0A 4L3FA 5IHWA 4PJEE 1S5IH 2W80C 4U1NA 5IW6B 2EDQA 3GBNL 5IK3A 2WLLA 2J8OA 3ML1A 2HVKA 1UGNA 5T1LB 3G5WA 4K23L 2KMWA 1MCDA 4GFTB 2Z31A 4ONGL 3ILDA 4WV1A 1F4WL 5AWNL 1KQFA 2WCSA 5CM1A 1E8ZA 5F7WC 2FBJH 3PPSA 3DIVA 3Q8FA 2FZ3A 4ZUSA 1SEBA 2NYYC 1PYWA 1DQMH 3RFZA 5FUCE 4JRXD 3CFBB 3QPKA 2Y2WA 2KDYA 2UZYA 3WEXA 4IBSA 2YPVH 3N91A 5DMKB 2ZG2A 5CSZB 3B2PA 4U0RB 1A22B 4Z3JA 4HUUB 2BVQB 3V6FB 1S78C 3V0HA 4FKKA 5F1NB 1JXGA 4R8WL 2Q3XA 4FABH 1M6OB 3WDHA 1QLEL 4PR5A 4F24A 4P4KC 3ARZA 2OK0L 4OZ4A 4F37F 5EU6A 4I7ZC 1W0VA 3K2IA 1VRSA 5G55A 3ZQWA 1JUFB 1SEQL 1IFHH 1Z9NA 3FQWB 4MQSB 4PCTA 4UIMB 5D71H 3X12A 5AYQA 3SDXA 3LAFA 4ZXBB 4P8QA 5HD8D 1JGLH 5IFJA 1QRNB 5F9AC 5I8CA 2F5AH 3LKNA 4ETYA 2AGJH 4UILH 1L3NA 1FVDB 2J2ZA 5C3TA 4JUTA 1RZGA 3WIAA 4HBCL 1HCFX 2BP0A 3CZJA 3MKGA 5DUPH 1EGJH 4M3JA 1N6UA 1HEHC 2XTJD 3MJWA 2R23A 3V10A 4FFZH 3QIBD 4ODWB 5E8OB 2BY2A 3NUKA 2D2OA 1EVTC 4X99A 3ZW3A 4F91B 3KGSA 4JZNB 1ZVHA 2B4CH 5HJGA 1J0KA 4DHLA 4XE0A 5BZZA 1A6PA 1O7SA 1P7QA 3IDNA 3CFKB 3N85L 1E5AA 5FA4B 2OR8A 2VSKB 5DSCB 2EXSA 4Z23A 5FHBL 3WIHH 1HIMH 1B0GB 2VDQB 5HHPA 1YEDB 4M61B 3W39A 5IBTH 1EFQA 4P23D 3P11L 1CQKA 2W9EH 3GZPA 4L3EE 4LEXH 5D2NC 5KBPA 2PTTB 3O45B 3GMOA 4I0PC 4N3UA 1UB6B 3SCMB 3IJ7A 4G6KH 3DOSB 4RDBA 4ZX6A 2YEZA 2ILLA 4JDZA 4LPYA 1U95B 1U92B 5FUOH 3G04A 3CDFA 5KVGE 3HZYA 3NH7L 4NQCB 4J3SA 4PJBB 1MOEA 3ABLB 4HCIA 4CGUB 1R0AH 2EE2A 3K4DA 4XPBL 3ESOA 4ELMB 5EOCL 4ZSOE 1XR9B 4EF3A 2O5YH 4EDWL 3V0IA 3VFUA 3DO4A 1MHEB 4Y4HD 5IKCA 1MLCA 3WDJA 1DQML 2FECI 4M8VA 2P80D 4Z3EA 2OS7A 4YHKH 3S3BB 4EZJA 2EILB 5JXED 2MNWA 1TR7A 3DOHA 1G6VK 2WGNB 3PQYD 3UAJD 1R75A 4GRLD 2J6WA 5HHME 5JW5A 1AZCA 3HS0A 1P84K 3VXME 1QSFE 2K3TA 3HC0A 3QI9A 1FVDA 3H55A 4UTBA 4GG6F 4Z7UF 3ULUE 2C7FA 2Y22A 1PZSA 4K9JA 1OE3A 4WJKB 4U3SA 4M93C 3QDGE 4Y4FA 5EIIA 25C8H 5HHPB 2P8PB 4LHQB 2ZKWA 3VFGL 2PYEE 3HNTL 5DJCB 1V3LA 4PJHE 1SJVA 4YH6A 2XQYA 5D7KD 5IJVB 3THMH 5E9DE 3T5WA 3CFKA 2ITFA 1BWWA 3X1BA 1FO0B 1W0WA 3MUGA 2HN7A 2DLFH 2KBGA 4L8SB 5K9JL 1RMFL 3RGVC 4N28A 3TNMA 4HIQA 3JTBA 2G2PA 2GEQA 4E41B 2Z7YA 1K8DA 2NY5H 1JZ5A 5F1NA 5GGQL 5FGRA 3BP7A 3RWHB 4U3HA 4QRQA 4ZAKC 2X4PA 5FGBA 4CGTA 1EAJA 2M8XA 3QHFH 4P3CH 5B21A 2W38A 4AONB 2E6JA 3NZHH 3KPOB 5I74B 3LEYL 5TGBA 4UYPA 2E5EA 1NFKA 1LP9B 3Q1EA 3QUYD 3ZLQC 3CNKA 1YECH 4KQ3L 2ZP0T 3W81A 5LXGH 2UZYB 3NZSA 1IVTA 2BHFA 4NBZB 2QPEB 4O4YH 2DW5A 1HXYA 1NSNL 1WA1X 4WI2A 4QNPF 2PTVA 5DJ0B 5D1XC 1P7KA 4E0RB 2JKXA 3RUGA 3B7SA 3T2QA 2R8SL 5L6YL 3Q0HA 3SE6A 2EP6A 3LQAH 3VXPA 1I1FB 1JPFB 1LLAA 3U6RB 5E95B 2ENQA 1TLMA 3ECBB 1HQRA 4NQDA 3NEOA 2VXTH 4E9YA 2KT6A 3P9MA 2WXKA 1FG2A 4KAQL 1J18A 5KG9B 1QBMH 1WE5A 3GUTB 5MP6H 1IGCH 2NW3A 3LYRA 1MLBA 1OM9A 3L5HA 5JXAH 1UWXK 2WUCH 4P46D 5EFIA 3FK3A 1WVZA 2IFFH 5DVPA 4LSSH 1MEXH 2D3VA 4H13C 1RPUA 1KV3A 1QNIA 2R1WB 4XODA 3B6SA 4Z7VB 3V7AE 4HWZA 4R96B 3AAZB 1MJ7L 4EN2A 4WI7A 3S6CA 1L9QA 1XR8A 2R27A 2WQWA 2ORBH 1XCTA 2ESVE 3ILQD 1YJDL 2LW3A 3KLAA 2CLVA 4LRIA 3W2DL 3OPUA 2J12B 5C08E 3AVEA 1RZ8A 1CDHA 3TF7C 1PDKA 4N20A 1QSFA 3KZ8A 4NHCH 4YDVB 4KZEL 1HWHB 3S8GB 3ARYA 4KRPC 5DJDB 1OAUH 1S2EA 4QXGL 4QOKD 1D7CA 2CM5A 3QI9C 3WHXA 3LOWA 2UY7B 3WN5C 3HRPA 25C8L 1HOEA 3VCLA 5DF0A 4FYTA 3GTPA 3U4BH 3KEHA 1U0QA 3BVNA 3S4SA 3JTSA 3D39A 3UAEA 4OLWH 1CD0A 2B4CC 1XXDC 1N4XL 4PRIA 4LQFH 5ALCL 3OJVC 1T0NA 4QGTA 4R9HA 1C08B 3MO1A 3T8VA 4OJEH 3B9AA 1OIOA 5JA9A 3WYRA 5IEKB 4MD0A 3R0MA 5F1OB 4RISH 2PI8A 1V3MA 2OMWA 2YXMA 3UO1L 1T1YB 4XNDA 1UUNA 1DVZA 5KSBE 1AY1L 4TQIA 4B9YA 1FDLH 1OAQH 3WXVL 4Q9CA 1U4EA 4K5LA 5IIEA 4I0PA 1OOAA 5DA0B 4HWEH 3MBWB 3FHAA 2JKIS 3BT0A 5F7MC 5FDWA 1P4IH 2Z92A 3CHOA 2GKIA 3K6SA 2DLIA 1Q4NX 1ZANH 3D5OF 1BXVA 4I9XA 4XN5A 2ZKXA 1PX8A 2D03L 2Z7UA 5BXFB 3VXNA 3RAJH 1CU4L 1FF5A 2X0WA 1FPTH 3Q01A 3DPDA 3CFCL 1XCWA 4AE1A 2GTWB 3HRZB 2HMID 3CH1A 1Z3RA 4RSVA 1XDTT 4P2OA 2XSKA 3V0FA 1JGEB 4JRWA 2WXFA 3CUPA 3CE1A 4FG6D 1G7JA 1Q38A 2JLPA 4J27A 3BT2L 4MYPA 1ZC1A 3P73B 4R0LA 1UD3A 4NKDB 3BPCB 1KCVH 5H4UA 3CZBA 3L1EA 3V4VH 1QQDA 2WLHA 3C08L 4WAFA 1UASA 5IESL 1E42A 4H0LC 1QFWM 2XDHA 3AROA 2BZDA 2QHRH 2ALWA 2LHAA 1BA9A 5CWSA 5I17B 3RWEB 3O6FB 4FLRA 4PWIA 5C0ND 3ISYA 3BWAB 3GMPB 3UJJH 5EBMA 5DHVH 4BHUI 1SF5A 2D7TL 3OKOA 4GA6A 1BD2E 3J8F7 1TVBA 4UT9L 4QRFA 5KJ7E 4LPWA 5IFAL 2VUYA 1BYPA 5L4JA 1G5GA 3FQXA 3K71B 1KYFA 1A8ZA 2K78A 4UV4L 1O9ZA 2GFBA 2DWTA 4FJZA 3N55A 2NY5C 5JIPA 1UM6L 4HZLA 1JNLH 1R27A 3OLIA 3TCLA 1AD0B 1W15A 3NOIA 1Y1DA 3JTTB 4LVOB 3VGBA 3IEAA 1UCBL 4NNPH 5DK2A 3HZMA 1CLZH 4ETQA 3D2UD 1O7DE 3VI3F 3MV8E 1TVHA 4P5TB 4RFNC 1ZGLB 1OF0A 1HHGA 2JK5A 1YMMA 5E99L 4P5MB 5G5DB 1B90A 2Z6FA 1ZVSB 4FQCL 4EKXA 1D7BA 1RP9A 3CHPA 3RKDC 2K8MA 5A2FA 3FOMA 1QRNE 3P9LA 3ROOB 5GGTL 4HGMA 3LNIA 3HUJA 3DRTB 1XEUA 3RGVB 4B50A 4S2SA 4B0MB 4GG6E 1X5HA 4Z7VF 2CH8A 2VDLB 3EJSA 4PH8A 4PJIA 3L8QA 1FIEA 2GY5A 1XGQA 3D6GA 1OSYA 2DI9A 1YHPA 3SGDH 1MPAH 1XTLA 2Q7YA 3EOAB 3FFDB 2BSDA 2ERJB 2NZ9C 3WLWD 1REIA 2VIRA 4PB0H 3Q8EA 3O2WH 4R90L 4CMMB 1A6AA 3DV4B 3ZBMA 4L5FE 4FNLH 2CDEA 5C7XH 1J0JA 1FGNH 1M2OA 3PABA 1T1WB 4HIIB 4YBQD 3RWEA 1DANT 2IAMB 3E6HB 1UHDA 2WAQA 3MUHL 1V54B 3BOVA 4FADA 1TEGA 2EVIA 4Y4HA 4XPAH 4Z0XB 3CZSA 1FGVL 2GI7A 4HJTA 4IW4C 4TNWK 5GRVK 2F7QA 1T4KB 3W0WE 1MUJA 2H3NA 4MMZC 4ELME 2PPEA 3HE7A 2EABA 4OKVA 4UDTB 5KYXA 2FQDA 2DWYA 3Q8AA 4L8DA 1UOWA 2QKSA 1XZ0A 2VMFA 4L4VA 4PJXB 3MLZL 4MCYA 4AGPA 3CDGA 3MAWA 3VXQB 1ADWA 4QRTB 1KJ3L 1S7RA 4MMYA 5EF1A 1YN6B 4HXAH 1C12B 3DI3B 4I85A 3I02A 5ETUA 5GPRA 4XMTA 3VCLB 4F2MA 4BFNA 4U1JA 2BINA 2P8MA 1F3JA 3QFDB 2UY7A 4XVTH 4QO1B 3O9WA 4FQ2H 2RTTA 5DJZA 1RJCA 4GRWF 1U91A 4NP9A 2UY6B 3P4OA 2G5BA 3UAJC 3HZ3A 2CLRB 1E4WH 3QWOA 3CFJA 3ESMA 4KK6D 3QC5X 4TM9A 3F58H 5C0AA 1NFIB 2QQKH 1QFWH 2FYYA 4UU9A 4NZTL 2NRDA 3PWNB 4A7SA 2EH8H 3IPBA 3UTTA 1MFAL 1G8KA 4M6ML 1SXAA 2YGVA 3FQ2A 4TUOA 3RVVC 3UL4A 3SYAA 4XRCB 3BUBA 5TH2A 2NUTB 4G3YL 2HRHA 2OL3H 5L9DH 1KJ2A 4G7SB 3DRQB 4JKKA 4QTHA 4GOSA 5ACMA 1ZS8A 1T6BX 3MTXA 3D39B 1T6WA 3HJEA 3MHZA 4XMZA 1DTUA 1F86A 3OKMB 4HK3N 3P9MB 5T1LD 3R8QA 4I2XA 5DS8A 4P23A 4IRJD 2NYAA 1NTDA 2AQSA 3C9NB 3N9GL 4GW1B 5BZWB 4I18A 1E9PA 2XICA 3QUXA 1ZHKB 1DE4A 1DN0A 2EH7L 1E8XA 5D4JA 5LAXB 4WCYL 1MQKH 2FB4H 4K9EL 4PJGE 5IB4B 4Y7OC 4LRNH 1A5FL 3BE1L 5EU4A 4BZYA 1R46A 3ENGA 2MFNA 3I75A 4UOJA 1DFBH 5DR5L 4FNSA 3R7RA 3GTQA 4JJOA 1P4LB 5A6IA 4CVWA 4JAMA 4J4PD 3M07A 4KUCD 2YUWA 3H54A 5MHSD 5DJAB 2XV3A 1YYLH 1OALA 2Y7NA 3WUWA 1G4MA 1AKJB 1ZXQA 2F53E 4N22A 2FX7H 2D7QA 3WFHB 5F3HA 1YEGH 2Z4TA 5GSRA 3H2WA 4PGCB 4HYTB 1MFCL 5JDJA 2Y1ZA 5JZ7C 1D6EB 5E6IA 1RVFH 2WKOF 4I9WE 5F0MB 1W6LA 5KVEL 5IVXF 3MGTB 4G7YL 12E8L 2D9QB 4NRZB 3CFDA 1XF1A 4F2FA 2HN7B 5AOJA 2EE6A 1XF3B 3MLZH 5E9NA 1Z9SB 4Z7VE 2AE0X 4YXLL 4ZS6C 1S7VA 4YDKH 1IBYA 2NYYD 4X8GA 2BP8B 4U7SA 5C0EA 3IDMA 3TJHD 3HI6L 1LEKA 3MREB 5BUPA 4KRPB 5IWLC 1ZK5A 1NL0H 2BOBA 2OSWA 3RVWD 4O02L 1AE6L 3NSXA 3QI9B 1OKEA 1BLNA 2N56A 4HKBB 4KTYA 4E9WA 3ATEA 1PCSA 1Z7JA 4KHXL 1ZLUK 4H8QA 3WMSA 3P30L 2VW7A 3FSWA 4LIQE 1UYWH 2CO4A 2WTRA 1T1XA 1RUML 1JVOA 4CN4A 2NDFA 4F8QA 4ODXB 1MWOA 3EOBA 2HX7A 3CCHA 1BXAA 3KWVA 3T0EA 1LYQA 4ZZFA 1YRKA 1PFCA 1XF2B 3NVQA 4L4TE 5DUBA 3WTTA 1G9EA 3CSYB 2X4TB 3L3KA 4P2QA 5ENWB 4XAKD 3TT3L 3NPSC 3PLXB 3AABA 1T2QH 1T6VN 4GRLC 3O45A 5GGUA 4KGJA 4DF9A 2ZAGA 1QNZL 4JM4H 2ENSA 3MZGB 5JPNA 4WY7H 1JRHL 1YNTB 3DI2B 1U58A 3DROB 1R7RA 4W6WB 2BC4B 5DYOA 2GJZA 1ADQL 1PMYA 4C59B 1E50A 4OTXL 4JFDA 2G3XA 1GYAA 2XJLA 4KK9D 4F9LA 4FQIH 1JMXA 3IDNB 3O6KH 4AGNA 1A02N 4NUQA 1OZTG 5AB2A 1XMEB 3FAWA 3SODB 5DUBB 2IBBA 2SEBB 3BPNC 2DLHA 3ARDA 4DIXA 5TTRA 1RUPL 2A6HD 5DQJB 4U7MA 3VGFA 2KLSA 2YD2A 3MA9H 3RVWC 1ZLSL 4EUPA 5LGJA 4LPXA 2BVPA 4PY8J 3QZNA 2CAKA 2Q8AL 4RQQA 1UWEH 4U6TA 3S96A 3T71A 2L7JA 1IZKA 1SYSA 4GQQA 3P40A 5CUSL 1BAGA 2VSDA 3B43A 4Y5XC 4W6XB 2E2IA 3GMMA 1NA8A 5I82A 1DBML 4D7ZB 2BJMH 4MQ7B 1A9EB 1AVAA 4I87A 1FIGL 4LCYB 3IDYB 1AANA 2DQHH 3HR5B 3MZTA 2YWZA 2MSPA 5EN2B 1RLWA 5AVRB 3Q8CA 3SPHA 3TA3B 4TS6A 5E8NA 4CNIB 1CFVL 4CC1A 4PFEA 1CYWA 5KS9B 4FFVC 3ZDZF 3GI9H 2JFCA 3ASOB 3W11C 3ZDYB 5J7CC 1MHPH 4N8VG 2TSAA 4WDIB 4NZRL 3CFDB 4JW3A 1F3DJ 4RDQF 5I1KL 5LBVA 2WK2A 4WI6A 3HE6C 1HT6A 4JN1L 4N2CA 5CSZA 1CLVA 1U8IA 5EPPA 3AQDA 3QEQE 4C83B 3ARBC 1ET5A 1ETA1 2R4RH 1AKJA 2DH3A 3QJTB 2P24B 2K4AA 3MV8B 3VG0L 1TITA 1E6JH 2LQRA 3LKNB 3PGDB 4IU2B 4AX3A 4G8FB 3I6GA 4YFEA 1BZOA 3L48A 5IFJB 3QJSB 4ECNA 3I6GB 1QW9A 4PGDB 4DUWA 2NTFB 3CHQA 3PL6A 5C70A 2BSRA 3Q2WA 2R7EA 3PNWA 3AY4A 4Q6IB 2BRRL 3NTCH 2GB2A 3N42F 1T2QL 3LKPB 2ITDA 5HPOA 2EDEA 3IAPA 3QQ9D 2WB1A 3ATFA 4Z5RB 2A0LD 4RQQB 2B1AH 5J11B 1EGJL 2FEEL 4UOZA 4WGKA 1JTPA 2WXGA 4JQIH 2ZKYA 4JCWA 1LVEA 2HJFB 5KSUB 2CGYA 2P46B 4WTZG 1AP2A 3AWFA 3F8UB 4HU2A 2GVYA 2AP2A 4H8PA 3TBTB 1ZTXE 2X2IA 5DVMA 3KWUA 3K6DA 4F33A 1FVCB 1BVLA 3PWJB 5DGQA 1J8SA 5JUEL 3UPRA 1IAKA 4Z7NF 1A6VH 1DO5A 2B9AA 4HAKA 3U83A 1Q9LA 1HINL 2K4WA 3FFCA 4I4WB 3B7TA 4APQC 2AJXL 2FNBA 4Y1AB 4OZIE 3SIKA 3W0WB 3V7MA 4APXA 1QZ1A 1HDMA 2BRQA 1EHAA 3WNIA 2XV0A 1FZMA 1NC4D 3ARBD 4GSXA 4QJ3B 3DVNB 3CZLA 2FHFA 4Q6KA 3HMWL 4C8XA 4FJYA 4JE0A 1FUNA 3BKCH 3UJIL 4CVXB 3ZZLA 6PAZA 1VB9A 4FHJA 4QMEA 1X6NA 3AQZA 1Q94B 4ALAC 1LHZA 4FL4B 5DJZB 4FKHA 4NENB 4I89A 5GRZA 1Q90A 3A6BL 4P9HL 4XBPA 3V6OC 2CHDA 5LKNA 2VSMB 1TWFA 1THCA 4X9HA 3TWYA 4U1IB 5T3ZL 1J9CT 1HYSD 3L7EB 4HCGA 4JVWA 5EOQL 3WUZA 2YPVL 2ZP8A 5D5MF 4DGVL 4DT2A 1F13A 4NZRH 1HYSC 2OX5A 4NDMB 1JHTA 3PWNA 3QRFM 1EA9C 4HJGA 1SXCA 1EZVY 1M1XB 3NPZB 4UINH 4R7VA 5PCYA 2WSPA 3SYCA 4IOSA 4WW1B 2J72A 1TYEB 4O9HL 3T0XA 4UT6L 1VADA 2CR6A 1PLGL 2ZSVB 3QI9D 3TBWB 3Q1SL 1C5BH 2RQ8A 2WXNA 1JXDA 4TOYH 5E2VL 1J9SA 3BDXA 1RJLB 4Y88A 4H2AA 3ETBJ 3VFTA 4HWBA 1H15B 2YR3A 4OFKA 2F53D 3O9WB 4Y9EA 5D2LF 1N19A 4TULH 5D96C 4YSUA 4ZMVA 4H1LG 4X5WB 4UWQB 3VXRE 4HKZA 3RHWF 2XBDA 3OWRA 3O11B 4IS6B 1A6AB 4LSRL 5AB9A 1CL7L 2JLLA 4IRZA 2WV3A 4XXWA 3UTSD 4PJXA 5AL8A 4K3GA 1YN7A 1BFSA 4XB7A 2E27H 5BQDA 1JV5A 1DJZA 4L0PB 1JGIA 4Z7WE 3WO4C 1A14H 3FAXA 1CFTB 2HT3D 4WUKL 4YZWA 4WW2A 3RI5K 2D31A 4PJIB 1JZJA 3F5WB 3VI3B 1GOGA 5C2BL 3GHBL 4Y4HB 2H1LM 5F3BA 3S35X 2A73A 3FT2B 3HMXH 4PJ5E 1XGPB 4OD1L 1LDPH 1CF8L 1OCWH 3L3HB 3HLAA 3C09C 3EJQA 4PW4A 2CR3A 4LVNC 1SOSA 5F89A 1CQYA 1HHJB 1DR9A 2QZ5A 4NXSA 2B8OT 1Q0YL 2F53B 3LKRB 3O9WD 5GRJL 1HTYA 2ZXDA 3TASA 1DLHB 7FABL 3MMEB 2EYTA 4AKOA 1R4XA 2YBRB 3GMQB 4YK4B 3GMLB 5F7EL 3FHQA 2ZSWA 3HLKA 3B8SA 4HD5A 3L6FA 4HKXB 2GFBB 1PKOA 4AT6B 4BH7A 1OP3H 2F9BT 4N1CA 2DZEA 3T65A 3ZIYA 2R1YA 4JRYA 4V1DA 5ADOH 1YQ2A 5I17A 3MRFA 3VFNB 4N6RA 4RGND 4H88H 4Y5XA 3UAJA 2WCGA 4P5TA 2UYLA 4FQXA 5I73C 1A6TB 5DD3H 3C8HA 5T3ZH 2IQAA 3COOA 2YPVA 3CLWA 1HJBC 3QCVL 2AQNA 1BFTA 3LQMA 1CIUA 3VSUA 1BEYH 4HIXL 5KW9H 5E1AA 4KNUA 3V6ZB 4XO8A 3ETTA 1F6LL 3H9HB 4FS0A 3S36H 3A23A 4QXGH 4NRXB 5GRXG 1S9YA 3EOTH 1KYAA 3PGCA 4I1RA 2MIZA 3F7LA 4QIWA 2PO6D 2JIXD 4FAAB 2X9ZA 5BXFA 5BV7L 5L7XL 4PLOB 4L4TB 3P4LA 3D85A 2AQTA 1FC1A 3WU1A 4YIQB 1OAXH 1TDQA 1RJYB 3GINA 3HPLA 4UOW1 1UZGA 3DMRA 3IDGA 2NW2A 1AGCA 3PV6A 4PIBA 4FQQA 1XZ0B 4L4VB 4BV1A 1P6WA 4AMKH 3IETB 1E5UI 3NACL 5E94B 1OW0A 1JNHA 5E5RB 4K8RD 4Z7OE 1PJWA 2CGRL 2EIMB 5DXWA 4ERSH 4AIZA 2Y07H 2OSYA 4XC3L 1CD9B 3CFJB 3LKSB 3BAWA 1A14L 4RMSA 1IAIM 1E4XI 3VTAA 1RFDH 2BWQA 1AY1H 2W0FB 3D0LB 1VFMA 4HUWA 4AYMC 2D7NA 5I1DB 3GJFK 2F5BH 3MRIB 3OG6B 2DQGH 2Z65C 4H44C 1OCWL 4PRIB 1KEMH 4JZOA 4XTRD 1CI5A 1E40A 2CDEB 3ZY7A 1FDIA 5F7KC 3P77B 4RFOH 5E8DL 4P57B 3T0VA 3ZL4L 3LKOA 1AZZC 3NJLA 1PYUB 4PJAF 3T6XA 1WAAA 4MCYB 3RZCD 4AV0A 1X4ZA 1SMYD 2CDFA 4ZOEA 2NNRA 3D85D 1N8ZB 1K4CB 5EORH 3WHXB 4JX0A 4NZUL 1W9XA 1CD1B 2EZ0C 1GR7A 4E5XB 2VLRB 4MS8C 4Z0XA 2W0FA 1AGFB 1BAFL 1FL6B 1QHOA 3LQZB 4RA0C 5F7NC 2EEFA 4N2DA 3H3PL 5E9DD 3C8KB 4JPVH 5JOFB 3DJSA 1DSFH 1YA5A 1P69B 3OQ3B 1D9KC 4NX0A 3NAAH 5SV4A 4XMVA 5DRZA 1VKXB 4A6YH 3U7WH 4ZFOA 4OF5A 1PCXA 4IKKA 2AABH 4WWKC 4XNUH 2I60H 3ZE0E 1QLRB 1JN6B 2GUOB 4B3EA 5I1IH 3B6SB 3FQ4A 3MRDA 4OF0A 3TCLB 2BPBA 3FQRA 4ZAKB 1OT1A 3C6EA 4NB7A 3UZQA 1INEH 3R7QA 4A7QA 1WHOA 2BNUB 4IDJL 1ZA6B 4LFHG 3RZCB 2BIQA 3EZJB 4XNAA 3VH8B 5EU5A 4JM2B 5T1MA 1T5WA 3WTYA 1I75A 3LKRA 4JB9L 5IHUH 3I3BA 1HHJA 4NHCL 1PDKB 4PRAB 4U1LA 4CKQA 4L0YA 5JR1L 4AKQA 1GSKA 2CJUL 4ABUA 1N5AB 2Z91A 3O6ML 2VMCA 1CLZL 4R97B 3RDJA 2D3NA 1I1CA 3BAIA 3X2QB 4XOEA 5I24A 1BW8A 2FO8A 1WWCA 3HZMB 4DAGH 1DUZA 2DYSB 3MCKB 1J0YA 1J0ZA 4KTEL 2A3TA 5GGRA 1L6PA 3FU7B 1F11A 2X3BA 5DC9B 4DETA 1FNHA 1UVQA 2OMTA 2Q8BL 5K9QI 2X6CA 5B39A 3N43B 4X5PA 3QJHA 5EZLB 3LH9A 2F18A 4AYEC 3L2NA 5H4ZA 2HCZX 1G6RL 5CGYC 5K93A 3MSPA 1CDUA 2DQJH 3GMPA 1P6FA 3MLRL 5IQOA 3MFFA 5HDLA 4Z3FA 1E4JA 5HSFA 1JK9A 4QHKJ 4ZMWA 2DIJA 4F9PC 3TNMB 4Y4HC 5HYQA 3ATDA 5I1EH 1SUHA 4M29A 5E1QA 3DBXB 1KN2L 4L8SA 2CBMA 4LOFA 3V0WL 3EFFB 3WTVA 3MRQA 1N3NA 3PS6A 2FQGA 5T5FA 5D1ZB 2VZSA 1W16A 3DTXA 3MV7B 4IKJA 1HCVA 1DQLH 4Y1AE 5ANHA 5CEZE 5LQBH 5L2KD 4A2LA 1FLTX 5FW8A 2KPWA 5DA4A 2F68X 3X2IA 1RHHA 1P6AB 5KJRH 5CGTA 3L95A 4TVPE 3QZLA 2PCPA 2VMJA 2YPLE 1MRCH 4XN9A 3OMIB 1OARH 4UAOB 5TFSH 4DP5X 1IRAY 3VO0A 5AOMA 4J3VA 3EH5B 1F58H 1LDSA 4RNRA 4ZTOL 3WAJA 2XWBA 2XZAH 4IS6A 2GW5A 2A6KA 3SY0A 1V7ML 2J7LA 4HAFA 4S1RL 1DVFA 1BQ5A 3T09A 4BWWA 4X4YB 5CU5A 3ORJA 1IAIL 1BZ7A 3NFSH 4LCWA 4MB1A 5A16B 1FZMB 3TC9A 1JE6A 3VFVB 5I73B 3G6AA 4B5ZA 1PZBA 3QWRA 1FAIL 2CUIA 2TRHA 3O5AA 2FO4A 4QF1A 4GKOA 2VN4A 4DP1X 1F90L 3TEWA 3GLEA 4D9QD 1MIEL 1IGTA 3CVHA 3PF2A 1JPTH 1X5XA 4EMZA 1XH1A 4ZFZA 1Y0LB 1ZT4A 4YMPA 2YD3A 4U05A 1I9EA 3TVMD 2PKDA 2ZXGA 3ZR5A 3VXRB 3DV6A 4TLTA 3S0PA 2IWEA 1J12A 1UWGL 3OJDB 1MLCB 3E3QC 4OCYL 2B39A 4OZGE 4ODVH 2B16A 1PTZA 2DQFB 4M5YH 4DTGL 1VENA 4KU1A 4YSSA 5KG9A 4Z5RA 5TK4A 4N90E 1Y6MR 1E8WA 4WF7A 1R5VA 5ITBL 3QQ3B 3KVDD 3AS2A 3OKLB 3VWJC 3SPVB 1TZGH 4F93B 2HT4C 5JHMA 5DZOA 4N87A 3L4UA 4M1DL 1NDGB 4YFLF 1UJTA 1JCKA 3RX7A 1YEFL 4GNKB 2EH7H 5T1KB 5IQ7H 1J5IA 1KCRH 4Y1AA 5EN3A 2IWFA 4X6DF 1WCBB 1I3GL 4G8FA 5I5RA 3N0PB 1I7TA 2XZCH 4YHYB 1DMRA 4ODUA 3SDDD 5EF3A 3K2UL 5FGSA 4ESKA 2VLJA 3TCTA 3MV01 1KJVB 2KUTA 3I9IA 3DMMB 4NI3A 3WI9A 2FSDA 1JXFA 2A77H 5D7IA 4D3CL 2PXYD 5CZVH 3BD3A 4J6RH 5E5UB 4KPHH 3MV7D 3QIUB 1B2WL 4XCFH 1ETJA 2LVCA 1AQDB 1AXTH 1RU9L 3R06A 5FCUH 4E41A 2FSEB 3MXWL 3SUMA 1CYGA 1GA2A 5H94A 5E6ID 1D3CA 2WBJC 1J9QA 3MCYA 1FNEB 4MB3A 3ATBA 3MBXL 1HYRC 2HUHA 2VLJB 3L3IB 1WUZA 1H5BC 4LCYA 2AJYL 1HL9A 2R83A 3KGTA 4BKLA 3VXUB 5CZXC 4PSRA 1TG8A 2VZUA 4V1DE 2HFGH 4YUEL 3OKKB 2Z8SA 4WGVB 3GYRA 3S37X 4HJ0C 4Y19D 5DRNB 4Z7AA 4BQ9A 1VPOH 1I9JL 4XVUD 2ERJC 1TZHA 2MOQA 5JIKA 3V6FA 4AE0A 4TN9A 4ZMYA 2NMSA 4WEMB 3K6IA 4GRWE 3MRBB 2VM4A 4TMPA 4PV9B 2F74A 4LP5A 4ORZC 1A7NL 3QXAA 3ARDB 3EYFB 2E6QA 3SB3A 1TJIH 4LLVA 2Q7AA 1J1XH 1VFOA 2WANA 3LPOA 4U6VL 1QMUA 2BS8A 4EN3D 4N3TA 1QBLH 2BS9A 3QDJD 4X80H 4DEPC 4EQ3A 3QG7H 4Z7OB 2C3GA 2X10A 4NQXA 1TJHH 1G8JA 2YKLH 3T4YB 1K9TA 1U58B 5H4YA 1NJ9B 4CJ1A 2B2XH 4U1SA 1O6VA 2C45A 2OZ4H 4WKZA 4ZFZB 1TQTA 2GSIB 5EU3A 1LEIA 2FT8A 3WIIL 2MCMA 3HC0B 5DURD 5AVVB 2H3XC 4KH2A 3WDIA 1ORQA 1S46A 2ZXAA 4LHUG 2RFXA 2UWEB 5ENWA 4JFTA 4PG2A 4KHTL 3JWOC 4M61A 3WE1A 5ICXA 4NM8H 4BCZA 2NZ9D 5F70A 4F7MB 3PE9A 1J11A 3V4PL 2VXQH 5A16A 4X7EC 3LRHA 4N5UA 4O58L 1MFDH 1DSWA 4AI7A 2XZCL 3FTGB 1XHHA 3EOBB 2PMZA 4UOW0 4DQOH 1NKOA 2BLFA 2R29H 1KXHA 3OF6A 2ZOTA 3ARGC 5SWZA 3MJ9A 3AG4B 3ZE2E 1M53A 3CPLB 4YBQC 2DMRA 3MRBA 3ERXA 3S37H 4U6YA 1ZT4B 5SWQA 3N42B 3VE0A 2BHUA 1EVUA 5TQ0H 4PRHE 4WRLA 1L5GB 5C6TH 2YPKB 3LTVA 5I8CB 2K1MA 4XAKE 4ELMF 2COQA 5H35A 4FQ1H 4K3JH 2VDPB 4Z7QB 3EGXB 5JPNB 3CFIC 1MFVA 1VA9A 3QR2A 3UX9B 1CLOL 4GEJA 4UIMA 3NIDB 4HISA 2ITEA 4FD0A 2AI0L 2PLTA 3E9TA 5F7YC 5AWNH 4BZ2L 4MA8H 2EVHA 3PAYA 3ZE0B 2WXJA 3BIBX 3CV5A 4PHZA 2MHAB 3EYOB 3SGEH 2XC8A 4MWFA 3IGLA 2F7IA 5DD5L 3QNXA 2A6KB 3SY0B 3UZVA 3BO8A 3V4VA 1M6OA 2VQ1A 1I3RA 1SQMA 2IQ9L 3IXAA 1PQEA 1CPUA 3NJFA 4IBZA 1NLDL 2ATPB 4QD2E 4W9HC 1E60A 1L9RA 2YEQA 3KPSB 1LO0H 5JPMA 2FUQA 2C9AA 5I6PA 4TVPH 1A7OL 2WVVB 3SGJA 3DECA 1RIVH 1I8AA 3CMOL 4YPJA 3CWGA 4WEBL 3VXTA 3CX5J 1JNNH 4MDJA 4KRPD 4LSTL 3ARSA 3CTTA 2Q86A 2QQNH 4BFGA 2QV4A 2QPFA 3A67H 5D7SH 3W5NA 4ZZKA 3VG0H 3PREA 4XPBH 2XN9B 5DQDH 1FNAA 2X4OB 1MWAB 2X4SA 2ZXCA 1EUTA 2P5EA 4KLNA 4M3KB 4BFIB 3BZFA 4YDZA 5DMGC 3RB5A 2DJUA 2Z9TA 3J27A 4TVPD 1KULA 3D3VE 1OHQA 1SEQH 2WO3B 1S7SA 3SGJC 3ZYOA 5AUMB 1J05A 2HA1A 2OZ4L 3RTQD 1SQ2N 2PP9A 5BCAA 1BHGA 3N41B 2W92A 4I2XB 5DS8B 1GXEA 1OF2A 1B0RB 3BHBA 3EG9A 1CT8B 3UPAA 3U9WA 1QCSA 3BGMA 1WBXA 3EDKA 1I7RA 1IAOB 2Y1YA 2NUTA 2X4UB 2CBOA 4DZBB 1IVLA 1N0LB 3MRLA 1EAQA 2JIQA 1QSZA 1TENA 3POCA 1MKFA 5DUMH 1W72B 3ZHKA 4P4KD 1E28A 1OGAD 1MNUL 2AJ3B 1FHNA 4KK5C 3GTVA 3ZDWA 2G75A 1JD9A 3L4TA 4BQCA 5IREA 5KSAC 3Q6FB 4YZFE 5DRZB 1OTSC 2ARJA 4UV7H 4RAVA 1HH9B 1AKPA 3CMGA 4DKFH 1FYTB 3TO4D 4DESA 2ADFH 1DVFD 1M2VA 4FZ8L 4P07A 4Z3TA 5B7FA 4M7KH 4L1SA 5ILTL 5IW6A 3KPRB 5LB1A 4BWTA 5TK2A 3SPCA 4MS6A 4P0DA 5IOPB 5DCCA 3HOGA 3SD2A 2N4IA 2QGEA 4XR8C 3O41A 3SE4C 1X4YA 3BKJH 1C12A 2E7BA 1MAJA 1NUDA 2AAAA 2QSVA 4O4YL 3OKMA 5B3NA 1CFBA 4A04A 1F6FB 2B5IC 2XPYA 4P5RA 2VKWA 5IQNA 3UTZB 3LRSB 5IVZB 5CR8A 3FW6A 3HNSL 1KJ2H 5C0NC 2CA4A 1O7VA 5DLLA 4QXTA 3SUKA 2R2HA 1BQSA 2Z8RA 2Q6WA 3DX0A 3ILPB 3BLKA 3BRFA 5BW7C 3U4AA 4MJJA 5GHWL 1TWGA 3I6KB 1RJZB 1RIVL 4LLQB 2YD5A 4KZCA 5JTWA 4TQPA 3QUMB 5AW8B 1URZA 3E6HA 3T2LA 2I07B 4OY9A 4J1UB 5E8EB 1PLGH 2DL2A 5TQ2H 1EFXD 1N8ZA 2YJQA 5D4QA 2X5PA 4HLZH 4JFXB 3W9EB 3JWDH 3L3DA 2VO5A 3BPNB 5HHXL 4CVZA 4JK0D 3JWOH 4LSSL 5FV2A 2DBLL 2CRYA 5D6CA 1P4BL 3D85B 1AS8A 4A2FA 2DM7A 1MDTA 1XAUA 2B15A 3O6LH 3UXFA 4EUPH 4YN3A 3TYFB 3I02B 4FFVD 4GI8A 1VFBA 1H3XA 2CRIA 1CBJA 2V2WB 5I0WA 5B4MD 2ZWKA 5FYLL 4J8QA 4LVHC 1J0HA 5HD8C 2K45A 4GUOA 1ZSDB 4O2CA 5EBWA 1BJ1H 4R2GC 2HSIA 5GXBB 4GI6A 1OANA 3B2VL 2H3NB 3GJFH 2IDSA 3MRHA 4BFOA 2HT4D 5I66A 1KELL 5AD0A 4DNLA 4OZIA 2R2EB 2AFNA 3E80A 4FRWA 4KJYA 5C0CD 2A9AA 3RIKA 4WEUD 2IPUG 3KDMB 1LNUB 3CLEH 1B4LA 4PSPA 3AJ7A 4FEMA 3GMRA 5C8JA 5BMFL 5BV7B 2GAZB 2R1YB 1KBGL 4NOFA 1N5AA 1QFWI 2NY2B 2PCFA 2VN3A 1NFDA 3AM8A 4XOBA 3I9AA 1G9MC 3IFPA 4IMLB 4DGYH 1JGVH 2CCLA 1A0QH 2OL3B 3NYKA 3WD5H 2KZ1B 4WQOA 1E7UA 4DCQB 4TSBH 4OD2A 3F7KA 2R0WH 3OHXC 2X1QA 4JM2A 1NCAH 5GGSY 2DQUH 5LBSL 4YC2B 5DO2D 5C1MB 2HPTA 5F6IB 4M7KL 5A2JH 3Q3GA 4AQ1B 5JIIA 3IPFA 2I9LB 1ROWA 1TJGH 1C5CL 2V5SA 1CTMA 1LMKA 5C0FB 3GMQA 2CHNA 3X2KA 1I8LC 4LVEA 4KAQH 4X9GA 1D9KA 3EO0A 4YSRA 5FX3A 3KM1A 3KPRA 3P0VL 5A3IC 1HZLA 1OZUA 3IFNL 4K7FA 2VGLM 1F4WH 3CX5K 1EJOL 4JQVA 4NC2B 4ZFOB 4DGUA 5GS0L 2VW4A 4PM1A 4JS7A 5AW7B 3NQIA 1P4IL 1ANUA 4IBUA 2BSTB 3VD4A 3OWEA 1CDBA 4L8BA 3MDJA 4P5KA 5JLZB 1K4DB 3LZFL 5E4EB 5EUKA 3LNDA 3NJKA 2A73B 3TBVA 4OLEA 1E5ZA 2PW2B 3FJTA 4AT6A 4BH7B 3LS4L 1GGIH 1FP5A 3L3OA 2BNQE 4HIXH 1SLVA 1T0MA 3CFQA 4XPGL 1MJJA 1AHWA 4BZ2A 2FTAA 4NQEB 4Q52A 1DYZA 4Z78A 4NQCD 5BS0B 1IBGH 1HKLH 5CCKH 3ZT6A 1G7IA 4ZX4A 3FTYA 1HU8A 2F53A 1OHZA 1YNKL 3ZE1B 1GGYA 2KZBA 4R4BB 5I23A 4JZOB 3OPZH 2YXVA 3BWAA 5G4MA 1WCMA 3T8XA 4P2YA 2P7TA 2G0KA 2PR9A 4NM4H 4AEHH 3UOAB 4JM0A 3NIGE 5JHBA 3MRKB 1I3UA 4XMKH 5SWSB 3CK0H 3ELAT 2VDKH 1U8LB 1D2PA 4G1EA 5IMKB 3GSVB 2A6JA 2E7CA 2PXYA 2OSLB 3TZVD 3PGFL 4Y4KB 3UADA 4NIYE 3MO1B 4TPRL 5C92A 3B2VH 2YOCA 2YMXL 3CUPB 3FF7A 3SYQA 4NWUL 3WY2A 2YA0A 2WGXA 4HJEA 1FDLL 2GT9B 2ICEB 2FBRA 3M17B 2NW2B 4KJPD 5DHDA 1VEPA 4OF3A 2XXMB 1UCBH 4ZQKA 1SXNA 5KOMC 5ELIA 3WENA 5KYUA 4GFXA 2APBA 4ODTL 4ALAL 2OMUA 3MV9D 2ZWLT 5I8EB 5F2FA 4QHLB 1M7IB 1A0QL 2C9UA 1GZPB 1QSFB 4C4KT 3L1OL 4C47A 1WIPA 1FSKB 4JR9L 3WIHA 4X6CA 2NY4D 1XGUA 4HJUA 2Q87A 3L5XL 5EO9B 2C9PA 1KPUB 3NCJL 4MNQE 3QDGB 4HJGB 2K3HA 2NNAB 5IJKA 4PLJC 1X5JA 5FUOL 2KQAA 3SBWA 5I1CL 3D3VD 3AAZA 2XA8L 2J6EL 5E9DB 5BRZB 1CLYL 4JGNA 4U1IA 2L7QA 5IW3A 3LXCA 1JWUA 1MFEH 4WTWA 1KXVA 4TTGA 1W8OA 3JWDC 1WZMA 4P4RA 3HS9A 1NFAA 5C0CB 1V8HA 3BX7C 4NWTH 2Y2YA 4BXSV 4JPWH 4BK4A 3FBQA 1OTSD 4N0YL 1SMOA 5D1ZC 3PXHA 2W94A 5K1VA 3LRKA 2YD6A 3MU3A 4HCRL 3ZUNC 2YO3A 4KO6A 8FABB 2B77A 1JDDA 3V6OE 5ICXB 1E3FA 1QA9A 4KOBA 2HB0A 3VM5A 2XXFA 3MACH 3WELA 3V0DA 5CJQL 2EDRA 3UTQB 4CC0A 3KPPA 4OW6A 1CURA 1C7SA 2J4WL 1QPKA 2LLNA 4KTDH 3UACA 4S0SD 4I48B 4OIAA 1N0XL 2EE0A 4F8LA 1N9PA 2AJ3A 2UWEF 4KTEH 4YWGH 4KXAA 1UENA 2DYRB 4Z7VA 1NUNB 1AP2B 4YK4C 2YLKA 2ZCHH 1DQDL 1I9RL 2CGRH 4M00A 4ERSL 2D4FA 1IGYA 1JV5B 1KIRA 1NEZB 3MRCA 2LFGA 4M7JH 4L9DA 4M4RA 4NQSA 5LN8A 4ONOA 1KQGA 5FLVA 3EBIA 4WWKA 3BSZA 2QQKL 5HHQB 1FFOA 3U36B 5LVEA 2V8LA 5B38A 4W4OA 4ZMOA 1U8QA 3VB8A 4Q56A 1EXUB 2V45A 4PBVC 1I8KA 5IOKA 3LH2H 2H8PA 3QIWC 1KXQA 5KYWB 5J6HA 4D8OA 4M6MH 4HJIA 3GB7A 4RFOL 4N2NA 5DD0L 5BZDA 3IFOB 2X9XA 4G83A 1UTDA 2A83A 1R1CA 2ZUUA 4MJIA 4DJMA 3DGGA 2I9TA 3IBEA 1D5XB 2MQ0A 1TTAA 5E4AA 5F7FA 4C54A 1RHFA 4OU3A 1V7NL 4S1QL 3U9PH 1CFSB 3L4WA 1GIGL 3SZKC 2NLJB 1DQJA 1KTLB 3N9GH 2X4NB 2DIEA 1WYJA 5CBAA 2ADIB 3KPOA 4KDTA 1AG0A 4PN6A 5CP7B 5L8JB 5BRZD 5EV7A 5JPMB 4EI5D 3NAAL 5ITFA 3N40P 3MRGB 4YXKH 1ZLWH 2VPZA 1A6ZA 4HUVB 2EC8A 4JG9A 4RGOH 3B3BA 4G71B 3WFEL 5GS1B 1R3LB 2J5LB 2NPLX 2IAND 3QEQD 5G4NA 1GKEA 3ZPDA 4LQ1A 4MD4A 1LO2L 3B4NA 4KI5E 2I60L 5ESVB 5M94B 3R1GL 4G1MB 1Y7VA 4IRSC 5DHVA 3IF1B 2VRQA 5EZJA 4K3DL 3VX0A 2DLTA 3UABA 2BC4A 1WWAX 2DMBA 4TUJA 2Q0ZX 5DYOB 4I77H 3WO3B 5C0AE 3NK4A 3FFCB 4XOCA 2ADYA 1OXYA 3ABKB 2J8UE 3ISWA 2X41A 2WIMA 1Y18B 1BVLB 1JPTL 3PWJA 3UPRB 2BIMA 1D5ZB 2EXYC 2YUXA 3DX8B 3HUJF 3MACL 3R19A 5CCHE 3NFNB 5JR1H 4GQZA 1MCCA 2H4EA 3HFML 4YGAB 4GH7B 4LLWB 5MI0C 1P7QB 4KODA 3IDJB 1J5OL 4W81A 5DQJA 3Q2VA 3ZK0A 1GS7A 4F2ME 2Y6SD 4AH2A 1JFHA 4PV8B 4BJLA 3N44F 2ROXA 2ADIA 5CBAB 4N85A 1QFOA 2WTRB 4NFDA 5IV2A 3VQ1C 4FXGA 3Q43A 4M7JL 3HC2A 4ATWA 3SPVA 2RFXB 4CRZA 2UWEA 3TTSA 2EUZA 1T7XA 4FC3E 3LHAA 1FZKA 5DMJB 3M88A 3BXNA 4DVBB 1AGEB 4JUSA 1M42A 4M6OL 3X3GL 4G43A 1MFMA 1UGKA 3T6VA 3BP6B 1QLEH 4MNQA 2ICEC 4NO2A 1XF2A 2OQJB 5B6CA 4JFYB 1R3LA 1KUMA 5DD0H 3T08A 1I7ZB 1XGZA 3ZKND 1MWAL 3FO9B 4K0OA 4NO3B 3TNNB 4W9ZA 1N12A 3QB7C 1LE5A 4ODXA 4DEPB 1U8IB 2G5UA 3ARQA 3U36A 3ARXA 5M95B 5KS9F 2X1OA 3S3SA 2EVFA 1E7VA 3U9PL 2X44D 1AHMA 1YLEA 3STZB 1K8IA 3AY4C 3FQYA 3FZUD 4HBCH 4HLJA 2B20A 4K9EC 5F44A 3QQ7A 5FCUL 1IBZA 4UZGA 1FCGA 3ZDXE 3PXJA 1R19A 5J3HD 4G7YH 4R4NC 4KO7A 4MJIB 1LQSR 2B1HH 4OTXH 1SY6L 2OTUB 1KCVL 4CNIA 4NCDA 2AQQA 1IC4L 4E9VA 5IESH 2YRPA 3T0AA 3N85H 3MRRA 1UWXH 4YL9A 4PY8I 2GBVA 3EYUH 2HRPL 4GG6B 3R1GH 5D1ZA 2F58H 5D1XD 1SOXA 4PD4J 5IM7B 1U8QB 3RRQA 1NC4A 1PBYA 3ARBA 3II1A 1IM9A 3EDJA 2BHZA 4QRPD 4R84A 1QZNA 3GO1L 4DUXA 2R51A 5F7DB 3IJ9A 5GGSB 5IW1A 3MJ9H 4PY7B 4U1NB 2AW2A 3A5VA 4HIEA 1I9JH 4GW1A 3MFFB 2BVPB 3GBDA 5BS0E 3MV9E 5CF3A 1NEZA 3MRCB 2J1XA 3GKWH 3M6DA 4LOUD 1TSRA 4I1NB 4PW9A 4PGEA 4NLHA 4M9PA 5FEBA 3BWUF 2VN7A 4K5OA 1UCTA 3S3PA 2NX5D 1RUMH 3ECUA 1P1VA 2AXFA 1P1ZB 2QVFB 1DBBH 1XBRA 3F7PC 3RVVD 1PAZA 1RZKC 3VG9C 5B1JC 3QG7L 3TO4A 5I30L 3MRRB 1UWGH 4OCYH 2ZYRA 4NCC2 4EI6A 5F97E 1N64H 4ABVA 4HEMA 4FYQA 2XIBA 4FMVA 4DPAX 2NNAA 4PS3A 3GK8H 1J1PH 2IANE 2V5RA 2JIOA 2FNWA 4XNMA 5DD1H 2BCMA 5I1KH 2AMUA 1D5BA 2F0CA 3DVIA 4FQHA 3O4OC 1T03L 1AACA 1N68A 4N2FA 3TL5A 5L88L 4KOCA 3K8MA 4Q6IC 1CE1H 4PRBB 2MQCA 2DM4A 1T5WB 3QWQB 4AYFB 2VXQL 1NIEA 4LF3B 4X8JA 4G5ZH 4YHIB 3HCVB 4X7SL 5FO9B 1KJ2B 3H42L 1KBKA 4Y2DD 4TNEA 3EO9L 3IU4L 3M8OH 5HI3C 2X70B 2KL6A 3BESR 1YQVH 1AZUA 1U8PB 1P7QD 1XB6A 1CK0H 2A9BA 4WHCA 3VXSE 3QCTH 5D93B 2NY3B 3QDGA 3HEIB 4GRLA 2EJ1A 4NBXB 1P2CA 1OCOB 3RNKB 2VW6A 3BPLC 3DDFA 1OGPA 3C5JA 3GJFA 4KNTA 3KXFB 2JA7A 1AFVH 4YSPA 2CLRA 43CAB 5BVPL 3P2DA 5E70A 3VDBA 2IH8A 2UY6A 1U91B 3PRZA 4UT7H 4KQ3H 4APQB 1KBVA 3UFIA 4F15B 2NY0B 4HVBA 2R92A 3WCYA 2HJLB 4CC4A 2OCJA 3SKJH 5EPMB 1KIQA 4IRSA 2Y7QB 4UB0H 1ONQA 5HHOD 1DVFB 2VDNB 2IC2A 3CF2A 4XPTH 4G82A 4CMMA 3LKOB 3G5YB 1UM4H 2QVMA 1J5HA 2HFGL 4YUEH 2IOOA 4PGCA 5CKAA 3H8NA 4HG4K 2D4DA 5E08L 3GKWL 2X4RB 4DW2L 2HFTA 3OD3A 4JCLA 3V7AG 2X12A 4G1EB 4M1GH 3BIKB 4PP1C 5MP6L 2ZUVA 1DBAH 3LKSA 1TQCC 2B0SH 3NCYP 1E6JL 4D94A 1SJMA 1GMIA 5IEHB 4Y0GA 4FHBD 4A6YB 2UUDK 3NBNA 4OV5A 1UXWB 4GQ9L 1BMWA 3QUZA 1RCYA 1MCNA 1DE4B 4K7FB 2E9GA 3IDGB 3PV6B 4GO8A 4BQ8A 3LVEA 2G5RA 2Z4QA 3O3EB 1Z5LB 4XCCL 2PPAA 1PZ3A 5KBNC 3QQ4B 2GC7C 2Q10A 3RTQA 1FL5A 2W0PA 2MJWA 4XH2A 4OD2B 1OAKH 4BGLA 2NLJA 1KLFB 1UB5A 3N3EA 1IEHA 4F1SA 1S9XA 5D7IF 5CD5C 4V1DD 2V7NA 4JKMA 5EBMB 3C09B 4K9EH 1NCHA 3DPBB 5E00B 3RURA 3UTTD 2ZYHA 1D5XA 3O2DL 2DM2A 4PJBF 4OCRH 1KOAA 3H9SE 3HZKB 2F61A 4P4KB 2EO9A 3OGCB 3VW3L 1IL1A 3IKCB 2QT6A 3F7RA 5AAMA 4PJCB 3TM7B 1BOYA 1CXFA 1GYVA 4NLAA 5EU6E 3Q05A 1GY1A 4H8WL 1LK3H 5CHNB 1ET7A 4AQ1A 5CILL 3TWCL 4B97A 2FRGP 3BWSA 3LSOB 3NIFF 1MN4A 4RISL 1IE4A 1EDYA 3LV3B 3QDJE 4LSUL 4ELKA 5TD4A 4K3JL 2FWOA 1HHHA 4CN1A 1TQSA 1ZA6A 3RZCA 3K1DA 4U1JB 2LLLA 2RA1A 1IIIA 3OX8B 5JOEA 2B1OA 3CSPA 2GAZA 1WAPA 2MTAA 5EO0A 1IBFA 3BEVB 1NEPA 1B4RA 2DPKA 4GKNB 2PYEA 3BFQG 3G9AB 4K8RH 3TPUB 3WLBB 2CDGA 3RDTB 3UTSB 4QKTA 4NKDA 4HPHA 4X4KA 5LWYH 4XX5A 1XH3B 3MA7B 3HLAB 4EZMA 4HIPA 2J8UB 2ZTBA 5MENA 2DTML 5C07A 3FMGH 1TQBC 4RV0A 1MHCA 3VXMA 3WY1A 2XTJC 1P4UA 2OTWB 3UBXG 4JY5L 4O9HH 1BXUA 2NSQA 3QEGL 4YC2C 5FM5O 5ANMA 3KPSD 4P2RB 5DT1H 3VDCA 2PO6B 3FQUB 1DBAL 5IMLA 1BQHB 1A65A 5HHXH 4FMKA 3NCMA 3UMTA 2FT6A 4JVPA 1S7UB 1JGUH 4PJIF 1OQOA 4QOKA 1AG6A 3GDCA 2HTLC 1G7QB 4X6CF 5E9AA 1ETB1 4U0RC 2Y7LA 3TT3H 3DARA 3X3FL 1ACYL 1FE8H 1Q8MA 4GAJH 1GCYA 2MTPA 2ZIDA 4BDVB 2YSSA 3B2UD 2EDBA 1HEZA 4YHNA 3KYNA 1VADB 4RAVB 1B3JA 3T6QC 1FCCA 4XVJH 4ZFGL 5EU7E 2QLYA 3NA4A 1JOIA 4MZ3A 3S5LB 2P5WA 1ZTXH 4UYQA 4IBTA 1JF5A 3SOTA 1DJHA 3KR3H 3RL1A 4MVBC 4PRHA 2EO1A 3L9BA 3WIFA 2IH1B 1U8HB 2XNAA 5JQ6H 5JDSB 1V3JA 4BUGA 1IBHA 1T22B 3EYSL 5HDQH 2G2RA 1NCDH 2Z0UA 1JTOA 4HWBL 1DVSA 2GJRA 2XPGB 4KZDL 1X9LA 3CFMA 3FO0L 3VFRB 5IG7A 5C7ZA 2VN6A 3AWGA 2Y07L 2NX5E 4HKJB 2XQBH 3FQXB 5DMIL 5AVZB 2DWDA 2E3VA 4F57L 4QRSA 2N01B 3OKOB 4BKTC 5I74C 4GINA 5MEND 1A47A 1AH1A 5HDBB 3CSBA 1R0AL 2R56H 3OKEB 2ATAA 4LKCB 5F1IA 4F15C 1OAYH 4W70A 2P5PA 3EJYD 1EEZB 4Y2LA 1ZIBA 5I5JA 2R1WA 2PP8A 5GGRY 5DTFA 3SKMA 3ZL4H 2NAPA 1KJ2L 3H0TB 1AR1B 3VUAA 2V7NB 3OHMB 2Q2EB 4HIJB 5J0BA 2BIPA 1AGBB 4JG1L 1WBXB 4J7RA 5LNDA 3BCFA 2BVUA 4GAFB 4G8GA 1CXIA 4HFUL 3PDGA 3F01A 1CFMA 2PN5A 2GC4C 2BIOA 2NYKA 3TEZA 5EZOH 1ID2A 4BK5A 2X4PB 4JRLA 2HT2D 3SQOH 5F0LB 1MJJB 1XSKA 1Z5LA 4AZ8A 3D12B 1AI1L 5KWYC 4P2RD 4JM2C 2ZJSL 4FN0A 4LSQH 2CO2A 3JWOL 5D7LA 1KXTA 1XIWD 3KLSA 3UTPD 4Y5YA 2BSTA 2A6DB 2DQTL 5IB1B 4PGDA 1QLEB 1EZUA 2XFXA 2E9JA 3KE0A 4R97C 4M8QA 3RVXC 1WICA 3SBQA 3SGEI 2AANA 1PEWA 2GITB 2IMNA 5E6SB 4PBDA 3G9VA 1N10A 1NGPH 3HHSA 4OIFA 3U0WL 4TPRH 1TKWB 1MHHA 1S3SA 3D48R 2DY2A 4YHLL 4QRQB 4LKXA 1QFWL 2IO5A 2VZ3A 1BVKB 2WQVA 3BP7B 2JI1A 2XV6B 3C5ZA 2CKNA 2WO4A 1VLXA 1XSIA 1MJUL 1A7RH 3QYNA 3A6OA 1RULL 2AK4E 4I3SL 1U3YA 5FYJE 4W9JC 5ID0B 4NO3A 1N8OE 5FYKH 4J8RB 4ODTH 1M9SA 4D0CA 2OL3L 1KTCA 1H15A 4GW4B 4JE4B 1DANU 4HWBH 4JFYA 5KBDA 1NH6A 2WYTA 4JO8A 4NHUA 2R2CA 2UV3A 4Y8AA 2BX5A 3U7YL 2H1PH 2JQMA 4HAGA 1SJEB 3D09A 1QSED 3KWWA 1ZEAL 4IOFD 5EN2A 4HEPA 3RWFB 1CR5A 2ZSVA 3G04B 5DFVD 3QEUB 2AJXH 3C5JB 3EYQC 43CAA 4IKIA 3LY6A 1M1SA 2FBOJ 2ZXBA 3UBXB 1PD0A 3LPWA 3WXWH 5I5MA 1XCTB 1XSJA 1EV2E 1LJMA 4U6YB 3DSFH 3QH3B 4IHBA 5JW5B 5H37G 5C71A 2FWUA 2JQZA 3OZKA 4R5TA 3X14B 3B9EA 1TUPA 2EXTA 2GCYA 3BEWB 3KH4A 1KENH 2IFFL 5J13C 3QORC 4KK9C 3TM6A 2VM3A 1H9DA 3LD8C 3SDYH 2FUTA 1T3FB 2BCKA 1F8TH 5EFIB 5CD3A 2BIIA 4B95C 5MERA 1U8MB 3ALXA 3CZUB 4Z7WF 5KYYA 2NW3B 4CSSA 1RURL 1ZKAA 4I9WD 2X6AA 3L2MA 4JPWL 2DQDH 1ECZA 3V79C 3HC3L 4OGXL 4PRBA 4HS3A 4XMLL 3FU9A 3HZYB 4F7CA 1JP5A 1F6AB 1TQCB 3BZEA 2JJWA 2MQ3A 3U6RA 5FDYA 3G6DL 3K72A 4WKZB 1ZHNB 1SN0A 1ADQA 4RAHA 5I2IB 3ALWA 2JH2A 3IMSA 5GLYA 2WP3O 1UHEA 3HG1D 5EDXA 1B0GA 2FLBT 4K7PY 1FYTD 2PO6C 4RMVA 3TO4B 1CIDA 1HC1A 3ILPA 1P5UC 3PHSA 1WPCA 5BOPA 5CIPB 2O5XL 1V7MH 4OB5H 2Y23A 1S7WB 1F56A 2C1OB 5DJXA 4QCIA 3MLSH 3O4LB 1H3GA 1U8OB 3JV4B 4G9FD 3RWGA 2R69L 1IT9H 3KGRA 3PWPA 3CX2A 3WKPA 2XXCB 2R23B 4B7IA 5C2UB 5ITFB 3BH4A 1BYNA 3CSGA 2RHEA 2C3VA 3QHFL 4P3CL 4UTAL 3Q9QA 5JHDA 1J0IA 3BFWA 2WUBH 2GTZB 1O75A 4XE5B 4GMSH 5D7IB 3VGGA 2DWSA 1K85A 1AZVA 2GIMA 4A7TA 4ODBD 3GTOA 4Q0XH 3K46A 5CNHA 3VXUA 4MVBD 5DC0A 3ME0A 1E2WA 1NIAA 1COBA 4K7PL 1KN2H 2VITA 5MI0B 2GPZA 4BZ1L 2EC9U 4GSDH 1XSOA 5DRWA 2V3EA 3CG8A 5EUOE 5FWQA 4CU8A 4ALAH 5EU6B 1CE6A 3GKZA 1MF2L 1AQKH 4MBRA 3RAJL 4ZO8A 3U4EB 4OIIH 2ED6A 4OLYH 1L7TL 4Y2OB 1U6AL 3FONB 2OAAA 1BIHA 2HVKB 1DLFH 3S3CB 3ARGB 3U0PB 4LCCB 4N2AA 2EIKB 1BYOA 1D6EA 4N8VB 3VRLE 4ZUVA 5FW7A 1QW8A 3B56A 2WJ5A 2YBGA 1H5BB 5IKCB 4WI5A 1MI5A 1JZHA 4L4VE 1M05B 4HT1H 4F58H 4N0CC 4OF6A 3IBOA 3BH9A 2GCYB 3BEWA 2X89A 3K2UH 3L4YA 3CXHJ 1TQBB 2LE9A 2ODIA 4NQCA 1JF1A 4PJBA 5CAYB 4W6YB 2F7PA 3RZWA 1RZKH 4HUMB 4WU7B 1IB5A 2Z64C 3SPIA 3ZMRA 2PTTA 3CN2A 4OSUH 4MCMA 3VGAC 5I18L 3QJFA 4HCRH 1PKQB 5JW4R 4ZUUA 4MDRA 4D0DB 2XN1A 4UM9D 3ZDZB 1ZHKA 2C9XA 3GIVB 3CGTA 4OCWL 3H3KA 3N1QC 4PRIE 3RWCB 4XP6H 4LCIH 4G6FD 5LUMA 1QFPA 1N2RA 1TPXC 2E4TA 2CIKB 4QAMB 3S8FB 4ONHA 2VWEE 3ZL1A 4X7TB 2DMCA 3V4VB 3BO8B 3RVTC 1BIIA 1T21A 1JS4A <