4L48A

Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
202
structure length
202
Chain Sequence
b'MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
molecule tags Sugar binding protein
source organism Clavibacter michiganensis subsp. michiganensis
publication title Crystal structure of wild type and d78n mutant clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
total genus 44
structure length 202
sequence length 202
chains with identical sequence C
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4l48A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4l48A02
3X2KA 3M3GA 3FT9A 1N10A 4ZM7A 1OA9A 1WHPA 1HD5A 3X2NA 4JJOA 1BMWA 5GM9A 2KQAA 1BW4A 2G5DA 2AE0X 2BH0A 2PJJA 4L48A 4ENGA 3SUMA 2ENGA 4FFTA 2G6GA 1BW3A 2VXQA 3X2IA 2PNWA 3X2HA 2PI8A 3X2PA 1OA7A 4JS7A 3X2OA 5GLYA 3CZBA 4FG4A 3X2JA 3D30A 4JP6A 4FERA 5GLXA 3X2MA 1WC2A 3X2LA 3SULA 5H4UA 2PICA 4AVRA 4JP7A 3FT1A 3SUJA 1WHOA 1L8FA 3SUKA 2GAEA 3X2GA 2JNZA 4JCWA 3ENGA 2HCZX 4FG2A
chains in the Genus database with same CATH superfamily
1MCWM 3MROB 5EO0A 4HOMA 3T4AB 5HHXH 4YXHL 4FL4C 5SWSB 1CZ8L 43C9A 1KGXA 2R9HD 2EH8L 3QGVA 3CMOH 4QRSB 4XBEH 5IIEB 3V0HA 2EDNA 3FOLB 5F3BA 3IR7A 1GH7A 4M9OA 4F3FA 3GTKA 1PZBA 4RAVB 4F20A 3PDOB 3QZWB 4OH2A 5EF1A 4WY7H 3FQYA 4BH7A 3RUGA 4ZMTA 3BW9A 3ULUE 1TMQA 3NEOA 1J87A 5HYIA 3ARXA 4PYGA 3TZVA 1SRDA 4KAQL 2VDML 2YQGA 4N6QA 3RKPA 4KI5D 5I15H 4L8CA 4A37A 4G1EA 4MB4A 1PW3A 5TE7H 4WI2A 4N2FA 1F5WA 1XL4A 4QTFA 4XP9H 3G3LA 3WI9A 4XPFL 3NFSH 4MQ7B 4BSWA 2JIXA 3ESVF 2VLJB 3ZJAA 2XJKA 8CGTA 5IG7A 1NBCA 4HIHA 1JGUL 3GMLA 3P4NA 3TF7C 3DHPA 3GLZA 3TN0B 5I17B 4MX7B 5DZ9A 2J2ZB 3AS1A 4JR9H 1HKFA 1F1GA 3K2IA 3WKMH 1BQHB 4W81A 6FABH 1T21B 3SPHA 4XO8A 4I0PC 4DK6A 2B14A 4G72B 1DVQA 1HAWA 1YNND 3LZFL 3KLKA 4HD9A 4CSTA 3QQ8A 1ZKAA 4TQEL 4GEJA 2IO5A 2A6JB 3HE7C 3EKCA 4UT6L 1Q9OA 3NJFA 3FOMA 3GHBH 3WS6A 2NY4C 3BWZA 4FQXC 5GSVB 3BWSA 1D9KD 1CQKA 3N43B 3LNIA 4JS7A 4TLKA 3H7BA 5BVPL 3STBA 2EIKB 2IADB 4PBDA 4ODXA 1VA9A 4H8WL 5L9DH 4FAAB 1F45A 4LHJB 1JYNA 1A22B 3T6XA 4ZS7H 3G6AA 4LLQA 4X8GA 3MNWA 3RAJL 1NC2B 3B1TA 5GIRB 1TOXA 2F18A 2WLZA 1VEOA 1WT5C 2DQGH 3SSGA 2JJVA 3I6LE 1FZOA 1CD1B 4EXKA 3ML9A 3VMNA 1XR9B 2IPKA 3PQYB 4DAGH 3RY4A 3T2PA 3L3OC 2A7BA 4N2EA 5LGJA 4JFZL 2H5UA 4XCYA 2ITDA 3TNNB 3T5WA 5GJTH 3ZZ1A 4LOEA 4KXBA 5ENWA 5C18A 4HWNA 1A0QL 3HLAB 3V4UH 3VXRB 2I9LB 1A64A 4A68A 3NH7L 2O61A 3QDGD 2Z31B 3EOTL 3JV4B 5I8KH 4JQIH 5IVXE 3GIZL 5IT2L 4Z3HA 1EZVX 5KUMA 1R3KA 1AXIB 5DQDL 3B2PA 1B4TA 3DXAD 1CK0L 3BN9D 3L16A 1ND0B 2Q1EA 5IVOA 3PGDA 4DP7X 4KKBC 1UWYA 5F7AA 2P5EB 5J3HC 1DL7L 3FN3A 2BC4A 5AAWA 3S4SG 4QF1A 3QORA 5JPNC 1R3IH 3AT9A 5L6YH 4J3XA 5IBLC 2I60L 1RUQH 3ARUA 3E3QC 2V7HA 3CZFB 3VI3F 4LSTL 4BE5A 4HLZG 1KSRA 1GC1L 4FG6D 1A25A 4HUXB 4HJJH 1NIFA 5H94A 4PV8A 1IGJB 2NQ3A 5AVWB 4L5FE 3V0WH 1KEML 4IBUA 4JHWH 2QV2A 1J9TA 1JV5B 2AAAA 1AQMA 3FS9A 3ECUA 3NK4A 3NFPB 5H37H 4XMXA 1H6TA 3NN8A 4KXDA 1UXMA 2X6UA 2YAEA 3K8LA 4NXSA 4ODBD 3RVUC 1B9ZA 4XNQB 5DUMH 2ZXCA 4Y2DD 4PLOB 3KL3A 4CILA 1NCTA 1FFNB 1XZ0A 3CQFA 4YSSA 4FFVD 2CUAA 2QVKA 2XQYK 5CCKL 4ELMB 1HHKB 2VUOA 2V4LA 2X70A 4JX0A 3TBCA 5LXGH 1NGWB 1TZHA 1CU4L 1S7VA 2Y5QA 1WJ3A 5E00B 3FUIA 5F9WC 3QJHA 4MZRA 3ATAA 1G7LB 1CYWA 4PGZA 3EO1B 3AG1B 4M7ZC 2NCMA 1GSKA 3OLDA 4XBGA 4HPHA 1FAKT 5C0NC 2GBVA 4PIBA 4X7TB 3NSYA 3RTQA 5CEXA 1TLKA 3LS4L 1LP9E 4UM9D 4MJIB 4WW2B 5J6HA 3HBQA 5IMMA 1N0XL 2MQCA 2G75A 3GTNA 4CW1A 4F92B 1EEQA 3ARRA 4FQIH 1SY6L 3L17A 3OJ2C 5DJAA 5ESVA 4NJAL 5EU3A 3B6SA 1P5VA 5TF1L 2APBA 2TAAA 4XCCH 1I7TB 1GCYA 5DUPL 3FU8A 4GMSH 4HZLB 1I9JL 2WUCL 2G60L 1J5HA 3RIFF 1QSVA 5D5MF 1HH6A 2VLJA 3FMGH 1I4FA 5I74C 5DZVA 4WO4A 4PRDA 4IQHA 3U0PB 1FL3A 1A7NL 4N2BA 5C70A 4OM1L 2EXTA 4A6YA 1G7PB 2LTQB 2K7QA 1BAFH 4R96B 2AQ3A 1YNJD 2AGJH 1DFBH 2C3WA 4CDGC 1LE9B 2EUWA 1ID5I 2CLVB 3NCYP 3HI6L 3MRCA 3FQNA 4AIOA 5HI3C 5E1GA 4JW3A 1B4RA 4IBSA 3LRSB 3H2WA 4Y1AB 2O6DA 2OP4H 3VMPA 1ICTA 1H8SA 3V7AG 4JMNA 2BW4A 3VFWA 1OOAA 1UA3A 4P2OD 3FRPG 1AY1H 2ZP0T 1KXVA 3DUSA 4U1KB 1I82A 4U6HB 1S9WA 3NP4A 3O2WH 4PW9A 1JGUH 5KSVB 4IW4C 4Z8FH 3FBKA 5FO8A 4QKTA 2UZXB 1UT2A 1LM8V 5E1AA 4KDIA 2QSVA 4NZJA 2YQBA 2CLZA 1T5XA 3AACA 3MBXH 3FUMA 1R3LA 1RK7A 1MCBA 3SUJA 1XEDA 4W9HC 1E40A 1TKWA 3MXVH 4OZFH 1TYEB 4BDVA 3QJUB 4O4YL 1QSFE 1UHDA 1EGJA 2DQHL 3ZDYB 1EANA 4PCYA 5D1ZD 5F7LB 4Y4KB 5DS8B 4OCXH 2YPVH 3DJSA 2CMRL 3QEQD 5FR3A 1U2HA 5GHWH 4JM2C 2EO9A 4QRRE 1YPZF 4L9LA 4Y1SA 5I75B 3L3GB 5F1NA 3ZE2F 2FUTA 5TE6L 3LXCA 2BK8A 2RMNA 5ENWB 4GAGH 1CFTA 4IRJD 3FF8A 2CIKB 2FX8L 4XWOC 1IAII 2VJ0A 2KKQA 3MOAH 1UKTA 2R9HC 1U58A 3OHMB 5AW9B 4MJ6B 4NQVB 5IVXB 5JA8B 2FWOB 3VFMB 4MMZB 1QPXA 4K8RL 4X5QA 7CGTA 4XE0A 3BPLB 4M4PA 2CWRA 1I9EA 3ECBB 3CLEL 5CF3A 3E2HB 1KEMH 4DVBA 5JQHC 2BS9A 4A7UA 5EEZA 2DL2A 5ICZA 3QG7H 5ID1B 3DMMB 2CNZA 2W5PA 3KPSB 4B9YA 4HOXA 5EEXA 3QDMD 2XXCB 3BQUA 1NGZA 2Y22A 4PBXA 3QI9B 4JFHE 1SOSA 3OV6A 2C8NA 1ZYRD 2W59A 1G7HA 2WTPA 2Z31A 1DEDA 3IFOB 4HA1A 2P8MB 5GRXG 3ALXA 5I1CH 1DEEA 5T3ZD 4Q6YA 2JCCE 2QZ5A 4X6EA 2G9KA 1DANT 3TWCL 1KUMA 3NPSC 4LP5A 1R3IL 2C3HA 3KPQB 4W9EC 3BVUA 4Z3GA 3P9MA 1HCFX 1F6LL 1BVNP 3P2TA 5I75C 3QZBA 3AXHA 3PHQA 1OW0A 4PUBL 1NAKH 5DLMH 3PDDA 2X70B 3U9PH 3CFCH 3FTWA 5KG9A 1TZGL 4LRIA 4XOAA 1RH8A 3DXAB 4KZCA 4OCNC 4UOQA 4XP5H 2NY1C 4YHYB 1G0XA 1OTSC 2UY7A 3HE6A 4P59L 4PLKD 5CP3A 3SGKA 3U7YL 3NRQA 1KFAH 1MN4A 5DJYB 2ITCA 3PP3K 4E9WA 1OCRB 1ZLWK 5EEWA 5D55A 4HCRL 1OE1A 1WBXA 3QXAA 2P45B 1JZFA 1AZZC 4XC3H 5DLLA 2BNRB 2D31B 2OZ4L 3QAZC 3FB5A 3CSBA 1FFNA 3Q1EA 4HF5L 4OZGB 4OGXL 2VDOL 4UZGA 1HC1A 2JIXD 5ADOH 1EO8H 3W57A 2WZ0A 4XP1H 2ZXEB 1TQVA 4XCFH 5DYGA 5JIMA 1BIIA 3MJ7B 2NT0A 5IFAH 1XWVA 2YUJA 3T8XA 4YPGA 4D3CH 4IHOA 4W70A 4XVUD 4ZMOA 4X5WB 3IMVA 5E9DD 1GYWA 4K7FA 5DD6B 4AUYA 5IREA 5DD5L 1GIGH 1BEXA 4F3FB 3B9DA 3B56A 1CJYA 3TBVA 2VMJA 1A1MA 1WIUA 2H3XC 4NKMA 4P4KB 3SDDA 1KWGA 3VSTA 5IKCB 2HA1A 4RWYH 4FI7A 2UXGA 3MLSH 1BEYH 5A40E 3QH3A 3RIKA 2EVIA 3N40P 4XXWC 4HC1A 3HMXA 2OMWA 4M8QB 3ESUF 1N5AB 4X7SH 4TNWF 5HVHC 2WVTA 2WXOA 5CLZA 3TFKC 2ZSWB 4QHUB 1NBVH 5EBWB 4JO2L 4ALAL 4FG0A 3K8KA 2YPLB 3VFTB 4YSDA 4O58L 4KH9A 3UBHA 2Z64C 3REVB 4OLZL 4HJGA 1LQBC 2FYYB 5D70L 3U0TA 5LKNA 4EIGB 5D9SA 1PG7L 3X3GL 5I6MA 4PHXA 4XHJD 2VPZA 2NLJA 1M7XA 4DKDC 1KTKE 3II2A 4V1DD 1QX1A 2NW2A 4XBEL 5KAQG 2PUQT 4U3HA 4NNXB 4KKCD 1F6AA 3H2QA 4UM8B 5D7SH 3PL6D 1KGIA 5I5MA 3ZMEA 3MBXL 3ROOA 2X4QB 4JO1H 4P2QA 5EG6C 4N0FA 4Y0GA 4ZOAA 1WC7A 3MLTA 4FG4A 1GMIA 2JA6A 3S37X 5MI0C 3EBAA 5KANI 1ITCA 3FKUS 3VD5A 1MLBB 4RMTA 5EPPA 5IVNA 2XA8L 3F00A 5D2LF 4QYOB 4AV5A 4PRIB 2IAMC 4KMLB 1R5VB 1U8LB 2F8OA 1Y7VA 3AB0C 4KUCF 3P0GB 2VC2B 3ES6B 2FDBP 3MV9A 3SDCB 1IQWL 5I5IA 1SMAA 1ZLEA 5DD0H 2QQKL 4AH2A 4FFTA 4OLYH 3SDAD 3S3SA 3T0XA 3X3FL 3F7KA 2WXJA 4XMPH 5KOMC 3BP5A 3U2SA 2ZX9A 1QQDB 5IFHL 4AG4L 1HHIA 4HIEA 5K9JH 1UWGL 5FUOH 3SDYH 5L6YL 4HIIB 3TT1H 4EI6A 4D9LL 4KKQA 2J1KA 4JRXD 2E7HA 3FU9A 4IIQB 4ZFFB 1BLNB 1CDJA 5BO1L 2YAHA 4RZCB 3QQ9D 2GITA 5K9JL 5C97A 2E7DA 2FTAA 2DLTA 2AK4B 3DOSA 5BOJA 2R2CA 3CPLB 5HI3D 1SY6H 2VLKE 3M7FB 4KTGA 1L0PA 2XG4B 3A5VA 4EQ2A 2V8LA 1D6EB 4F7PB 2QEJA 2J1XA 3FO1B 1H0HA 2H6OA 1JNHB 1MAKA 3PF2A 3TBYB 5JMRA 3VFNB 1P2CA 4KK8D 5FO2A 5I0XA 2XIBA 2Y7QA 2MQ0A 1K8DA 1M05A 2NY5L 3RGVC 5F9OL 5C07E 5K9KA 2OL3L 4O2CB 2ID5A 3CC1A 1JDAA 2FYVA 4R90L 4PW4A 5FAAA 3OWEA 1JZ4A 1AR2A 4NQCE 1TR7A 1FYTD 4E9YA 4OCWL 3QI9D 3WNIA 3O45B 4ZS7L 4E9XA 3N2JA 4JZJA 1UQSB 2W60A 4EO5A 3FQUA 4AQ1B 1F58L 5ESAA 4A7TA 4JKKA 1P69B 1EO7A 3ARQA 4YHZH 2X89A 5DJ2B 3MZTA 1ORQA 2GY7B 5CEYA 3KH3A 4G3YL 2BNQB 4LK4A 5GS2H 3MRLB 2DWDA 1FO0A 1MFCH 3T3MF 4HFWB 5GZOA 4UU9A 4HFUH 4N0RA 1K8IA 1Z3GL 5B6CA 3APFA 4FXGC 5DJ8B 3TGXA 2CZNA 4QDGA 2Q86A 2Z4QA 2FIRT 1A1MB 3QXAB 5E08H 5KSVA 5LDSA 5HDQH 1KYFA 3SGJA 1Z5YD 2WNKA 4Z7VF 1T0NA 3UZVA 1OSPH 5IW3A 3I3EA 2EIEA 4YDKL 3S8WA 1GCFA 1FL6A 3DI2B 1OZUA 3H4HA 2M26A 2ZOOA 5DF0A 2P44B 1GZHC 1RZFL 1OTUC 1CF8H 3GSUB 4RRPM 4H0GA 1OK0A 3O3AB 5DO8A 4JRYA 3X14B 4FFWC 4CW1B 4PJIF 1JXGA 1TQBB 3RX5A 3WJJA 1DDHA 1G1OA 4LSPH 1T6BX 4RLDA 4BYHA 1HHGA 3HPLB 1J48A 4PGCA 1JNNL 2EE6A 4GXVL 4JFZH 2PNWA 1F56A 5JHLA 1H19A 5MEPA 1YAZA 4E41D 2EIZA 4NQCD 3JWOH 4HV8B 4OFPA 4X4ME 3E0GA 3BISA 5L4FA 2I9TB 4NJ9L 4NKMB 4NFBA 3T6WA 4K23L 4PJ5B 4Q0XH 4JB9L 3UDWC 2FLBT 4HMEA 1RQ5A 3RDTD 3VFUB 4FCAA 1RU9H 1TO5A 1CZ8H 2C4FT 2AXFB 3TYGL 4QXUH 1R24A 3BDYL 4FHBD 2HFEA 4DFIA 1XTMA 1RSYA 1AGCB 2XZQH 1TYJA 1T83C 5ITFA 1UASA 3JV0A 3WJMB 1BG9A 3S4SB 2X4TB 4ZFOL 3REVA 3C5SB 3WFHA 3GRWA 3DUUB 3FT2B 3M46A 5C2BH 3BAJA 5E2TL 4LF3A 4A7VA 1GJWA 5IFJA 3ZXAC 3IU4H 3UTSA 4LPVA 4X6EB 2K6ZA 3KGTA 5FPIA 2HPTA 5KSAA 4Y4HD 3CSPA 3A3YB 1LMKA 4PRBA 3L3GA 3QORC 3V0EA 3OZ9H 1GSMA 1IFGA 5TDNA 1XDTT 2JE8A 4YVNA 4NZFA 2BWQA 3QDGE 4MKTA 4PRAA 3V7MA 4Y89A 1QLEH 2XSKA 1TCMA 3NACL 3ATFA 2YO3A 2FYYA 4MMZA 4BGDA 1WICA 1I8LA 2OSXA 3NJJA 1V10A 3MCYA 2A0LC 4DP5X 3VVWA 3M8OL 2YGVA 3DBXB 4DP6X 3PUCA 2F1EA 1MHEB 2XV3A 4M7LH 1QR1B 5IW1B 2Y72A 4XMWA 2YD4A 2ZONA 1OK8A 1EVTC 3FJTA 3V5DA 1CG9A 5H35B 3O2DH 2DICA 4CRZA 4XMLL 5MP6H 2QQKH 4X9BA 1KIUA 3HG3A 3MLXH 1M05B 1FJ1B 1ZHLA 3ZE2E 3MACH 3O41A 4NC1C 1UB6B 5AOLA 1HCVA 3X12A 2XWBA 4ODUB 1KYDA 2R0KL 3H3KA 1JGLL 3PWUA 3SDAB 1YPZB 5IJVB 2QSTA 5IQLA 4X5XA 5LNGA 2Z93A 4UT7H 1KLGA 1J05B 1WE5A 2XWJB 4D8PB 2QQLL 2CD0A 2IQAA 2Z91A 3EYQC 3DGCR 5GRUH 4BKLB 4DCQB 3EHBD 1PAMA 4I48B 2AK4A 3EBGA 5DD6A 4WDIB 4Y5VA 3W3BA 2UWEB 1TFPA 2JB6B 1XXDC 2YEQA 2DPKA 4J3OH 2BVPB 1UHEA 3DURA 1YEGH 1PYQA 3HE6B 4L3ED 5C0AD 1S7RB 3WFCL 4NUMA 1RFDL 5DJYA 2FX9L 2CBQA 4UT9A 2HVKB 3QB7C 3EUDA 1UJTA 4JO5A 2FJGA 4MXQD 2IQ9H 1YDPB 4XO3A 1K6QL 4NRZA 4YL4A 5CWSB 3HC3H 2JJTC 1N9PA 1ADWA 1RZGB 3EZ8A 1UTDA 3JYBA 2DBJA 4P5RA 3GSXB 5IEHA 2NX5E 4XH2A 4CRPA 1D6EA 1CVSC 5CP7B 4DN3L 2BRRL 2VR3A 1DR9A 4KFZC 1NBQA 3SO3C 3GM0A 3W39B 1WBZB 2CG9X 3IU3B 2XKSA 3FQWA 4LSSL 1A6WL 2EDOA 2WBXA 3Q6GL 4NKDB 4D9QD 5LBVA 2BVEA 2MHAA 4PJEF 3GBNH 1U3YA 4GRMA 1P5UA 1RIUL 3N1PC 4FNUA 4Y4FA 5E5MA 4C4KO 1IAIL 1L5GA 3NP3A 3KLQA 4MDIA 2CE6A 4PWIA 1A6TB 4RAHA 2TSBA 3WE6A 5IUSA 4I77L 5I1LB 4R26L 4BUHA 2OX5A 1LD9B 3ZLQC 1BXAA 4YFLF 2H6PB 2WZAA 4XNYH 2HTKC 2DQCH 3ARFA 4XP4L 1CLCA 3ARGA 2CCVA 5I1JL 2W65B 4M5ZH 3SQRA 4BFJA 1HILB 5FV1L 3V52L 3RY5A 4P2RD 2EVFA 4DGIH 2JFCA 4X4KA 4TTDD 3SPJA 3BUIA 2JXMB 3V6OC 4BFKA 3S6CA 2DWDB 1MDTA 1NOFA 1CR9H 4Z5RA 1KELL 3BWUC 2RHEA 5F3BB 3FTSA 4JJHA 3Q1SL 3FN0H 4U0QB 5HDOA 4N2DA 3CHPA 3MV01 1FVDB 1IC1A 3QIUB 1A14H 3E6FB 3LEXA 3DK0A 3G5VB 4URTB 2I9TA 1DVFA 2NX5D 4ZFZA 2VITA 1M71B 1G9NC 5IEKA 3U7YH 3MNZA 1QYGH 4G2AA 1PMYA 1A6UL 3UGXA 2GTQA 1J1XH 3P30L 3BCFA 3BEWA 2DY2A 2JCCA 1MFBH 3IWVA 3ECWA 1TZGH 2GCYA 4PY7A 4ABVA 1F3JB 4LPWA 2NY6B 1DVTA 3FTUA 4CKQA 4RX4A 5E8NA 1BZQK 3V0IA 4DPBX 5TK2A 3K8MA 4AV4A 3F7QA 3V4PA 3C2AH 1XGRB 2F7OA 1EEYB 1CD0A 1MY5A 5C09A 4H25B 5F9DC 3EYVA 2Z31C 1OSEA 4KRLB 4C54A 4LL4A 4QRBA 2E9JA 3HG1A 2BE5D 4TSBH 1UXWA 2OM5A 1WIOA 1DZBA 4JO4L 5FF6A 3W2DL 2ZCHL 2VXUH 2WINA 4MMXC 4U49A 3L48A 2ZWZA 4YXLH 4LRNH 1ACYH 1CD1A 2AEPL 4PRPB 2Q8BL 1X5LA 1LEGA 1XGTB 4BSVA 4QJ3B 3SOBH 5AUMB 5GSVA 4D0BB 2A6DA 1CXHA 4X6CA 5KVGE 2D3JA 1L7IH 2WXPA 3X2OA 4JN2B 3CLEH 4LSSH 3K80A 1NGPH 4N5ED 4R8WH 5IROA 4J2XA 4G11A 1WLFA 1ACCA 5INDA 4KRPC 4N20A 3IB4A 3SGKC 3T3PE 2G2NA 5EU4B 4KTDL 1FGNL 2BY2A 3RGVD 5C3LD 4WWKA 1SM3H 1MJUL 2DM7A 5HI5C 1FL5B 4NUPA 4YBLC 2HJLB 4AM0B 4JPQA 3DX0A 2H4EA 3VI3B 1A0QH 3X1GA 3SO3B 4FA8A 2AC0A 1N2RB 5FS5A 4ZM7A 1IZJA 2LLNA 3SGEI 3GPEA 1T7YA 4GBXD 3N1QC 3DOSB 3QNXA 4RNRB 5D2LE 3S7GA 2WBJA 3FK3A 3GI9H 3LHPL 3TPKA 3CSTA 1T1XA 2GSIB 5LGJB 2FJUB 3MRDA 4J5VA 1A2YA 2DKUA 3I50H 4OZ4B 4UILH 4OCXL 3RKDC 2H0PA 1H0DB 1G9NL 1Q0YL 3BIBX 2A0LD 4L8CB 4QI3A 4QO1A 1SFHA 4JLRA 4XTRD 3H9ZA 5JLZA 3SUKA 1RVFL 4WI9A 4AYFB 2FJGB 2QHRL 2IH1B 2EDMA 5L8JB 4TNVF 2ENSA 3M3GA 1MJ8L 2VCOA 5C0JA 1KENL 4XNQA 1A6ZA 1YAIA 4I5BB 3MCKA 4O02H 2VWEC 3NIFF 4NP4L 1NC2A 2VL5A 3KR3L 3L45A 3P4OA 3BUBA 4RWHA 3FUEA 3JV5A 1MAJA 4G8GD 2DTMH 4UB0L 3O2WL 4NIYE 4DH2A 3MDJA 1A3QA 1SZNA 3BVNB 4X0KB 3RNKA 5I73B 1B3JA 3AXLA 3DVIA 4K3GA 4GKSA 2J8OA 3D39E 3D0VB 3BUYB 2VC2H 1A3LL 3OF6A 4KK5C 1D5RA 4XMLH 5MP6L 1JERA 5FUCC 1JPTL 1HU8A 1PQZA 3KYMA 2JQMA 3DPBB 1SXBA 1XR8A 5KEZA 1BXUA 2LVEA 3I9GL 1VFAA 2RGSA 3FOMB 4WHYG 1TWCA 5AL8A 5T3ZL 4OLVH 1E4XL 2IEPA 3VFPB 3IR6A 1UGKA 5EO0B 3N43F 1NFKA 1MNUH 1QAWA 4UT9H 4J8RA 4J3OC 1S7SA 3IDXH 2OMYB 2P5EA 1DCLA 3LNGA 1OAUH 2VDLH 3MV7E 4PD4K 3GMRA 1Q8MA 3GS4A 4X6BA 5A2BA 2HN7A 2J2ZA 4HUWB 4D7PA 4OJEH 3L08A 5K1JA 2BFVH 4BH8B 3OG6B 3HNTL 4N28A 4UOZA 1ROCA 5KSBA 1PX4A 4NT6B 4ZSOA 2XZCL 2YD0A 2HTLD 4FQIL 2V17L 5AENA 3QXTA 4K8RD 2PYFA 3NAAH 4ZW6A 1FC2D 4U3SA 1FWXA 1XF3A 2NYZA 3M1BB 4FNSA 2AZAA 4NO5B 4ABUA 3QIWD 5FCSH 4D0CA 3NTCL 4UQ2A 2XVBA 1MI5B 1FVEA 4PJ5E 4BIKA 5BW7C 3NZ8A 5KW9H 4PGBA 1RUAH 3EYQD 3GJFA 1TIUA 3RBGA 4GQ9L 3W9DB 3CBKB 2FQGA 3LD8C 4KMQA 3DJTA 1U3ZA 2GJZB 4PG9A 2H6UA 2XZQL 1R3KB 4S0SD 1RHHB 2FCBA 1JZIA 1WQVT 3EYOB 3HG1E 2GCYB 4JFEE 1KLFA 1FV1B 4YS4A 3ETSA 1WUNT 3ZW3A 4CN4A 3BDYH 3NSJA 3ZTCC 3WAJA 4IKJA 5CCKH 4YEEA 1H3VA 3MRHB 3PCYA 4P57A 2X40A 1DQTA 4U1JB 1FZOB 3RNQB 2NNXA 2XNAA 3JSSA 1L9RA 1MCRA 4JKNA 5IOPA 1ZAGA 3UBXG 2FBJH 2R0WH 1TQBC 3IAQA 3K6IA 4IM8A 2QKIC 1S5HB 1X5IA 3F7YB 1R7RA 2YAPA 1HHHB 4ZTEA 1NFDA 4GXVH 1M71A 3WY4A 1HOEA 4XN5A 1SBSH 4LCCA 5IJKC 4LSPL 5GGRA 1PCSA 4S2SB 1Q1PA 2YA1A 1X6LA 3KW7A 1AXSB 2AF2A 3WKPA 3PHOB 1P84K 3QDGB 2UVEA 1RZFH 1S78D 1IC7L 4QOKB 1GHFH 4XO5A 3KMDA 5AKVA 3TIDA 1RIVH 4JFOA 5DK0A 1F4HA 5L8KB 4J3OG 4U7KA 2I5YL 3VI3A 4IMKC 3O3DB 1F11B 2N4IA 5I8KL 2HRGA 3IXTA 4YO0B 3HS0C 4PJGE 2VLRA 3ZZSA 1RUKH 2IANE 3H9SA 5GJTL 3L1OH 5D7IE 2ZUYA 1UKQA 1MW1A 5I24A 4JZJC 4LHQB 4P23D 2W0PA 4HALA 1KQGA 1Q9KA 1WEJL 3NYKA 4EVNB 4M6OH 3M1CA 3ZTJH 3WKYA 4R7VA 1Q16A 2KQMA 4XC1L 4MNHA 2NNFA 4JHVA 7FABL 2C9VA 2EXYC 5ABDE 5E0QA 4E42A 3IFOA 4JPSA 5E2WL 2RQ8A 3ULVF 3EZJB 3F7LA 4IS6A 1CZ4A 4NAMA 3GDBA 4Z7OF 2BS8A 3TBTB 3N85H 5D7HA 1ECZA 1YN7A 1XF2A 3A6CL 3KYAA 4WENB 3OVUB 5F3FA 1TJGL 2X1QA 1NANI 2NXYB 5D1XA 4AYMC 1QFHA 2HFFB 1EPFA 1YEFL 3C5ZB 1RZIA 3KVPA 3LEVL 4M61B 4OD2B 5HVGB 1ZLDA 2E4TA 2P8MA 1VGEL 3QCUH 2NY6C 4HKBB 3X2NA 1NGWA 3L5WB 4JDEB 2AQTA 3VGDA 1URZA 1NDMB 3QRGL 2O5ZH 3FW6A 1RIHL 3DRTB 4N4YB 4EZKA 3TEXA 1IGCH 1A6AA 3H0GA 3DJ9A 1MW0A 1Z66A 2WWMC 5CJQH 1SLWA 2BX5A 4B5ZA 1JK9B 2PPAA 2WLMA 1AGBA 3OJMB 3IDYC 1DBMH 1SLVA 4OAWA 4LVHC 3R8QA 1RJLA 5DD3L 1G8KA 1J0JA 4QHKI 4Z7WF 1CT8B 4NHUB 4XVOA 4EI0A 1UVQA 3DLQR 4ZSOB 4L3FA 4DKFL 3VG0L 1T0MB 1NGQL 3BIAX 4JPWL 3ZO0A 4ESKA 4KZEL 1U9KA 1ZVSB 4WW2F 5D93C 4PY7B 3TEYA 1PKQA 1IMHC 1UCBH 3UAJD 4XMTA 2XA8H 3U9UB 1XMEB 3LNFA 2WNGA 5DS2A 3WFBH 1B90A 3ZDXF 1QBLH 2GBUA 2PPEA 3RTLA 4F7MA 2VUKA 3UFIA 4AE0A 1TMOA 3RFZC 1GKEA 3O8XA 4HMCA 2Z34A 5KSAC 3OXRA 4HK3N 2WQ8A 5B1JC 1NBYA 5T1LD 3KXFE 4YAQA 4IU3A 4RGOL 5T1MB 4QMEA 3SY0B 2FBOJ 4K94H 2R23A 3RJOA 1HYSC 1UXSB 4TUJA 3VFGL 3WO4C 1UT9A 5L2JA 3PGFL 5KJRH 1KXHA 4NQDA 1IEBB 3OX8B 4LOFA 2BIIA 4N6RA 1R3HB 4Q9BA 3KPRA 4UTBH 5AKRA 2Q87A 3UG3A 1BQLH 4TVPH 4FLSA 1XVSA 4CAGA 3AVEA 1KGCD 1WISA 3FCTB 1DN0A 1R0AL 2A9CA 1TWAA 3NJXA 1U8QA 2YEZB 3QUML 3WL9A 3LZLA 5I0ZA 1NBZB 5IVXA 2GSMB 1AIFB 3FB8B 3B9KA 3FFOA 4PJGA 3SDXB 3P9MB 4U6VL 1CICB 5H2BB 4E41A 3QUXD 1BW4A 1Z32X 3D1MC 1YEHL 35C8L 4OZHF 4CC4A 3EJJX 5KG9B 1QEWB 2QKIB 2UZPA 3I2CL 4LESA 3F6LA 4WSGA 2HPOA 4PGDA 3NCJH 1QFWL 1WG3A 4ZNEA 3IDMA 1IV8A 3SPGA 2W9LA 1JFQH 2ISDA 1CFTB 1AS7A 4NM8L 4JFDA 5KYXB 2XWEA 2VLRB 5ILTH 3QNZA 2DYPD 4MAUL 3K6FA 3LS5L 4GW1B 4ZDHA 3S5LG 1QWUA 1KJMA 2BS71 3AS2A 1AHMA 2HKFH 3OKKB 2O5YH 2Z1PA 3WCYA 2YAOA 2FWUA 4I89A 1WZ1H 3MUY1 4W9IC 4N0CD 1AOZA 2F5AL 5BV7C 2BP0A 3MOBL 2NY1D 2AE0X 1XZWA 4FXGB 1EFXA 2BCMA 2IDUA 3CC5A 4HWEL 2WSKA 2Y07L 4OI7A 4F57L 1ZT1B 1P84J 2MFNA 3Q7JA 1XGQB 3IDJB 3QPQC 4CVZA 2H26A 4PGJA 5C9KA 3Q3GA 1WVZA 1A6VL 5DMKA 5HJDA 1N7ML 1I1YA 5HY9B 5IR1A 1UACL 4C2MA 1WBYB 4YNYB 5BRZB 4ADIA 2EILB 5KVGH 2LVCA 4QOKD 5BS0B 3QE5A 1EXUA 2P8LA 1HEHC 1IT9L 5DEFA 5DFAA 3FONB 1A7QH 2RH0A 1CXIA 2DQDL 3LB6C 3QZLA 3WLBB 5K9OB 4ELKA 2WVUA 3S36X 3WGVB 4EOWL 3P77A 4TOYL 4LPUA 4YE0A 3OGOE 5H37A 1C5CH 3E38A 1I1FB 4Y19D 4Y4HC 4UV7H 1W72B 4CMHC 1SOQA 1N3NB 2LTQC 2BP3A 3BVDB 4N0UA 4N9GA 4XP6H 4WGWB 1NCBH 4G9FD 4IIQA 1GHFL 1SYVB 4YHPB 5D72L 5BZWB 2CM5A 1NC4B 4TNEA 1PPYA 2Y2YA 3B7SA 1P7QD 1Q4NX 3GGWB 2R69A 4NT6A 5E1HB 1XSIA 3BKCH 3BGAA 1FH2A 3UMTA 3FSWA 2WNXA 1BQKA 2OMXB 1YNKL 4MAZA 2GK0A 3O6MH 2BM3A 4FP8H 1PKQE 2NZ1A 2QQNH 3M1BA 4KOBA 4Z6AT 3GXMA 3LNHA 3VFNA 2Q8BH 3F85A 4LLAA 4JFQA 3QQDB 1ACYL 5CJXC 3VACA 3UTOA 3BKYH 2J5WA 4HKJB 4AVIA 1S9YA 2JA5A 2P28B 3G5YA 1RULH 4LL1A 3X1BA 4HMDA 4QTIL 3HA0A 4RFOH 1O7DC 4HW6A 1SXSA 2YZ8A 4G6KL 3CFBA 3N9GL 4KY1H 3T8XB 5EIIB 1JYXA 1LVEA 3P11H 2KH2B 2QR0B 4JKLA 1J1OL 4N8CL 1QTYT 3V4VH 5LQBL 1BX2A 1FFOB 1VPOH 5M94B 3B9VA 3MOAL 2AABL 3DV4A 4HH9A 4HWBH 4WV1A 3GHEH 2DQFA 2XXMB 3K71B 1DQML 4G7VH 5KW9L 1J1XL 3OTTA 5I66B 1ORSB 3OXRB 1OHZA 2VB5A 3RGBA 3VJ6B 4AW4A 4HDIB 4XB3A 4BHUI 2XXGA 4L4VA 3S88L 4PRNA 5GGTL 2H2SD 2FWLB 2WUBH 3MRQA 2ODIA 3PNWA 4H5SB 5DJDB 4E41E 1IL1B 2YXWA 1JRHH 1F6FB 1R3HA 1W72L 4J4PD 2CUHA 2X88A 3CH1B 5SV4A 1RV6X 3S2AA 2BY0A 4HLJA 3W9DA 3VU1A 4R2GB 1K83A 2EO1A 3P2DA 4HXBH 2AHIA 5CO1A 4XVSL 5EZOL 4AVKA 5FGSA 4Z1PA 1RURL 1ZDSA 4JFSA 4J4PA 2JIQA 1L4IA 1RLWA 5AVQB 1PBYA 1E5YA 2RQEA 2ZUQB 3K0YA 3MRNB 5DO2C 1GOHA 2NW2B 1VENA 2BHZA 4NGHL 1A9BB 2AJSL 4IU3B 2GTWB 5CGYD 2YU9A 5I19L 2P80D 4HUVA 2IDQA 5IROC 5HVHB 1ZVSA 3S48A 5KS9F 5IOPB 5F7FA 1MREL 1S7WB 2Q3XA 2WO4A 3U1PA 1XGUA 2PP7A 4PR5A 4WFHE 1KULA 3KJ6L 3BQVA 3FSZA 1CIUA 3SIKA 3UBGA 3C60A 1CBVL 2IFFL 1N59B 4FLHA 4WCYL 3JZ7A 1NIBA 2VZTA 4O2CA 5F89A 1CGVA 1F8TH 4M7JL 1A7NH 2E7BA 1PD6A 1JGDB 3CDYA 3TBWB 3HHRB 1XIWB 2BMKB 1TSHA 3M45A 3RGVA 4MS8C 4MQSB 3B7YA 1ZVHA 1TVHB 3PPSA 2X89D 3QWOB 5F72S 3BMVA 3QDHA 1JJUA 2MPAH 2WJ5A 1LO0L 4HJTA 2OV0A 5D1QD 4RMQA 1FIGH 5I74B 1ZLWH 3VD1A 3ZHKA 3O6KH 2I7OA 1MCFA 1XGYL 5AOKA 3V0DA 3AFLA 1E5CA 2VH5L 2P5PA 3DX9B 4C8XA 1DSYA 4LGRB 1UWXH 3CN1A 3EJYD 3CF2A 3LV3B 3SE8H 2DLGA 2D3LA 5B38G 3BVTA 4HFWA 4ZUSB 2YFNA 3P1VA 3QUMB 3KNBB 4GW1A 2QMJA 4ZDHB 3ZYZA 3B2VL 1KG0A 4M1CC 1YEGL 2MTAA 2WKOA 2P52A 3V5DB 3ZL1A 4L4TB 2EEFA 2OPCA 2MPVA 4GKZB 2XU9A 5I8EA 5I76B 2AEIT 1MWAA 4KQ3L 1FZJA 4Y2OB 2P9RA 2OR7A 4FXGA 4EVNA 2CHXA 2EKSB 1ZGLB 2CNYA 4ODVL 1M7DB 3R7QA 5GRUL 5C3IA 1L6PA 4EZLA 4YMPA 1QSEB 1QNZL 5DHYB 4A6YH 1JZGA 4JFPA 4K2UH 2FECL 2VLJD 3IJEA 4RZKA 4YOKA 3WEXB 1ID2A 1T2JA 4GUPA 4JFDB 1AFVL 2JKWA 1DQQB 1KTLA 4YSPA 4F8NA 5A16A 1TTBA 4PS3A 4PW3A 5TQ2L 3GTJA 4GIOA 4G6JH 3VNYA 4C83A 3UJJL 2ARWA 2IBZX 1A6PA 1I1CA 3J8F7 1S7UB 1B2WH 2AXWA 3B34A 5HYSB 3EJSA 4TSBL 4RSVA 5DYOB 2TRYA 4H8QA 2J43A 2OMTB 1S7TB 2VQ1A 5LAXB 3MR9A 4JZJB 1QTPA 4GSDH 1CB4A 5F0LB 4PJ5A 1PGRB 4JZNB 3VXTA 2CR6A 2X4SA 1YMHA 4FGMA 3R06A 2B2XH 4YHKH 2WBJD 1LEIB 1K9TA 4FZEH 4LASH 4FG2A 4HXBL 3CE1A 4G5ZH 3SBQA 2UYLB 5MEOA 2WYZA 3GF8A 2BNUA 4JM4L 1NCAH 4LCUB 3RL2A 4FQCH 3LMJH 1BFSA 1S9VB 1IJNA 2EYRA 4UU9B 5FHBL 3OKNB 2DWXA 2OMXA 3HEIB 1CDIA 2MNWA 2DYPA 3PDOA 3QZWA 4QIWA 3SB3A 4E5XB 5I1DA 5BRPA 2JKSA 2G75B 1XF5B 1ZVNA 2DF3A 3BW9B 3CHSA 4GT0A 4UAOB 2HSIA 2LQRA 3W5MA 4EQ3A 2VDQH 4GRMB 4YDNA 3PQYD 1T3FA 1O7DE 2OTUA 1V8HA 2AJVH 3GTMA 3GSQB 4S1RL 2FIKA 4R7XA 1RMFL 1YDPA 2ATPA 3SBWC 2KHAA 2OSYA 2XICA 3IMTA 3KL5A 4MQ7A 3CXHJ 3ULVL 1LO4L 2PJJA 1W8OA 2UWEE 4HVBA 2AQNA 4GA6A 1J9QA 2V2XB 3PAYA 4RAUB 4LLMA 2VM3A 2X0UA 3FOLA 4DGYL 4MD0A 1FFTB 2PCPB 3HTLX 4XNAA 4MXVF 5H4UA 3CFDB 1T7WA 5IJKA 4HAFA 1ZRUA 1MRFL 2WKLA 1C5DB 5K39A 3DSNA 4KMTL 4NZRL 3NCMA 4W9CC 1IFHL 4KX8A 5KANG 2DD8L 2VLRE 3L9RA 1T66C 1KCWA 5EZLB 3IGAB 1V3JA 3JWOL 1QWNA 1RD6A 3T0EB 1JSYA 3MKKA 1YNLL 3VD9A 2F19H 3OAUH 4OT1H 1MFDL 3QDJD 5FO8B 2B39A 4X99A 1RP9A 1XH1A 1A4BA 4I3SL 3O41B 3RWEB 2CLZB 2A38A 2R1WA 2ZYHA 1AAJA 3LKPA 4OD1L 1J05A 2CKBL 4PH8A 1K4DB 3DYOA 3O3BB 2WO2B 3SCMD 5L0QC 5BRZA 1GGYA 3GBLA 4MTMA 3M6DA 1BWWA 3ZE0E 3G6JA 3VXNB 4ZAKC 4NRXA 4J6IA 3UBFA 3FYEB 5IY5B 3CIAA 5BV7B 3LZNA 2GTWA 5EU6D 4X4YB 1BDYA 4KAQH 1U8PB 4UOW1 3PWNB 5LGYA 5IBTL 2IV2X 4J6RL 5IQ7L 2BSTA 5L88L 4O51A 2A9NL 2MWCA 2NY5C 2A9AA 4I88A 1DQKA 4OQTL 4CADA 1MHPH 2VXQH 4UM9B 1D7FA 2XFXB 3Q05A 4YSEA 1ADQL 2YEVB 1RK1A 1ET8A 2VISB 1MCHA 3I9AA 3MNWB 1BMWA 2E7MA 1JXJA 3AREA 5B8CC 4JFFD 1JD9A 2FGZA 1HDMB 3C8DA 1JTPA 5CJ5A 4LO9A 4X8CA 3TH3T 4FA7B 4ZTOL 3GTOA 3EH3B 1OA7A 2BNQD 1ED3A 3FU0A 1IBYA 3DIVA 1IKFL 3H54A 3MRIA 4Z95H 3I75A 1XGUB 4PR5B 3O6LL 4UANA 1BWMA 1TPXB 5HTSA 5CGTA 1I9IH 5B38B 3QIUA 5H94B 2MHAB 3O2DL 3FHAA 5D1XD 4UTBA 3BT0A 4KK9C 4NM8H 2LU4A 1ZPUA 5C86A 4OUUA 4D0DA 3AQXA 4L3EB 4ZW3A 2CHNA 2IQAB 2XQBH 2YXFA 4GSQA 3KJ4B 5EPMA 1YEHH 3Q48A 1J10A 3CHRA 3MODH 3KPLA 2A73A 2D3VA 5F1IA 4JJ5B 1X4YA 1QLEL 3CFKB 4PJ8C 5ESVB 2VW4A 3THMH 1BXXA 3N91A 1DVUA 4HXAH 5LAPA 3ZSSA 3MRMA 3WNMA 2O6EA 2ZWSA 1R33A 4OZHA 3WIAA 1UOVA 2NXYD 4PSPA 4ZFQA 4I4WA 2H2PC 4CDHA 2K4AA 2K9UA 3P3UA 4PJEA 3TN0D 2PW1A 4KXAA 2KPNA 2R8SH 2QJDA 3KNBA 3CQPA 3KW8A 4OZIF 1ZXKA 3A6OA 4FNLH 3V6OA 4PRPA 3CXDL 2DQJL 3L5JA 4FE9A 5D7JC 2XV0A 1E50A 4G1MB 4XR8C 3VRLE 5F7EL 4P06A 4TLUA 2A68D 5HJBA 3CHXA 1CTMA 3O8XC 2FO4B 4YQXH 1ZHNB 2D03L 3HR5B 4ODSH 4MCZB 3BKJL 5L2KE 1B9KA 3IPEA 4K5PA 3ZRCC 4YR6A 1WSST 3NZHH 3U46A 3BKML 1Y6NR 3CQQA 1LO2L 1A9BA 1DHKA 1LGVA 4E9SA 3VQMA 2WBJB 3QEGH 4W4NA 1EEYA 3SKOA 1DQLH 2R92A 4HX1B 1NMBL 1SHSA 2JQZA 3K72B 1TQCB 4ZK8A 5TK4A 1A65A 3DSNB 3G5VA 3LIZA 1CTNA 2XN9B 1RK0A 3MLZH 4HCFA 2HJKA 3CVHH 3T2LA 1BF2A 2R2BA 3K0WA 1TQTA 5DS8A 4UTAL 1IC0A 5EU3B 1HE8A 4NQDD 4PS4L 3TX4A 3M88A 5D70H 3UZQB 3GXUB 1EAPA 5AG9A 1S9WB 3GQFA 4D0BA 4LIQH 5DJDA 2JCCB 3LTVA 3QDMB 4RESB 4I8DA 3ARSA 5CJQL 3RWEA 5D7JB 2E56A 4MD5B 5FKPA 1E9QB 2ZE0A 1T5XB 5AD0A 3RHWF 5C1MB 5KSUA 3RIAF 3X2MA 3MLYL 1AHWA 5ACZB 5I6XB 4LEBA 2W9EH 5ESQA 5JW5A 5ADPH 1WGVA 3G9AB 5E2VL 4XMZA 3GMQB 4OF8A 1HXYB 4UNVA 4WLCA 1TPXC 5DJ6B 3QEUA 3NCXA 2IBGA 4HK0B 4DVBB 4QRUB 5A2IH 5KWYC 2ADGA 2YARA 3TYFA 5GM9A 1WA0X 1NGXB 1SFOA 1J9SA 4XNMA 3HS8A 2WBJC 1ADQH 2EKJA 3NJGA 5EIQA 1NEZB 1LJMA 2FJHA 3JTSA 2CSPA 2ZF8A 4IYKA 3BQUB 1GYAA 5FA3A 4A38A 4N2KA 1U41A 4ICWA 2MTPA 1MF2H 5EC1A 4Z0XA 4U1MA 5K1VA 4HWBA 3G5WA 4G7QB 4IKIA 4OB5H 3QC6X 1YA5A 3PU7A 3Q44A 4L18A 4LVOC 3RGHA 3OXSA 3LEYL 4APQA 4HCGA 3U25A 5B39B 2BCKA 1U36A 4JAMB 4XTRC 2KLSA 3ETBJ 1H3PL 5EOQH 4ZMVA 4JFOB 4I0PD 1T22B 5L4JA 2AQ1A 3F7YA 2DH3A 3JWNC 4E9RA 1BXVA 5E4AA 2G4EA 1OD9A 4JZNA 1EMTL 2FLMA 3WDHA 4GINA 3ZBMA 3H3BC 3H9SB 3ZKMD 4LCCB 3ARBA 1G6RB 4MJID 2XKUA 2OFQA 1ZE3H 4L4TE 3BWAB 2JIMA 2B59A 5HPOA 3UPCA 4PWHA 3U6RB 3TNMB 2ZXGA 1KLFB 2Z92B 4I18C 2JTDA 1FZJB 3ATBA 4UV4H 4Y2OA 4LDEB 4E36A 4PJIB 1WAAE 2CXKA 2YOAA 4N87A 5HHOD 1MPAL 4QNPE 3RNQA 4YHLL 3L1GA 4G8IB 1N6QH 3EFDH 2PABA 4JGMA 4R4BA 1NEPA 1ET7A 2JTYA 3WIIL 2HT2C 3J07A 3NRFA 3OPUA 3P73B 4R4FL 3JTTB 4Z7VE 2QPSA 5BVJA 5DRXB 2PKDA 1WWCA 1PY4A 2KC0A 3QR1A 2GJJA 5KS9A 2HVBA 4M4RA 4LLYB 4TM9A 5CHNA 3ROLB 5F7KC 2G2RA 4L4VE 4ZMWA 2ATPB 4NUJA 5AAMC 2HKAA 4HGKC 1Z5HA 3QG7L 7PCYA 1MI5A 5D96B 2EDFA 2AJZA 2LFGA 1A02N 1HHJB 3FQUB 4XXCA 4AQ1A 4WI3A 1FH5L 4TUOB 2EDTA 4DERA 4EDXA 2GJRA 4EI5A 4W9GC 3SZ6A 1R3JA 3CZGA 3D05A 3QG6B 4K8RH 3PV6A 4DQOH 1YQVL 1WWWX 4YSAA 1S3KL 3VWKB 5E5LA 5C8JB 4WNSA 3T0DA 5EOCL 1QRNE 5K39B 4AEFA 3DSFH 43CAA 2IJ0C 2Y25A 4LCUA 4XPHL 4YXKH 3JVFC 2DS4A 3LMJL 2X05A 4BKSC 1OGTB 1KZQA 2R56L 1J0KA 1CI5A 5B1CA 1R17A 1E43A 2V3FA 4X0NA 4Y4KD 2BZ7A 2W0KA 2YPVL 3T6VA 4YHKL 3QUKA 1HNFA 3VXUB 3U7AA 3G5ZB 3GFUA 4YZWA 4MWFA 3MXVL 1NKGA 3MNVA 4OFQA 5D2NA 2DYSB 3T0AA 2Q2LA 2OW6A 4LMQE 5F97E 1KDIA 1SN2A 2XLLA 3CDGB 1OSZA 2A6KB 2VDLL 4L29B 3BT2L 2ERJC 2WMPA 2YAQA 4I4WB 5KYUA 4G6JL 5C0EB 3VH8A 3BH9B 4JDTL 1W16A 5KVFH 4NYLA 2CU9A 4KZ0A 1SMOA 4RWYL 4K3JL 1KN4L 3TEZA 3QHFL 1U8PA 3T8VA 1BQHA 2VMEA 1IGFH 1F11A 4LU5H 4FJZA 1LO5B 3MRGA 4X5RA 1I85C 2WV3A 3AGWA 3HI1B 3PL6A 3Q13A 2XN9A 4L37B 2CKBA 2EYSA 5I0WA 2PN5A 1KBVA 3FT1A 1RZKH 3PPEA 2JB5H 2XX0A 4FLRA 4PS8A 2ETWA 4WKZA 2P48B 3L3DB 3HBZA 3OKMB 4P5KA 5I82A 5D7IB 5IMKB 2AJYH 4GXFA 5DZPA 2XN9D 1AXSA 3HAEG 2HLAA 4JHAH 2VLKA 2WLLB 1WC7B 1B3IA 4PWJA 1ZTXH 1ZT4A 4JFHD 3GSNB 6CGTA 4PJFA 4DZ8B 3DYMA 1FCCA 2G2PA 5DRZA 3SE8L 4ADJA 4BFIA 3MRIB 4N2IA 1QLEB 4NQEB 3O6FB 5CMAA 1YNTB 2X6CA 1AGBB 5E6RB 5TPWH 2YPVA 5I0VA 4DK5A 2B63A 4IOFD 1T21A 2HJKB 4LCYA 5E7BA 1IRAY 3SJVE 5SWSE 5J8OA 1UM4L 1NCHA 4TF4A 3OJDB 1U8CA 3WUZA 2A77H 5L2JB 4JKMA 5FYKL 4ZMYA 2LGNA 1U93A 1B88A 1U4FA 5G4MA 1KPRB 4KK6C 5E8PB 4BGLA 5DK2B 1RJYB 2C9UA 4P2OC 2FH6A 2I9LA 3RJQB 3Q5OA 3TT3H 3WO4B 1VRSA 2BY3A 5D1XC 2EZ0C 2HJFB 1AHWB 5ACZA 3ZTJG 4HETA 3TJHD 3KCWA 1EJOL 5DLML 3VTTA 3MRMB 3T4YA 4PCSA 2PCFB 4JN1H 1C12A 3FN9A 4NKIH 4UYPA 5IV2A 3HG4A 1KNOA 2JKTM 4E9TA 5BQ7A 3FO0H 2EE0A 3BH8A 4KU1A 3B9AA 5TH2B 3GO1L 2MCPL 1M6UA 4FULA 1IGIL 1FRGH 4Y9FA 5D5MA 2A6JA 5KVFE 5AAPA 3QEQA 5C08E 3JWNE 3B8YA 5JZ7D 5GSRB 3WIFA 4KHXL 3ZO9A 4HPYL 1WFIA 4YXLL 4JHWL 4A7QA 5AYUL 3WTTA 2CBOA 5D1QE 3VFRA 5GS1B 2EDBA 4Y1AE 3ZYIA 3ARBB 2B08A 4UMSA 3H42L 4X9FA 3ZGHA 1SOXA 2GFBA 1PZSA 1TEFA 1GGBL 1AIFA 3FB8A 3W1ZA 3TOPA 3IETB 5GZND 3MLPA 2B4CL 3CC5B 4OD3H 5IK3A 3UX9B 5GGTH 4XCNB 2BIQA 2Y1VA 2CO4A 4ES9A 4PEEA 2GHZA 4HIXH 1O7SA 4B53A 4ICXA 3BPOC 2EDXA 3QZWG 4L0PB 5I8CA 3CFJA 4KLNA 3ZKMC 1AQDB 2I25N 1MIML 4YSQA 3U7WL 1T22A 3TBYA 2GW5A 3RUGB 1U8MB 3BGMA 4ZYKB 3IRCA 1DUYB 2H0EA 3HI5L 3SKUD 2CA3A 3SBWA 2D4FA 4OD2A 4BXSV 4M1GH 5GLFA 1NA8A 2PR9A 5CN3A 5D2NE 3QSKB 5AOJA 4YPJA 3RFZA 2ENYA 1XF4B 4WTXA 2XTJC 3ZZLA 4W9ZA 4ZO6A 5LWYH 4MJIA 4WW2A 5E4EB 5T1KD 4RBPH 1KZYA 3AU0A 3GIVB 3QUZB 3BPCA 3ZHDA 3OMAB 2X4UB 1TJIL 2WXMA 3PP3H 3L4CA 4Z76B 3QJFA 5E8OA 3FZUD 5IMLA 1LL1A 1M3IA 4A2EA 3QRFM 1AVAA 3CDGA 5KVMC 3W0WE 1CL7H 4XP4H 1L0YA 1OAKH 5DWUH 4HIJA 1G0YR 4YDVB 3BRGC 1G7LA 4OCYL 5DJ6A 3RDTC 3CVIH 4YAQB 2LHAA 4LSQH 4QRUA 3ARTA 2WN2A 4U0RC 4AJVA 1T04A 4RAVA 4EN3C 4TRPH 4CC4C 1UD3A 3BDBA 1MCCA 3FCBA 3HFFA 5T1LB 5HBBA 4TQEH 4F9PC 2YAFA 3HRPA 3VB9A 5CGMA 3C6SB 1XEUA 1CFMA 1FVCB 1AGEB 2AK1L 3QUXC 3TT3L 4PJAA 3B6SB 3EW3B 1EAJA 2KLRA 2VABA 4Q2ZA 5FGBA 5TQ0H 4NOHA 1R24B 4AEHL 4JG1L 4TULH 3OF6D 1F2QA 1HEZA 3EO0B 3T77B 2WBWB 1DYZA 1SJXA 2YZ1A 1RCYA 1INEH 5F7NC 4ENEC 5J06A 4R3SB 4XCCL 2B3RA 2WIMA 4M5SA 1XCTB 5AZUA 4NKQB 1FYHB 1UXSA 1IC5H 1F3RB 1YEJH 1NUFA 5BV7H 1D5BA 4U6YB 2NNAB 5IHUL 5J3HD 3UTPE 3RVUD 5DEGA 4G43B 2QVFB 5CS7A 2DJUA 5SWQA 4YX2L 1DJZA 3VI3E 2CGZA 2YHGA 2BW5A 4M6NH 3D3VA 3KVQA 2ZP8A 4IKKA 4TSAL 4R5XA 3UYPA 5F9WB 2UY6B 3IPFA 5IBUB 5AB9A 4CGUB 4WY7L 2E7LC 2R59A 3CG8A 3QNFA 1ZLVK 4PJCF 5D5ME 3TIEB 5EF2A 4PJDB 3SCMB 3JVGC 3CH1A 1ZHLB 3NPSB 2M1KA 2VJXA 4YHOL 3QIUC 3LPWA 4N1HB 1NM9A 4V2BA 1P4LA 4JVPA 4ERSH 2H26B 3MRFA 2ZNXA 3NJLA 4MRBA 3P73A 3LZPA 4M7ZB 5IV2B 5IB2A 2XWJA 1YNTA 3H3PL 1WBYA 5D1QA 5IHLB 4NO2B 3VFOA 4Y1AA 1DBJL 2AQPA 2G9HA 4XNXL 4UIKH 1OAQH 3UPAA 1W6LA 3U6XS 2IPTL 4BFGA 2XN2A 3Q9PA 3V4PL 5K9OA 1I8MA 5DA4A 3D4GA 4WK0B 5TE4L 4PJ8A 3T6ZA 3V6OE 4Y1TA 1HNYA 2GAZA 2WXIA 5LGKA 3OMZA 5JPNB 3V2AR 1N8ZB 1J8HA 2CO7A 4YHML 4KQ0A 2Y06L 1RZ7L 5E9DA 4PJCB 5FWRA 1CQYA 5TDNB 1HHKA 4DZ8A 1N5YL 4LT7A 2FSEB 3MV9D 2DBLL 1YNTF 4Z7IA 3KPMA 3D09A 5CJXA 2NVXA 4HHAA 1KJ2B 3QULB 4WFHD 2YWZA 3BD3A 1KPVB 1QRKA 4U1GC 1IBGH 1JPST 3NIGF 3SYOA 2AKRA 3QQ9C 2EKSA 4LSVL 3T0EC 1ZGLA 2CHZA 1JZJA 2FGWH 2I7SA 5ALBL 3NJKA 1A9EB 5BRQA 1U8CB 4MS8D 2VNCA 2EZ0D 3QFJD 1YYML 4KRPB 1E27B 1NGYA 4PG2A 3L54A 5CILH 1ORSA 7TAAA 5KN5B 2R4RH 4G80A 1BOYA 4F24A 1Q0XH 3U30C 1N18A 4N8UA 3VFSA 3WGUB 1FH5H 2J4WH 1TF4A 2N56A 2VXVH 3FUJA 3NN8B 3W0WA 2FO8A 1P53A 2GFBB 1IVLA 3Q01A 4LLVB 5JPMB 3EF7A 5ACLA 1KNOB 3NABL 3GI8H 2Z91B 3N06B 5HYJB 2IWFA 3ULUH 5HGBA 3B7RL 1X9QA 1ZV2A 3P4OB 2L7EA 3Q2VA 3U83A 5FW7A 5FYJD 3WFZA 4DP1X 5EO9B 1FCGA 1B4LA 2A1WL 1UZ6F 2DQJH 5FYLL 4CJ0A 5ID1A 4OQTA 5DA0B 1Q72L 4IDJL 5GGTA 2H41A 3UYRH 3QEQB 5I30H 1AQDA 3MV8E 4PB0H 1IAKA 4JFXB 4J1UB 3KPSA 4B96A 4DSYA 1E6JL 1XGZA 4OFDA 1JNLH 1LO3L 1F18A 1MPAH 2NUPA 5B3SB 4OJYA 1YY9D 3ZL2A 4J4PC 4S0TD 5TDOB 2F08A 2YD8A 3HNSH 1IGCL 4XBGB 2IDCA 4HJIA 1ZGLM 5DMYA 3ARFD 3TV3H 2B0SL 2B1HH 5DZNA 2OJEB 4DP9X 4LLUA 5C08B 3UCRA 4F2FA 5MERB 4Q74A 3D18A 4ZFOB 4L8SC 3GSXA 4KO9A 1UCTA 3BZFA 1IM3A 1UOWA 3PXJA 4BFIB 2WZPD 4HUCA 4L1BA 3K46A 5JOFA 3MI6A 1P7HL 2XI9A 5CIPH 5CJBA 1ZSHA 3UTTA 3L6FA 2HWZH 1H3PH 1X9UA 5EOQL 5SWZD 2ZX8A 3H1ZA 4X6FB 2GPZA 5LNEA 5CCGE 4CN1A 5GGUA 4PB9H 1QLFB 3UIZA 3OPZL 2RAMA 2NXYC 3GSOA 4XN2A 1UUNA 4DN4H 4RAUA 1L9SA 2B1AL 3QVAA 2VE6B 3NJMA 4WHTB 4G6ML 3LEXB 3FB5B 4N9OB 4G43A 4X6DE 4NHCL 1FFQA 1C7TA 5ERWA 5FF6B 4IOFC 1L7TL 3H6JA 5JA9A 2O6FA 7FABH 4HEMA 5F89B 3L9RB 3B5HA 2BXZA 4XHQA 1YC7A 2ROXA 2VXQL 1YEKL 4P5KB 1OA9A 2AJ3A 2CPCA 4U6HA 3BPOB 2ZPKL 1MDAA 3QWOA 3BH8B 2WWMD 5FFLA 1KC5L 3BJ91 4N86A 3HRZA 2N59A 3GSNA 4JRYD 4LCIL 4HUVB 4K5LA 1KTBA 1A3ZA 5BNXD 5EZIH 2AFNA 2NXZD 5DVKA 5EB9A 1FF5A 1T04B 4MA7H 4NQEA 5EORL 2WLIB 1IEHA 2MJWA 5E6ZA 5T1LA 1W15A 2D2CC 3ABGA 2H45A 4AL8C 2VUYA 4POZD 2HWZL 1Q0EA 3EH2A 1XSOA 3C6EA 4MD4A 3U4BH 2JI2A 3IMUA 4H26B 5EBLA 4I0PA 4GSRA 3S36L 1JPSL 2I32A 4IIZA 1MCOL 5DUBA 1OSYA 1V7MH 2PPDA 5FB8B 2YJLA 2K6WA 4Q4IA 3QJQB 3BP5B 5LAXA 4ZTPL 3WNJA 2X4QA 3DX8A 2PI8A 5LJYH 4XCNA 4PV9A 4FQXA 3FRPB 1KEGL 1R34A 2X4SB 4QO1B 5JLZB 1DBBH 4A63A 4NZ8A 5JORB 1P7QB 3QRLA 4EKJA 3TM7B 5JYLA 2J5LB 4CVWA 1IEAB 1KJ2A 3HNSL 3FT4A 4JY6B 3RX8A 3RU8L 4IBVA 1KGWA 2GAEA 1KB5H 2EADA 1RK1B 4P9MH 3K1DA 4AI7A 1JNLL 4AYGA 4BQ6A 1D7CA 5AAMA 1KF9B 3IRZA 3CPLA 2ADIA 5KAQF 12E8H 2JI3A 5TFSH 1V55B 1NPJA 3H7LA 5A16B 1BM7A 4C83B 1I3GL 4IRJA 4WHCA 1HESA 3B9KD 4WW1A 1IQDB 4JFDD 3PWNA 1RZJL 1VF5C 5C71A 4JVUA 2OMTA 2UXVA 3TIEA 2PP9A 4L1TA 4B9GA 1IQWH 3F7RA 3FUNA 1NLDL 4APXA 4LOUD 1O5PA 3MLTB 4QY8B 2J6EH 3UXFA 5INDB 5T5FH 1FHNA 4YHNA 1ZT7B 3MV7D 3SHSA 1U3JA 3PIQA 2VZUA 1S9KC 1UFGA 2VQTA 2YPLD 2YR3A 3H85A 3ZE1E 1CD8A 3QPKA 5E99H 3HG0A 1O7VA 2V0AA 4MZ2A 3RPIB 1T1ZB 3CSYA 4OGAD 4ACPA 3EOAB 3MV9B 4Y9EA 5CILL 1S3RA 5GGVL 4M43L 3GTPA 3WUWA 1OXYA 4EZJA 1CL7I 5T5ID 1DQDH 4I85A 2FD6H 3ULSB 1A1OA 1RUPH 4M5YL 1NEZG 3KAAA 4J28A 5JPNA 2WVSA 1U8MA 1F02I 1RJZA 1IBBA 2FRGP 2YA0A 1X7QA 1YEWA 1D9KA 3DIFA 3DPBA 3QPXH 5KVDH 1OL0A 4Z3EA 3IJHB 4G9FE 4U1HB 4WTWA 3WG7B 3W82A 2VN7A 4MNQE 2NSXA 3ECVA 5JW4R 4JRFA 1D5ZB 2PWEA 4UCFA 2DI8A 1YEEH 2QADD 1A7PH 4N2LA 1BD2E 2VTFA 4Q56A 5J5EA 4L1SA 2R0ZH 2BNRA 2D31A 4NPKA 4KDVA 1NMAH 4RV0A 3AMLA 5DHVB 5DVPA 1OP4A 4PRID 2FEEI 1T0NB 1CBJA 5HYJA 3CFUA 1WCBB 3W5NA 3LRLA 4QLRA 2DL9A 5EBWA 2MCMA 4PJXB 1QFUL 1HQ4B 1LQSR 4S1QL 2DKMA 1AW8B 2NY7H 1G9MH 1VFOA 2O1AA 3KJ4C 2Y1ZA 2L3BA 2YS4A 2W07B 2D73A 4FXKB 4RISL 5DC0A 5F6HJ 3UJJH 5IZ7A 4FFZL 1Y0LB 5FKAA 5JXED 3KYKH 2AI0H 2QTVA 3RL1B 3OQRA 2XPGB 1AXTL 1KJ2H 1NQBA 4HC1H 5AKTA 5K9KB 4DETA 3RVVC 2EABA 2OTUB 1UA6H 4H88L 3KYMB 3WDIA 5I18L 1ZS2A 4B5EA 1JWMB 1X5JA 1LK2A 4L1DA 4U3SB 1MJJB 4NNYA 4UINH 3DVGA 3MBWA 4ZW8A 3LRMA 3OGCA 3S2CA 1FBIL 3RWHA 3UADA 3H9HB 3DPDA 1RVFH 2Z65C 3PG2A 4X6DB 4OV5B 3CLFL 3O0RL 1LP9F 5EO9A 5GISL 3WIHH 3TJEH 3BZFB 2YXMA 4KHTL 4YE4L 3FU6A 1LDPL 3ZR5A 1IU1A 4GAJH 3TV8A 4IHBA 3KPTA 1K4CB 4QYOA 1G6RH 4KKCC 2KUTA 2YFOA 2BHYA 2V6HA 4LAQH 2F53E 5CFHA 3AXIA 1PZ2A 5E5RB 1KIPA 1SPDA 1XSJA 1I3UA 1PEWA 2DAVA 4M6AA 5HJ3B 2GY5A 3LPFA 2DLFH 3MCLL 3GSNH 5D96C 1DBAH 4P2OA 5B8CA 3H8NA 4XC3L 4Z7UE 5EN2A 1KCSH 4QRTB 4Q6IB 3D7PA 1S4IA 4M48L 4FTVB 1OCCB 3ZT6A 5CSBA 3O3DA 2W0LA 3OKDA 1Z1WA 5E9DB 3HVNA 3C8KB 3I6KA 3NA4A 5HHOE 1P0SE 4LVOB 4KXZI 1ILSA 4UQ9A 3PJNA 3VXSD 2V9RA 4OT1L 1OGPA 1WHPA 2VWEE 1QLRB 4XMKL 3SDCC 3IDIB 4WWID 4OLWH 2VOTA 4N5UA 1CICA 5H2BA 2RCSL 1CDHA 2VO8A 3PREA 4MJ5B 2DD8H 5FKPB 3KPOB 4N0FB 5AD0B 4Q14A 3X2PA 1WFOA 3CBJB 5K93A 1A9EA 1FNSH 3U2IA 3BE1L 1A5FH 2DJSA 2WZ6A 5JW5B 1NCOA 3HLKA 5AOMA 3VE0B 5I1CL 5DMIL 4LCWD 4ONGL 4Y16C 2DQEL 1S5HA 4JPVL 4M3JA 1BAGA 4JBSA 2EXYD 4YVUA 5HHMB 2EUVA 3STZA 4JPKH 1RK0B 4MGXA 1EBPA 3I3DA 2NXZB 2HTKD 3DTDA 3WKQA 5BMFH 1BVZA 3DTXA 3WENA 2UZYB 5KYWA 5CINH 4PLNC 1PFOA 4ZO7A 1WAAF 4HQQL 1NDGA 5FO9B 1Y18A 3EJYC 1G87A 4FJYA 3IMWA 5I5RA 2O5XL 4GXUM 2R1YB 2NVYA 4L9LC 5E5UB 5ISZD 3CBRA 1JAEA 1XGPB 3H4FA 1JF1A 3MO1B 2E2HA 1S5IH 4XAKD 5GGQH 2F5BL 5T3ZE 2R29H 2YK1H 2ENPA 2D9QB 3FSVA 2VR7A 1J88A 3SYPA 3BMWA 1DBAL 1XB6A 5JHDA 5IROD 4G8AC 5DEFB 5F71A 1JBJA 4ZUVA 4NWTL 4ZD3L 1MFUA 3WXVH 2WY3B 1BD2A 2Z31D 3MBED 3P2BA 3ARWA 1BVKA 3V5HB 4ILDA 1FDLL 2R2EA 2OJEA 4JM2D 1MUJB 3FO2B 4PJDE 4A2DA 4LFHG 2H3NA 5HDBF 5KN5A 3KPLB 1SOKA 1FJ1A 3GEWB 2CR3A 4FQHA 5D7LB 3VDCA 3VW3L 1YPZA 2VR6A 2B59B 2KERA 3KWVA 2VDMB 3UTQB 1RULL 4H0LC 1ND0A 1R5IA 3FSOA 3R4DA 4AXWB 3INUH 3AAZB 3KXFA 4LPXA 1ETA1 5DXWA 4C57C 1JTOA 5JHBA 2W60B 2XV2A 1TWHA 3TA4D 1GAFL 4NZDA 1YN7B 1XF2B 3M1OA 2DM4A 4TV3A 4H2AA 4BFBD 4KUZL 3QUXA 1OW0C 3SDXF 4B9KC 4F7KA 3FPXA 3OSVA 5LBGA 1WWAX 2BRRH 5FGBC 2J20A 1HSBA 4KK5D 1SVZA 1INQA 5AFAA 4ODVH 1P4BH 5JDSA 2BSEA 2PXYC 4JY5H 1CFNB 4MXWL 1U33A 3RPKA 1B0WA 2BVOB 3PWVB 2HH0H 4PRHD 2OTWB 4BSWB 1BBDL 1F90H 1JVLA 3EOBA 3IFPB 3UBXI 1Y6MR 4IEFA 2IADA 1OZTG 4Y88A 4G7SB 3X2LA 3Q2CA 2G60H 4ZNEE 5F7UA 4XPGL 3ILQC 3NJIA 3O8XB 5CR8A 5TD4A 1AZVA 5CD5D 4NX0A 4OLUH 3FFCB 4P99A 4U6TA 1HXYA 1QA9B 2C9AA 2DDQH 4E9VA 1B4JL 5F21B 5LBSA 2K6YA 2R23B 3GNML 3CD4A 3L3KA 1E3FA 1C16B 3JT2A 3NCWA 4PGCB 5EZPA 4QHKJ 4KKAC 5IGXH 1K85A 1CFVL 5DUJA 1A1NB 1ZTXL 4GS7C 3LRGA 4DT2A 1ZA6A 3MOQA 1IFRA 1CE6B 4Y2NA 1ERNA 1D5XA 1KBPA 3GRWL 4ZMLA 3HU3A 1KPUA 3RUGE 5SWSD 5E9DE 1S5IL 1HQ4A 1RUML 5ICUA 3X2GA 3W39A 5AZ2H 4I9XA 4JNXA 4QJ4B 1GYCA 1DMSA 4NCC2 3WNPA 4OGYL 4WTZG 4YGVB 1GTNA 2GVYA 1EFXB 1WZMA 2DLEA 1QZ1A 4FEMA 2VSMB 2X09A 2XYBA 1J0IA 4GAFB 4QF1B 2OCCB 3LKRA 3BLPX 3IGFA 3PWPE 4YDJA 2CIIA 4I18A 5E4OA 3LXBA 4JP6A 1M56B 1T4KB 2OJ1A 4DK3A 2ITDB 3TNNA 4EN3D 4GRLA 5DR5H 3B2MA 5DVLA 5D4QA 2GEEA 2UVFA 3LXUX 3SJVD 2BLFA 3SDAA 5IJVA 4CMMA 1OWRM 1XAKA 3LZOA 2KQNA 1R0AH 4ZTPH 3UZEA 1KN2L 5FWQA 2DQIH 3OKYA 4NM4L 1F3JA 4P3DB 2HLAB 4I48A 1U30A 4PJ5D 3RX7A 3PE9A 2AS5M 4C4BA 3VMOA 2CGRH 4U2ZA 3FTZA 3OM3B 4KJQD 3MRRA 5FM5O 5LGHL 3BN9C 3L5XL 2QL1A 3U4EA 1T2XA 1EQWA 5F1OB 4KI5F 5LBSL 1I1YB 2A9MH 2GK2A 3WN6A 3T2OA 1BMGA 1WFTA 2OQJA 3EAKA 3E6FA 3QFJA 4MA7L 1SLUA 4LPCA 1LO5A 1QKZH 3QIWB 4JCLA 3DIFB 1Z9PA 4FDWA 4HS8L 1MCKA 3KS0H 3Q8FA 4F37F 2WM0A 2JELL 5CU5A 1Z2KA 1JHKL 2VDRB 1QLRA 3WFBL 2MOVA 1IQDA 1UUSA 2ZPKH 3OKMA 3ILPA 2EVJA 1RU9L 2CO2A 5E8PA 1FPTH 1O9ZA 3IPBA 5HDRA 4ZUTA 2BDNH 4K0OA 4QKXB 3UABA 2VXSH 3II3A 4LDLB 4WJG3 5GRVK 5CP3H 1PVHA 1FSKC 2WQUA 4UQ3A 3WFEH 4HWZB 1YO4A 3QFGA 1CLYH 2EEDA 4JPWH 5K33A 1ULVA 4RGNE 3E6HA 1MH5B 1O0VA 3IETA 1TMCB 3VCLB 5I16A 2E9BA 2V2WA 1F4AA 3GBMH 5EBMA 3TO4A 1BX2B 4FHJA 3GINA 2OXGA 4KO5A 1L5GB 1CPUA 3OHXB 3D0LA 1M53A 3C6LC 3BGFB 3FQXA 4L8SA 3HR6A 2GSIA 3BH4A 4UT6H 1IGYB 1AP2B 3G7TA 3BAEL 4ZXBC 3LDBC 5LBSH 3SDCD 3IGUA 5ALCH 2A6HD 4X6DA 2Z8SA 5AVYB 4EDWH 3G5YB 1G9ML 2NY7L 3P9LB 2P7TA 2ZUTA 3SO5A 2DMHA 2IPUK 4G1EB 4Y16B 3FCSB 2WXQA 4MWFB 1I85A 2CHDA 3AB0B 1K4CA 4YIQB 4NM4H 1S7VB 3UYOD 5CBAA 1EH9A 3QCTL 1J9CT 4L1HA 5B7FA 4NCC1 1J8SA 3OWRA 3UTPD 5LLIC 2A4CA 2BNUB 1A7QL 2V9UA 1N67A 1PPIA 1BGXL 3T4AC 2V8MA 2J6WA 3QJXA 2DIJA 1PIGA 1MHCA 3C5ZC 4KTYA 3IBEA 1SEBB 4JG9A 2D7OA 5TE7L 5IF0A 4TVPE 4NQEE 1NICA 3VRLF 4HSQA 1X7TA 4RMBA 3QIBB 2XPGA 4I3GA 4ZFZB 4Y2LA 5IB5B 5I15L 1OWWA 1TZIB 2EJ1A 3MYJB 3DRQB 1W91A 4J2QA 4KDWA 3ARDD 4W1TA 3CVHA 4NQCA 3VWJA 3GTLA 4AIEA 3UTQA 2FEJA 2ITEA 4QHLB 4YZFE 2R0LL 1KPRA 3FB7A 1FVEB 1IW7D 3GDCA 3ZE0F 4J8RB 4U4BA 5KYYB 3PWPA 3C60B 1RUMH 1EGJH 2RR3A 4N2GA 1NANH 1PLBA 5J12B 5LG6A 3UL4A 5F9OH 4ODXB 1FVCA 4KVCL 4LLDA 1PZ3A 4HGWA 1AD9B 2FWOA 3VFMA 1A8JH 3N1FC 4AIZA 1AQ8A 1AR1C 2H1XA 5I6XC 4CL7A 1JF6A 4DGUA 2BOBB 4P46D 4K7FB 2ICES 5FW8A 4Q9RH 5ICXA 4I18B 2XV6B 2KZKA 1H8LA 3WJJC 5DFVC 5GSRA 1EO5A 3FUKA 4Q6IA 1U93B 2WXHA 1AI1L 3QZNA 2AV1B 2V3DA 3G5XA 4HUUA 1E6OH 2UZXA 3ABLB 1N59A 2HMID 3MLWH 3PHAA 5EIIG 4RRPA 1EBAA 4KGJA 1NAML 4UZSA 3IXAA 3MNZB 5H4ZA 3T3PB 2R29A 5JUEH 3QFJE 2C9SA 2H8PA 1RHHA 1Z7JA 4HUNB 3UDWA 1P4IH 1FA4A 1QSZA 5J9PB 1AKJD 3WTVA 1OTUD 3MRNA 4P8QA 1I75A 4ZG1A 2AMUA 2FVNA 4I3RH 3UBXA 1MRCH 3GTQA 1QFWM 1OLZA 2ZAGA 1VAHA 3QEGL 4GRWE 4BFRA 4JZOA 3BGMB 4J12A 2NY4D 1E4KA 4PWGA 5IB3A 4LBEB 4PTTA 1Q9LA 4JKPL 4ZW7A 4OCRL 4F58L 2WTRB 1EHLH 4AYFA 2J21A 4UAOC 4F15C 1IM3D 4G9FA 4YQXL 4OZFG 1WBXB 5JYMA 2Y6SD 1A6ZB 5A3ID 4S2SA 4AC4A 1H5BB 1MCSA 1IKNA 1JGEA 4P3CL 3VWKD 1HDMA 4WI7A 5HYJE 4YSCA 4QTHB 4HCIA 1VACB 3ZT5A 1X5MA 4F7CA 1R19A 4S1DD 3V4VA 3R06B 3WJLC 1OB1A 5C6TH 1ECYA 2ZUSA 4HHAB 1HYSD 1OT2A 3CZKA 1PQEA 1A9VA 5I16B 1LNUB 3KYOA 2HT3C 2JF1A 1PLGH 1AD0A 3MGOB 4MMZC 5J4MA 4OUUB 3OKNA 1FAIL 4F2MA 3VGAB 1M42A 3IF1A 2H3KA 3S35L 1AP2A 2R2EB 4O5LL 3RDTA 3X11B 1T89A 1HINL 3SPVB 2NYKA 4X8XA 3VXQB 4MVBC 4K5MA 4W6WB 1M1XB 4TQIA 3ZL4L 1WFJA 3WNNA 4ZMZA 3U4EB 3G6DL 1QBMH 3D85B 5IHBA 3L4ZA 3MRFB 1RPQA 2OMWB 4M8QA 2G3ZA 4EKXA 4DW2H 1HEZB 2GJ6D 1TZAA 3ULUD 3T2NL 2VMFA 3QIWA 1TETH 1CDCA 5T33L 4N1CA 3FULA 4O00A 2PTTA 4R5VA 5LN4A 2HXAA 3SGEH 1F1DA 2B4CC 3HU1A 3ULVC 2GI7A 3MZGB 4MD0B 1A4JA 2BRQA 4UB0H 2EDEA 1I8MB 1J18A 3ILPB 1F4XL 3TBVB 3RWGA 5EHFA 5DEGB 3LN4A 2WLHA 3HMXH 1NLBH 3VI4E 4YC2C 2NLJB 1AIZA 2QT6A 2VJ8A 5F2FA 2L7JA 3CZEA 4P4KA 3SDDB 3WEOA 2B5IB 3LB6D 3A67H 2EEAA 5B3JF 2YA2A 5EWIL 1ZHNA 3EH5B 1XB3A 3HR5A 3QHZL 2JKLA 3FDWA 3QPQD 4PLJC 4YR6B 3WFEL 2PF6A 5FXCH 3WFDL 2YAMA 2YD7A 1VGKA 3TWYA 4LZKA 4UUJB 4C58B 4PS7A 3CN3A 4YLQT 3TZVD 2WQRA 2ATAA 2NY0C 2B9BA 1I8UA 3EOBB 4QHNB 1YG9A 5FM8A 5GLYA 2IGLA 3BD5A 3KBFA 4F58H 2JA7A 4FZ8L 1U8IA 5BZXA 2A99A 2I5YH 5JOFB 4XPBH 1FO0L 2R4RL 2ZD0A 3O4OC 3K6NA 3FO9B 4BM7A 4NHUA 3ES6A 4BZ2A 4OLXH 3GTGA 3K5RA 5HD8D 5CEZH 5EZLA 3GYRA 3DO7B 2GB2A 3ARGD 2H9GA 3ZTNL 3SJVA 1G6VK 4MDJB 3TJPA 3LRKA 1OKEA 2VKWA 3LN5A 4Z7WB 2X9YA 3QIBD 2NX5A 3EYSH 4AYDC 1D5XB 1FHGA 2NDFA 2PPFA 1QACA 5AYUH 5F0PB 3WV0A 1I7RA 4NDMB 3MJ8A 2A5UA 2CRYA 3UC0H 3VXSE 2COQA 3WTSA 5EUOF 1IM9D 1KCRL 3GMQA 3OKLB 1KYAA 3EYUL 5KOVC 3VSVA 2EYTB 3PDGA 1JPEA 2G9HB 5IB1B 5CLXA 2FBRA 1JMXA 2KI6A 3ZX1A 3ARZA 2FH8A 3ZUNC 4WTZA 4BUGA 4TUJB 4CKVX 4FNQA 4TYUA 2E8YA 4MKMA 2PCYA 1KCKA 3GZQA 2PPCA 2O93L 3U1SH 2FAUA 2XIIA 4O51B 1T2QL 4AZUA 3WYRA 3HB3D 4BZYA 1QBML 2XFXA 3IRPX 3LKPB 4YDMA 1XHHA 3S5YA 3QYMA 1KBGL 1MI5D 2FT8A 2V7NB 32C2A 4IOSA 3T1FA 5ISZA 4KDLA 3SE9L 4PJEE 1UH2A 3MKGA 3QXVA 1X9RA 3LH2L 3VXNA 2F68X 1ZIBA 2WQVA 1DCEA 1UM5H 1GL4B 1KCSL 1SUJA 4WWPA 3LKQA 5ICXB 1UH4A 2ZIDA 1JDDA 2ZWNA 2VDNL 4P2RB 4X4YA 2XZZA 1FAIH 3BN3B 5ID0B 3IM1A 4LEEA 5HYFA 1DQVA 2AV1A 3G5XB 4FQCL 4M5YH 1DMRA 4X42A 3UROR 3KPRB 5IHUH 1E4JA 1KV7A 2JJSC 3RILA 3W56A 2M2DA 3ZE1F 2BP5M 2Z0BA 4KKLD 4P4RB 5IB3B 3GUTB 1SXCA 3AITA 2ZXWB 3D9AL 5L2KA 1F90L 3CHQA 1EXGA 2DIEA 2RB8A 2ADJA 3GZOA 3QRBA 2B2XL 2JKJA 5EC2A 1MNUL 3VXOA 4JPIA 5I1JH 1DVXA 2VISA 1G4RA 1CGTA 3D4ZA 4OVVA 3IK2A 1AY1L 4N0UB 1UQSA 2A3TA 4E9LA 1HIMH 5L8LB 3VXRE 1EU1A 2ZYSA 2H1LM 4MNQD 1O6SB 1JK9A 2OSLA 4NFDA 4OAWB 3HI6H 5IOKA 2NY6D 4TS6A 1QUPA 4JY5L 4PVMA 4NS0A 2L8AA 1GTFA 3K1KC 5KVFL 1B0RA 4OVUA 3DK2A 5IW1A 1C9SA 1F3DH 3FQ2A 3JV6A 4FMKA 2Y9RT 1QNZH 5IJDC 5GJSL 3R1GL 2O26U 2VRQA 3T08A 4MLIA 1NWOA 4L0ZA 1KBWA 1BJMA 2VIRB 2R0ZL 1URIA 2HB0A 4QTHA 2DMGA 2Y7OA 2Y1AA 3GKWH 2V3VA 3EYSL 3D9AH 3LQAC 3ZTDC 1CZ5A 4RFEB 1KTRL 1DN2A 1X5KA 4WNQA 4B9PA 4JQVC 4NZUL 5C09D 1Q94B 3ZKND 3BQUD 4F5CA 4GP4B 3CSYB 3L3JA 3EO1A 1EDYA 2LU7A 2V3EA 4C59B 2PWFA 4TPRH 3VRJA 2JELH 4ZFGL 3ATDA 1NUNB 3UTZA 4PHZA 5ITFB 4ETYA 4POYA 1OQXA 3P0VL 5KBNC 1M6OB 3NCYS 3GMMB 1DQDL 3JXAA 5IMMB 3A24A 2KI8A 3B2UD 4FFWD 5F7WC 4W9LC 5I71B 1YQVH 1SDYA 3SE9H 5M95B 4PREB 5DVMA 2R1XA 3P4MA 2ADGB 3GXFA 3TYFB 1G7IA 1QVOB 5CBEA 1MXDA 2NXZC 3V0JA 5CZXC 1T2QH 4HQQH 3BC9A 5MENB 3IMSA 3H7BB 4PMFA 2NPLX 5EWIH 2QR0A 5C0EA 3GBEA 5IB4B 4KNTA 1HHGB 3WIHA 1I1RA 4NAJA 1VFUA 5IW6B 4RDBA 3CV5A 1YEDB 3UZEC 4HKJA 4DN4L 4Z7VB 2R4SH 3AUVA 3NZSA 4QXVA 4KBPA 1OTTD 4PRNB 4RFNC 1MJJA 3SY0A 2H9GB 1IAOB 2KQAA 5I1AA 4V2CB 1T5KA 4EUPB 1ZV5A 3J27A 4G42A 3BE1H 4A1RA 5FHAH 3V95A 3TEWA 4AKOA 3O9WC 4QOKE 1R1CA 2NQCA 4DEWA 1SXAA 5E1AB 1QYGL 3D39B 3EIFA 3HLAA 1WS8A 3X12B 5DEZA 1EFXD 4EE2A 1C5BL 1HH9B 4LQFL 4PJXA 1JGDA 3FT0A 3MJ8B 2GG1A 4I1NB 5C0CB 1INDH 3S35H 3V55A 2CO1A 3F6JA 4G82A 4WDIA 2CH8A 4EN3B 1MHEA 1QR1A 1Q1JL 1BSIA 4CJ1A 4XNZB 2X10A 3BEVB 4D7ZB 3PP4H 1L9TA 3SJVB 3FO1A 3D6GA 1RI8A 3QUYC 3AM8C 3RDTB 1BVNT 2AJXH 2WD0A 3DVGB 1IO4C 1RJZB 3KLAA 4M5ZL 1TDQA 5I1IH 2VDRH 3VXRA 1KXQA 4ZFGH 2WCGA 2XBZA 3IDNA 4JFFE 4XZUA 3ZQWA 4AUJA 3GMPB 4N8VB 4X6CF 5HYJD 3N55A 1HWGB 2DQTL 2ARJA 4ZUWB 4JQIA 4JCWA 4AMXA 2CJUH 5E8DH 2FQFA 2NNCA 1UEMA 2A74A 5C0AA 3C8HA 4HJ0C 3GKWL 1JTTA 3RVWD 1XXFC 4LCCC 2AMGA 4Q0XL 1ZWIB 3D4CA 3RB5A 1F00I 3RPIA 5JXEA 4OI8A 3CLFH 4MSWB 3HMXL 3V0GA 4PJIA 1YMMA 1KIPB 4P9HC 3QQXA 2NW3A 1OARL 1C1EL 4GG6F 4L1LA 2EE2A 3FQ1A 3PQYA 2VERN 1TTGA 3QISA 4YDLC 1MHHB 4LVEA 4J8QA 3CX2A 4FTVA 4PB9L 3T0ED 1NCNA 3VM7A 4KXZH 1OD7A 3V9CA 3QI9A 4I3RL 5KS9B 4LARL 4PWKA 3TO2A 3DX7B 4AQEB 4ORGA 2DEYX 4LFHD 1J7VR 2VPYA 2MNJB