4L48A

Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and d78n mutant clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
total genus 44
structure length 202
sequence length 202
chains with identical sequence C
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4l48A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4l48A02
3X2MA 1L8FA 1BW3A 2BH0A 5GLXA 3X2JA 2PICA 4JCWA 2ENGA 1N10A 3CZBA 2PI8A 1OA9A 4FG4A 3X2PA 3FT1A 3M3GA 2HCZX 5GLYA 3X2NA 3SUKA 1BMWA 1WHPA 4JP7A 3X2IA 3SUMA 3FT9A 3SUJA 1BW4A 4AVRA 3X2KA 2JNZA 3X2OA 4ENGA 2KQAA 2G5DA 4FFTA 4JS7A 1HD5A 2G6GA 4FG2A 3X2LA 3ENGA 1OA7A 3X2GA 2PJJA 2AE0X 3SULA 4L48A 4JJOA 2PNWA 2VXQA 5H4UA 4FERA 1WC2A 3D30A 4ZM7A 1WHOA 3X2HA 4JP6A 5GM9A 2GAEA
chains in the Genus database with same CATH superfamily
1S9VB 4PB9L 3PDDA 1EAJA 5GRZA 3PDGA 1QSFB 3I6SA 3KYKH 1HFUA 1TT6A 4JVUA 1F8TL 3O9WD 4UQ3A 4P2QD 2Z8VC 3IFNL 4RBPK 2O1AA 2X1OA 2JKNA 2VDRB 3A67L 1G9EA 3QCTH 3UJIH 1G9ML 1UWYA 2CQVA 3MNZB 1HQ4B 3K1DA 4I1RA 4JG0L 4U1IA 4GKOA 1AYOA 4MXQC 4WQOA 5J1AA 5JHDE 3P0VL 4LVHC 1P5VA 3D39B 1A6UH 2V3DA 4P5MA 3GDBA 3IDYB 1G84A 3SIKA 2DD8L 3MYZA 5H37A 1BYOA 4Z7UE 2OMYA 4BK5C 4PREB 1YEFL 5CHNA 4LGRB 4RSVA 5A1AA 7CGTA 4ISVB 1FNFA 2CBOA 1I3QA 3HLKA 3W5NA 1W6WA 4GSDL 2CPCA 4PHZA 3FOMB 3LN4B 4E41B 4U1LB 2J1KA 4P2RA 1BFVL 5IIEA 1KJ3H 3HC0A 4Y9GA 1WWWX 5HD8C 4L8SA 4PRAB 4MNQD 2F68X 4NZRH 1EJOL 2Q6WA 1HYRC 3RWIA 3ARED 2JI2A 3UEZA 3VD0A 2Y0SA 3TBYA 5T8IA 1A1NB 1G5GA 1I7UB 4ENZA 2WGXA 3FCBA 1ITBB 1QLEB 5MEPA 2HYMA 3LKPA 2OSLB 3ME0B 2WXQA 4ATTA 2IH1A 3NTCH 4H8QA 3LS4H 5T1DH 3EG9A 5C97A 3KDPB 2PYED 3D4YA 3H3BC 4NM8L 1K3IA 4ZFOL 2X2YA 1KTDA 3DYMA 1B9KA 4QHNA 1M3IA 3ZZQA 5KAQF 4LOUD 5C07D 1F18A 4MYWB 2YEZB 4JFOA 3ZL4L 4XP5L 1N4XL 4HCRL 3SKUD 1TXKA 2X12A 2H2SC 2H8PA 4XMPH 3WY4A 4EI5B 5EEVA 1TWCA 2YOAA 5JMRA 3V7AE 3TFKC 2ADFL 5T33H 4LLMA 3DMMD 4Q9QH 1U3ZA 3CJJA 3GHBL 1U8LB 2IDFA 2CJSA 4M6OH 1NMCB 2WZAA 1D6VL 1F5WA 5AVYB 1HYSC 2JIXB 4O4YL 5B39G 5F3HB 4D9RE 4JHWH 3QQ9D 1FO0A 3GI9L 3O3AB 3B2MA 4OFVA 1OAXH 2QPEB 3FCGA 4WU5B 2XVKA 1TFHA 2AEWA 2A6KA 2FEJA 4MA8L 4NAMA 3ZE0B 1NGYA 1UD5A 4PRPA 4ZTPH 1ACXA 1X5ZA 4H0GA 4UOQA 3A4FA 4EEEA 4R5XA 1KXTA 4MXWL 1KEGL 1EDYA 2EYTB 2ZIDA 3MLSL 1CLOL 1AOHA 4L0PB 1IU1A 4MCZA 2AEIT 4JL1A 1PNCA 4N1HB 4XPTL 1T0PB 5ICUA 3UJTL 1T2XA 3SKOA 5I1DB 2BOLA 2NNAB 3IJSB 4HWBH 3WFBH 2HVBA 3CPUA 5FW8A 2D0GA 2CGRL 4WHTA 2QJDA 4DCQB 3L1EA 2JELL 2XU9A 4ADIA 1JGLL 3PGFH 4N0FA 2B39A 1SJHA 1GHFH 1BQLL 1PBYA 4UAOC 2EQDA 4PLKD 1R34A 3X1FA 15C8H 4ICWA 4WUUE 2VN7A 1NAMB 3LQAH 4P9ML 1KENL 5D7SL 4AKOA 1FZOA 4JW3A 2YGVA 1AGFA 1JF5A 4WFHD 2EVFA 4JFDE 1CYWA 4N25A 3ULVH 2WWMD 3MOBH 1NL0L 1IFRA 3V6BR 3VFNA 3CBRA 4V2BA 3QG6A 4FQ1L 3K6OA 3G6JB 1MFBL 2GIMA 2HRGA 5HHPA 1ORQB 1DR9A 4WY7L 5C0FB 3BPLB 4Z77B 2VISB 3L7FB 1HIML 2DM3A 4G43A 4NN6B 5KYYB 5K5YA 2ICWJ 3L7EB 1QEXA 4HS8H 1NGQL 2VDPL 4X6CB 2BCKA 43CAA 2MKLC 3OZ9L 1CF8L 3T2OA 3ZE1B 3SGEH 1IIKA 1BVNP 5JW4Q 3NESA 4HU8A 5IMLA 1CYGA 3GXNA 1GMIA 4GA6A 1H8NA 1RY7B 4ONHA 1FSKB 4CSZA 2X42A 2OULB 4QRRA 2DQDH 1KJ2L 5FCUL 2QZQA 1P1VA 3HE6D 4R0LC 2VR5A 3VB8A 5IMOA 1I1FB 1PJWA 1LK3L 2ZX9A 2BSSA 2R2HB 3MXWL 5E8OA 5AZ2L 1M05B 1YJDH 3NH7H 2OR7A 3GMQA 3JV4A 4KXZI 1EAPB 4OCWH 4XMZA 2G60L 1FRGL 5FGBC 1N9PA 4Z3FA 5F9JB 2P1YA 1GIGL 3CDZB 2QPDB 1HHKB 4MWFA 2EP6A 4NC1E 5EA0L 3BPNB 3G6JE 3WS6A 5FYKL 4HIQA 5I16B 4TXVB 3DO3A 4IJTA 3NCYP 3G5ZB 3X12A 1TEFA 3EDFA 3IF1A 1LMIA 3SPIA 5IESL 3KJ4B 5TK2A 4H1LH 2W0FB 1Q9KB 5IJDC 4UTBA 3AGWA 3RTQB 2F54E 5J8OA 2VNCA 1IM3B 1VAHA 4CAGA 2IVFC 1GZHA 2D7TL 3GXPA 4JB9H 1U95A 4ILDA 3ZE2B 1UD8A 3BIAX 3E6FB 1ROWA 4W9EC 3N40P 4KRPC 4JDZB 5B1KA 2OSWA 4JZJB 5I1AA 2R2BB 1QPXA 3S48A 3DJ9A 4BIKA 2R0LL 3N42B 1AGBA 2P7TA 5T1MB 5AD0A 2R23B 3A22A 4U7KA 5KSBA 1WUNT 2VXVL 3MNVA 4JM2D 3CZNA 1KYDA 3A4EA 3M46A 5J4MA 1FE8H 3KEDA 4M61B 2NY3C 4HFWB 2VRAA 3BVUA 2ADYA 4FXKB 1R5IA 4N2BA 3Q6GH 3V9EA 4PWGA 1JZDC 4J23A 4X4ME 4XN9A 2G30A 2E9BA 4V1DA 1JPST 2X2IA 4BCXA 4NZTH 5FKAA 2VR6A 5ACZB 2HX7A 4ELDA 1ZAGA 1Q4NX 1DVYA 2FEDC 2XSKA 2Z7ZA 4LB8A 3C60B 2YKLL 5DD5L 1HE7A 1Q1JL 4PGBA 5ELIA 2BVOA 4PJEA 1MAML 2FATH 2ETWA 2OV0A 1QRNB 1JN6A 3SBRA 1YEKL 2MIZA 5B4MD 3E3QE 2OW6A 3FZUD 3AWFA 5IROC 4NLAA 3RWGA 4Q9CA 2QADC 2ZF9A 1RAMA 3EOAA 5E7BA 4UCFA 1FFOB 1NIDA 5FO8B 4Z23A 5GGSY 1WYJA 3X2KA 4DKEH 2G9KA 4ZPTB 2XBDA 4HS6A 4K8RL 4NJAH 1KYOK 2E9IA 1H8SA 3FTUA 5BVJA 1TSHA 3ATEA 3EJYC 4P3WA 3LNHA 1KLUA 1KPUB 1SEQL 1LWJA 2YR3A 2LVCA 4MAUH 3MV9A 2LABA 5EFIA 4NZJA 3V8CA 1THAA 1DQJA 1YQ2A 1U3HD 4O58L 1KJMA 4KQ4H 1E4WH 1TETL 3OAUL 3UP6A 1W0VB 3U9WA 4AUJA 1UXSA 3C08H 4CMHB 3BWSA 2VUOA 1OGAB 1GPOH 2LHAA 2IG2H 4Y5VC 1BVKB 1S7TA 1JV5B 4HUUA 3GS4A 3RVTD 5B22A 1QOKA 3OQRA 3BCDA 1YEIH 2WXRA 4WU7B 1HOCB 1E27B 2PXYC 1KV3A 4NZUL 3PL6A 1DZBA 5ICXA 3FQWA 4EDWL 1FNAA 1MLBB 1ZDQA 4P99A 1NCCL 5I74B 4C83A 4AQZA 2NY4B 4R7DA 3SDAB 3WFZA 5FFLA 1V5JA 2Q0ZX 3ZOAA 1HINH 1BQKA 5MI0C 2BSRA 5CN2A 4HKZB 2PCPA 5ENWA 3P40A 2N0KA 4G6KH 2OL3A 3QWNA 1EMTH 5CR8A 2CHZA 3RE0A 3U0WL 3RVUC 1EEZB 1P6AB 1PX3A 3OF6A 2GJPA 3EH5B 5E7FA 1A1MB 1I3RB 4Y4FA 2PPAA 4BV1A 2VDQH 3WTYA 1N5YH 1BXVA 3IDIA 1PAMA 3G5YA 5E9DE 2I7OA 1UUNA 2ADJB 3JVGA 3VGFA 2AJXH 4PJXA 4PSRA 2MCPH 5SX5K 1X5AA 4JK0D 2VQ1A 4ZW8A 1AR2A 1EFQA 1VEOA 3VFVB 1M71B 4H8WL 2NZIA 1NCTA 4JHZA 1AC6A 3O5AA 1HH6A 3N1GC 1OWRM 1VFOA 3EGXB 4FQIH 4YGVB 4NO0B 3VGDA 2CDGB 5KVDL 3SOTA 2ROXA 5JXAL 2VT0A 1T20A 2J7LA 2X89A 4JM4L 3ZE0F 4AE0A 3MCLL 4NQXB 3FUHA 3MGOA 1CBVH 2ICEA 2VLJB 3AQDA 4M29A 3OWRA 3DRQA 4E9SA 2YSTA 4Y4FD 4XP6L 1IM9A 3MV8D 2ZX8A 1KB5H 3MRNB 5DEFA 1L7TL 2IMMA 2GT9B 4EIZC 4GXVL 4PI2A 4S1DC 3K6SA 1FL3B 5JW3H 2C7UA 3TEXA 3QORD 3QFGA 1KLGB 4EDXB 4HX1A 4XOCA 5HY9A 4B5EA 1UQSB 1KBGH 2VMCA 4HEME 4OZHA 1P4BH 4GKNB 1ZTXL 2W65B 4KX7A 4DUVA 4Y4KC 3OKLA 5AVQB 3VXMD 1XGTB 2VLLB 3MV7D 1EGJA 4E9YA 2FK9A 1KWGA 1LP9A 2Z64C 2QPUA 2TRYA 3FC8A 4YDIL 5F7DB 3UYRH 2X89D 4ZFZA 5I23A 3FSOA 3IEAA 2C4FT 1K2DA 2C9QA 1P4IH 3PJLA 4BSWB 2UY7B 4U1SB 3TIEB 4NJ9L 2XN9B 1WUZA 3I6LD 3B1UA 4WWKD 4KGJA 1ND0A 2VN5A 4JHUA 1IM9D 3SGKA 3V4PA 4ZTOH 1NMCC 4X6CF 3VFWA 3HR5A 3ZE1F 3U9UB 2HTLD 2VC2H 1IAKB 5LN4A 3DK0A 4ZD3H 2ZWLT 1IAOB 4PJAE 1T22A 1FV1B 5F9WB 3S4SB 4H0IA 4QWWD 4HK0A 4JCWA 2ZYHA 4O2CA 4BDVA 1UA7A 3KLHC 3U7YL 4NGHL 1F1DA 1XXFC 4HSAC 1YPZA 2RCSH 3WIHL 5HI5D 3WKNA 4FQLH 3SPJA 4S1RH 4A6YH 1A6WL 2E56A 3EBGA 1K3ZA 4AXWA 2JQAA 4RA0C 2AXHA 5DHVA 1I7ZB 1U6AH 3KPLB 1ESOA 2X4TB 3L2NA 1T89C 1PIFA 3P0YH 4QRPA 4LSRL 3FB8A 5BRZA 3KCWA 2HWZH 3S36H 2KQMA 5EC1A 3VWJD 1NMBH 4G1MA 3MRDB 3KXFA 1X5MA 1QSED 1O6SB 5D5ME 1LE9A 4HIEB 1ZT4A 2ZYSA 1B4TA 4C8XA 4G9FA 1X5GA 3H1ZA 3N6YA 2EH7H 2BRQA 4XNXH 5E6RB 2B14A 5C0DB 1U8CB 1T1XA 1IMHC 5B1CA 4D7PA 3LQMA 3HG1E 3IGFA 4AT6B 3OGCA 3MYJA 5B3JF 4AYEC 1C12A 1CFSA 4FXGB 3P4OA 4PJIB 4F7CA 3VXOB 5DYGA 1D5IH 2XQYK 1LJMA 4OCRH 3TV3L 1S3RA 3APFA 3QWZA 1DL7L 1HX0A 4AUYA 3ZE2F 4BYHA 4K3GA 4UZUA 3BPLC 4OB5L 4DIXA 1MQ8A 4NN6C 4L5FE 1DVQA 3K46A 1NDGA 3L3JB 4PRBB 2I24N 4UQEA 3B5GA 4P59H 3N42F 3SPVB 3FT4B 4MAYA 1EEQA 5D71L 1N6VA 4FTVA 2GIXA 3WYRA 4Q8BA 3LZLA 4R3SB 1FGNL 5A2IH 2BVTA 2XV3A 5E1AB 5FHBH 1SJEA 3UPRB 4KHXH 4S2SB 2OX5B 3BJLA 4YAQA 3S8FB 1XB6A 4OF7A 4WKZB 1D6EB 4PTTA 1ZY9A 2PR4H 5A2JH 3EFDH 1E6JH 4JFHE 1NSNH 1Z3RA 4IGBD 1C8QA 2X70B 5E51A 3LSOA 2YGPA 7PCYA 4I87A 3UTPE 4QAMB 4HUVB 2ZX5A 4TNVK 2FGZA 3LV3A 4CVXA 1RUAL 3ISYA 1LLAA 1DQTA 4Z1PA 2EKJA 1F58L 1RIHH 1AMXA 1CWVA 5E5MB 3SQBA 2DICA 4AIZB 2P5EB 4BCZA 4MQXC 5DJAB 3D34A 1XH3B 1X9LA 1A6ZB 2G3NA 4MASA 4JAMA 4Q0XH 4RISH 1G6RA 3VXUA 4DESA 2W0LA 5DVPA 3KJ4C 1QWUA 3DVIA 4NNYB 2WO2B 4W68A 4RESB 4PS7A 2OYMA 4U1JA 1AR1D 3I9GH 3J27A 4FLRA 5CGYD 3RTQC 5LXGL 3LKRB 5DJ6A 3RU8H 3KBEA 2V2TA 3DX0A 3KPSA 4PJ8B 2UWEB 4L2LA 5E4IA 3DBXB 2ZX7A 3WNPA 2C9VA 3E3QC 4ODVL 3K8LA 3T3ME 3ULUD 3FUFA 2B4CL 5TGBA 2P80D 2YSSA 1QTSA 5TE6L 4ALAC 2W07B 3E8VA 3IJEA 5DT1H 4WUKL 2B1HL 2PJJA 4KI5D 1SHWA 2BZCA 2VDLL 2VSMB 5FO7B 4NO5B 2ZCHL 2Z35B 3MPCA 3SDXA 1I1AB 2VXSH 3UMTA 1BEXA 2A9BA 4PI0A 3S5LB 3DTDA 5AKVA 4XTRC 5IHZB 2P5PA 2IGFL 3EHBD 4JPIA 4W9IC 4NNPL 1B0GA 3PABB 1GOGA 3P9WB 1XGRA 3DNKA 4E42B 2JTYA 4O02L 1NBVH 3EOTL 5PCYA 5I15L 4WSJA 2VXQH 3C60C 3HB3D 2ZKWA 1JGIA 2K0RA 4LRNL 5AAMA 4QT5A 3QFDA 4LSVL 1KUMA 3BW9B 4U6TA 1VF5C 3Q6FA 4O2FA 2UWEE 4AX3A 3RB5A 1MCKA 3KZ8A 1FQ9C 3CXHK 3MRGB 4GFXA 3GPEA 4X5QA 4H2CA 1BXXA 3UPCA 5CINH 2DWDB 4FQ2L 5M7QA 1ED3B 1UWGH 2LTQC 2WNKA 4N6QA 4DZBB 3AUWB 4G6JL 3X1EA 1E9PB 4ONOA 5SX4I 3W39A 1BBJB 4NQCA 4OQTL 1YPZF 3QIUB 5DUBB 4F92B 1MCLA 3AB0B 4Q6IA 1XQ4A 1Z9SA 3H55A 5ALBH 2RFXB 1ASQA 3M7FB 2AV7A 4NHUA 4PAZA 2B1AL 3D2UA 3K4ZA 3OKNB 5TH2A 1AGDA 3AU1B 2QVKA 3GSVB 1RZFH 2WK2A 1UGKA 2J57A 1DQDH 2BM3A 3BVXA 1EZVX 5A3ID 3MLVL 1ACZA 4U4BA 5GGRA 3H9SB 4AMKH 2WLZA 3LD8B 3DROA 1F90H 4NOBA 2QT6A 2IWGA 1MCNA 4TMPA 2CO6A 1KZYA 2NY7L 2GITA 5IB5A 2WQUA 3KWVA 5EPPA 2DMRA 4OW6A 4XC3H 1KNOB 2DWEA 5HYJB 1MG3C 5JXEC 1SHSA 4FEIA 2IAMD 4NUGH 2XWJB 2Z1PA 3MXVH 4YEFA 4MVBC 4Y1AA 3ZYOA 5D70H 3DX6A 4N2FA 1DLFH 3TIDA 1EXUB 3MBWB 3C9NB 3MCYA 1UZ8B 5F72S 3DKHA 3QPKA 5C0AA 5LWYL 4OVVA 4HGKC 3ECUA 3CF2A 4YX2H 2WXGA 3APCA 4X0KA 4KTEL 4KXCA 1XR8A 1MSPA 2WNXA 3WO4B 2FRGP 3O6FD 3I9IA 3KH4A 5D1QB 3FUDA 4XVTL 5I74C 4Q56A 2NY4C 3QNXB 3MACL 5JNYA 3LXAA 5BZWA 4IKKA 3RWJB 4WI3A 2OJZL 4B3EA 1A6AA 1IQWH 1G7HA 1NKGA 2IH3B 4HCRA 5E1GA 3TONA 3ECBB 3U0TA 1F4WH 3EO9L 3OJVC 3O6KL 2N56A 4YSRA 1MFAL 1LM8V 2J20A 2NW3A 3T6WA 5L4IA 1Y0LB 2NY2B 1SM3L 2EDEA 5SWSB 5HYJE 4WI4A 4FNTA 5IEHA 2ZP9A 1W16A 3HPLB 1IL1B 2WLHA 1Q1PA 1NMAL 2A9MH 4X7EC 3RGVD 4F33A 4QYAA 5FTMA 1JFQL 5DVLA 4HOWA 1FUNA 4IIQB 1JFHA 2GI7A 4KZCA 4HF5L 3WU1A 3BUYA 4ODUB 2Y36L 4M7LL 5DU7A 4JHVA 1K83A 4B9KC 2Z91A 5EOCH 2DV6A 4FYRA 2R1WB 4P3DA 1MI5D 3R7QA 4F2ME 3WEAA 5D1QE 4P5SA 4Z3HA 5GGUB 4G7RB 3BP7A 5F7WC 1QRKA 5CCKH 4OZIA 1ZT1A 1Q0YL 4N0UB 4J27A 3NCYS 4JG1H 4DJMA 4KXDA 5KS9B 2VITB 4ZJ9A 2HN7B 1DQQB 2VDRL 2J25A 4FD0A 1I1RA 1KMGA 3DXAA 3E80A 3MO1B 5E70A 3T0ED 5GLYA 2DTML 4XMVA 4J3OD 5T5ID 4YFDB 3DSFL 4HUWB 1ZLWK 4LCWD 3VXRB 2K6WA 3N1QC 43C9A 4JPVH 4NCC2 1AQKL 4ODSH 4JREC 1PFCA 1VRSA 5BV7B 4G5ZH 1GGUA 4PJIF 3IXTA 4AKPA 3OXRB 1XAUA 4KV5F 1FAIL 2IWKA 4IBYA 2FJGA 2PP9A 1CGXA 4ZT1A 5GS2H 1GCFA 3HG0A 5DURD 2GTWB 1A7OL 3X2QB 4A63A 3MLZH 1WEJL 1JPEA 3QUZA 4J8RA 4BA0A 2Y6SC 1PSKH 3SY6A 4HMCA 4AVJA 4L23A 4YDKL 3WXVL 1QLEL 4QOKB 5KVGL 3IDNA 5K93A 5F3BA 3U4EB 1OAQL 3INUH 4GAYB 1FDOA 5AZEH 1GOFA 5JW4R 1F4XL 1MHCA 2H9GA 5D2NB 1P4LA 4R4BA 4M8UA 2YMXL 3VX1A 2G9HA 5T1KA 3PXLA 4IIZA 1SDAB 4CC0A 4KX8A 5I5MA 1CICC 5JORA 2VIRB 1WFJA 2FO4A 2F53D 3QIWB 4FNRA 3EDDA 4NERA 4TSCL 4W9GC 3EF4A 5I76B 4LCIH 5TF0A 4KU1A 5J3HD 1YC7A 5JW5B 1GW6A 2Q2LA 3GTLA 3QUYD 3QUZD 3SQRA 3WMSA 4CGUB 1EQWA 3VI3E 5TD4A 1WC7A 2B59B 2HT4C 4WV1B 4L1DA 4FG6D 3W57A 4AV5A 5EBLA 4X5LA 4K7PL 5HHOA 4NQSA 3QR1A 5IR1A 2XVLA 4FXGC 2RIKA 4I13B 4PGCA 3D06A 2ZOKA 2NX5E 2ZYRA 4FL4C 4PMFA 5INDB 3VWKD 4KAQL 4YDVA 4HFUL 3UAAA 4ZUVA 4GEIA 5T1KD 4HJ0C 5I1LB 1DMRA 2X6MA 2SEBA 1DQLL 1A25A 2IBGA 1PIGA 4HIXH 4OV6F 5FYKD 3SDYH 3F5WB 4LQFH 4OH2A 2HKAA 3VRJB 5SWZA 1NCHA 3AXHA 3M8OL 1NAML 2EC8A 3QQ3A 3ULSB 1DJGA 3CZFB 3L08A 3CFDA 5CN1A 5AUMB 3ARDA 1DUYA 1P9MA 1WZLA 3TJHC 1HXKA 4U3SA 3S35H 4F7MA 4JUTA 1MNUL 1AKJA 3IGAB 3BKYH 2N01B 2B15A 1SYVB 3Q2WA 4JCMA 3HI6L 1GVIA 2A77L 2BX5A 1VFMA 1TPXB 4PB0L 3PUCA 3IRCA 1NCWH 3FRUB 2Z7WA 4MA7H 1R9TA 3LRMA 2IH8A 3ARFD 4Y9FA 4NHCH 4YHIA 2D3LA 4P3CH 4X7TB 5I1KL 2FJHA 2X28A 1PW3A 1TTBA 1T5WB 3QWQB 4CRYG 2YA1A 4MSWA 3SGJA 4F5CA 4J2QA 3TA3A 4JO2L 5JIIA 1FG2B 3KYMB 4FLHA 4KY1H 2ADIB 2J8OA 2OJEA 4WGKA 3VD4A 1T04A 5EUKA 4NIKB 4LSQH 2DQJL 3A24A 3J7HA 3H0GA 1KZQA 1WISA 1ET5A 3PGDA 3FAXA 3ARDD 4N0YL 1LXMA 4XN7A 2WY3B 1U8PB 4KVNL 3VGBA 1YQVL 1JMXA 4NWTL 4PJ8C 1R3JA 2JWYA 1T7XA 1IC4H 5DMKB 2E7LC 1DCLA 4PM1A 4MD4B 2PO6A 4F24A 4Y19A 4YE0A 1BP3B 3A4DA 3HTLX 4J8QA 4CDGC 1X4XA 3WNNA 2WIIA 3P30L 3NFPA 3VE0B 3TBCA 2DM7A 1QBLH 2R1XA 4PJ5A 5I5RA 4DVRL 3X3FL 3HC2A 1Z66A 2J88L 1Y07A 2HVJB 1KGUA 1Y5IA 4RMBA 1ODUA 4XNAA 1WF5A 5IUCA 4Z76B 4K8RD 2B20A 2WAHA 3IDGA 1J05A 2JLLA 3QXUA 1IE4A 2D31A 2XICA 1T7VA 4HJJL 2G0LA 1HOEA 3SEPA 3GFUA 4JFQB 1WBZA 1U36A 2GAZB 1AKPA 2YXVA 3Q2VA 4ALAL 3L95A 1PKQE 1TTRA 1WA2X 1COBA 4GKZB 3TYFB 3VGEA 1I4FB 3NFSH 2UUDH 4GMTL 5I8CB 1R3LA 4BSJA 1BD2B 1J5CA 2BFVH 4XNYL 2PWDA 2R4SH 1MVUA 4QRTB 4HHGA 1VEPA 1DUZB 1OGSA 4QY8B 3TGXA 4LAQL 3DRTA 1UWEH 5AAWA 1W9XA 3DV4A 5J6SA 4IRJD 4KK8D 1PY9A 4DAGH 1E8WA 5D1ZD 4OCYL 1IW7D 2ZSWA 1YNKH 3CLEH 3KYOA 4BH8A 3TT1L 3QIUC 2RQEA 2V2WA 3PHSA 3H0TB 4QIRA 5I6NA 3FT1A 4KXZH 4WEBH 3PDOA 1XF4B 3GTGA 2CG9X 2EZ0D 1IBZA 5F7FA 4YXLH 2VDNH 3ZN6A 2KQAA 5J9PA 4UIKH 1XX9C 3S8WA 4O2EA 3HEIB 4F8PA 2EVJA 5DK2A 1A8JH 1EZLA 4IBTA 3TO2B 5L7XL 1H3PL 2IDQA 2XPZA 1J0HA 1WC2A 1AGEB 2ADGA 2CDEB 3LD8C 4XC1L 2WN3A 4JFEA 5IFJA 3P9MB 2WNGA 4Z7OB 2WWKO 1C5BH 1RZJH 1UH3A 4NFCA 1L0YA 3OB0H 4S11A 1UZGA 4ZDHA 3ROLA 3V52H 4TM9A 3Q1SL 3LN9A 1RXLA 1IGFH 1WIPA 4HS3B 3HPJB 3VYNA 1OV8A 1HXMB 2AJZB 3LPGA 2FLMA 4YHYB 5B7MA 4JDEB 5T3XH 4BK5A 3C2AH 4GP5B 1TZGH 3TLRA 2F7RA 1U91A 3KPRE 4L3ED 4MJ6A 1O0VA 3FKUS 2V6HA 2Y72A 3PP4L 3WO4C 2LAGB 4WJG3 3REVA 5D1QC 4N85A 4GNKB 4FFWD 5IW6B 3G6AB 1CLCA 4RGNB 5CFAA 2D0FA 3EYUH 4I0PA 2IAAC 4B96A 3IB4A 3V4VA 1TJXA 4NQEA 1E2ZA 1GGYA 12E8L 3DGGB 1QI5A 3H42H 3MV01 2HJFA 5F88B 3FRPG 2F08A 2WVTA 1T3FB 4J28A 1E7UA 4PJHB 4QJ4B 1E28A 3X1NA 2NY2C 1LDSA 4R96B 4UF7C 5EU6A 3PQYD 5FO2A 1U58A 3DVFA 5LCVH 1PQZA 4MXQD 1H5BC 1GAFL 3O0LA 1L5GB 4K5PA 5C0CD 2ZP8A 2HLEB 4P9HC 5LBGA 5FB8A 2V7HB 4IIQC 4EN3A 1EANA 2F5AH 4XMLH 4FNQA 2ID5A 2OR9H 3IN2A 2NY5C 3HFFA 4PN6A 4UWQB 4AI7A 2EIZA 2JB6B 1OD7A 3QARA 3ULVE 3KPPB 1YMMD 1U8QA 1SJVA 4ANWA 4G8EB 1TWAA 5TE4H 3BIBX 4XPBH 4WEMB 5EF2A 4JFFA 3IMTA 1ZEAH 1RJLA 1UXWB 3QXVA 3CC5B 1MW1A 3HR6A 4N8VA 1H15B 5FO9A 1I8AA 4JZNA 5GGSA 3TEUA 4R84A 3RB7A 4H1LB 1B4RA 1SLWA 4DW2H 2HA1A 2Q5BA 5T5NG 1OSPL 3ASWA 5IV2A 4MJ4A 3DX9A 4BE6A 2E7BA 4KDWA 4BRJA 1S7UA 1EXGA 1USZA 1KIPB 2QFRA 3P3RA 4OAWB 2DQCH 2X4OB 1QHPA 3OMZA 5E1HB 1DCEA 2JTDA 1WCMA 4ELMA 2Q8AH 1PG7H 2XJKA 2E47A 1TTGA 4XAWL 1H9DA 2C3GA 2I5YH 3MRQB 4Z18A 4XNUL 1FDIA 3VXSA 3LRSA 1X7QA 3ETBF 1BZOA 4DOHE 2F58H 1DJZA 2H2SD 2WKGA 4CGTA 4G82A 1UASA 1VHPA 3F7VB 3PWUA 2BNQA 3I75A 3ILDA 4HZLB 1ICTA 3O2DH 3TFKD 1J1PH 5DO8A 4BSVA 4PMEA 3UERA 5DUPL 5GJSL 4CADA 2AAAA 2YD4A 4LL4A 3FU0A 1KXQA 4NKQB 3WFEL 3MFFB 2WXFA 3OPUA 2ZG1A 3DJSA 3V0VB 1JK8B 1SLVA 2QVTA 3ECVA 1LE5B 5FDWB 3TBWB 3Q8BA 1YECL 3GHPA 2CGZA 4WDIB 1A4CA 2H45A 4NPYB 4LIQL 3DDGA 4FG0A 2ZUQB 1DJWA 2WKOA 5D2NC 2AK4E 5E8EB 3RRQA 1MFDH 2R59A 5C0NC 4CILA 1MRDH 1HCZA 3MJ8B 2OK0L 3VXSD 2QZ5A 3EYQD 1OO2A 3CSBA 2EYSB 1IJ9A 2O6EA 3PNWB 5CM1A 3QIWC 4N5EC 1ZWIA 2WYIA 4B60A 1UKSA 2H1LM 3CGTA 4HLZH 2Q87A 2WLIB 2Z34A 5L8JB 4XWGH 3QCVL 2Y5TB 2WM0A 2OM5A 1FFNB 3NIFB 4KJQC 3CN2A 1JGVL 2P46B 5EUOA 3UFIA 3V9CA 2GKIA 4WV1C 3IU3B 4YDLC 4QF1A 5ESQB 3ILPA 1LO2H 5CEYA 1VACA 2ESVE 1G1KA 2W8CA 4MXVE 5FGBA 1J0JA 4EJ1C 2YPVH 3LMJL 2BDNL 4LMQI 2W9DL 2H1XA 2XN1A 4W9FC 4WFED 1KYUA 1BYPA 3RIFF 2H1PL 3QDGB 3X2OA 5L2KB 4FE9A 2JKJA 5D7LB 3CX5J 3ZU8A 3QCUH 3ZRSA 4UAHA 3L16A 4KUCD 3UBHA 3B3IB 4HC1A 1JPSH 2OSYA 1CD0A 2NCEA 4HJGB 4UV7H 2NYKA 2QR0A 3X2MA 2XOTA 4ZPVB 3NCJH 4J3VA 2COQA 4G8GD 1ZHLA 3FCTB 1IGTA 2B8OT 1YRKA 2Y07L 4P46C 4B41A 4LNRB 3IFLL 5F7KC 3KHQA 3QNYA 1URLA 1MHEA 2YXFA 2R0WL 1MHHA 5C0IA 3FTWA 3LEVH 5C0BB 3C5ZA 1J8RA 1WO2A 5C08D 1I8IB 4JY5H 4XB7A 4I18C 4WWPA 4NQVB 3V6FA 1I8UA 2VDQB 5AW4B 4QDGA 1KELH 3MNWB 1AO7A 3EJCA 4KUZL 4YHMH 2WCSA 1PU0A 3MI6A 3VMPA 3L3OB 5CJXC 2AJ3B 1K6QH 3SJVD 1KN4H 2Q9OA 3QDGE 5AL0A 9PCYA 4UTCA 4NWUH 2Y1VA 3TBVA 5TDOB 2LU5A 4OM0L 5AW0B 1QR4A 1T7YA 3CAFA 4F7TA 5IHHA 3CTTA 1FPTH 1SLUA 3DOSB 2EO7A 1TVBB 5L9DL 2QSCL 3MU3A 4OSUL 3LKSB 3FQTA 3X3GL 2NDGA 1KFAH 3HE7C 2WQXA 4KJYA 3NJNA 3A23A 4A67A 2XKUA 2VOTA 3RUGA 1E5ZA 4KRPD 5EOQL 1S9WB 5AB2A 5H4ZA 3HC3H 5DD1L 5E6ZA 3FB7B 3N0PB 4FYTA 4MJIA 4XBEL 4UYQA 3CK0H 4EUPG 4M9OA 4M3KB 1IGMH 2HZHA 1LGVA 5KW9H 3RPKA 1G1OA 5JDSB 4MDJA 2FHFA 3O45B 4GAJH 4AQOA 1KB5B 2NY3D 5SV3A 3NSFA 2CR6A 4LBAA 3CHOA 3L5XH 4M3JA 4P2OD 1NOLA 1TTFA 1IAMA 4MDIB 3RZCB 3D69A 5DZVA 4BHUI 4V11A 1BEYL 4Z7OF 1EK3A 5JQIB 2Y23A 4MBRA 2C1PA 4WI5A 2CJUH 2AJSH 4ZAKB 4QGYA 5ECJE 5INCA 3TBBA 3REWA 2L04A 2PF6A 2BMKB 3FPXA 2KC0A 4NC0B 1LK2B 1RZGA 2GSGA 3MZTA 3QUMA 4QTHA 3UTSA 1JZEA 4JDTH 4Y5VA 1FZMA 1NDMB 2BNRE 2NNXA 4R7NB 5IROD 3RY4A 4WWID 3V0HA 3BGFC 2H6PB 1O7DE 3ARQA 4NO3B 1DQMH 1PS3A 2VYRE 1RZPA 2FECL 2QADD 5DJDA 3TJPA 2CCLA 3F7PC 1JNHA 2FX7H 3HCVB 3L6FB 3BAJA 2IDCA 5JHDA 4C4KO 4F3FA 2V2XA 4Y88A 2ICCA 2VC2B 2HRHA 1KY7A 1R1CA 3FRPA 5HHQB 1OP4A 2IGLA 2OMXB 2VM3A 1YNLH 2WKOF 3KVDD 2XG4B 3MRLB 5PAZA 4PJHF 1PMYA 4C56E 3SYCA 1YAIA 6FABH 4X7SL 3HHSA 5HGHA 4A6YB 2OCCB 2ARWA 4K07A 2DI8A 3NRFA 4TRPL 5IFAH 5GSVA 3ES6A 3SE8L 2I07B 4KTYA 1TWFA 1J9RA 4J1UB 2UV3A 3FTYA 1K5NB 2XPGB 5KSUA 3BSHA 4LLYA 4UT9L 2G4GA 1XT5A 3AQZA 5EUOF 3SBWC 2FEEI 4IDLA 4RQQA 4QNPE 1GMEA 4PCSA 3FH8A 2PXYD 5EMYA 3QXWA 3IAGC 4GG8A 2XFXB 1QVOB 4GP4B 3LN5B 1D5ZB 4MS8C 3GBLA 5LKNA 3VM5A 4LSDA 2ENSA 1HESA 1I82A 2VR8A 3CSPA 2XWBA 3DTUB 3KR3H 2WXHA 5CS7A 3ULVC 3HU3A 2DPKA 2F2HA 5CILH 2BO0A 3IDXL 5A2BA 4HK3N 3FHEA 3UIZA 2YD8A 1TDQA 3Q48A 1QLFA 5EZOH 5I73C 1U42A 4RRPM 4I3RH 4D3CL 4N2MA 3PWNA 1GYCA 3S96B 5I66B 1M1XB 1MCWW 4OCSL 3TCLA 1UD2A 3DVNA 3MLXL 1KLFA 1UXLA 3I6GB 2Z93A 4X5WB 3FUMA 3ZDXB 1WA1X 1QNZH 4JFVA 3GB7B 2AERT 5TDPA 3MKKA 1QSFD 2IBBA 4XI5C 4GRWE 3QHFH 2Y7QB 1JGDB 4NAQA 2E6JA 1OHQA 3VGHA 1B6DA 3NJMA 1UZ6E 3DVGA 3R0MA 3UAEA 2A69D 1NCAH 2UZYA 1QATA 1WRFA 3RAJL 5JIQA 1OM3H 5CSZA 2FHCA 2X0VA 5AYUL 4BINA 1VC3B 4GIOA 3P73A 1NANI 3O3BA 4G1EB 1N0XL 3D39D 5D2LE 4Y4KA 1YJDC 1DVFA 3RFRA 2J55A 4FQXB 2PKDA 4DP5X 5GZNC 4TUOA 2A9DA 3AS1A 1JXJA 1XTLA 3DPDA 3EH1A 3DC0A 3IE9A 3QYCA 1GTNA 3GJFA 4EBQL 5ID0A 1YA5A 3ALPA 4DO5A 2JA6A 2DH2A 2WXLA 4ANVA 1PZUB 5DJ2B 4KDTC 4E41D 3MKGA 4YO0B 3OXSB 5EU4B 4AGNA 4WUUA 5LBSH 4ZI8A 2EINB 3NFNB 4D9RD 4OQ1A 5I1EL 3GMMA 4PJ9C 1I3UA 3JUZA 2EIKB 3D4GA 3U46B 4A6YA 4YHZH 1UWFA 3CFKB 3AY4C 4JFDA 1QDNA 3ARVA 1IEBB 1S5IH 3U2IA 2WBJA 4U1NA 4G7YH 3RURA 5I24A 4KK9C 3TXAA 4ZS7L 5J11C 5MEOB 1UADC 2BSTB 1OA9A 3NIFF 3O0RH 2AK1H 4J7RA 1ORSB 4FHBD 1D3CA 1AQDA 3FU8A 3V5HA 4G3YL 5KOMC 1NAKL 1CQYA 1MAJA 2WXNA 5F9OH 1DN0A 3ZKXC 3LZNA 1E9OA 3MCKB 3U7WL 3D2TA 3ZO9A 4EI5D 4F8QA 4PWKA 3CZUB 1JZHA 3NBNA 1N5AB 4FZEL 4QXVA 1X7TA 5LGHL 2FBJL 4Q52A 2JIXD 5H94A 2CK2A 4FGMA 1PPYA 1F4HA 3UACA 4POYA 3VXPA 1IFHH 4ZMZA 3FU9A 4PGEA 4Z3TA 1YYLL 1NGZA 2W38A 2WMPB 3JUYA 3PHQA 2EEOB 1W0WB 4IYKA 4L05A 2FDBP 1A0QL 4RBPH 3C6LB 5DJ0B 3ZUCA 4ZW3A 3KLHD 1VIWA 3DA0A 1IGCH 1J9QA 4FI8A 1KF9B 4AENB 4MX7B 2WGNB 4HHAB 1CD8A 4NPJA 2ZUQC 5DK0A 1DBAH 3O3UN 5TQ0H 2AQQA 3BSZH 3IMSA 5BV7L 2YN5A 2E7ZA 1G9NC 3GBEA 3MRFA 5CU9A 4Z8FL 1ZSDB 1BX2A 3FOLA 4HGMA 4MLSA 3BKJL 5I26A 5IBTL 3B8YA 4OGZA 5DD0L 2IBZY 4PR5A 4MMXC 4OFQA 4TNWF 2ZWYA 2F54A 2CWRA 2D9QB 2ZXEB 3P1VA 1SYSB 5F7EL 5F70A 1WCQA 1IC1A 1ANUA 2XPYA 3PFQA 4JO1H 2KHAA 4L29A 5IFHL 1EU1A 3GSRB 2Z92A 5JIKA 2D7OA 4X6EA 1NCDL 4B9PA 2J8HA 4QJ5B 1XR9A 3H3KA 1WFOA 1E42A 2XNAB 2H0PA 1U41A 2H26B 4H8HA 3GMNB 2CK0H 5DWPA 5BS0E 3DPBB 2GUOB 2HVKB 3QZMA 3ZK0A 5IT2L 1DLHA 3I2CH 1QTPA 5I1GH 3RVXC 2HFGH 2A1WL 1OTUC 3RPBA 5EIIB 1R46A 5CEXB 4X4MA 5I0YA 3PPEA 3U48A 4Q2ZA 5DHYB 4ZK8A 3T5WA 3QH3A 4EUPA 3QIBB 3E9TA 4RAVA 2JK5A 1L9MA 2OMUA 1Q90A 1ZVSB 2EDJA 6PCYA 4QTIH 4GT0A 4O5LL 4U0RC 2P8PA 2R0ZH 2F54D 3Q3GB 3DJRA 2AJUL 2HH0H 1TYRA 3BT2H 1G7PA 3PNRB 2TRHA 3ZSTA 2FYYB 5IM7B 1ZDSA 3BKMH 5E4OA 1QBMH 2JSFA 4FMKA 4N26A 1DQKA 1V3MA 2WVSA 5ADOL 1WSST 3CVHA 3P4LA 1ASOA 2WXKA 5AW2B 2XXCB 4WHYH 4BQ8A 4EIUA 5IKCB 2PPFA 3BZFA 5ESVB 5IJVB 3MOAH 3F12B 3BO8A 3W38A 3IK2A 4NRXB 4R7VA 4ZMYA 1ZPLA 3CMOH 1AXTH 1F3JB 4X98B 3CFEA 1GSKA 3OJMB 1PZ5A 3GSWA 3B9VA 3PIQB 2JKWA 3D0LB 3HOGA 4MQXD 1CI5A 1LD9A 4HIHB 3OKYA 4GMSL 2A0LC 3DIFB 3FT0A 1CE6A 3GSXB 4LLUB 4L4VB 3RTQD 1EH9A 1GZPB 5DFWH 3B7UX 5H2BB 4AH2B 1EXHA 4U6XB 1CR5A 1IQDB 2YAMA 4X9GA 5EO1B 4UOW0 2HRPH 4IU2B 1CFNA 5G4MA 3OAYK 4LGSB 4LCCB 4D9QD 1PLBA 2WXMA 2NT0A 1P7QB 5BQ7A 5KWYC 3U6RB 2XQBH 2OCFD 3KYKL 4P4RA 5J0BA 1TZAA 5ICZA 3K4DA 1P7KA 1SGKA 4WK4B 3RWDA 5DLMH 3OX8A 3CDGB 3QCTL 3G5VB 3VX0A 5KYWB 1OEZW 1RD6A 3LH2L 3PUUA 4K3EH 4X80H 4Z7QB 1IO4C 1W72A 2BVQA 5J56B 4W4NA 5E95B 3GK8H 1A6UL 3KPMB 4XXCA 2W0KA 3BAKA 3T2PA 3OKDA 1CFQB 3LKQB 3DGDA 3RZCC 4IMLA 3A5VA 3L3DA 4XBPB 4IRZA 5MERA 5ADPH 2G75A 3M1OA 5EEZA 1XAKA 4XOEA 1Y18B 3MA7A 3U6XS 1FVDA 2C3WA 3C60D 4IOIB 1ML0A 2NYZA 3U4AA 3GBNH 1A1OB 1C16A 3H7BA 1QRND 4ZMTA 3SKMA 1KJ3L 1ZLSH 5IQOA 3VU1A 4HU2A 3N9GH 2V45A 5E9DA 3BRGC 5E5LA 1FNHA 2MRYA 4NZRL 3S5LG 4K3JL 1PYQA 3RFZB 2VH5H 3NN8B 4XCNA 4DERA 3WTTA 1TEYA 5EG6C 2UY6B 4PP1C 4AYSA 1FL5A 2J43A 2JJVA 2PP8A 1NJ9A 3CFJA 3K74B 4BXSV 5J13B 4XT1C 5CWSA 3ZDXF 3IKKA 4UILH 3LS4L 5T1DL 2IF7A 1XSIA 4KFMA 1VFAB 5GGVL 4A7UA 3FCSB 1T6BX 2GFBA 3AT0A 1C08A 4K94C 1MFCL 2APTA 3MX0A 3FB5B 4QMEA 3ZIMA 3UTZA 3NDZE 4HWUA 3FUKA 2OXHA 2JA7A 4XMPL 5HDBE 1OGAD 1BIIB 4Q6YA 1F3DJ 1KGIA 2F5BL 4WI0A 4GAGH 4LOFA 4Q9QL 3ZX1A 1BFSA 3BGAA 4M6OL 4PRIE 2FTAA 2QEJA 5CR1A 4RDBA 3JTSA 5JXED 3M1BB 2DQMA 4I5BB 4JHWL 3KWWB 4MVBD 2XKNB 4K3DH 1BOYA 3C8KB 4OR1A 1G87A 1D9KB 1RZKC 4WI2A 3BFWA 5DTFB 3BRFA 2GSMB 3KPOB 2D03H 4MMZB 1GGCH 2AXFB 4LGPB 1YEJH 4HEMA 3U30B 4QXGH 4ZTPL 3P2BA 1G5AA 1S7SB 2Z8WC 1CK0H 3PV6A 5CJQH 3LB6D 3VFSB 4LLWA 2QGBA 3QDMB 5F6HI 3CSFA 2NY4D 1QFUH 3SDAD 5C9JB 1KQFA 4L2YA 4HWBL 3WFBL 5HVHC 3BFQG 3SCMA 5CBEA 4GOSA 1NFDB 3L5WA 2EIJB 1OZUA 5KVEE 1JK9B 5ISZE 2AEPH 3K8KA 1XMEB 3LZRA 3JWOH 3SE9H 2WWOA 3OZLA 3PGFL 1GHFL 2DQFB 3MJ6A 2APSA 2MNWA 3QZOA 2P8LA 3MGTA 3DSNB 4KOBA 4YGAB 3VI4E 15C8L 3BAXA 4B6ZA 1INDH 1D5MA 1KTCA 4PJAA 4EOWH 3IJYB 3MRMA 4OBRA 1JYNA 2V8LA 2PTTB 3IR5A 1ET8A 1MG2C 5HI3D 3ULVL 3MOBL 2RR3A 5BO1L 1BMWA 3WHXB 4F93B 1CGVA 1P7BA 4Y2OB 4D0CA 1KPVA 4E5XB 5C2BH 1NEZB 2X7LA 3GDCA 3GXIA 5EZLB 1T7ZA 1I7RA 4FQXC 2NR6C 1XF5B 2VE6A 4NO0D 3QDME 2ZOLA 1LQBC 4HS8L 4WNQA 4YNYA 3TPKA 5KTEH 1I8KB 2DI9A 2WZ5A 4PS3A 3T1FA 3A3YB 1RPKA 1RP8A 4QHLB 1NFDE 5D5MA 5JYMA 3TP4A 1H6FA 3WEBA 4JPWH 5JQ6H 4LSTH 4GKSB 3MLPA 1T4KB 1MUJB 1UJ3B 4LVOB 5B1JA 1VADB 4BQ6A 3GUFA 2ICWA 2EYRA 2N7AA 3HG1A 1CGTA 1F41A 3L2MA 4JRYE 1OKEA 3UYPB 3GHEL 3ESMA 2HFEB 3M6DA 5IGXH 2I9TA 3EJQA 3NH7L 1YJDL 4RRPG 3BLPX 4BFIB 1KCKA 4J2XA 4KODA 4JFPB 1AP2A 4LLQB 5C6TH 4XCYB 3JXAA 2YC1A 4OCWL 4UI2A 3HRZC 2OTPA 3APDA 3ZIYA 2IXQA 4ADJA 4FF9A 3ZRFC 3IAPA 2CIKB 3CFCH 4QAWA 3HU2A 4TQEH 4M6MH 3IJ8A 1MRCL 2GCYA 2BRRH 1AAJA 1CLZL 3EOBA 1CQKA 3KLAA 3C87A 5DC4B 4NQQA 1LILA 5A6MA 5E6SB 1K8IB 1TOXA 2EDYA 4HV8A 3B2UC 3B3BA 3GEWB 4FFZH 4NQDB 5FV2A 3MDJA 3ZRCC 4B9JA 3UAJA 2XN9D 3UZQB 4AG4H 4FQQB 5F0LB 4NNXA 3VH8B 1RPUA 1IRAY 2Y6SD 2YFOA 1QFWH 4JB9L 4P2QE 5TQ2H 3EXJA 3VUAA 4AQ1B 4AGOA 4TVUA 3QZPA 1TQCB 3D05A 3EO0B 5HHXH 1XF3A 4XE0A 2QLVB 1GY1A 1XTMA 5I71B 5C09E 2CW0D 3C6LC 1L0QA 3VRLE 1SEBA 4ODXA 3EBAA 1S6NA 4L3CB 3GS0A 5FGRA 5IVNA 3OPZH 3V7MA 3SUJA 1FE8L 1G7JB 3P3YA 5CO1A 2VJXA 2WTPA 1CICD 1BZ7A 1G7QB 4K55A 1EJ8A 5K9OB 3Q6GL 4PJFB 1EFXA 1MF2H 1D5BB 4Y2DA 1GJUA 1CDJA 2XVGA 4G7QB 4WI7A 2NYYC 1B2YA 4B97A 4UINH 3OGOE 4ZM7A 4P57B 1QW9A 3PGCA 5D1XA 3ZGHA 2ATKB 3LPPA 3CC1A 4MNQE 1BQHB 2WSDA 4FZ8L 4OIAA 3OAZK 5GS0H 1PQFA 1YUKB 5IJKA 4LF3A 2VDNB 2HT4D 1MHPH 2FATL 4LASL 1AS6A 2O5ZH 4OJFH 5BUPA 2VO5A 1JBJA 1GGBH 2QTVA 4LVEA 3UTPD 25C8H 3R8BB 1GYVA 4TULL 4M7KH 1OF0A 2EDMA 2PYEE 3AROA 2BVPA 4ZSOB 1MCEA 3S37H 3VFTB 1RZ7H 2IJ0C 1WS7A 1G7IB 1V7MH 4HJ0D 1MCJA 4DTGH 3WY3A 5I30H 4DKEL 4UU9B 5C07E 1WA0X 1T21A 4NJAL 2AGJL 5JPMB 3WNIA 3DO7B 1NBYA 3AADB 3CD4A 4MAUL 2NY0B 3QIBC 2I85A 4Q7DA 4GW5B 3OC5A 2ROYA 3BZEB 4UIMA 2B3IA 4KQ4L 3E1ZA 1UM5H 3LNEA 4YSQA 3OKEA 1HNGA 3LKNB 4CW1A 2A5UA 1CMOA 2H3NB 4Z7QF 3TJHD 4GRMB 3MROA 4JO5A 1GPOL 2MFNA 5B3NA 5GZOA 4APQB 2IG2L 4Y16A 5D55A 2E7LA 3BPOB 4JRFA 4ZQKB 4GO9A 5JHLL 1JWMA 1E60A 1PEWA 3AZUA 4AMXA 1XSJA 5DRZA 2F8OA 4JG5A 1OWWA 1ZS8A 1SQ2N 3BVNA 4BUHA 4C55A 1TNMA 1YEIL 4ZSOE 1UHDA 4DPBX 1SFOA 3FTGB 3HAEH 5D6CB 3DX7A 4OD3H 4MQTB 5E2UH 4QKXB 2P5ED 5CZRA 1RFDL 5KYUB 3K3QA 1Y6NR 2OMTA 2E27H 1QQDA 1Z6JT 3VFMB 1P84K 4BE5A 3BT0A 4JQIA 5C6WH 2FYVA 1NLBL 5EBGA 2H0FA 2CLRB 2GJRA 4BKSC 5H4UA 4XHQA 4B9YA 1Q9WA 2EVIA 3L3HA 2BIMA 4DHLA 2C9UA 1HINL 3BQVA 3NCXA 1I9RH 3GC3A 5DD3H 3P11H 4UZGA 3RI5F 3SKNB 3MRIA 4JN1H 1KT2A 4G6KL 3VFPA 2F74B 5EOTA 1EMTL 4PJ8D 1JMZA 3CPLB 3CFBA 2VAAA 4YBHA 3ZKND 1N5YL 2Q76B 4JFZL 2VDQL 2EE6A 2IPUK 2ED8A 2CO7B 4IU3A 2YBGA 2BW5A 2XN2A 1I1YA 4MKMA 5CP3H 2GHZA 5KSAC 1N0LA 4CU7A 1L3WA 4WRLA 3SO5A 2AJXL 3G5XA 3T71A 2PCYA 5DRXA 4QHMB 4G8AC 3TBSB 3IXAA 5EDSA 2TAAA 3ZDWA 4F9PC 2H0JA 4YPGA 1I1AD 2DLTA 3H3PH 5J6GA 2J12B 2GC4C 5AL8A 3GEFA 1Z5LB 2J8UE 1FHNA 4BWTA 2P42B 3N06B 3DIVA 4FQIL 5K9QG 1RJYA 4Y5XC 1E5AA 1UCTA 3BCFA 5TDNA 4DKFH 2YBRA 1T83A 2OTWA 5DO2C 1CBVL 3K72A 3X2LA 2QVIA 1ZA6A 3ASNB 4ABQA 5F96H 2R2EB 5FECA 2JKTM 1KB5L 5IB4A 4KDVA 4HK3J 1R3HB 1W80A 3E7JA 1U4EA 4GW1A 5JW3L 5LQBH 1G7MA 1F6LL 4F9LC 4XXDB 3Q01A 1I8MB 3KM2A 5KG9B 2FE0A 3N85H 3QIUD 1KBGL 3QQ4A 3JWNE 1P4BL 1MH5A 2KH2B 2X4QA 4XVSH 6PAZA 1KEMH 4PS4L 3L3IB 4F2MA 3UYRL 4GO8A 4JO8A 5F6IC 3P4MA 3KH3A 1N3NB 3TNMA 3W81A 4FS0A 3ZDZE 1JZIA 1JZ4A 5F7AA 1P4IL 4J5VA 5EB9A 3HU1A 1JHTA 1UOLA 4OGYH 3H9SD 4FMFA 2MQCA 4IOFD 3IDMB 1UEYA 3W1ZA 3DOHA 5I6LA 2HG0A 5D72H 4DK6A 5D7IE 4JY6A 4ZTOL 5HYJD 3US9A 4XCCH 1M1SA 1OGTA 5F1OB 1L7IH 4NUJA 4EVNB 2WO3B 5DRNA 4JY4A 2VC2L 4ZD3L 3MUHL 4XNMB 5KN5B 4L8CA 4WIQA 5FDYA 1H5BA 1YSOA 1IV8A 4OLXH 4LKXB 3SE3A 3VFRA 4L48A 1X5FA 2BOBA 1TU2B 3F6IA 4PWJA 1OARH 4U6YB 4P5KA 4HKBA 2RCSL 1ECYA 2JJSC 4FQLL 1EO7A 3E6HA 4OZGB 4S1RL 4TUKH 2BFGA 3ATDA 4RRPA 5D1QD 4KRLB 1U6AL 3EGDA 4GI6A 4YDNA 2WP3O 1P69B 4UNTA 3FO1A 1RSFA 3P0YL 1URZA 2HWZL 2ZUSA 3S36L 3RL1A 1NMBL 3GUTB 3PWVA 4E2OA 1C5CL 2MEJB 2XQ0A 2ZCLH 3PHOA 3L3KB 3ARTA 4U6HB 2OMZA 3ZHDA 2EH7L 4I1NB 4XNXL 5FTJA 1E2VA 3MJWA 1ONQA 2H5UA 2NY2D 2O6CA 1AG6A 2WSPA 3I85A 4JMNA 5SWSD 3SZ6A 3CQZA 3ZPDA 5BMFH 2BZDA 3GS7A 1F02I 3KLKA 3N44B 5FUCE 4DP7X 3TTYA 1XGPB 1D5IL 1NZRA 5KVMC 1F6AB 4OCRL 1BOGA 1HHGA 1BQ5A 2W9EH 4CC1A 1TJIH 3V6ZB 1EEYB 4GG6E 1KIRB 2FVNA 4IDJH 1H3VA 1PT1A 4P59L 3IR6A 2CDFA 2E6PA 1EHKB 3HZ3A 3QS2A 5EWIH 5FR3A 3CH8A 1SVCP 1NC2A 1S5HB 3WFHB 5LBVA 4Q4IA 4WGVB 2I7SA 5JDJA 1AD0B 5BUAA 3GJFK 5FHBL 2BWIA 4KHXL 4KC3B 5AB0A 4PWFA 3VI3A 2XYBA 3MUGA 1KCRL 1UJ3C 3LIZA 4CMMA 2Z31B 1ZV5A 2PR4L 2WN2A 3EFDL 5DS2A 3FH5A 1E6JL 1NSNL 4UANA 4LCYA 3TZVA 3QEQB 1H8LA 5EPMB 4HDIA 5AQ0A 2NX5A 3WEXB 5D7JA 4W9LC 3VXRD 4XN2A 3P54A 5A16A 1MIMH 1M3JA 2Z4QA 3HRPA 1MOEA 1BBDH 1WAAF 1RIHL 1YLBB 3D3VB 1A4KA 1DQVA 3AWEA 5AZUA 2VLME 1KTJA 5IB2B 4X9FA 4R7XA 1MJUH 4Q0XL 4PIBA 1KIQB 5ETUA 1L9QA 1JUFB 1NC4B 3TH2T 2EIEA 1WP6A 3FJTA 3GSNA 3I9GL 1JZ8A 1P6FA 1BXUA 3EYOB 2F18A 4KX9A 2ARJB 3RU8L 3SYOA 4FKKA 2BIQA 3OKKB 3EH3B 4FOMA 3F6JA 2G0KA 2QVMA 4AQ1C 1N8ZA 4TPRH 2X44D 1T0MB 4BWUA 4PJCA 2EJ1A 4ELKA 4UM9B 2DQTH 4LVNB 4XMKH 2Q7YA 1AE6H 5C2UB 2GEQA 4APXB 1Z0NA 4KWUA 1A9BA 1IGJA 2NX5D 4RMUA 5DJXA 5I71C 1KCVH 4I8DA 2XY1A 3GIVB 5DT1L 5FFOA 3T4AB 4BZ2A 2XYCA 4PGJA 5C0ND 1RUKH 2L0DA 5JOEA 4HISA 1CFMA 3FTZA 5EC2A 1DBJH 4H25A 3QIWD 3ARGB 1SXSA 1MREH 1SXNA 4N5ED 4W9CC 2AMUA 3WIFA 5H37H 5E6IB 5EZIH 1QEWB 3V0AC 1MW0A 1NANH 4LNVA 2R92A 4GSQA 3QZBA 1SDDA 4YBLB 4GUOA 4QXTA 3MV8E 3WEOA 3KDMA 1BM7A 1VERA 3TBTB 3QDJA 4PP2B 1FLRH 1PLAA 1XD1A 1X6LA 4P46A 1RQ5A 3V95A 1XB3A 1ZLUK 4EI0A 4K23H 2VZVA 5DQJA 4PLOB 1IVLA 4OLUH 4I18A 1JPFB 4PV8B 3AITA 1IAIH 4ZUUA 3VXME 1UWGL 4CSSA 1R47A 1SJXA 3HI5H 3B7TA 3MRJB 1K72A 1IGYB 2R0KH 1IEAA 2K78A 4QRQA 1KWKA 1KV7A 5JPMC 3CXDH 2GJ6E 3WJLC 4TLTA 1WZKA 4FJ6A 5ALBL 1Z9OA 2HUHA 1RHFA 4MRBA 1DEEA 2IQAB 3EDKA 2IALA 4PLKC 4OZFG 4YFLF 1DQDL 3HE7A 4FJYA 4X6FB 2VLRA 4OUUB 4GLRI 4P5TB 4L9LB 1PKQA 3LQZB 4OFIA 1VLXA 4P46D 5GQBA 4AMKL 1F90L 1ODAA 1M9WA 3DTXB 1RI8A 3KPTA 3LKOA 2YUXA 3BPOC 1IIIA 3JWDC 4TSAH 4XC3L 3NJXA 2AI0H 4UMSA 4OVUA 2F19H 3C5SB 4NUGL 3LXCA 3MXVL 1FO0H 3CFIC 1F1AA 4PS8A 5D70L 5CGBA 4TQIA 4BFRA 3GXMA 1DLFL 4UTAA 3RVWC 3NEOA 3NZHH 4AGPA 3S5ZA 2NAPA 4P4KA 1CD1B 1E8YA 4P06A 4LBEB 1KG0B 5DQ9B 4YX2L 3GSOB 2BVEA 4ZW7A 4UT7H 4DVBA 1NOAA 3RKDD 3OJDB 1TMQA 5AVSB 3GJEB 4JRXB 3ISWA 1QSEE 1FFRA 5IMKA 3U36B 1QA9B 1R3IH 3LAFA 3QWRD 1ETA1 4DQOH 3B7RL 1PFOA 1UB5B 3AAZA 3GD1C 3HE7D 2NYAA 2AEQH 4JHBA 1KPRB 4GI8A 2A4EA 1IQWL 3V0EA 3AJ7A 3WKYA 3CFNA 1FBIH 1PY0A 3BWAA 3KWUA 1S2EA 1KBPA 5BXFA 3SD2A 1BZ9A 2Y5QA 4DGWC 3MBEB 3BP4A 2PPCA 3ETTA 1FFPB 3IFPB 2PYFA 3VJ6A 5C0EB 3UBXA 2FL5B 1PZSA 2A9ML 4Z0BL 4HUXB 4B0MB 3L5HA 3JWNC 1UFUA 5EF0A 1EUTA 3KPRA 4KNSA 4RAHA 3O2WH 3EH4B 3RDTB 4JJ5B 3SDCB 2FIKA 3BWUC 1L9SA 1R5VB 3GLAA 2E8ZA 3BN9C 2CKBA 2UZIH 3BP5B 1V27A 3T2QA 4YSSA 3BAEH 4Q6KA 4YPJA 1R5WB 2B0SL 3B9KC 4L1TA 2XT1B 2DLHA 3H9HB 3OLDA 4OZGF 1LEIB 4JG1L 3EIFA 2XIBA 4I2XE 3V6OE 4JCLA 1B6UA 1FORH 4Z7VE 1P7HL 4HGWA 5B21A 1MJJA 4PJCF 1N7MH 2YD1A 4AJWA 5I18H 1U33A 1GYUA 1KTLB 1XEUA 5CZVH 2MPAH 4PRNB 3B2VH 1B0RA 1OAZH 5F89A 4G8IB 1YMHA 4OLYH 5DYOB 3KJ6H 1MFEL 4JPVL 2FX9H 4ODSL 3F7KA 4G6MH 4PU2A 2X0WA 3C6SB 1NWPA 1NIEA 2EDOA 3TPUA 4JKWA 5I6OA 4G5ZL 4FFTA 3DYOA 3N44F 4F7EB 4ANKA 3AG2B 3HS0B 3PJSA 1JZGA 3IVKA 2EIMB 5EBWB 3QI9B 2X2HA 4UTBH 3MRKB 1JRHH 4HW6A 3D7PA 3FZUC 5DMJB 4KFZC 5DRWB 3ULUE 4BELD 3MLZL 2XXFA 2ENQA 2Q7NA 1SXBA 5IK3B 1ITCA 4LPXA 2JCCE 1PSKL 3HVDA 3QEGH 4X6DE 2JE8A 4KI5E 1S8DA 3EXLA 2IBZX 4CC4C 3INUL 5FUCC 2MOQA 4LCUB 1KJVB 3MRCA 5AZEL 4PWIA 4MS8D 2ZONA 5KANI 3FW6A 3BOVA 2JKRM 2RBLA 1TVHB 2DYPA 3ULVD 2UYLA 5GZNA 4DGYH 4M8QB 1UJTA 3VXNA 5HP5A 2HFFB 2F7OA 1CL7H 3WL9B 3QDAA 4PW9A 1OF2B 1MCBA 1WICA 3LJ3A 4RWHA 1HSAA 4I9WD 2RHEA 5HPMA 2P3YA 2X6VA 4RGND 5GS1A 2VTFA 4KDTA 2VDOH 2UZPA 3QJXA 1F11A 1DVSA 4LCIL 3OMAB 4PJ7B 1WZMA 4DFIA 8FABB 1FZJA 2YJQA 1IT9H 4IMKC 4PJ9A 4YLQT 5CD3A 5GRWA 2JQZA 4QD2E 2ARJQ 1ES0A 5HHME 1N18A 1NFIB 4U4IA 1AHWB 5FYLE 3O3EB 5E8PA 3V8OA 3BD4A 1M57B 2O5XH 3UG4A 5E94A 5TTRA 1IZKA 4R26L 1KXVC 3G04A 2KDYA 4NOFA 3LZFH 1PJ9A 2AK4A 2Z7UA 5I9QB 2E9GA 3QXDB 4K9EC 4NRYB 1UEMA 2NSQA 1N68A 5FV1L 3U79A 2LLGA 4NI3A 1LEKA 5K9KB 4HIXL 5HYFA 1LEGB 3NABL 4G7VH 3NAAH 1A7PH 3Q5TA 2CJ3A 4LQFL 4ACTA 3NJJA 4Z5RA 4X4KA 1P1ZA 3EAKA 2DIEA 3KGRA 5G55A 4NRZB 3RI5K 4PJ9D 1FVCB 2ZJSH 5EIVA 1J48A 4GY4A 1HH9B 3WUZA 4HIIB 1FFQA 3S35L 4GKLA 4LEOB 3BKYL 4FQHB 4W70A 7TAAA 5KSVB 1GR7A 2BC4A 2ESVA 3QULA 4ZXBC 3L8QA 5ALCH 4KK9D 1ILSA 1IBHA 1NCWL 4PG9B 3GSQB 1JPGB 1T0NA 3PWPB 1ADQA 2Y7NA 1RUMH 4NHCL 4P3CL 3U0PA 3LNFA 2IWFA 2G2RA 3EOYG 3TH4T 3TVMA 1QO3A 4Z7WE 4JZOB 2ZXAA 1S7XB 3HMWH 4GP8B 4MMXA 2C5DC 2AV1B 1CGUA 4LHUG 3WG7B 1DEDA 4KY1L 3IETB 3THMH 3QZWG 3BPCA 2RMNA 2D7NA 4LSQL 3PREA 2PABA 4TVPH 4FNSA 1GJIA 3CVBA 4MNGE 4WAFA 3M1CA 5FUOH 2JVUA 3VYOA 2VDMH 2JI3A 4P2CG 3M3GA 1JDAA 5EU5A 2OL3H 4I3SH 5FC9A 5AB9A 4JP7A 4NENA 3SGEI 4YR6A 3QORC 2OMNA 2BSCA 1IC4L 2Y7LA 3DYPA 1PZDA 3ECWA 3FT3A 4IS6B 5AVUB 2HKHH 4OZFA 5C0GB 1LTXA 1VEMA 4FAAB 5HGAB 4ETQA 5FA4B 5JHLA 1A2YA 1KCSL 1U93A 1WPCA 2MQGA 4D0DB 1KIUA 3R4DA 2ZOUA 5EEXA 3WJMB 1QBLL 1MI5E 1U8MB 2BOCA 5I0ZA 2IIJA 3QO1B 4N2CA 4O51A 4F37K 2B9AA 4U6VH 1N59B 1ULVA 2BY2A 4OF0A 4TUJB 3FT9A 4PFEA 1AI1H 1PCXA 3WIIH 4YBLC 1E5YA 3MLTB 4GBXB 2PW1A 2HLAA 4JO4H 1UH2A 4NC2B 3E9UA 2FUQA 5I1IH 2FB4L 4L8DB 1VZHA 1ZE3H 1PLCA 3KPQA 3LXUX 3GIZH 2O30A 1U8OB 2QLYA 3JYCA 4XRCB 3STZB 4ZNEE 1CU4H 4QGTA 1RK0B 3STBA 4NCC1 1B0IA 1RVFH 4AONB 3NFSL 4I1PA 3VGAC 1PZCA 5LUMA 2BFVL 3BQUB 3FO2A 4Y9BA 2R4SL 4LCWE 5J12C 4XX1E 1GKEA 1RIUH 3RVXD 1UA3A 1OTUD 1HZHH 3S5YA 3SN6N 1UWEL 3VRIB 3O8XB 3QDGD 4DAGL 1ZTMA 4ENGA 4WI6A 1JS4A 3QJFB 3D08A 5B1AB 5L2KD 3C09C 1AIFB 1YNKL 3CLEL 4MA3A 5D7LD 4MJ5A 6CGTA 2VQTA 1DVTA 1U8NB 4HIJA 4EE2A 3ZY7A 5A6LA 3VWJC 2NSMA 4H26A 4WEBL 1EGJH 5FM4A 4ZFFB 1BFTA 1U92A 5F9AC 3D18B 2WJ5A 2VDNL 4YXLL 5IMMA 1J0ZA 4UIKL 2BP0B 1ZT7A 3W0WB 2HG5B 5GHWH 2CIIA 2BNRA 1J0IA 5F1IA 1OE3A 1DDHA 5E4EB 2OMWA 3RYMA 3VA2C 1AANA 5DHEA 3X2IA 1QCSA 4MQSB 4UUJA 3WFCL 5LDSA 1BVLA 3V4PH 3O41A 2N7SA 1E9QA 4GO6B 5CSGA 5C0BD 1C5BL 1RZJL 2P5WE 1XWVA 2XTJB 5FIEA 3V52L 4W93A 3UBFA 3ML8A 1IGFL 5HYQA 2AW2A 4FA7B 4KKNA 4X5XA 4KJWC 3RY6C 1DFBH 5DMIH 2ITDA 2X4SA 1OAKH 5FYJH 1JDDA 1SXCA 2R7EA 5T3XL 1MFVA 4C56A 1TZGL 2ZKMX 4RFNB 2A74C 4PRDB 3GLEA 5DHVH 4P23B 2HKFH 2IFFH 3NYKA 3LY6A 2XG5A 2CUIA 5IY5B 4TTGA 1XIWB 1G1YA 5B38G 2BNRD 3OKOB 3EYUL 3LZPA 3SYPA 5E5UB 3W0WE 2DJ4A 4KY2A 2GSIB 3VFUB 5E9AA 3V6OC 1CT8A 1K4DB 3WMQA 2VN3A 1S7WB 1J8SA 1G6VK 2PTVA 3VSTA 3EYVA 4JN2A 3OR7B 1IKNC 4AZ8B 1LO5B 1RJZA 1RZIA 4YC2C 4AE1A 5LCVL 3W9DA 2X0UA 3LYRA 4WO4B 5J6HB 1RMFH 3BXNA 5FYKE 3TCXA 3Q5OA 3RZCD 5KVFH 2E8YA 4XMLL 2V9RA 1GY2A 2OR9L 4C56D 1IBBA 3A6BH 3HUJB 4ZAKD 5C0RH 5CGYC 1AR1C 2I32A 4XO9A 1YDPA 3JT0A 2P8MB 3BEWB 3JSSA 4XNQB 3RDTC 3O4LB 3QDHA 4Z78A 3ARPA 4WNSA 1QWNA 2OBGA 5DDHB 1HJBC 4Y8AA 1GJWA 3WD5H 3TU6A 4JFYA 1VKXA 3CXHJ 1XBRA 5DJZB 2ATPA 3GKZA 4YZFE 1BHGA 3ULUC 4W81A 4JVWA 4WVRA 5C0JA 1RURH 3FB6A 1MW2A 4DGVH 1A6TA 2BWQA 3ISRA 2IV9A 1S9KC 1XCTB 4X4YB 4L8BA 2NLJB 1FFTB 4LL1A 4PP1D 3N55A 1INQB 1O5DT 4WW1A 4PJ7F 1PPIA 2DQCL 2FSEB 5D2LA 3AMLA 3WS3B 4LDCA 3W9EB 5JPNC 3EHBC 1PYUB 1SN5A 2Q8AL 1PG7L 4RNRA 7PAZA 3NSJA 3L5JA 2I5YL 3AXLB 4ZOEA 3F7YA 5L6YH 3HHMA 2PUQT 3HUJE 3TNNA 1RIVH 3ZYIA 5I2IB 1O5PA 3HB3C 2PW2B 2F58L 5EO0B 4KQ0A 1U8JB 2OR8A 2EUVA 3PPSA 1G6RH 1B4JL 3UTTB 3HS0C 3O2DL 4Z7AA 4CNIB 5IG7A 1J1PL 3QJHB 1MDTA 2J73A 3RLSA 4U2ZA 1VFBB 5KUMA 5KBDA 3U1SH 4E9RA 2P43B 1EZSA 1FJ1B 3GMPB 4M5YH 5AKRA 1ZVYA 3WTWA 4M00A 3V5DA 1J0YA 3K2KA 4NKOA 2HSIA 1SVZA 5IREA 4ZX6A 1EO8H 2JA5A 3ARWA 3D25A 1UACL 4M48H 4H4NA 5CUSH 1HS6A 4LO9A 1MFDL 5K59E 3JZ7A 1MRDL 1TEGA 4AAYA 4DPRA 1MLCA 1J18A 3MRRB 1D5XA 2BHZA 1J8HB 5LGJA 3VQMA 4GRLB 1KBKA 5HBBA 1U3JA 1A65A 2EO1A 3J2PA 3SY0A 5GGTL 4N2LA 1KCBA 1V10A 2K9UA 2B2XH 5F7NC 1KTKE 3UX9B 4PBVC 3PYCA 3WV0A 4RAUA 5SWQB 5DD6A 5ANME 3UH8A 1NGXB 1XCQB 4A7GA 4L4TA 3EGSA 1G1CA 4U1KB 2YHGA 2FZ3B 4LHUA 4AZUA 1CGSH 1MKFA 3QUXB 1YEDB 5C8JB 3QZWA 4TLUA 4WJ5A 3NDYE 4Z0XB 3Q7JA 4CN1A 1BVNT 4UOW1 5T3ZH 1LO2L 4JDVA 2AABH 3HRZA 3RWHB 3LOWA 3VDAA 2YPVL 5D7HA 3MREA 1UYWL 5DC2A 1I7TB 3CU1A 4FQXD 3WY1A 2NR6D 4DN3H 3GGWB 3IFNH 3JT2A 3L45A 3QXAA 5CBAA 1ZV9A 4A7QA 3N1MC 3E38A 4WW2A 1JIBA 3LEXA 2P26A 4AUUA 2X4NB 3B34A 3HAEB 4ZTEA 1R4XA 2W9LA 5FF6B 4LK4A 2Q8BH 1OLLA 3LIUA 4KGLA 4PJBB 4JQVC 5E99H 1FYTB 1JPSL 2ZNWA 4GPVA 4RZCB 4UV7L 1FNLA 2DD8H 2FH6A 3C5JB 1E2WA 3DUUA 3R06B 4FFYA 3B7YA 1YEFH 4ZUTA 3U82B 1KOAA 4RMVA 1NEZG 1FWXA 3SYAA 4TN9A 3OB8A 2N1KA 2AEOA 1SFDA 3RGVC 2WTRB 4YJZL 3LEVL 5BS0A 2MHAB 4C4KT 1I8LC 3HZKA 4JY5L 1AXSA 1JCVA 4HJSA 4PWEA 1XH0A 1R3KB 4ENED 1AFVL 3GMRB 1AJ7H 1KELL 3EADA 1EJOH 4L3EE 3AABA 4YHML 5HSFA 1CLVA 1QMUA 4JKPH 4YE4H 4KH9A 1QSVA 2NCMA 4MD5A 3N3EA 2BIIA 4NT6A 4NWUL 4OF6A 3ZHNA 1AA6A 5KVDE 5GSRB 3BHBB 3WFDH 4X8JB 1FPTL 4JEGB 4OFPA 3GXTA 3TTSA 5D9SB 2M26A 2WINB 3BUPA 3T2NH 1KFAL 4MCMA 2ZOWA 5HVFB 2NNRA 4K2UH 2IFGA 2X1PA 3QWOA 4J3OC 1N6UA 1N4XH 2A73B 3HC3L 3PQYE 2X4PA 3MLUH 3MODL 4HCRH 4PY7A 2LFEA 1WBXA 2DB8A 5C0CE 1OB1B 3RWFB 1P6WA 2ENJA 3C6LD 5BS0D 5IQNA 4H2AA 1IGML 2ADFH 2RALA 3WJJC 5KW9L 2KQNA 5GIRA 1O6VA 3BZ4B 3NPSC 4GAJL 4L1SA 2EUXA 5EN2B 4OGXH 3FTSA 3L5XL 5BZDB 5TF1H 1YMME 5JHAA 3SE4A 1G0YR 2ZXWB 2HTKC 3CX2A 4IKJA 1OAJA 2G3XA 4YVUA 4OLWH 3TFBA 3WUWB 4HPOH 4DKAA 5K9JH 2Z3FA 1NEPA 2NYYD 2CBMA 5GRVK 5HDOA 2CJUL 2AJSL 2CD0A 3UABA 2DOCA 1RZ8A 3GTQA 1RHHA 2K3HA 3BESR 1OSYA 4NN5B 4QR7A 4GIAA 4QRSB 1ZVHA 4U05A 1YY8B 3EO1B 4RFEA 4XPTH 1QLRA 3FF8A 1NBZA 3UJTH 3PE9A 1JI1A 4PRHB 3GMOA 4GBXC 3EYFB 4LLVA 4PVMA 4DT2A 4JDTL 2HJLA 1L6XA 4Z3EA 4LMQE 4W6YB 3GMLB 1SOQA 5IVZA 3VFGL 4DSYA 1FVEA 2V4LA 4IBQA 2AKRA 1XGQB 3MLRH 3V0IA 5DSCB 1DQML 2AZUA 4PJDB 4ES9A 5FW6A 5B38A 3QHTC 4M7ZB 2IANB 2FX7L 2KZBA 3MR9B 2NY6B 1MWAL 3SDDA 5HHNA 2WXJA 5EU3B 5M94B 1CD9B 4OLZL 3FFCB 4LT7A 1CXKA 3OHXC 5D7SH 1TTAA 3O8XC 4KZDH 4I48A 5T1LB 1BQHG 3DHJA 3QIBD 1XGUB 1YNLL 1IBFA 2QKIC 3G08A 4BZ1A 3ORJA 4HWZA 3ZJAA 3ABMB 2F1EA 6FABL 1E5CA 4NKMB 2ZD0A 3QUYC 1VSCA 2JJTC 4MQ7B 5ICYB 1CFTA 4Z7NB 5A40E 4TL5A 3OKMA 4KDLA 2VDPH 5FYKU 1T1ZA 1CF8H 5JMOC 3HHRB 3VD2A 4BFKA 1YAZA 2CALA 3HI1B 4UDTA 5LG6A 3DX8B 1X5KA 1HDMA 3V5KB 4A7GF 2LFGA 2BIHA 4AVHA 3JWOC 1U9KA 5KSAA 4IRSC 1KBWA 4XNZB 2YPLB 1FN4B 4PJGB 3UGUA 4GH7B 4NM4L 2AXWA 2DH3A 1EBPA 1AYRA 2XTJC 4X7FC 4Y9CA 5TFSH 5F0PB 4QXUH 3AS0A 4XBGA 5I17B 1SOXA 1UVQB 3D85A 3VG0H 3UZVA 2R69A 4G70B 4EMZA 5CJOH 4W6XB 2OZ4A 4H8VA 3U2JA 2X4UA 4UNVA 4A37A 5CILL 2XWZA 4Y5XA 1FRGH 3HA0A 4RFNC 4WW2F 1HHJB 4L4VD 2GJZA 5EA0H 3VXTA 3RJDA 4OZ4A 4P23C 4AL8C 1O7SA 3ET9F 4I4WA 2AS5M 2HCZX 3VFOB 1YEHH 4LPTA 1XIWC 4AQAB 1TZHB 3TJEH 1S7QA 4YWGH 4PRIA 4MHHI 1PD1A 5IESH 3V0DA 1QNZL 1UOKA 1SLXA 3OR6A 3QHFL 3KNBA 5HJGA 2H32A 2B5IB 3QC5X 3FQRA 4ODWB 1PDKB 4WFEE 3ZQXA 3QEHA 1NCAL 1HC1A 1JWSA 3DV6B 4XXWC 4Y4HB 1OM3L 1NM9A 3D85D 1A4JB 3L5IA 1DE4A 2DS4A 3ZVVA 2H7WA 5G2NA 2O5NA 1OSZB 4N9GA 3TO4A 3HLAA 5DC0A 2WXPA 2VLKB 3F7LA 2C3VA 1FNEB 4PW3A 3QYNA 3T8XB 2VXVH 5JO5A 3PJNA 1B3IA 1BFOB 1DHKA 3EW3B 3MRBA 3H2PA 3LCYA 5DO2D 5ISZA 4QRUB 1W8EA 2G5UA 4G8GE 5AOJA 1TZIA 3E1F1 1SN2A 2A83A 3CN1A 2R93A 3KLDA 4GXFA 4PRID 1XZ0A 1T1YB 2CLVB 5JIDA 4N2GA 3VI4A 1QKZL 1A14H 5HHVL 4HXAH 3JWNG 5LBSL 1LNUB 1Q0XH 5C08E 2ITCA 5IWLA 2FWOA 4YHZL 1SBSH 5DUMH 2A6HD 2K3TA 5E0QA 4YFEA 4FTDA 4LP8A 1MAMH 3HMXA 1S5IL 4GQQA 1M2VA 3SJVE 2XWDA 1NPUA 1E4XI 1N2RA 1YEKH 4Y0GA 5DMYA 4K8RC 1NGWA 5IB3A 2ZCKH 3FN3A 3WXWH 4UQ3B 3AS3A 5H4YA 1I3VA 2JIOA 4R8WH 3ZQ9A 5L8KB 4EQ3A 2VLKE 1BJ1J 1QUPA 2VQ4A 1R33A 4U1IB 3B6SA 4KO5A 4XHJD 5J1AB 2Q3ZA 3TN0A 2C45A 4KO9A 4ABUA 5ID1B 1P5VB 4P5MB 2CR3A 5JR1L 1BGXH 4EKXA 4NP9A 3WE6A 2OMYB 3OAYH 4JRYA 5CHNB 2JI1A 2Q86A 2XWCA 1JYVA 3Q2NA 2GHWB 3JTTA 1WT5C 2CKNA 4CBPA 3TESA 1WV7T 4BKLA 1IFHL 4TLSA 1D9KD 4D9LH 5EEWA 4PJBF 1JGEA 1SRDA 2MOGA 3QFJE 3ROOA 3VVVA 5GS0C 2VSCA 4P2RB 1IGCL 3QNZA 2D3JA 4RDQF 5IIEB 3N50A 1DO6A 3HC0B 4KJPC 1BF5A 1AS7A 5GGQH 1MCRA 1TQBB 4L8SB 2QV2A 4P8QA 2LT9A 1RJCA 1LHZA 1DBAL 2CU9A 3C75A 3QDMD 5TQ0L 2Q6WB 3RWIB 3RBGA 3TBYB 2R51A 5CLTA 4HLZG 3UO1H 1ZHNA 3K2IA 5JHMA 3UOAB 5F6HJ 5MEPB 3WEMA 3LKPB 2AITA 2EEFA 1WLFA 1IC7H 1Y1VA 1OE1A 2IH1B 4G11A 1WWAX 3EG9B 4PTUA 4KXBA 5FYLL 3O9WA 2FAUA 1NCCH 4LKCA 1KTDB 4P2QA 3NUKA 4QHNB 1CDGA 4JO1L 2Z6FA 3BLKA 3M17A 4HKJA 1M56B 1Q9LA 2DWXA 2J5LB 4JFOB 5CZXC 4BUQA 3ARXA 4FQCH 4Y7OC 5DGRA 2H8PB 1W8NA 3QUXC 1MVYA 5C09A 2KUTA 5JUEL 3AQXA 4LLMB 1MFNA 3EDEA 1FF5A 3B83A 2OI9B 3I2CL 1IJNA 1VGKA 3GTPA 2HFGL 1UD3A 5FHAL 1DSYA 2VMFA 4H8WC 3WLBA 3QRFM 1JTTA 4FQJH 1FO0B 1EPFA 1OL0A 1E90A 1ZRUA 1ID5I 5DQDH 4M1CC 4S0TD 5DI8A 5GS3A 2A6KB 3ZKQD 2BVUA 1QW8A 2VN6A 3F00A 4ZYKA 3QJZA 1NGYB 4PRPB 2R0ZL 4DEUA 2NUPA 4BH7A 4LCVA 1KXTB 2HH0L 3BZDA 3BT2L 4MNQA 2BY3A 4OJDH 3RNKA 2DI7A 4TV3A 1ET7A 1OCRB 3AREA 2R29A 4MCZB 5EBMA 5IOPA 3BKML 4ZMNA 4TNVF 1ZGLM 3SKOB 1QBML 2OA9A 2X38A 1RUPL 3FQUA 3GTVA 5JXAH 1JWUA 4WHTB 2XN0A 2CLZA 5C09D 3OHMB 1X4YA 2Q7AA 1RV6X 4N0FB 4R2GB 1SJHB 1VCAA 1KB9K 2PYEA 3MOAL 3VFSA 4EN2A 4YDJA 2UX6A 4XP6H 4ODHL 3CMOL 5C07A 5IHBA 1CGWA 5GM9A 3FN0H 1AXTL 2ORBH 4X42A 2ZYIA 1FZOB 1OCZB 2DYRB 3FONA 1AHMA 1AGFB 3H9ZA 5MENE 4U2YA 2PMZA 4B95C 3VFNB 3QG6B 4PJDF 3DMMA 2XIDA 4NQDD 4PCYA 1TZOA 4RGMC 3SBQA 1S7RA 1WH0A 2CO4A 2JKIS 5HHPB 3ZTNH 2EIBA 1F1GA 1YN7A 1J9SA 1QSFE 4YIQA 4G43B 4DETA 3KLLA 2BCKB 2HRPL 43CAB 4H44C 1NEUA 3V4VH 1CUOA 3IDJA 4KKQA 2DQIH 3QG7H 1A6VH 5IMLB 4D2NA 1L0XA 4ONHB 4DP0X 4NJ9H 1ZANL 2MTPA 4QRRB 3D39E 4EF3A 4I77H 1PZ3A 2ZSVA 3WN5A 4Z7NF 4B9ZA 1W0YT 3NK3A 5DLML 5IMOB 3DHMA 2IPTH 4IOSD 3WKMH 1S7VA 2ZZUT 4IBLT 2G6GA 4K3EL 4X80L 2BSSB 5E8OB 4DH2A 4KK6C 4ETYA 3GMQB 3WJLA 4I0KA 2DQEH 2YIHA 3JV4B 3U7AA 1PZ2A 1UKQA 4ZO7A 4PJGF 2AMGA 2W95A 4E41E 2EDQA 3OV6A 5ADPL 3ELAT 3K4AA 2R1YA 3LTVA 4MWFB 4QIWA 3BJ91 4ZZKA 2L7EA 4NN5C 3VG9B 1A6WH 2LW3A 5BQDA 4ZUSA 3J07A 4RIRA 3GBNL 3X12B 4Z3IA 5HTSA 3IF1B 4QCIA 3BD3A 1Q94A 1BW4A 1ZLSL 4HALA 3G6DL 3N9GL 4FG2A 1AGCA 5KVGE 1DFXA 1XVSA 2ZUXA 2VH5L 2X40A 4FMVA 3ATAA 3VTAA 1U95B 2QMJA 4MB1A 4KMQA 2R9HD 4HQQH 4WENB 3EYQC 1G7LA 5HGDA 5ILTL 2Y4SA 3X1GA 3L4CA 4UILL 5I1AB 3II2A 2J8UA 4JANA 4Y2LA 1AGBB 3KS0H 1UT2A 2P7TB 4ZMVA 4AYFA 5AD0B 5KSBB 3HE6A 3MNVB 3TV3H 3ZW3A 2V9UA 3D6GA 5T3XD 1YCSA 4KO6A 3CCHA 1R5IB 1TQSA 4OKVA 4XZ4A 3DETD 4APQD 4V1DB 1RK1A 1QACA 4GAGL 2QV4A 4UB0H 4NBYB 5FKAB 3ZE0E 5T5FA 2VDOB 4YUEH 1DTUA 1EWHA 1TR7A 3RGBA 3ZDYB 5KJ4A 5CLZA 4K3DL 4PD4J 3IAQA 2A68D 3MRHA 4PGBB 4ZQTA 1SOSA 2BVOB 3RVWD 4PJEB 2F7QA 2D03L 4LRIC 4QHKI 1GGCL 1JN6B 1H6UA 2F9BT 1NGPH 1YEJL 2YK1L 2ZAIA 2J6EA 1NDTA 1EVTC 4K71B 2GYSA 4QXGL 3X13A 4DZ8A 3HZVA 4YH6A 1CK0L 5CJQ