4L48A

Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
202
structure length
202
Chain Sequence
MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and d78n mutant clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
total genus 44
structure length 202
sequence length 202
chains with identical sequence C
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4l48A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4l48A02
3SULA 3FT9A 3SUJA 3SUKA 3X2IA 2HCZX 1WC2A 2PICA 4JP6A 4JS7A 3X2OA 4ENGA 1OA7A 3SUMA 1WHPA 2KQAA 4FG2A 4L48A 2G6GA 3D30A 3M3GA 3X2GA 3X2KA 5GLXA 1BW3A 1WHOA 5H4UA 1BMWA 4FG4A 4JCWA 4AVRA 3X2MA 5GM9A 2JNZA 2ENGA 3X2JA 3FT1A 4JJOA 2GAEA 4FFTA 1OA9A 3ENGA 4JP7A 2PI8A 5GLYA 3X2HA 1N10A 1BW4A 2VXQA 2AE0X 3X2PA 3X2LA 4ZM7A 2PJJA 4FERA 2BH0A 2PNWA 3X2NA 1L8FA 2G5DA 1HD5A 3CZBA
chains in the Genus database with same CATH superfamily
3FTXA 5IB5A 3NZHL 4H0GA 1TPXC 4XN2A 2EXYC 2J8UE 1K3IA 4YFDB 4ZG1A 3W9DB 1SYVB 4M1DH 2JTDA 2VMEA 3WEXA 4M1GL 1BFOB 1D5XA 2QV2A 3LY6A 4P05A 2NSMA 3HB3D 4DW2H 1FA4A 3C5ZA 3X2MA 5AOIA 1CGWA 3WD5H 4CVXA 2JQMA 3T3PE 1KQGA 1JV2B 5A6MA 3MC0A 4JM4H 5D1XB 2VLJB 4FFWD 4CU6A 2JV6A 1FL3B 1TTBA 5I17B 2EDOA 1DVUA 4JVUA 3DRTB 3KWWB 3IR6A 1DBJL 3NP4A 5L2JB 3W9EA 5ITFA 2ATPB 4F7KA 4XPHL 5AVRB 5FLVA 2R0WL 1L9OA 3N0AA 4Y2OA 3ZHNA 2FO8A 1IGYA 3GYRA 1J5CA 1JDCA 2Y6TE 3DOHA 5FUCE 4OM0L 5JIPA 4JO1H 1A9EA 5IHLB 1CBVH 3BVVA 5ISZB 1EFQA 2J8HA 2ENPA 2ZXAA 5BJTA 4H8PA 3OL2A 1CFVL 2P52A 2ZSWB 2Y1VA 1Z9SA 5DWPA 2NXZB 3PAVA 3VD1A 2WCGA 2WAQA 3ETBJ 3EO1B 2ZPKL 4JRWA 2EDFA 2WXPA 2VXVL 4OF5A 5IQLA 4AEHH 1I8MA 5D6DA 5FKPA 4PP1D 4CSTA 3SDCD 3GMNA 5FYJU 5DS1A 1EFXD 4XXWC 2VR3A 5GGUB 1DSWA 2JJTA 4PGEA 4UB0L 1ZHKA 2GIYA 1PQZB 4HXAL 4MNGA 2YPKA 1B3IA 2R7ZA 2VXTL 5CEXB 3FKUS 4HH8A 3VI4A 4JBSA 5JW4N 3CGTA 2HKFL 2IDFA 1L9NA 2ALAA 3ALXA 3CE1A 3MOAH 5EO0B 3VMNA 1AYOA 2JIRA 4FNPA 3VJ6A 1C12A 3QQ4B 3KLAA 3MGTB 3SQOH 3SGKA 3OAZH 3TZVD 1EMTH 5FGRA 4ZPVA 3TJHD 3PLYA 3UO1L 4Y5VC 3V0GA 4A2FA 3I6GA 1C1EH 2I9LB 3GB7B 1MCLA 4KTDL 4OZIE 2PPFA 5C7ZA 3WFBH 4J5VA 3VWJC 3HG2A 2NY3C 5KYNA 3ARBD 3QI9D 3ZDZE 2CLRB 2HTKC 2WLYA 4LQ1A 1K6QL 5T33L 1JHTA 4MQTB 4R7VA 5EBMA 4X5QA 5E1AB 1DHKA 1LP9F 2Y9RT 3I75B 4U1KA 3EJCA 5JPNB 5DUBB 3UYOD 1GOGA 4DPBX 3K7UA 2OI9B 5CGBA 2E74C 3F7YB 3VNZA 4NGHL 2B1HL 1FFOB 2OV0A 3H0GA 1EO8H 3LN4A 1JZ6A 4G72B 4XN5A 4Y7OC 4N2HA 4Z7WE 1MRCH 1KJMA 3N06B 3EG9B 1U33A 3RWHA 2Q3AA 2OFQA 2VDOL 4OZHE 4PRBB 1DEEA 1UQSB 2GHWB 4KK9C 3LEXA 4M93B 5DQ9A 1MCQA 2VDLB 2AJXH 5IM7B 4TMPA 5K9OA 4XHJC 4JPKL 2HFEB 3O3BA 4MD0A 1BWMA 3BAYA 4IU2A 5D7JB 3EGXA 3N44F 2I9TB 3TN0A 1KN2H 4JPSA 1R6VA 2CRMA 3IGFA 1GHFL 3MO1B 5BRZE 4HUVB 2HX8A 2ZUQC 3O45B 2HRPH 3KLHC 3QPQD 1CC3A 3B7UX 3RGVB 3B2VL 1T4KA 5DJYB 1T4WA 4URKA 1G6RB 3DJRA 5EZLA 2QFRA 1PFOA 3O0RH 1T7XA 1S9XA 1EX0A 4XAWH 3UC2A 4OQTA 3WHXB 4B9KC 4QJ4B 5C0CD 3HBPA 2BPBA 2QVMA 5MEOB 1QRKA 2WQSA 4MVBD 1ES0A 4L2LA 4P5MA 4LBAA 4GG6E 5EU7C 5AWNL 4DP5X 1I31A 1T0MA 3CFKA 4WNJA 1OAKL 3QORB 4XCCH 3PL6C 1KTLB 5E56A 2R1WA 4KJQC 4ZX5A 3RIAK 4DNLA 4H13C 1MNUH 5EC2A 4OCYH 2X42A 4KKBC 4RETB 4KDIA 2EEXA 2DWTA 4KNQA 3ZLQC 3BSZH 3MCYA 3RWIA 2HJFB 4X5RA 3QRBA 4P23B 4XVTH 4RFNC 2YD0A 3A47A 3KPSD 5LWYH 2GAEA 3IN2A 4Y2DB 2W0LA 3C9NA 4P4KD 3WNIA 1JGLL 2AITA 2GSIA 3MRGB 4NQCA 4XN9A 3VB8A 3NFNB 4Z6AT 2M26A 3BUBA 1S3KH 3IDJB 3MLSL 4MJHA 1YQVL 1E61A 4MWFA 4Y9FA 2G5BB 3QHFH 2XA8H 1HOCB 4AVIA 3D25B 4N20A 5C7XL 3LS4L 1FG9C 1MRDH 1JD9A 2NUPB 3CV5A 3D30A 3BUTA 2EACA 3L3GB 4LIQE 3OPUA 2XKUA 4I88A 3UG4A 3BXNA 3RKDC 5HXMA 4ERSL 1CF8L 1KCBA 4PJDA 5DJ0B 5GGTA 3SBWC 1GGIH 3HMWL 2WIIB 4PMEA 3VFVA 1D6VL 1IAMA 4RZCB 4QRQB 4XXDA 3WS6A 3ILQD 1YEDB 2EDEA 2ROYA 5DRWB 2DQHL 3TWCH 1R24A 1TFPA 3OMNB 1W0VA 5ADOL 3QJZA 5CJQH 1P84K 3K6IA 2X10A 3ZE0F 1JZHA 4MA8L 3VTAA 4YEFA 3ZHKA 2X9XA 4IOIB 2Y7MA 3C2AH 2VQ1A 3LYRA 2XWZA 5CJ5A 5DI8B 2X9ZA 5HJGA 1M42A 2A73A 1SY6A 5B7EA 3FBQA 1HL5A 3SDCB 1OAQL 5CBAB 5DDHB 2EH8L 1EFXB 3QWRA 1QYGH 5D7SH 3QUKB 4LNVA 5I9QC 3TP4A 4WW2B 2GUOA 3RVWC 2K3HA 3U83A 4GP8B 3VGDA 5C6PB 1CU4H 3X12A 2H41A 1NSNL 1WV7T 3EBGA 2PJHB 1IFGA 3P02A 1TF4A 4Y1AE 4YR6A 4JFTA 3LKNB 3LXAA 8CGTA 4WU5A 1YEGH 3V0WH 5DMJB 4NZFA 4R26H 1MF2H 1KENL 3ZUCA 1HILA 2FO1A 1E6OH 3H8NA 2WQ8A 2OMYA 1AJ7L 4EN3A 3JTSA 2OMBA 2JIXB 2WLZA 5LNGA 5DZOA 1MCFA 3C09C 1BDYA 5E9NA 4M1CD 1RZQA 4KOBA 3EFOA 3QZWA 2Y2YA 5A6IA 2G2PA 5FYJD 3T09A 3AABA 5L6YH 4IRSD 2XTJC 4GIOA 4XVJH 1H3PH 3O6LL 4YXLH 2F7IA 3P4MA 2YUZA 1QRND 1P4LB 1TWHA 2R93A 3KYOA 2FD6H 4A04A 3QA3A 4JM0A 4OCXL 4G9DB 1SHWA 1CL7L 4PRAA 5I5JA 3ULVE 2DYPD 4FERA 3V4PL 1XGTB 4N5UA 2ZKYA 4Z76B 2HJKA 1JVOA 5E6UB 5AW5B 4NJAL 4RFEA 5DJAB 3WOVA 4YHOH 2LQRA 1JOIA 1D5RA 4X9HA 2DD8H 2XN9A 3NIFF 1BAGA 5D9SB 4MJ6A 5IBLD 1JXDA 1BZ8A 3T65A 2H47C 3ZIYA 4PJFF 3UMTA 3UZQB 2O5XL 2GK0A 2ZOLA 4JFQB 2L7EA 2F0CA 2O6PA 4QOKD 4X0KB 2CLZA 4XCEB 3LZFL 3G6AB 1NWOA 3RVTD 3RVVC 3QUZA 1ZHLA 4E9VA 4OZGF 1OSZB 4J2XA 4AGPA 1LL1A 1MFBH 2AVGA 4N0YH 5GS0L 3FB6A 5EHFA 1U8KA 1T0NA 3LJ3A 4Y4KD 4YK4B 4FQPA 4ZDHA 3B2XA 2HVKA 3CUPA 3QCTL 4XMTA 3CFTA 3FU0A 1SNRA 1A6AB 1FZJB 2DJMA 1Q1PA 2W65B 4GI9A 5EZJA 1H8SA 4FG0A 5I75C 1BVZA 2ADYA 4FFVC 3FDWA 5JQ6H 3GRGA 4L18A 2A6DB 4AG4H 3AWGA 4WY7H 3ZE1E 4JLRA 1E9QB 1HL8A 4WO4D 3DUSB 4YIQB 3BE1H 3LNHA 3NVQA 3KDMA 4MD5A 1VSCA 4PJGE 2J1XA 4X6CA 2DRUA 1LO3H 4YL4A 5IQ7L 3U7YH 3IRCA 4CSZA 1ASPA 3MROA 3HC0B 1PZ5B 2EH7L 5AVYB 3L3KA 4MAYA 1S7VA 1R9FA 1OGAD 4K7PL 3O41A 4N8CH 3VD2A 4S1DC 2BO0A 2MCAA 3ISRA 4N3TA 4PS8A 5INDA 4A6YB 3V0AC 3KH4A 2WVVA 4P04A 3UADA 3WCYA 4IKJA 4YXKH 2W9DL 3LKPB 4LCYA 5E8OB 4PJHF 4XMWA 2OMWA 4TVPH 4N86A 4WEBL 1A6WL 5GSVA 4KVCL 3ARPA 2QGEA 2MFNA 2NNAA 4LARH 3ZKXC 5TQ2H 1UCBL 4M61A 1R0AH 1RZGA 1QFUL 1A5FL 2Z35B 3FQTB 3MLVL 1KLUA 3AQXA 2IAND 5CM1A 5GGVL 5DUJA 2DM2A 1ZHNA 4UQIM 5B1BB 5T1DL 1T5KA 4WI6A 2XQ0A 2CXGA 4HIHA 2VR9A 3SHSA 3RAJL 1KIRA 1BM3H 4PHZA 1KY7A 4HWNA 1VGEL 4ZAKA 1MY5A 2XI9A 1AHMA 2FZ3A 4P46B 5I1KH 2BNRB 4GUCA 3C5SB 3VSTA 1WT5C 5DS8A 1LP9B 2EKSB 3BO8B 3G6JF 5FTNA 3V4VL 2X0VA 1OTUD 4O2EB 4KGJA 5DJZA 2XWTA 1AR1C 1SYSA 1M7UA 1XH2A 3IFPB 4LDOB 4XE5B 3B3BA 4O2FB 4JFPA 3WFCH 1H9VA 1U3JA 4XNYH 1RLBA 3ECQA 3X2GA 5SX4H 3LN9A 1F3JA 4KI5C 4X5XB 5E5LA 3QDJB 3RHWK 3NA9H 1THCA 5G5DA 4F2MB 3CVHL 3RGBA 4IRZL 4C56D 2HA1A 4LLDA 1OWRM 2ARWA 3HE7B 4C58B 4PBXA 3UO8B 3VH8B 4NHCL 1MW2A 1OP3H 4MNQE 4FZ8H 1OTTD 5HPMB 2OP4H 1C16B 1NDMA 2WXOA 3N44B 4L3EB 5KYUB 3VX1A 3PXLA 1CXIA 4EDWH 1KEGL 4LBEA 1KTBA 2AQTA 2C1PB 2HKHL 3TM7B 3KBHE 4PLNC 3TO4B 1A6VH 1Z32X 3ARUA 3N1PC 3ZIMA 2ZOUA 3DURB 2IWFA 1QRNB 1EDHA 3CX5J 2N56A 1E27A 3GTKA 3ELAT 4OSUL 2BY2A 3ZTJG 2NY2B 2DICA 3KE0A 3GMOA 2C3XA 2WZ6A 3IDUA 2JCCF 2VC2L 4YE4H 3B9KC 3W0WB 1CLOL 3JWNG 2HT4C 1E4XL 1SBSH 4MJIA 3NK4A 1QWNA 1ACYL 3ZY7A 2A6HD 4TQEL 4HC1L 2ZD0A 3TT3H 4F9LC 4JVWA 1OP5H 3MCKB 3IDMB 4G1EB 3T2NL 3MODH 4G80B 1AACA 3WKPA 5IEHA 3QIUB 5BXFB 4NKOB 1CFNB 1J8HA 5EU6E 3MRFA 1FJ1B 2WIMA 3QC6X 1H3TA 3GTVA 3LIZL 5DHYA 3T0ED 1XCQA 1KIQA 1T80A 4X9YA 5GRJH 2X70B 4QOKB 5C07D 5KSAB 1ANUA 2WOYA 1WD9A 2YRBA 3FSWA 1TVDA 5KOVC 1JK9A 4AONB 3OHXB 4E0RB 1WBYA 3L4TA 4R8WH 4HKXA 1JNLL 3IWUA 3HZKB 1M6UA 5DQDH 1OW0C 1W72H 1ZOXA 4UNVA 4IGBB 3BKMH 1CXKA 3FSVA 2XACC 4ZW5A 2WZAA 2WXHA 2C7UA 2YJLA 5FYLD 4J1UB 5E8EB 1DJXA 4HUCA 4PREA 2KPWA 1NPJA 4H26A 1VAHA 2MHAA 4TTDC 2CO7A 2ZP9A 4U4BA 1A3LL 1PLAA 1P4BH 3B5HA 4Q97A 5DD6B 3AU1B 2ZXWB 4WO4B 2B59B 3GSNA 4HMCA 3AQDA 2VQ4A 2AV1A 4B9FA 2J57A 3H7LA 3NIDF 4EO5A 4A7VA 3H3PH 5DD1H 2CA4A 1AZBA 2C1OA 3MLPA 1NC2B 1TJMA 4YHMH 5E8NA 4AQEA 1J10A 3VG0H 3MNDA 4M8QB 4TPRH 4BH8B 4CMMA 4EUPG 4L4VE 4EVNA 3SYOA 5KVFL 2ZYHA 5HGBA 5AB1A 3BAXA 4HBCH 2C7FA 2IDQA 4TSAL 4GI6A 2L7JA 2OMZA 5C08E 1BG9A 1G9HA 3L3HA 5IB5B 4JFDB 3LB6D 3TJEH 2XV2A 5ILTH 2PICA 5GGSY 2TRYA 3R06A 3ULSB 3NTCH 5A2AA 1FI8C 4W9GC 4P2RE 3SUMA 4ELKA 4M4PA 1G4RA 3KPOB 4UIKH 1GH7A 1UKTA 2C3WA 3G7TA 3WEXB 2D0GA 2WXIA 3UZVB 4APQA 3VGAB 4YSAA 4CVXB 3OMIB 1GYVA 2WLMA 2YGOA 3NJGA 4P99A 3MOQA 4NKMA 3BGFC 4F9PA 1HYSD 3N9GH 1CR9H 4MB3A 3SDXF 3AXLA 2J2ZB 3FQWA 3RRQA 5J56B 4IJ3B 2X1XR 4WI5A 2A9BA 3NSDA 5CIPA 3GTJA 3EJJX 2VN3A 4YSEA 2A38A 1DQKA 5EWIH 5SWSE 1RP9A 2GIMA 4JFUA 2G3NA 3DX3A 1MFEH 2WQAA 3U82B 5E6ID 3NIFB 1HH9A 4FKEA 1E2VA 3CBRA 3A4DA 1UACH 3VG9C 4OM1L 1A9EB 1UKSA 5DHMC 3UTPE 3IMBA 4MB5A 2VDNB 4PJFB 1R4XA 5CP3A 1F41A 3UDWC 1WAPA 3TX4A 4HJJL 3MFFB 4HXBH 4OZGB 2IC2A 4XMVA 5H37A 1JFQH 3MA9L 1TIUA 2VW6A 4HT1H 3O4LB 1YDPA 1D7FA 3KR3H 4A2GA 1WICA 4ZNEA 2H0PA 3WFEH 1ET5A 5KSBE 5C0EB 3Q1EA 4NQEA 4LLQA 4QTIH 4XP6L 5ICXA 3ZGHA 3B1UA 1EAPB 1FGNL 4JDVA 2EECA 2IMNA 2K1MA 1PKOA 2D4FA 2ICEC 3IPFA 4NZTH 1NINA 3UP6A 5DSCB 1ZT4B 3OBAA 4XP9L 1WBXB 2PW1A 3MV01 2MQGA 4L29A 1NJ9A 4H8QA 1CYGA 1QHPA 3MBED 3JWDH 3HUJA 1Q8MA 4HCRA 4PN6A 3VXQA 3F64A 2VLKD 5C0RL 4Z95L 3VI3F 4B3VA 3PIQB 1WWCA 1SLWA 1NCBL 1HOEA 4OD2A 1G7LA 2OJ1A 4QRBA 4HX1A 3WUZA 3NACH 3I6GB 4WUKH 2GFBA 2VLRE 4NUQA 3NGBC 3IU4L 1SN5A 3MRQA 4U1GB 1PKQE 1DL7L 5IHUH 4R0LA 5DR5L 3NQKA 4TQPA 3STZB 2E7CA 5BS0A 2NVXA 1IGJB 2UZXA 2GBVA 1NM9A 3EOTL 4PJHB 1UD4A 1XB6A 5I71B 1DQML 4I5BA 1QBAA 1VFUA 4IRJB 4QHNA 3EBIA 1OSEA 2GKIA 2YEVB 4G9FE 1UATA 2HTLC 5FOBA 4JM2A 3QSKB 4CNIA 1BPLB 3HC4H 3K80A 4U1LB 1TJGL 5CMAA 1ZLUH 3RWHB 4OCRL 2D4DA 4LSVL 1UC6A 1CD1A 5DQ9B 4BKLB 2B4CC 4QWWD 1TJIL 4Y16C 3WGVB 1JWSA 2F2HA 4NQVB 3MRJB 3O3BB 4F7MA 4NI3A 4IU2B 4HEMA 3LD8B 4EZKA 3EGXB 3WDHA 2YUWA 1GMIA 1PAMA 5DFAA 1DBKL 2WZ5A 3C6SA 1FO0A 4TUJA 5HGHB 4XP5L 4R4ND 1KEML 1Q90A 3G6JB 3RGHA 3QUYD 3D52A 1AO7A 5FDWA 5AZ2L 2VN4A 5LCVL 2XC8A 1PIFA 2C9AA 1EGJL 3KLDA 1E4KA 1NFDF 3BP4A 2E6JA 2P5ED 4L8DB 4JE0A 1KYUA 1FLTX 1GYWA 1LD9A 5K9KA 4N1HB 3D0VB 1WLHA 3EKCA 1UXSA 2HPOA 2OW7A 1TZAA 3T2PA 3ZX1A 3IE4A 3KEHA 4JO4L 1A21A 2YSSA 4GAYB 3V95A 3IMSA 3U36A 3FO1A 2Z64C 2ZSVA 3L4YA 1DVSA 4XPBL 1AGEB 5IBTH 3KPRD 2FL5B 4KPHL 1FZKB 5G4MA 3CH1A 2Q10A 2FJHB 2IH9A 4HPYH 4KMLB 1WFJA 4MHHI 3VD4A 1USQA 4EIBA 2R1WB 3NCFB 1RVFH 4K7FB 4BRJA 3PREA 3CZEA 4MS8D 4X8JB 5LGJA 2GSGB 3GMPA 2WLLB 1MEXH 2BIHA 5ERWB 4PLOB 2VL5B 4WK2B 3FNKA 4PY8J 4U1SA 2WWNA 4K3JH 4NRZA 2Y36L 4XXWA 2W38A 1MFVA 2OMXA 3DOIA 1ZANL 5J1TC 3CFJB 3TFKC 2OZ4H 1FNAA 1JF5A 2B2XH 2CJ3A 4EBQH 5BUGA 2JCCB 3UIZA 1KCUL 1G9NH 3EYOA 2V3FA 3QJOA 1SJEB 4ZT1A 1N0XH 1Y0LA 2CKBL 3HKZA 4W9LC 2J6WA 1AXTL 3K3QA 3QFGA 5B21A 4XHQA 4TVPE 5E2UL 1DVXA 2WZPA 1H5BA 2IDUA 4FLOA 4LOVA 4F8LA 15C8H 5IB3A 4D3CL 3NSCA 1A25A 1IC4L 4O2CA 1P5VA 1GYUA 3AT8A 4YHZL 2DYRB 3ZT7A 4QRRA 2BIPA 5EZOL 3QXAA 3IS1X 2H45A 2Q8BL 1IBBA 4MQSB 3GXIA 1E28B 2AJUH 4PTUA 3UTSE 1GC1H 1NMAH 3OKMB 1TJHH 4XTRD 1CIUA 1UT9A 1XSIA 2J5LC 1MQ8A 4LASL 4LVOB 2AXHA 2Z91B 1AGDB 2IF7A 2XG4A 4NB7A 4AITA 1DJZA 1KGIA 2DWYA 3ZDWA 4Z8FH 4QO1A 4XBGA 2A73B 1K8DA 3CCHA 5T3XL 4G6AD 1O9VA 1D2PA 4M62L 1I7RA 1OD9A 3ATFA 2GUOB 2K7PA 1VCAA 1XXDC 2VM3A 3FQUA 2QQLH 1NIBA 2FX9H 4PGJA 1AQ8A 3JWNC 4U3SB 3DVNB 4WU5B 4G5ZL 4KXDA 1VESA 3VFSB 2BJMH 4JPVH 1HILB 1F90L 3MBEB 5EIIA 1XZ0A 5AAWC 2IGLA 2NYAA 3DTDA 1P5UC 1V10A 4QHMA 4U2ZA 3NIDB 4G3YL 5J6SA 4J4PA 1AHWB 4KRPD 1GGTA 1XXFC 3SE4A 4LKXA 4HKZA 5TK4A 2R0LH 2XV6B 4GXUM 3P4MB 1JI2A 1F5WA 2FYVA 3VXSE 5AG9A 4PV8B 1QSED 3MRCB 2VPXA 3F6JA 2H1PL 1J1OL 3DOSB 3S3PA 5L9DH 1WWBX 5GRXG 1MXGA 1N5AA 3CFCL 5E4AA 5AZUA 2ITDA 1MHHA 5D5MA 5B1JC 1ETZA 3I6LE 2F58H 5IK3A 1X5LA 2YAEA 3U4AA 4LK4A 3BDBA 1E5VA 2OMNA 3DPDA 3BHBA 3NZSA 4FYRA 5HDRA 4MMXA 1JZ4A 2DQDL 4X6EA 1BOGA 3L3IA 1B2YA 1YZZA 1PZ3A 3EOAA 3RUGF 5KVEH 4G6KH 3TPUA 5IROD 1X4ZA 1X5ZA 3A6CL 1MI5A 4W1TA 4GY4A 3D1MC 3IFLL 4GW1A 3T6WA 2A9NH 3DSNB 3KXFA 1NEPA 3ZL2A 1RZ7L 1IO4C 2VLME 1BHGA 4PI2A 5JQHC 1T0NB 4JMNA 4QRSA 2MKWA 4F33B 5JHDD 3CIQA 4PJ6A 5IMLA 4M7KL 1KIUB 3CUPB 2IFGA 3B6SA 4ELME 3EDEA 3QUYB 4LHUB 5JHLA 1JGEB 4PG2C 4JGMA 2OR9H 3T0DA 3NCYP 4KXBA 4D0BB 1K4CB 4ZFFA 5L4FA 1ZYRD 4PS4L 2VE6A 1MZYA 3GSRA 3EAKA 3PWPD 1YYMH 1BZ9B 1F4XH 3KDMB 2DBLH 1F13A 3D4GA 3RURA 5T3ZH 5SWZA 4IJTA 3K72A 2VDRH 3GSVB 1HVXA 4ONFH 5IBUG 2ZUXA 3S98A 3ABKB 3SKNA 4BCZA 4GSRA 4HZ1A 2UXVA 4C4KT 4KK6D 1QKZH 5HHQA 1NCAH 1XH1A 1YNKH 3ZQXA 3B2PA 1CDJA 1UHVA 2V7HA 2Y25A 2ZG3A 4PJIF 3MRRA 2YLHA 3Q8EA 3D3VD 1YC8A 2FJFB 3MJ9A 2NZ9C 1PLCA 3PWJA 1B4JL 2DWDA 2VQUA 5HDBE 3BZ4A 1BJMA 4EZJA 4YSUA 4AIZB 2HLFC 2F7PA 1M05A 4ZUVA 1KV3A 2C9VA 3PAUA 4E41D 4E9TA 4RAUA 3ARFB 1RJLB 5IJCC 4MJ2A 5GSVB 4DPRA 4ETQA 4K8RC 2DDQH 4M61B 4Y19E 5LBSL 4G59C 3VI3B 1Z5LA 3H9SD 2VERN 5AVXB 2PWFA 3K5SA 1A2YA 3RX5A 3NSFA 3Q6GL 1WP6A 1TVBA 3QUMA 4TSCH 3ROOB 1U92A 4F7PB 3N42F 1YY8A 1I8IA 3QEQE 3SDAA 2APBA 1MIEL 4QNPE 1FYTB 3LKQB 4HIPA 2R9HD 1DVTA 2FBJL 2FZ3B 2XKSA 5DK0A 3QI9A 2WYTA 3V52H 5MP6L 2YMOA 3O6KL 2ERJB 1U8CB 1CBJA 2P26A 2XQBH 2YZ8A 4KDTC 3N40F 5B3NA 3IFOB 4JFPB 1MFMA 2XBTA 4H2AA 2ESVE 3SCMB 5I0WA 5I1HL 4RMBA 3CX5K 2CHWA 4OT1L 3HI5L 2BSTB 1T0OA 4X8GA 4B9GA 2K6WA 4OW6A 5EZIL 3WUWG 1NCTA 5G5DB 3PGDB 1NAMB 4Q6IC 2QTVA 4FKHA 5FO9A 2V6HA 1SOXA 1L6XA 3FONB 3MRNB 2OW6A 5LGYA 1EERB 1DQDH 4Q0XH 1NDMB 4UNIA 3FO9A 2R8SL 4BDVA 4TL4A 5HHOA 2BP0A 3HMXA 5EU3B 2VDQH 3BDYL 5TE4L 2X6CA 2O5YH 4KRPB 3BP5B 1I50A 2VLJE 3C2SA 1TEFA 4C8XA 3LQZA 1NFDB 5DWUL 2ZUVA 4LSRH 1XR8B 2VWEE 5AG8A 1F3DJ 2R2HA 4Y5YA 4L8SC 3IDGB 3BN3B 2JB6B 4G6JL 1YEKL 2VYRE 2AJZA 3ARDD 1T20B 4JZOA 2DQCL 4S11A 1BA9A 1QMUA 5E4IA 4BFNA 4MJIB 4JHVA 5C0CA 5L8KB 3P4LA 4MXVF 4PJEE 1PLGL 3KH3A 4CDHA 5IKCA 1ECYA 4MQ7A 3VM5A 1E5UI 1SXAA 2FWOB 5IVXE 1HU8A 1UXWB 1PX3A 1Y07A 2G2NA 3IPBA 4XZ4A 3GHBL 4ABQA 3MRFB 2OQJA 4G8GE 2Z8SA 1CFSB 4KFMA 1QQDB 2BZCA 1TWAA 1IM3A 2FGZA 2FHBA 1OZUA 3IJHB 3KPSA 3WBDA 5IT2H 3ML1A 4XNZB 4P4KA 3HRZA 1U8LB 2FEEL 3ECWA 3O2WH 5JORB 2HWZL 1AIFA 1IEBA 2E6QA 3CXFA 4JKNA 1BQKA 1YRKA 4E9RA 1Q9LB 2P7TB 4W68A 4AWJC 3VACA 2EXYD 2PTVA 4OQ1A 3X1GA 3TVMB 1Y1UA 2AGJL 1LO0H 3GFUA 2YD2A 1ZEAL 2QHRL 3VXTA 3WMPA 1U21A 3FT1A 1UEMA 1LO2L 25C8L 4Q9RH 4X6FB 2P9RA 4ICXA 1DBBL 1UASA 4DQOH 4F80A 1KTJA 2DQJH 2I07B 2FQEA 1Y5IA 2K8MA 2J7LA 3SJVD 3CXDL 4LRNH 2QT6A 4ODUA 2Q76B 1UHDA 2FX8L 4UV4L 2P5WD 2JKIS 2C1OB 2YN3A 1R33A 4CW1A 1BBDH 1ZHBB 3L7FA 2B1OA 4Q7DA 4DERA 3NOIA 5DT1H 1MN4A 2ZG1A 4NFBA 1UA6L 4ODXB 4WV1B 5JOPE 2VXQL 5KEZA 4D0DA 4ZMOA 4DMRA 1LJMA 3IDNB 1NCDL 1RIVH 3QJUB 1D5MB 5CJBA 5DUMH 1CXHA 1J5OH 4LLYB 3D3VB 5F7YC 4QMEA 4Z3TA 2OK0H 4PJCE 5D5MF 3OKNB 4PS7A 5DC4B 3MGOB 2H26A 1JNHA 5CD5C 4PWGA 4J3XA 3G5ZA 1X5MA 1HC1A 3A67L 1RULH 2DMHA 5EOCL 1TUPA 3OX8B 1X9QA 4G8FA 5C70A 1D9KD 1HHJA 1RK1A 2VRAA 4GKZB 2DZEA 3UJIH 3FH8A 4D8PA 1A64A 3X11B 1QABA 4IRSA 1FBIH 2V3EA 4NKMB 3ARTA 2X28A 5GISH 3SPIA 4WDIA 1QNZH 1D5ZB 1FGVL 3ARYA 5I1GH 3G08A 2H2PC 2R56L 3FQWB 2HRPL 2LFGA 3MJWA 1KXTB 5FA3B 2DYPA 1SXBA 4MXQC 3EFDH 1OAZL 3KWXA 1KCVH 3HBQA 5CBEA 2GJ6B 1KGYE 1HAWA 2VDPL 3UTTA 3GMMB 4XNXL 3EW3B 2OXHB 2IOOA 3WFDL 2Y72A 4BA8A 4F9LA 1J86A 4Q2ZA 5TH2B 3RUGB 2CG9X 1OPOA 1GTNA 2NYYC 5D1QD 3U4BL 4CKQA 2DTMH 4YC2C 5GZND 1OF2B 1XZWA 1E7UA 3N85H 1BD2D 4FQ1L 5DRNA 3SN6N 1A7PH 2UZPA 3ES6B 1UH2A 5KBKA 1MOEA 1QATA 3L17A 5J5EA 2FR4B 2XQYG 1MHEB 1XDTT 1T3FA 1YDPB 3DX1A 4N2LA 5ACZB 2CO6A 3ARGC 1B6DA 4M4RA 1BREA 4PPTA 5E1QA 4CRZA 4G43B 1CT8B 3GI8H 4NQEB 5FR3A 4FQCH 4LLQB 3S36H 3WNLA 4C47A 5TD4A 4GSDH 1CTMA 3QFJE 1NGQL 1QX1A 4WK0B 4F58H 3OXRA 4JUTA 4RMTA 3DV6B 4NM4L 3ULVC 3DX7B 1TITA 4XC3H 1NEZG 3VE0A 4OI8A 4ZM7A 1WFTA 2ADIA 1TWCA 1OARL 4KK9D 4MA7L 2BVQA 4HQQL 2UWEF 3SODB 3V6OE 3CK0H 3HPJA 4J39A 4TSBH 4ZFOA 3CLEL 5EO1A 3MN8A 4MDIA 3EZJB 3JSSA 1QI4A 1T7YA 4NZUH 2FEEI 5FO8A 5B4MD 3LN5A 1F6AB 4OD2B 1JNJA 1G7LB 3ZDXF 2V2WB 3NCJH 1MELA 4LAQH 2FO4B 2X4RA 2WXFA 3U7WL 4U6TA 3NFPA 4LPVA 4F2EA 5AW7B 4GXFA 4PRDA 4Z0BH 4AV5A 2MH4A 4HWZA 4PJIB 1B0GA 2ZYSA 2VDKL 3IJEB 2A6IA 4U1MB 4I4WA 4UM9D 5KS9A 3QJFA 3D39D 4X2UA 5CSZA 2XSKA 3TH2T 1UFUA 4X83A 5IQ9B 4LZKA 5JXEC 4GKSA 1BVNT 1ETB1 1MQKH 1ZY9A 2JCWA 3C6LC 3EBAA 3INOA 5H94A 4TXVB 4PJ7E 35C8L 3SO3C 5ANMA 2VQTA 4AZDA 3DK2A 3MRHB 5DD5L 2BSBA 5FOBB 4QRAA 1UM4H 4MZRA 2JWYA 2FSEA 5A43C 3BKJH 4WI0B 1E65A 3NJFA 1TPXB 4JZNB 2FJUB 6PAZA 2H2SD 4KJQD 1Q9KA 3GSUA 4RWHA 2XV0A 2H6PB 2WGNB 3RKPA 3DRQB 1ZVNA 4D0CA 1Q0YL 1R3KA 3US9A 4Q9CA 2YA2A 2QQKH 5E51A 3VXRD 1IJNA 5K9JL 4L05A 4TUJB 4DO4A 1T2QL 1MCPL 1NGXA 3VCLB 4X5WB 2R0KH 4NIKB 5LBVA 3DMMC 5GXBB 1S3SA 1F1DA 3X3GH 1CLCA 4BFGA 1S7WB 3NPZB 3KPNB 3MJGX 1OCOB 5TDPB 3AMKA 4B3EA 1WAAE 3V8OA 1GKEA 3GM8A 4L4TD 1KULA 3ESVF 4X9FA 4UT7L 5FW7A 2PP8A 1WCQA 1ULVA 2BY3A 1Z3GL 3U0PB 3MRDA 5KAQF 4AH2A 3D0LB 1NDGA 4XR8C 4N1CA 3HNVL 4IOSD 3RKDD 4KRMB 2AQQA 2N01B 1BX2A 4IKLA 4DEUA 4FN0A 3UDWA 4KJWC 3OQ3B 1DR9A 5T3ZE 1MFBL 2LLGA 1T1ZA 1ZLVK 3VRLF 3KLLA 3OG6B 3AZUA 2JIPA 4X42A 5LGJB 2YR3A 3DDGA 3MLWH 5BUAA 3BQUC 4QRPD 3GI9H 3KCPA 4D9RD 2C9SA 5LBGA 3CZSA 1KFAL 3SDDD 4OGXL 2AJ3B 4ZXBD 4WJG3 3RVWD 2CU9A 3S3DB 2YIHA 1RQ5A 4OD1H 3IE9A 2J6EA 2YPLA 3W39B 2XFGB 3EYSH 4R4BA 3EJUA 1UJTA 2EUWA 1Y0LB 2GJRA 1LYQA 4JX0A 1JK8B 1QLEL 3WKQA 2PCYA 4GXVH 4FHKA 5F6IC 3RI5F 3UTOA 4FQ2L 4OGYL 2MTPA 3M07A 1E0OB 4H4NA 5IOPB 1LDPH 1P5VB 4O2CB 5DRZA 3POCA 1XL6A 2G75A 2IG2L 4HALA 3AY2A 5J1AB 1NQBA 2YFNA 3ZN6A 2BP5M 3BVXA 3GSXA 4A67A 2NUTA 5D7LD 2G2RA 4F7EB 2MJWA 5HD8C 3T0EA 3QNYB 4Y5VB 1AQKH 5LXGL 3FSZA 1BD2B 4N8CL 2COQA 5C07A 4ZNCD 2FQGA 3R1GL 5A2IH 3VWJB 1CF1A 5I6MA 2NY3B 3SPJA 4BWWA 5H4ZA 1CICD 1EJOL 1CTOA 2NQCA 1N8ZB 3DPBB 3H9HA 4XBGB 2HX7A 2PWHA 4TNGA 3CCHB 3IMUA 5SWQB 4ODTH 2XY1A 2WXRA 5TFSH 2FIKA 1C9SA 1MWAB 4ODWA 4BGLA 4UT6A 4Z3GA 1UH3A 5GGTH 4EDXB 5HYFA 1EDQA 1FH2A 5MEQA 1HHKA 4GINA 3PWUA 3QJSB 1J0YA 2CD0A 5EIIB 2YXVA 2VR5A 3K81A 3GXNA 1OT2A 3EYQC 5CN1A 2ZUTA 2J88L 1OM3H 3L3OA 1RZKH 1ZS2A 3KPPA 4N68A 3WNKA 2VPYA 4P0DA 4KO9A 3BVNA 1SY6H 2DLHA 3HC3H 3GO1H 4DGUA 1MW0A 4DT2A 1KB5B 5E6SB 2ZCZA 2QL1A 4K2UL 5E08L 3Q2NA 3VGFA 1I85A 1WEJL 1ZWIA 2ZUQB 1U3NA 1X9RA 2A74A 2WMPA 4FFVD 2DJSA 5IHWA 1I75A 4IK7A 3D39B 3IWVA 5D5MB 3EYVA 4JGNA 3HPLB 3OJDB 1A02N 3L5WB 4X4ZA 2BZ7A 3NZ8A 1ZA6B 2NMSA 3H53A 2Z31A 1U95A 3ILPA 3Q3GA 4GAFB 2I5YL 4WHDA 5I1JL 2EDBA 3QEHA 1PYWB 4N22A 4E9YA 2N4IA 4UILL 1L7TH 4OZ4A 5BZWB 1U8NA 1IL1A 2UVFA 2D9CA 4L3EE 2IQ9H 1LWHA 1G87A 4C83A 3P54A 3PL6B 4PBVC 4GW1B 3LVEA 1U8QA 4S1DD 4AIEA 3MHZA 4QEGA 5FCUL 5JLZA 4NWUL 1IC0A 4PRNA 4RFNB 5C9JB 2CQVA 3ML8A 4NUGL 3KJ6H 3ATAA 3CSTA 2E46A 3CLFH 4NUMA 4P4RA 4OLUL 1A7NH 3UTQB 4YDJA 3KYKH 5EPMA 3W0WE 1T03L 1A4KB 4AYMC 4N2OA 4P5KA 4O51A 1NCCL 5C2BL 4NFCA 2O6CA 3X2QB 3RBGA 4NQSB 3MODL 2IFFH 4YDZA 1NCOA 2GITA 5CGTA 5E9AA 3EH1A 5SWZB 4BFIA 3J27A 2YWYA 4DEPC 3QEGH 1AS6A 2W91A 3EDKA 4LMQE 3MRMB 4CVZB 5CJXC 1UZ6E 3TEXA 5GRJL 3TBTA 1HT6A 2VLLA 4YGVA 3TLRA 3GJEA 4RMRA 4ONHA 4HMDA 3VD9A 3JWOH 3MRRB 3VXMD 3IK2A 4B9YA 5KJRH 4QRPB 1KC5H 1B9KA 4MZ3A 3WIIH 1MDAA 4MCZB 4NWTH 3I2CL 1U6AH 3M7OA 3VFNA 3BIAX 5I9QB 5HYQB 5I1CH 3R4DA 4RAUB 3VSQA 3BKYL 1FDLH 3ZKSD 4BK4A 4YDVA 4DP9X 4IU3B 3X1NA 5DZPA 1RMFH 4ZMQA 5JOFB 3ISYA 5F9WC 1Z5LB 1XGPB 4PR5A 2PR4L 2E7BA 2VLKA 3ZK0A 4N24A 1A2YB 2KQAA 4NQDA 2APFA 3MXWL 5FKAA 4BRVA 3V0VA 5GHWH 5PAZA 4M3HA 2HSIA 1RIUL 3ZDXB 1TVBB 1DJIA 3QUMB 4POZC 2FLBT 1TG8A 3HZ3A 1U92B 1FHGA 3RIKA 4P48A 3QE5A 5GRZA 3VXPA 3NRFA 1OHQA 4WJ5A 4GO8A 1PGRB 1UADC 2IVFC 3C09B 4KKPA 1GVIA 4M5ZL 1L3WA 2NR6C 4J8RB 4L3FA 1HHHA 2XTJB 3VM7A 5J13C 2WV3A 5FWQA 4YHLL 4MXWH 5AQ0A 4X6DA 3WMSA 4FABH 4P9ML 1RJCA 3CFBA 3MYJA 4QHKJ 1W8EA 2F53B 1E8YA 2QPSA 2IIJA 3DXAA 3T4AC 2YPVH 1AGBA 3D85D 1CICB 3RBSA 3ZTCC 3MA7B 4GXUN 4KGLA 4IM8A 2Y0SA 1PYQA 1BQUA 3LKOB 4H0LC 5E0FA 1WZMA 5DD3H 2CJTA 2O61B 3ULAB 1TO5A 1N10A 1J1XH 4Z7OB 5IOKA 1RPUA 5IEKA 4CVUA 5IF0B 1A1MB 3L7EA 5H35B 3WTXA 2YA1A 4PWIA 3QR0A 5HHOB 3DVGB 5GRUH 2BLFA 2NZ1A 3H0TB 2ZKWA 3M86A 1FNHA 4AY0A 5FA4B 5A2LH 1UVQA 1AQMA 3L5HA 1CR9L 4XOAA 1BZ7A 1J05B 2H1LM 3INUL 4GRLC 1IB5A 2P8PB 3FRUA 3N43F 4YHKH 2JKJA 2VXUL 3ABMB 4OIIL 2FHFA 1NOLA 1H6FA 3IU3B 2R2HB 3QQ7A 3QXTA 4G6MH 3PNWB 2D7TL 2GSMB 3K6NA 2ZXCA 3MNWA 4OCLC 5F7EL 4EUPA 5I75B 5T1MB 4PG2A 1IBGL 1MCEA 1MJJA 2LAGB 4FNRA 1NKOA 4X5PA 4AT6B 2NTSP 3UAJD 2FHCA 3D34A 4FG6D 4ISVA 4RMQA 3V5KA 3QQ9C 2JA7A 2BP3A 2ICWA 4E5XG 4N2DA 5E1GA 3MJ8B 4JRYD 3S2CA 3JZ7A 5IQMA 2WLJA 3OR6A 5F96L 2BXZA 5JIKA 3CPLA 1YEJL 3L45A 3BCDA 3HJ0A 4JKMA 1P69B 1IM3B 2QPFA 4R96B 4AQ1A 2HX9A 2IPKA 1MRFL 3P30H 1GR7A 1V8HA 2E27H 3VXNB 3X2IA 4MNGE 1UOLA 1IEBB 4G7RB 4H8HA 4NNPH 2VR6A 2Q8AL 3FOLB 3UZEC 3FZUC 4UUJB 3CIAA 5JA8B 3QJRB 2AI0L 3VI4E 5CZRA 5GLXA 4LDLB 1GW0A 3GXUB 2YZ1A 3ZKXB 3ATDA 5DFWH 2WKOA 5ESAA 4RBPH 2GT9A 2JFCA 2PXYD 3ML9A 3PAZA 4U6XB 4JFHE 1IEAB 3SKJL 4AJWA 4WUUA 3L13A 5FFGA 5B22A 4O02H 3IM1A 1T1XA 1YC7A 1PL3A 1F8TL 1HKLL 3MV7D 1MREH 1BMZA 1PEZA 1OVZA 3FTSA 1OGPA 4A68A 3C5JA 4LOUD 2UY7B 4O4YL 5C0DA 1T1YA 4PV9B 2UYLA 3WY1A 1LO5A 4PJ9C 3MNZB 4DO6A 3NCBB 1YNND 2D7MA 3KDPB 3PQYD 5JXAH 4LEXH 2CBPA 2GCYA 2V3DA 4I2XB 4DN4H 2IADA 2DM7A 1BQHB 4QY8A 5I18L 1AR1B 3ZL4L 3FHQA 1BWWA 2SODB 4KDTA 1MZZA 3F58H 4X7FC 5I15H 3CSBA 5AOZA 5EMYA 1TTAA 3LPOA 4QHLA 1Q94A 1HS6A 1SMOA 3D06A 2ZUSA 3NN8B 4U49A 3VFGH 3G5ZB 3LEYL 1HSBB 3GSNH 2NY7H 1SF5A 4Q6IA 2J73A 3RE0A 4BZYA 1WCBA 4S1RH 2AABL 1U8PB 3CU7A 5ITBL 4J6RL 2NY4C 2IWGA 5KVDE 4D8PB 3FT3A 2ZOKA 4TNFA 4MQXC 1QSEA 5GS0D 4U2YA 4HLZH 3G08B 4GAGL 3ARXA 3X14B 2MKLC 4JFED 5T1KB 2VSCA 5J9PA 1JBJA 3EFFB 3OPZH 2NY0D 2BNQD 5EBWA 3UAAA 4AGLA 4NRYB 4L8SA 1BF2A 3P9MB 4YZWA 5FFOA 4KO8A 2VZOA 2G6GA 1C5DA 2COVD 5CBEB 5FCSH 3CSFA 4WWKC 3B9KB 2VDLL 1E30A 3UTTB 3FCSB 3MAWA 1U8JA 5KUMA 3IJSA 3D85B 5CFAA 2VZVA 1XF2B 3HFMH 4KU1A 2FATL 2FX7L 3D9AH 3VYNA 1U3ZA 4YZFE 4UM8A 4W93A 1XGQB 4XGZB 5IROA 4BSVA 5I16A 5J6GA 1CDGA 2KERA 3BYYA 4OGZA 5TDNA 2E0PA 2YAOA 4M43L 1AANA 2CHDA 5LUMA 3H4FA 3IMVA 4NO0A 4PRHB 1DQTA 4OCSH 1GGBL 3A6OA 3RZCD 2CGRH 3Q8FA 1GPOL 5CF3A 3O9WC 1B0IA 5HHVH 3FT4A 1SRDA 1VCBC 2K4AA 4P9HL 1X7TA 1EEQA 5CIPH 4MAUH 2DM3A 1NANH 4NQCE 3K4AA 4QT5A 3T8XA 2AQ2A 3MDJA 2DPKA 3OXRB 4Y2LA 2EUXA 4LGRB 4PTTB 2X4TB 2OZNA 5HBBA 5JO5B 1KGCE 2MCPL 1SXSA 2ATAA 3QULB 1RK0A 3SIKA 4EI5D 1A0QL 2ADGA 2LU7A 2EDRA 1YVLA 3GPSA 1SN2A 1ZE3H 2Z93A 3PWPA 4W6WB 4Y16D 4B9CA 2XTSA 5IMKB 4DP4X 1HXYB 3FBKA 3FAXA 4XBEH 2R0ZL 4XRCA 1ADQL 1T66D 4PJDE 4BFOA 4WK4B 4KITB 1B3JA 2IDSA 3I3EA 4GQ9L 4MDJB 1C08A 4N1EA 1UZ8A 4J6IA 3V5HA 1GC1L 2VJ8A 5EUOA 3ZQWA 4Y4HD 3WO4C 1BXAA 2AJYH 1MW1A 1HE8A 2A4ZA 2Z92B 3QDGD 2I26N 2UZIL 2WNGA 3RWEB 4F15C 3R19A 4UDTA 5DJDA 1IAIH 3BEVB 3X2LA 1RERA 4PY7B 3UC0L 3MGAA 3ABGA 5CSZB 2OL3L 2JA6A 2A9DA 4XI5D 2IO5A 4H5SA 1YMMD 4PI0A 2O5ZH 4PJ5A 4E41A 3GT6A 4HCRH 4GW4B 4RX4D 4JJHA 1JTTA 3HCVB 3EH5B 5DVOA 5D4HA 5A16A 5IB2B 3B9VA 1AG0A 1TT6A 3DARA 3GSUB 4OLXL 1FL5A 4FZEH 2PYFB 1WZAA 1L6ZA 1QPKA 4JFFD 5CGMA 1DN0A 5F1IB 1R3KB 4HS6B 2VMJA 1OALA 3FKIA 3QDMA 1OOWA 5DRXB 3VFPA 2R15A 4E9LA 1E9PB 1L5GA 2XT1B 2P1YA 2BVOA 4HG4J 2BDNL 3FF8A 3Q6FA 5EA0H 1YNTF 4UU9B 2BP8B 2E9GA 3HS9A 4JDZA 5C0FA 3BGFB 2NX5B 1JYWA 3PWLA 2ROXA 3FK3A 1NGZA 4AE0A 4TQHA 1KLGB 3AWEA 4CC1A 4ECNA 5DJXB 2BVTA 2JI3A 4NUPA 4WW1A 3KJ4C 4PRPD 3D18A 3H1ZA 3AG4B 3TBVB 2MCG1 3SY0A 2PR9A 4UZSA 2XZCL 1J11A 4AH2B 3OKLA 5KYYB 5FM8A 2XN9E 3B2UD 4R83A 4P59H 5C0AD 2R23B 4N8VB 4UDUA 1HZHH 3VG9B 4EI6A 5ABAA 1BX2B 4ZUUA 4J23A 3HG5A 1CQKA 4W4NA 4BQ6A 3U46B 3IJ8A 4KO5A 2PF6A 4OU3A 2AK4D 2J8UF 5TTRA 2C4XA 1B4RA 2QDWA 1FAKT 3AFLA 1RFDL 5HGGS 4IDLA 4M7LL 3N43B 5I74C 4KZDL 3ULUH 2NSXA 3F8UB 5B1CA 2QZQA 3Q2WA 3IVKA 3C12A 3T3PF 3L1OH 4KHXL 3UJTL 2BIMA 2NW2A 1MDTA 2WUBH 3ARDA 4KKNA 2ICEB 1T21B 1MCNA 4JFEB 4HISA 2NY0B 1Z0MA 1CR5A 5AKRA 2BM3A 1CO1A 4XZUB 1YYLH 1YYML 5B38A 1S9YA 5CEZL 1HXKA 1U8OA 1E5YA 5T3ZL 4X6CE 1I1AD 4FG4A 3TCTA 5BW7C 4DN3L 1JWUB 4OJAA 1H3UA 4Y9CA 3HU3A 1UD2A 4LLUA 3SYPA 5C0BD 2OSLA 1KXHA 4Y4FD 2NUTB 3EBHA 4PP2A 3F05A 2J25A 3J2PA 1R7RA 1UB6A 4Y2NA 2J44A 3LKRA 5FTLA 4ZYKA 1URZA 1WFUA 3HS0C 3NGBB 1ITCA 3EH4B 3FU7B 4M5YL 4UTAH 3RZCB 1ACCA 4XBMA 4ZOAA 3H9HB 1FWXA 4PGDA 3OZ9L 4J3OC 4X5LA 1Z9PA 4UOW1 5DA0B 1QHOA 4ZS7H 1JNNH 4L1DA 3ZTNH 2VWEC 4QXGH 3RA7L 5JXEA 1LWRA 4XX1E 2FIKB 4F27A 3DGGB 5AW6B 3C6LA 2A9MH 4JDTL 4LDCA 5CJOL 3GC3A 1ZXKA 5DD0H 1IFHL 3ARWA 3FUIA 4O9HL 3A4AA 1L6PA 1OEZW 4NZDA 4GRWE 2Q86A 4FQJL 5CKAA 4XNUL 2LVEA 1HHKB 1MH5A 4P49A 1F58L 2BS71 4AMKL 1TETL 3PHSA 5F44A 3FQXB 1RUPL 4P2CG 1K72A 4Y16B 1DZBA 1PDKA 3SJVA 1U30A 3KPPB 1JZGA 3ESOA 3S34L 2P5WA 4A6YL 4FXGC 1KCSH 1KT2B 2XN2A 3D4YA 3MJ7B 3HE6C 1YEEH 1MCDA 2AXJA 4M6OL 2YAHA 3QDGB 4F24A 1NBCA 3QXDA 4X4YB 4OZIF 2GG1A 3MLTA 3TT1H 4BELD 5INCA 1MIML 3ZDZF 3WL9A 1TTGA 3S5LG 5F1KC 1VADB 1I7ZB 1AKJD 5JIQA 1J9RA 5GSRB 4CVWA 2G4GA 4IHOA 4YSDA 3V4VB 1YMMB 2EDJA 1QBLH 3QO1A 5GS2H 4I3SL 1KPRB 3OZLA 3QWQB 1D7DA 5EIQA 1VEPA 4N2BA 5GRVL 3STBA 4Q9BA 4B27A 1TQVA 1FFRA 1JD7A 2V7NA 3A3YB 1S9WB 2A77L 4P3DB 4Z7WF 3MLZH 1U8NB 1IL1B 3EO9H 4Q0XL 4G2AA 1FVDA 3EJZC 2JI2A 4NP4H 4OZHF 4C83B 1PMYA 4XN4A 4Z78B 3FQNB 3CVHB 3QS3A 4MMZA 5LQBL 2WWOA 4LFHD 4Y9BA 5JIIA 1G6RH 4JY5H 5F7MC 2NZ9D 2XCMC 3RNQB 3TF4A 4DGIH 1JP5A 1YNLL 5KANI 4UQ3A 1G7JB 3CWGA 2V2TA 3M46A 1QO3B 4X80L 2G3XA 1M71A 3V6FA 5I30L 2F18A 3OKEA 1QSFB 2JELH 4MJIE 1X6LA 3DIDA 4ORZC 3EUDA 4TOYL 2WBJD 5JPMC 3OAUH 3HZVA 3A0OA 1ZIBA 5GZOA 1RURH 2G30A 3QDHA 2ADFH 1NBYB 1C5BL 2GITB 3O6FD 3GWJA 5D1QA 1KELH 3QYNA 4L5FH 1TMCB 4MKMA 5DYOB 1J8HE 3WUWA 5BQ7A 43C9A 1VFAA 4GUQA 1N59A 5D70H 3H42H 4XB3A 2FTAA 4HIEA 3BT2L 4PGCA 1ITBB 3FXIC 4GG6F 4R4FH 1BGXL 1I7UB 4OV6F 5DMIH 4AENB 1Z0NA 4GT7A 2J5LB 1EHLL 4WFEE 1IGFL 1P9MC 4QTHA 1ONQB 4OLEA 4ZS6D 3P0YH 4DGVH 5KJ4A 1I1FB 2XXCB 4OF0A 1P0SE 1NBVL 3J8F7 4U0RC 1PG7X 4ADIA 2PTUA 1PFCA 4MCMA 1PZAA 2C3VA 2BH0A 1JFHA 3TESA 1H3VA 4OKVA 4YDVB 3E80A 2KUTA 3RTQC 3MLUH 7PAZA 1KGWA 1EJ8A 3CXHK 1BQRA 1G9NC 4NQDB 4CDGC 1R17A 3V0VB 4JFSA 3HNTL 3FCTA 4GBXC 3SOTA 4KNTA 3MUUA 1AI1L 5DJ2A 4PLKD 4GUOA 5H4UA 1KSRA 3I6KB 4LRNL 3L5JA 1G7HA 1P5UB 1QBBA 5ESVA 3WMQA 2X7LA 5JR1L 2OA9A 3LH2H 4GQQA 3ESMA 4F7EA 2YFOA 3HKFA 1UOWA 4TRPL 1QZ1A 1UWGH 1FH5H 1WBZA 3EGSA 5DTFA 4UM9A 2CIIA 2BVYA 3CSYA 1GC1C 3FH7A 4PJBA 5I6XC 1RJYB 1WZ1L 1PYUB 1FNEB 1WS8A 2QPEB 3HS8A 3MX0A 3WEBA 2X2JA 1AGBB 5HI3C 1CXEA 1XQ4A 4AM0A 2QQNL 3KPLA 4AJ0A 4FI8A 3DMRA 4NERA 4GPVA 2SEBA 2PYED 3THML 3TV3H 5DYGA 1G94A 2E4TA 1SDDB 4OIBA 5LHDA 2Z4TA 5F7LB 4Z3EA 2EDHA 2BWDA 1HFUA 3QUXA 6FABH 2BC4A 4KY1H 3GBNH 3NFSH 1A6UL 2BE5D 2GQHA 1QVOA 3CBJB 3V7MA 3PP4H 3TIDA 2X6MA 1LE5A 2VSKB 4GG8B 3U4KA 1BFVL 2VL4A 5C09A 4DUWA 4ZTPH 1YNTB 3MCLH 1R3JA 4FFZL 3ZL1A 2FQFA 2WLHA 2X44D 2XG5B 3MLXL 1AFVH 3IGAB 1T6VN 1LTXA 4KMTL 4PB0L 1OO2A 3F7VA 3B5TA 1KG0B 4NUJA 4AIXA 1TLKA 1W15A 3DX8A 1EIBA 4YAQB 3S4SG 4FYTA 1BVLA 3DIFB 4L4TA 5D8JH 1I9RL 2GW5A 1SLXA 4JO5A 1RZJL 3SO5A 3DO3A 3ULVF 3BFWA 5LNDA 4IOSA 5KSUB 3UGUA 5D93C 3VQ2C 5EDSA 4Z77A 4XOEA 1QEWA 4XO9A 3FFCA 3KL5A 5SV3A 2GB2A 1MCIA 2F74A 3VXOA 2J8UB 2JIQA 3IRZA 1J9QA 3RIFF 3QNFA 1AOZA 4AVRA 2D3NA 2CDGB 2X12A 3SE3A 4CGTA 2WUCL 2G60L 3VFUA 4FQQA 3F7KA 1TO4A 2XETA 5DHEA 5BV7H 1LEGA 1XGZA 1SMYD 1LO4H 4N0RA 4X98B 3SOBH 2XZAH 3GI8L 2ZCLH 4NQEE 1YAZA 4FQCL 2CM5A 1BVNP 4NPYA 3BVUA 3IS0X 1MHCB 2JKNA 3FB5B 2D7OA 1NPNA 2HUHA 4P2AA 4YBQC 5DUPH 3T3PB 3VB9A 3QISA 1BIHA 4ZXBA 4EXPX 2V9RA 3O3DA 4FAAB 3BSZA 1AGCA 5KW9H 3NA4A 3RWFA 1QWUA 1RPKA 2VDNL 5I8OH 3V6ZB 4HOZA 1JPFB 4TF4A 5T3XD 3DTUB 2GVYA 1C5CL 4HK3J 3HUJE 1KJ3H 4PYGA 3KAAA 4TSBL 1OSPL 4N0CD 2OTUB 3ZKMC 2IH3B 1LEIA 1YEHL 1GGCH 4M5TA 3ZZ1A 4K07A 1WIOA 3NIGE 3V10A 1B4TA 2F7RA 4K94L 4YSPA 1BW8A 4JCMA 3ZE1F 4LAQL 3GMRA 5D7LA 5DYFA 3L6FB 5G4NA 4PJGF 4DSYA 5GGSA 3C5JB 3P4NB 4KKAD 4U1HA 2EVGA 4S1QL 1FYHB 1LO5B 5HHMB 3RU8H 3OB8A 4FQLL 2XQYA 4FQXC 2AXFB 1IX2A 5BS0E 5GGRB 4JHWL 4ZMTA 1CDIA 1TQSA 2D3LA 2X6AA 4LMQI 2UV3A 2O93L 1ML0A 2XWRA 4GAJL 1GZPA 4JN1L 2FJGB 4WFFD 1F4WH 1P6FA 4N9GA 4OCMC 5KYWA 3K6SB 3T4AA 1N6QH 1PVHA 2AEPL 1KV7A 1FL6A 2EEDA 1CFTA 4TUOB 3ZUNC 5J11C 1UM4L 3BYTA 5IW1B 5I23A 2YK1L 1K3ZA 3KNBB 4NNYA 3WTSA 1NEZA 3E8UH 5HYJD 2F6AA 4Q6IB 5D1ZI 1NBZA 1JRHH 2WVUA 1OAXL 1WCBB 4OF6A 4HCGA 4OFYA 4ZRGA 4HEME 4BZ2H 1YUKB 4U33A 3BD3A 2DQFB 2IMMA 1PF3A 2P42B 3QPXL 5CZVH 4O5LH 3S88H 4MA1C 1AIZA 3GBEA 3FT3B 3LKSA 4DUXA 1AO7E 1IM9A 3E6HA 1SJHB 3PHAA 4DKFL 4L9LA 5F9OH 4OZIB 4P2QD 1QLFB 3S3SA 5HI4D 3ZDZB 1SQMA 4S0TD 2DEXX 4JN2A 4L8SB 2X40A 3BUPA 4B9JA 4CN4A 1ASQA 1K2DB 3OWRA 5TJWK 3WNJA 3HG1D 3VFTA 3N1GC 5AVZB 4M7ZC 1PQHA 2X6UA 1G7PB 1OA9A 4Z7WB 5KVDL 3TFBA 2NRDA 5DFVD 1MCSA 1EDYA 4OZHB 2AEQH 3QCUL 5FYJH 4BSVB 5I16B 3QIBC 5J6GB 1P1ZA 3OXSB 4QXTB 5B7MA 5AW9B 4XB8A 4CUCA 1VF5C 4BJLA 3PV6A 1ZT1B 4M48H 3GI9L 2DLFH 3TNNB 3RY6A 2CO1A 2R2EA 1K83A 1AE6H 3MV9A 3K8LA 5CILL 2PO6C 1IE5A 3U25A 4NXSA 4OD1L 4D9LL 3K74B 4OQTL 4B96A 5BRZB 4K3DH 3EYSL 3QYCA 1OANA 2P46B 2AJVH 5DMGC 4YHNA 2BVUA 3L9BA 2Y06H 5I0XA 2X6BA 1A6PA 3T8VA 2CO2A 1EAOA 5TE7L 1UM6L 4OJFH 1J7VR 4BH7B 3W2DH 1F2XK 2XQYK 3IDIB 3LEVH 4QRRE 3V55A 2V2XA 1FP5A 1QHQA 3ZR6A 1EU1A 3W11C 3F84A 4J27A 4NN5C 1UZ8B 5DMKB 3WY3A 1NICA 1UWXH 4DP2X 1VPOL 3VFRB 4DK5A 5K9QI 4GG6B 1ZVHA 1JPTL 1RUQH 2E7LA 1DVYA 5E2WH 1KBKA 1CD8A 1ORQA 2MPAL 2AJSH 4D9QE 3EIFA 2DH2A 2GY5A 4U1JB 5HJBA 4PJ9A 4NX0A 1W0YT 2NVYA 4H25A 4XB7A 1ZLVH 4Q58C 1N68A 3VXMA 2J56A 3Q05A 2UVEA 4AEFA 5LGHH 3HAEB 2EEBA 4DIXA 4ODTL 2OMUB 2WHVA 2ZWNA 1H6UA 4H5SB 4ALAL 2X1OA 3SPCA 2B3RA 1VFBA 2AW2A 2W0FB 5LB1A 2DOCA 5J6HB 4JRXD 1HXMB 3ZT5A 2F19H 2J21A 5AKVA 5I19L 2BRRH 1SEQH 2HP4A 4DAGH 2FDBP 1SPDA 1BQLL 3N1QC 3K6OA 1XR9A 4NNXA 1DMRA 4JJOA 1ED3A 2Z1PA 1XIWC 2MMXA 3R18A 3ENEA 4JDEA 4WTZA 1SHSA 2OCJA 5B3JE 5J8OA 2OSYA 2WWKO 5T5FA 1HEZA 1RZKL 3JXAA 1QLRB 3BQUD 4HWBH 1KCRH 5EV7A 1FFNA 2E86A 3MLYL 3VFPB 2BW5A 3P9LB 4LPXA 1IGMH 2PCFA 4X7EC 2EEFA 1U2HA 2ZX7A 4HIXH 5DO2C 2CR3A 3VFOA 3SE8L 5C0FB 5A2BA 2R1XB 2BFVH 3C60D 4L37B 1V3LA 3JT0A 4QAMB 1DDHA 3QHZL 5FPIA 2A2QT 3GPEA 3NAAH 4NOHA 2NYKA 3QJHB 3V5DA 3GTNA 4I18C 3KBPA 3NSJA 4GS7C 1RUAL 2HG5B 5D5ME 4J7RA 4ZPTB 5DHVB 4AXWB 5D1ZC 2E8YA 1QW9A 2CWRA 3QNZA 1GZHA 1XF3A 2L3BA 4DTGL 5CS7A 4RGOL 1F11A 1RJZA 1VKXA 1M6OA 1G8JA 2W0KA 3DX9A 1DBML 4S1SL 4Y1AB 4I13B 2F5BH 1MI5E 1JPSL 3QRGH 4LPUA 2EKJA 1M2VB 3O0LA 2VXSH 5I1IH 3KXFE 3WJLC 2NOYA 2D31A 3WLWC 1U3HD 4Q9QH 2XWBA 1WJ3A 3GRWL 3ARGB 3O9WA 4KK5C 4M8VA 1ZSDB 3WIHL 1QTSA 1XSJA 4NYLB 1YQ2A 3PHQA 4DP7X 1L7IH 2NLJA 1TCRB 3IVKB 5TPWH 2VITB 4E68A 1IGTA 3RG1C 3SY6A 4B6ZA 1ZA3A 4LCWD 1KNOB 2NW2B 5TF1H 3Q9PA 3K2UH 1I3VA 1DBAH 1P6AB 3IR7A 4JKPL 4M7JH 2WTRB 3HC2A 2X0UA 2XRAH 4WTWA 4X50A 3BFQG 1KF9B 4IYKA 1L0QA 1ZLDA 4PJ8C 4P2OC 1YG9A 2IFFL 4KUZH 4LSQL 3UAJA 4YX2H 3REVA 2YARA 5SWZE 4P07A 2OMVA 3U1QA 1PT0A 4WHYH 3DX6A 1MLBA 3NCCB 3RB7A 2OTWA 4KK8C 3WY2A 2OAAA 4YWGL 1PJWA 5IP4A 4JRYA 3IPEA 1KJ2H 3K71B 5AYUL 4FP8L 3CDGB 3JV4A 3C5ZC 4HFUL 3LKRB 4XNMA 3TBYA 2ZCHL 4MX7A 2DMKA 1EZLA 5TGBB 1KUMA 3I9GH 2P4AB 2W60A 1CK0L 2Y5QA 1NBQA 4Y88A 4ZZFA 1BLNA 1RZ8A 2E47A 1H0DB 2IV2X 1U6AL 3K4DA 3SE9L 3IETA 1ZGLP 2WLIB 4K9EH 1NLDH 2PLTA 3E6FA 5KSBF 4OLZL 5A2KH 2AVFA 1KBGH 3SO3B 2B5IB 1LHZA 3LXUX 1HEHC 4NO5B 5E2VH 1W72A 2PXYA 3LIUA 2IALB 4BKSC 4GP4B 5BZXA 3B34A 3FHAA 3ZE1B 1CFQA 2VUYA 3OUGA 2X41A 1H8NA 2G0KA 2QTEA 4PJGB 4B5ZA 5I0ZA 2Y5EA 3MV7A 1FCGA 3VFMB 2D0HA 1KQFA 5E9DA 1DVFC 2J1YA 5IBUB 5D72H 4M3JA 3X1BA 4OR1A 1I3RA 1WC7A 5E00B 5D6DC 5FUOH 1NL0L 5KSVB 4L1BA 3QWOA 4NJ9H 2JKLA 4IS6B 2XWJA 3DMMB 2JJTC 2EEAA 4WWNA 4IOFD 5CGYD 5FYLH 3GBMH 1A1OA 1AQDB 1QSZA 1A7RL 1WAEA 3RWCB 5E2TH 5E99L 5GS1A 4H8WH 3OQRA 1MFDH 2JKXA 4QIWA 5HVHC 2E9BA 3C8KA 4R7DB 3GTTA 3O6MH 5DD3L 5MI0C 5EULV 1IAKB 2DIEA 2VKWA 4GMTL 1GY1A 5GQBA 4P2RD 4P57A 4Z7OE 3FB8B 3WLBA 1R3HA 2AEIT 4TNVF 4G7QB 3EHBC 3GHEL 2VJ0A 2XPGA 1SLVA 5HHOE 3ZTEA 1BM7A 1Q1JH 2XZZA 5AAMC 2BWIA 2XXFA 4K23H 4LE8A 5EZPA 2O5JD 1NFAA 3BQUB 3NG5A 2YD1A 3QRLA 4KAQH 4FCHA 3KWTA 3O3EA 4JPIB 4F2FA 5MENA 2IAMD 4MSWB 3RDJA 5ABZA 2BSRB 2VM4A 3QZNA 3BEWA 1S8DA 4YLQT 2A4CA 3F5WA 1G7MA 1RXLA 1IZJA 1UB5B 2A7BA 5CZXD 2HAZA 3CC5B 5SWSD 2YUXA 3V7AG 3RY4A 3DGCR 5KYXA 2X89A 1NMBL 5C0CE 4QCIA 1ND0A 3ZSSA 2W07B 2X4UA 3WKMH 5F6IB 4DKTA 4WQOA 2APWA 3M1BB 4G7YL 4X9GA 4Z7NE 3OWEA 2P80D 3IJYB 1LVEA 4M00A 4KDWA 4WEMB 1IGCL 4Y1TA 4J28A 2VIRA 3R8QA 5BW7A 4ES9A 2ETWA 1PPIA 4ZOEA 3O3AB 2NR6D 5JDJA 2NXYD 4GLRH 4MNQB 2B3IA 1N4XH 4UNUA 5DJ8B 3TN0C 5D2LA 3MFGB 3KPSE 3D2UD 3M8OH 3TA3A 1EXUA 4D7BA 1MJ8H 1XGUA 4J3WA 3KS0H 1KTRL 3RNKB 5DYIA 5I0DA 2H8PA 4ODSH 3VD7A 1OTSC 1F4YH 4N2MA 3KM2A 3RVXD 3UL4A 4KNUA 5TE6L 4F7TB 1A9BA 3ELQA 3S96B 4FQHA 4OKVB 4EI5A 1R5VA 1RUML 4W6YB 3T4YA 2A6KA 1P4IL 4UAHA 4CMHC 1WD8A 4HBQA 1U2CA 4OTXL 2KZBA 3CHSA 1AA6A 1CDHA 3M3GA 4UV7L 1X9LA 2PTTA 4A7SA 5I1DB 3ESUF 1BW3A 4U6YA 1NUGA 4LO9A 5JUEL 5DJ2B 3WEOA 5I6NA 1NKRA 3QG6A 1G5GA 2EO7A 5D96C 4ZBJA 2AZAA 3C08H 3QFDA 3QVAA 3N1FC 1JGUH 4JPWH 4KV5E 4Y4HA 4U3XA 2VLRD 4R2GD 3BC9A 5EU6B 1XF5B 1KMGA 2CJUL 2DQIH 4KQ3L 4HK0A 3V79C 2D3VA 3M6DA 5EOQH 4DN4L 2CK0L 2CIIB 1CGSH 3HE6A 4TM9A 4IIQC 2YQGA 4OV5B 3WXVL 5FOJA 1KTDB 2PP7A 3V9FA 4HLZG 1XB8A 1LK3L 4ZW7A 1VB9A 3CFUA 4NO3B 3LRSB 3NRQA 5I0YA 4G9FD 4RX4A 4KI5E 2IH1B 2SEBB 1P7KB 1DJYA 3L3JB 3QC5X 3QQ9D 2QMKA 4XVSL 5AW1B 2LLLA 5C0ND 3APFA 3CDZA 3GUTA 3GJFK 2BC4B 1Y6KR 5ICZA 3W3BA 1QVOB 4IRZA 1X5FA 1NGWB 1LE5B 4FTVD 3O11A 5GGQH 4YDMA 5FYJE 4X9IA 1H15B 3MUJA 2BZDA 2WBXA 3P3TA 2WN3A 3DBSA 3JYBA 5F93C 3FRPB 5JIHA 1GTFA 3I02A 1HDMA 3AJ7A 1RZKC 1NCUA 4KZCA 4FNTA 1F42A 2NCEA 5CU9A 2ILLA 3IN0A 2F5AL 2HJLA 4IMKA 4KY2A 4PRPA 1XGRB 3QQ3A 1TKWA 4L4VB 3BRFA 2HUEA 2YEZA 4H1LA 3FB7A 3LQAH 4Z7VA 3BN9D 3PJSB 3LRHA 3EADA 1NUDA 1EAJA 3KBEA 5C0AA 5KS9B 2HYMA 1HHGA 3WJJA 4Z77B 1QEWB 5C08B 4IDJH 4BZ1H 4L3CB 1GCFA 1DE4A 3VXOB 2ZE0A 2Q6WB 4WCYL 4BINA 2AQ3A 5KVMC 1V7NH 5E1IA 5EFIB 4V33A 1TSRA 1S9VA 4DEPB 1OAYL 2Y7OA 2AK4A 4P2RB 4EN3C 3D6GA 5GIRB 5BO0D 1G0YR 4APXA 1USZA 4RISH 3VA2C 3VFUB 1BXVA 3TF7C 1NWPA 4TUKL 1IT9L 1EAQA 5JNYB 4KROD 2PWGA 5C0GA 3BAJA 3OKOB 4MAUL 1TMQA 4IMLA 1CZ8H 1SVCP 5I1EL 4HJEA 1D5BA 5I1AA 3P4OA 2CDFB 3II1A 3O3DB 3Q1SL 1X5JA 3GMQB 4A2MA 2ZUYA 3GZKA 1R5WA 1BZEA 5EU5B 3PABA 1FNSL 3RWFB 5B7FA 3RILA 1HQRA 1D5IH 4Y5XC 3WFZA 4KXZI 4ELMF 3MBWA 5SWSB 3RTQA 2OZ4A 3IKCA 5F9WB 3FUJA 1WK0A 5IHZB 5JW5B 1JGVL 1I1AA 1MCHA 3AS2A 4L1TA 2E76C 2ADJA 4HIJA 4LLWB 4W4OA 4DGYL 3QZOA 4XP4H 4UANA 4Y4FA 3UTSD 3FN0H 3O2DA 3B8SA 5DC9B 3TONA 3VGHA 2OPCA 2CIKB 3CQFA 1JHKL 4EE2A 5J12B 1OGAE 2N1KA 3FUKA 3DDFA 3EO0A 4P5TD 4XO3A 1GGUA 1M1XA 1OGTA 1S5HA 4ZFZA 4QRTB 1HZLA 1IAIL 4M6MH 5KS9E 2W94A 5J13B 4YVNA 2H9GB 5TDOA 2NY5H 5FYKL 1E40A 1J0HA 2HN7B 2NNRA 3D2UB 3IMWA 4BUQA 1PG7L 2O5ZL 4I0PC 5FV1L 1MFCL 1NAKH 3VSVA 4HCRL 1L9RA 3T4AB 5ANME 1FL6B 3JWOC 3PG2A 2XFXA 2W9EH 4G83A 1QFOA 4NLHA 2VDKB 1J12A 4XPFH 3TCLA 1AKPA 4AGMA 4OLYL 2LGNA 4PIBA 1WC2A 3G5VB 4U1NB 2K8QA 2QSCL 2JLPA 3DSFH 1B2WL 1ZJBA 1NBZB 1NGPL 2P43B 3BISA 5ETUA 1AGFA 4LSTH 4M29A 2EO1A 2VN6A 5D7HA 4U3CA 3WE6A 3PDOB 4ZI8A 5DU7A 4F37K 1A8ZA 5HJ3B 1B90A 2DQUH 4MAYC 1Q72L 4P3CH 5DZVA 3O2VL 1IM9B 3AREA 4YUEH 5T1LA 2OYKA 2R29H 4QNPF 4GRLB 4R2GB 4XNBA 1YN7A 5A2CA 1NAMH 4RAVB 1U93B 4XMPH 1PKQB 3MBXH 4XCFL 5BVJB 4LKCB 3RWGB 3G6DH 4KQ0A 1JWMA 4U7MA 1S7RA 5D71H 3GIZL 3I6LD 1AKJA 4PG9B 4YJZL 2WVTA 2JJSC 3MNVA 4GO6B 4Z0XA 4ANUA 4B9ZA 1KLFB 4Z3JA 4XCNA 1HI6A 5EU4B 5MHSE 3SSGA 4U7SA 3VGGA 3B43A 2XKNA 1BIIA 3GSWB 1FO0L 1MPAH 2F54D 4N90E 2H0EA 4D7ZB 2F61A 2J72A 4WFHD 3UYPB 2H3XC 4TNWF 3O8XA 5F7AA 2VLMD 2E9JA 4LL9A 4MS6A 5JMRA 5EEUA 5AUMA 4ZAKC 3IJ9A 4G1MA 2R2EB 3FHEA 4AJYV 3MV9B 4OZFB 5F1SA 1G7QA 1BV8A 1KPVA 1V55B 4OBRA 3CG8A 3VWKC 1YMHB 2DWEA 1JIBA 4AQAB 2YMXL 4LSPL 1QPXA 2YPLE 4ZMWA 4YHNB 4J3OF 3EDDA 1K5NA 2RFXB 3S5YA 5A2FA 3BPCB 3EOBA 3HR5A 1YYLL 5ENWA 3SDYL 3QBTB 2ZIDA 3P2TA 5CP7A 2PCPB 2VERA 1H6TA 3EYFB 3O6FA 1I9JL 3MV8D 4NI6A 4TLKA 4LCCA 3OLIA 4PJEF 5FW8A 4AZUA 5FEBA 4PV1C 3T0EE 4YEEA 1QLEB 5AVSB 1I8KA 1Q9OA 3DKHA 4QRUB 5IVOA 4Z7AA 3CJJA 2X1PA 4MYPA 5IVXF 5C07E 3ETTA 3GSQB 4GIAA 4I77H 4K5PA 5DHXB 1VEMA 2VAAB 4B7LA 4PJ9B 2AE0X 4FE9A 1SFOA 1I1RA 3E38A 2JKTM 1KYOJ 1I8LA 4HETA 3FJTA 3S37X 4QXGL 3BZ5A 2XJLA 1SEBB 2G3ZA 3OF6D 1OGSA 1IZKA 4WGVB 3LX9A 2IGFL 3L48A 2GI7A 2K3TA 1DFBH 1SM3H 4PH8A 5AOKA 2VOTA 1DQJA 2ZJSL 1ID2A 3F62A 4FNLH 2HXAA 4XP1H 1SXZA 4Y19D 4ZW6A 5EOTA 1HESA 1GW6A 1IEHA 1S78D 4X8CA 2AQNA 4XMKL 5KBNC 4NNXB 1IAII 2R1YB 3EXLA 1OD7A 4AYFB 2QQQA 5I24A 5CCKH 1OCRB 1H0HA 2QELA 3NMEA 3U9WA 2VMDA 1YUHA 3H7BB 3L95B 1A6TA 2NY4B 1M56B 4ODVH 3U2SB 1CMOA 2BOBA 5AOMA 1PZBA 3AC0A 4NM8H 3CHQA 4X6BB 4HEPA 1TVHB 3VFOB 3L9RA 4N28A 4YHIA 1KACB 3G5YA 5L8LB 4BK5A 3U0WH 3QIWA 5EOCJ 3MRIB 1DDHB 4IBZA 4P3WA 2B1AL 2I32A 5I5MA 2F15A 3NSYA 4X7SH 2BCKA 2L0DA 3GEFA 3ZMNA 2ESVD 2IPTL 1Q0EA 4PRID 2ZQKA 5T5NF 2YXWA 3R7QA 1KDJA 1XF3B 2PYEA 3MOBL 4WWKB 5B39B 1AZNA 1R5IA 4GSUA 2AF2A 4PJAA 4I85A 5HGAB 3I84A 3F3HA 5ID0A 3CN4A 4PJCF 3DX9B 4YXHL 3CZFA 3ZOAA 1DQLL 2R59A 4YFLF 3OLEA 4J3SA 3QIBA 1KB5L 3C8HA 3WHE0 4N26A 5B8CC 1CG9A 1ZT7B 3DO7A 5HTSA 4F93B 4LCUA 2UX6A 1Y7VA 5CLZA 1NGYA 1URLA 1HJCA 5D1XD 1R1CA 1SOKA 2VLJD 1TQUA 5LAPA 2MTAA 4J3OD 1N5YH 2KZKA 4XN8A 3ALPA 3CVCA 4PVNA 2YLKA 3BKCH 3MR9A 4PGBA 3JTTB 4W9KC 3VXSB 2H32B 1TYEB 4URTB 4YN3A 2HB0A 2YGQA 2EYRA 2DQEH 2WXGA 4HZLB 5E4EC 1SZNA 4HH9A 1X44A 4PUBL 4GJTB 2XX1A 3S5LA 4QYAA 2EE2A 2CKBA 3U1SL 5ISZD 2B0SL 1FE8H 1WH0A 2YBGA 3BPNC 1A7OH 4QF1B 3REVB 5JW3H 2YBRA 3LH8A 4AYDC 3DX6B 1MLBB 1Q9WB 4CC4A 2NXZD 1MY7A 4XC1H 2AERT 3TOPA 3ARQA 2HT3D 1NCWL 4LSSL 2I60H 2VDMH 1B0RB 1XSOA 3HLAA 3NDYE 4XMXA 5DMIL 4WSJA 3WO4B 4XNMB 3TBYB 2NT0A 4TULL 3PP3K 4FEIA 5DA4A 4DGVL 4F15B 3APNA 5JHLL 2OJZL 1AXSB 2W60B 3RDTA 1BAFH 4WNQA 2X4QA 1FV1B 1RZ8B 5C92A 3WEAA 4HJ0D 5I76A 1YY9D 3SZKC 2P24A 3DUUA 5ALBH 2C9PA 4GA6A 2EIZB 4HKBA 4M5SA 4S2SA 1XF4A 1QEXA 1MAML 3AUWB 1JV5B 4HS8L 4WU7B 5E8DL 3VRJA 5K39A 4FA7B 2VLKE 3PWNB 4NQDE 1W72B 1TZIA 1L9MA 2CMRL 3HOGA 4B95C 4EIUA 4QI3A 2ZOOA 3B7TA 1XIWA 3B9DA 2WXJA 1M7DA 4KOCA 1HSAA 1FNGB 2BIQA 4MJ5A 4OAWA 4RIRB 5D2NE 1YEIH 2DTSA 3LH2L 4ZTOH 1XGYH 4HF5H 5D4QA 2EVHA 5E9DB 4O58L 2D3JA 2CUIA 2ORBL 3GNMH 1S7TA 3MJ9L 3P1VA 1FH5L 3TBBA 4RA3A 1UHEA 5GM9A 4KTEH 1JHLH 2HMID 4LVNC 4X6DE 3QWOB 3FU9A 3U6RA 5JOPD 1OAUH 3TJPA 1FZOA 2L7UA 2XWJB 3BGMB 1M2OA 4FRWA 4GMSL 3BH8B 3CMOH 3DXAE 1RZIB 1P7QB 3POHA 3KJ4B 1FPTH 4Q89A 2B8OT 4N8UA 1TU2A 3V2AR 2LT9A 3C8KB 4JB9L 3TC9A 5KG9B 4MFHA 2HZHA 3LS5L 3QUML 3VXUA 4TQIA 5JMOC 3FUFA 12E8L 3LRKA 3PGFH 4I3RL 4PJ7F 4R90L 4HSCX 4XNAA 4Y19B 5HYJA 2YMTA 1T22B 3P2BA 4TLTA 5FO7B 1A7QL 3UTZB 1BQSA 5T5ID 1BXUA 1R3LA 2QVTA 4DGWC 2I27N 2EZ0C 3SBRA 5BVPL 3IGLA 4HV8A 5L4IA 1U58A 2VR7A 2G9KA 3SQBB 2M83A 1G9MH 3GKWH 1A4JA 3OAWA 5HHNB 3QEQB 4AZ8A 1FRGH 3MACH 2E7DA 3O3EB 2FSDA 2ITEA 2LV4A 4KBPA 5I74B 1UD3A 4P2QA 4XPTL 1N7ML 4R0LC 1BEYL 3U0TA 4XVUC 4BCXA 4ZUSA 2JKRM 4L8CB 1S8DB 3LCYA 5FUZL 1N3NA 1V27A 2OX5B 4WTQA 5FF6A 4JR9L 3OZKA 4XBPB 2Q7YB 5KYXB 4NBZB 1U8MB 3HG1A 4AYSA 3BLKA 1WAAF 1Z9NA 2ESVB 4GBXD 4Q6KA 4YO0A 4JM2C 4OI9A 4PJ8A 1HIMH 4UINH 4XNQA 3WKNA 4KVNL 4MZ2A 2ZXGA 3MVSA 3QORD 2ICCA 3HMXL 3T6XA 3BD5A 1GJIA 1AY1H 4FXLA 4JO3H 2BMKA 4JUSA 1E8ZA 4NENB 3WTTA 3KYMA 1TNNA 4P23D 1J0KA 1I3UA 1PAZA 5D2LB 1R3IH 1SHXA 4Y2DD 2XZAL 3N1MC 2RCSH 2UZYA 3HS0B 5EC1A 3NABL 5DUPL 2QR0B 1JN6A 1YYCA 4R7NA 5IJVA 4MA3A 5BZDB 2F8XC 1N2RA 4LLVB 1JGDB 3PUCA 1E4KC 4NZRH 2ZKHH 3ULUC 5EBLB 1FORH 1VGKA 3ME0B 1OCWH 1URIA 2HCZX 4FQHB 1MJUH 4UQDA 3S4SA 1HKFA 4X7TB 9PCYA 2A6KB 5DFTA 1IBDA 1RHHB 4N2FA 1QFWH 4WUUE 2K4WA 5LBSA 1ZV2A 2ZOTA 4G5AA 4PJEB 5F89A 1JPGA 1FIEA 4RNRB 5J3HD 1EEUA 1YJDH 2NW3B 2WANA 5C6TH 3VYOA 4B7IA 1JVKA 1AH1A 4PVLA 5DCCA 5IVXB 3BP7B 1UWEH 5KVGH 1FC2D 1SGKA 3MCG1 4YQXH 4AW7A 4E5XB 1S7XA 1IBYA 2BVPA 4E9SA 1DVFA 4U6VH 5HHME 1QBMH 1K5WA 5KBLA 4FXGB 1AP2B 4G8GB 4TQ8A 1JL8A 3L1GA 4FHJA 4HIIA 3H6JA 3HE6B 5E5UB 2FJSA 4BBWA 2RTTA 4XWGH 2AQPA 1Q0XH 4FOMA 2X4PA 4NP9A 5ECJE 3S8FB 1JF1B 4LVEA 3UJJH 5IMMA 3CFDA 1OL0A 4HCFA 1V3JA 3BZEB 3VYPA 3TASA 5F0LB 4IBVA 3QPKA 2FB4H 4JRXA 2Z4QA 4L8BA 1NOFA 3Q06A 1A14L 4LU5L 4W9FC 3SGEH 1KIPA 3VQMA 5HSFA 3LPWA 4KH9A 1NLBH 1CLYL 3A6BL 2WINA 2ZAIA 2OYPA 3ROLA 1H5BC 2DL9A 1HHIA 3K46A 1VZIA 2JIXD 4U3HA 4FCAA 5AB2A 3E0GA 4E9XA 1OE3A 4I89A 5C18A 2HFFA 1V05A 1RSYA 2WCSA 4ZK8A 1KXQA 4JO2H 1FIGH 3L4XA 2XYCA 1AMYA 4XPGL 5AAMA 3WN5A 4ZD3H 1S5IH 3MREA 2ITCA 3SPHA 3BWAA 3QYMA 1QSEE 4HSQA 1BAWA 3I02B 1M53A 4AOKB 2IQAA 4JFXB 3UBHA 5JPNC 4G8EB 1OP4A 3BFOA 3BSGA 3HHMA 3CH8A 1L3NA 4NSKA 1DN2A 4OD3L 1WUNT 4UOW0 1IKFH 4WHTB 5KOMC 3T9WA 1GJUA 2EICA 3W5MA 3JYCA 4FA8A 2KS0A 3GZQA 5IVZA 1AQHA 1MVUA 5JPMB 1ZVSA 3IXTB 3MKGA 1OLZA 4FXTA 4LHJB 4PJCB 2FEDD 3BESR 1LNUA 3JV0A 5L88L 1MFUA 1DE4B 2FBOJ 2MNWA 2MQ0A 5D7JC 5ECGA 4A7GA 4X99B 2X2UA 1M7IA 5CEZD 1S9VB 4WIQA 5I5RA 5D7IA 4APXB 4J4PC 3UPCA 1SF3A 2H3NB 4FQXD 4HHWA 3SE4C 1KPUB 4H20H 3QJTB 1IC7L 4N9OB 4GFTB 4DVBB 4OGAD 2G5UA 2BCMA 2OMTA 4U0RB 4LCWA 4POUB 5I8EB 4K3DL 3PGCA 4LCIL 4FFYL 4P2YA 2AXGA 2FYYB 3IF1A 4FXKC 4Q14A 4UAOC 1K8IB 4PHXA 2DJUA 2PPEA 2K6ZA 3OB0K 2GTWA 1GIGH 3T77A 3PWPE 1VENA 3RVUD 3U9UA 3JBG7 4XH2B 3RTQB 32C2A 1JZ8A 3CZJA 2RH0A 4WWOA 4B60A 4MMXC 1UYWL 3BH4A 4V1DA 5H2BA 4GBXB