4L48A

Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
202
structure length
202
Chain Sequence
b'MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGTVRVQVADQCHGCEVGHLNLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVVLPGLRMAPGEIQRTASRFYPVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose binding protein
publication title Crystal structure of wild type and d78n mutant clavibacter michiganensis expansin, in apo form and in complex with oligosaccharides
rcsb
source organism Clavibacter michiganensis subsp. michiganensis
molecule tags Sugar binding protein
total genus 44
structure length 202
sequence length 202
chains with identical sequence C
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4l48A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 4l48A02
4L48A 3X2NA 2GAEA 4FG4A 2G5DA 3SUJA 3X2MA 4JP7A 1HD5A 4JCWA 3X2JA 1WHOA 4AVRA 3X2PA 1L8FA 2G6GA 3SULA 4ZM7A 1BMWA 1BW3A 1N10A 2VXQA 2KQAA 3SUMA 2PI8A 3FT1A 4FG2A 3FT9A 2JNZA 3X2KA 3SUKA 4JP6A 1OA7A 2ENGA 4FERA 3X2OA 3CZBA 1WC2A 5GM9A 2PNWA 3X2GA 1BW4A 4FFTA 4JJOA 3X2IA 3X2HA 3D30A 3M3GA 5GLYA 1WHPA 4ENGA 3X2LA 2PJJA 2PICA 3ENGA 2HCZX 5GLXA 2AE0X 2BH0A 5H4UA 1OA9A 4JS7A
chains in the Genus database with same CATH superfamily
2NY2D 2ZUWA 3QUZD 5D1XA 3K72B 4R0LA 3F7VA 3ET9F 3WNLA 2JIOA 1G6RH 1E9PB 2APWA 4OKVB 4L5FL 4P0DA 1F5WA 1UZ6F 3QC8A 2C9UA 1QVOA 5KOVC 4NP4H 3UIZA 4WQOA 2VMEA 5HGHA 2AP2A 3QNFA 3RU8L 3BDXA 1RPQA 4O58H 2YR3A 5I1HL 5I6LA 2JI3A 3GTPA 3QRGL 4KZEL 2G60L 4WF7A 1PZSA 2DQUL 1YMHA 4F2ME 2GJRA 3HG0A 2GHZA 1PNDA 5DEZA 1NLBL 2QFPA 5D7LE 4YPGA 3VAEA 2VDQH 3GMRB 4RRPG 5SWZB 4BFRA 4R2GD 4YDLC 2P24A 3Q6FB 4K3JH 5ACZA 3DX8A 4GSXA 5C0JA 3WEOA 3Q5YA 3OPUA 4XNBA 2C7UA 3HI6H 3HS0B 1F3JA 4AJYV 1K3IA 3O6FA 4HALA 4KY1H 2Y22A 4DP2X 2ZOLA 3FB5B 2OMUB 1KDJA 4ZPVA 5CU9A 2K45A 2AHIA 1J18A 4PJIB 1OTSC 3I6GB 3AC0A 3L2LA 1C5BL 2Q7YB 2ICWB 2CLZB 2X1XR 3ULUE 4NPKA 2IADB 3HNVL 3I3EA 2FEDC 2FSEA 2VDKL 1LDPL 4GAYB 5T5MD 2KLSA 4NM4L 3AVEA 4LE8A 5I6KA 4YDZA 4KDIA 2B1AL 5KSBF 3FB6A 2VR6A 4YAQB 4JFQA 3FT1A 2R29A 3X1BA 3SY0A 3EJJX 2UXGA 1YEDA 3S36L 3KLDA 4OJEH 1NICA 1C12B 4BKSC 1I8IA 4HH9A 2BRQA 1I9JH 4RX4D 1TLMA 1N5AA 2GITB 4HEPG 2R29L 3WJJA 5CLXA 5DWPA 2NYYD 3AXIA 1KMGA 4JQVC 1IC7L 4NT6B 3BDYL 2VAJA 3EBGA 4YL4A 5I0YA 5DTFB 1M4KA 1KEMH 3MRCA 4LDLB 3PLXB 2NTFB 2J2ZA 1KOAA 2VPXA 1Z1WA 2K8QA 2WKOA 3LPGA 1GYWA 3QT2A 4CRYG 5C0CA 1UACL 4KXAA 5B7MA 2GCYB 1KYOK 4KK5D 5DEGA 3P2BA 4BZ2L 2DI9A 4RNRA 5I1EH 5KANI 3QQ4B 3ZTJG 5C9JB 5ANMA 4EI5D 1GKOA 2F7OA 2UZXB 4G83A 3NDYE 2YD6A 4XWOC 4DW2H 4IU2A 5BQ7A 1JWSA 3HLAA 1NEPA 3IE4A 1XF5B 5CJOH 1BA9A 2B20A 2NX5A 2BNRA 5HYSG 1PDKB 1MUJA 2NVYA 5IQ9B 2VXVH 2OL3B 1ZAGA 3NQKA 2OXHA 2YFNA 4BFIB 4FFYH 3IR7A 1WA2X 2Z91A 4AZUA 4ZD3H 2XN9E 3CC5A 4R4FH 3P40A 2X4RB 4G1EA 4N0FA 3CK0H 1JPEA 3T1FB 1KJMB 4GJTB 2IH3A 1Q9LA 5FECB 4ZPTA 4Z7NF 5I75B 1M56B 1MWAB 4K94L 4LXFA 1Y18A 2BWQA 4MDIA 1JXDA 1DQQA 3IF1B 5LWYL 5C6PB 4B50A 1RZIB 1G6RA 1SHSA 2OI9C 1DHKA 3GNMH 4KQ3H 5CN2A 4LSPH 2GY5A 1ITBB 5JDJA 4ZUUB 3ULSB 4E0RB 1S9VB 3IGAB 3RPBA 4TXVB 5KS9A 1G6RL 2HP4A 5BZDB 1TQCB 2EECA 2YHGA 3CZJA 3QQ9D 3PHSA 3IPEA 4KTGA 2IEPA 2IH9A 4JHVA 4ZOBA 2W95A 3SJVE 5K59F 4KUCF 1TO5A 3JVGC 3OHXC 1L7TL 2YRBA 2BSTA 4O58L 4CN6A 5DMIH 1K5NA 4DCQB 4NRYB 3VFSB 2XZAH 2DM7A 3B6SB 3JZ7A 3RVTD 3CSYB 3COOA 1BMZA 2QSQA 1CD9B 2VDQL 3FUMA 5F7KC 4LKCA 4YR6A 5CEXA 5FHAH 1A22B 4OFPA 2Y36L 4MMZC 3RUGF 4AITA 1QFWH 2ITCA 5I8EA 1CXLA 1KGUA 3ATAA 1R3KB 5C09E 1NINA 2JIQA 4GXUN 5B3JF 3HI6L 5EWIL 5BUAA 1ND0A 4NZDA 1IQWH 2F9BT 4KY1L 4XGZB 1WZKA 2WANA 3B9KD 5CILH 1OGAD 2XFXA 3QBTB 5EG6C 1JF1B 1FIGL 1LEKB 1IGJB 2XXFA 4CVWA 3FPYA 3Q2CA 4L8BA 4PJAF 4JPWH 1CD1B 4Z7VE 1CC3A 3X11A 3TT3L 2ZOOA 3PYCA 5ITFA 4PGBB 3WIFB 2H9GB 2VDOH 4KJWC 3CUPB 5JUEH 4HU2A 3H9ZA 4GXVL 4A37A 5E8OB 2IOOA 4NZTH 3F12A 3V0IA 4PBWD 4Y7MA 2HLFC 3OB0H 2O5ZL 1CK0H 1JHKL 2AEWA 1E9OA 4M4PA 5CZRA 4HWBH 3PDOA 5TH2A 2ZWNA 1E7VA 3V4UH 1I9JL 4ODWB 1FFOA 2YA1A 3D39E 1QLFA 1TITA 4PLOB 5ECGA 3VGAB 1FBIL 5EU6B 5HHPA 3L3KA 3NEEA 4AMWA 4BYHA 4QRRB 3SKMB 3O8XA 2Z6FA 5LO7A 4ODBD 1SJXA 5AW4B 3FU7B 1KEML 2NQCA 3PJSA 3U0WH 2ARJB 4HF5H 2YBRA 1A6TA 5IMKA 4ZMQA 4HJGB 2DQMA 1L3NA 2G5RA 3IJHB 2J12B 4CAGA 3A47A 2AJ3A 1I8UA 3WEBA 2HVJA 1YEGH 3ZGIA 2WAHA 4BA8A 2UX7A 1R3HA 3Q13A 4JG1H 5EOTA 1FYTD 3GB7B 3O3UN 5SWZD 4DW2L 4XAKE 4KRPB 1ORSB 3VSVA 4P3WA 1XCTA 4OFQA 4ODTH 2EIBA 4ZMTA 3FFCB 1WVZA 4XP1L 5KVMC 3VFTA 4HUNB 3RE0A 2XQYG 4PRID 3DBXA 5DD3H 2X38A 4FFYL 3ARPA 3LS4H 4N8PA 1YMMA 4G5ZL 5T1LA 3VH8G 5GGRY 4FQXD 3GSVA 4R4FL 5E4OA 5FAAA 3IB4A 1WC7A 3RTQD 1PKQB 1HL8A 3O2WH 1A3LH 2TAAA 4OCRH 4RCAA 5IVNA 4CC4A 3UJIL 4QAMB 2NQDA 4WWNA 3PWPB 2R39A 1MVFA 2VE6A 4KO7A 5JDSB 4XVUC 4YHMH 3WSQH 3T8MA 1DLFH 4MNQB 1KENL 1GL4B 4ETYA 5T5ID 4LSPL 4IQHA 1DQDH 4EIZC 1KLFA 4K4KA 3AJ7A 4X5RA 3H9YA 4JKPH 5HGBB 1LMKA 3LVTA 1WCQA 3D85D 4U0QB 1TTCA 2Z8SA 4I48B 4K55A 4ZAKD 3WFCH 3X3GH 2XCMC 4HK3N 3GMMA 4KUZL 4LSTL 2KQAA 4XOEA 3ARED 3D3VD 5EZLA 2ZTBA 1J0IA 2APFA 4KZ0A 1ZIAA 5T3ZE 5DMIL 4ENZA 1S7RB 5E8DH 4DKAA 1RK1B 2YAOA 4H8WL 5DFVC 4M5SA 3ZDXE 1XGUA 4M7LT 3UFIA 4ZRGA 2ITDB 3K6IA 3WEMA 1S7WA 4U1SA 4AL8C 4DN4L 2FR4B 4HLEA 4EUPB 4YHPB 5CR8A 3VWKB 3LX9A 4IRZA 4JFFE 1MCHA 4OCYH 5DF0A 1IQWL 4R7VA 1CICD 4FULA 5AW6B 5C0AE 1FPTH 1I4FB 4N24A 3ZE1F 1CGVA 3UTSA 4QNPE 3W0WA 4NAJA 3MV8A 4YSAA 4PP1C 1SEBA 1TT6A 3H9SA 3UZVA 3IFPA 3G5VA 2FJGA 1UUSA 3CZSA 4HMCA 4W9DC 1RJYB 3BW9A 4LQ1A 4NQVA 4JG5A 4HOXA 3TV8A 2YPVA 4PJFB 5JUEL 4G7RB 4DO6A 1YQVH 2R2EA 4IMKC 2B14A 3MRPB 1BBJB 5AB1A 1QACA 2FJSA 2AGJH 4FYTA 5EEVA 3CC1A 3UTTD 5JXEC 3BVNB 2YPVL 1SLXA 4D8PB 1CK0L 3AWEA 2I9LA 3RY6A 4EO5A 5DURD 3S96A 1BSIA 2R2BB 4HWBL 3CVHB 4YK4B 4AW7A 5E9DD 4K7PY 4L37A 4XBGB 1GPOH 4OFDA 3V0AC 3OLDA 4X42A 3PL6C 3V5DB 1BXXA 2OTUA 3MSPA 4E2OA 5IQ7H 2JA7A 4JRWA 2B2XH 2ICEA 3NCJH 3GKZA 1MCCA 2BSRB 5GRJH 3L4UA 3VXTA 5EU4B 2VN7A 3S5LB 4R9HA 2IAND 5E99H 2X4SB 4I9WE 1G7JA 1AQDB 4QJ4B 2TRHA 4XPTH 3MJ6A 5TD4A 2J1WA 3AADB 1YPZB 3RWIA 2P42B 3MGOB 4FS0A 5FO7B 2AJUL 5G2NA 1JTOA 4C56A 5EZIH 3OMAB 1YEGL 3IDUA 5DO2D 1KB9K 2MOGA 1OM3H 3AGVA 1ZHKA 1JZ7A 1F4HA 3P11L 1I1FA 3SSGA 2A9ML 4JO2L 4MJHA 4NC1C 4ODTL 3ZK0A 1QNZH 4MKTA 5GGQH 1OARH 5BVJB 4JUTA 7FABH 4YWGH 5A3ID 3O5AA 3Q8BA 1SJEB 4XP4H 4Z7UA 4R26H 4OGYH 3LS4L 1ZS8B 4GRWF 4G9FA 3VXRA 2GTQA 1SMYD 1WJ3A 1PZCA 3NFNA 4OUOA 4HD9A 4NZFA 4OCRL 4R7NA 1R3LA 4LAQH 3KJ4C 1KB3A 3TTSA 1U3HA 2GBTA 3SCMA 2QR0A 3K81A 1UEMA 3TA3B 4YHML 2KBGA 4YXKH 1NDTA 5IVZA 1DLFL 2J1KA 2PW1A 3RVVC 4TRPL 3VG0H 3BKYL 2H6PB 1PBYA 2ZUUA 1JN6B 2HRLA 1DQDL 4EN2A 4XNMA 1RJCA 1P4LB 2HN7A 1YY8A 5CD3A 4HIHA 4JKPL 2OMZB 2CK0H 2VJXA 4F7TB 4FABH 1RL1A 2ARWA 4X5WB 3X3GL 2H0FA 1O7DC 4OI9A 4NKOB 2DB8A 1VFOA 3UH8A 2RA1A 2J5WA 4KKLC 4DETA 2Q10A 4HWEL 2MJWA 5FYKU 3T6WA 2M2DA 1O7VA 1ZD6A 2PO6C 5EU6D 4FFTA 1W8OA 2A74C 1OGSA 2CG9X 2JKLA 4YVUA 1IEBB 1T1XA 3VTAA 3ZL1A 2RB8A 3QJTB 1LXMA 5FEBA 5BS0B 3QWZA 1H8SA 1MHHA 2Q87A 2G30A 3AITA 1XGQB 4MNHB 5C0ND 2WZPD 2F8OA 3ESOA 1N2RA 5D2LE 4CADA 2WUCL 2VL5B 3RWDB 3EHBD 2WLKA 3IU3B 4OCYL 2MKWA 3HAEA 4K3EH 3BAJA 2JCCE 2Q8AL 3T9WA 1SHMA 3QJFB 4A6YA 3SQBB 4AYFB 2IOMA 5BOZG 2AJYH 3GXDA 3QXTA 3E38A 5IHUH 1QR1B 1HHJA 4K7PH 4PUBL 5IQMA 1YQVL 1NDMB 4P5SA 4P5TB 2XWRA 5DK0A 2XLLA 3RGBA 1F41A 5AW0B 4OUUB 2EIEA 4BK5A 3PWPD 4F3FA 2H26A 5GRVL 2E9BA 5GGTH 1U8OB 2V9UA 3BO8A 3CFKB 2F54B 1ES0A 4LRNH 4C57C 5J9PA 4LAJH 1D5MA 1KV3A 4B7LA 1GPOL 1JV2A 5C08D 4AQ8C 3C5SA 2W92A 3ECBA 5JHLA 4I4WA 3SGJC 3PWNA 4PJ7E 4OM0H 4I3RH 3FQ1A 1BP3B 4K7FB 5E99L 4FAAB 5BZWB 1TQVA 3NYKA 4LVNB 5JHLL 3ZMRA 3MN8A 5GS2H 1UCBH 4N0YH 5JZ7C 4IOFD 1PYWB 2EO1A 3GGWA 5IESL 3Q1EA 3UTQA 3DTXA 5EZIL 3WOVA 3X2OA 1ULVA 2OMYB 1QPPA 3E80A 5FUOH 4U6XA 5EUOE 2FJHA 2D2CC 4TSCH 3P3RA 4OZFH 2FDBP 4EAEA 3ML1A 2WTOA 2BO0A 4IRSA 1CE6B 1TWCA 4OZGB 2G3ZA 2ZUXA 2EIKB 3KPMB 4FFVD 4YWGL 4CBPA 2Y6TE 1PEWA 2YS4A 3WMQA 1G7LB 2WNWA 1CGSH 2WWNA 4MYPA 4XP4L 4R26L 2X4QA 5D71L 1GYVA 5I24A 5LN4A 5AD0B 5ENWB 4J12A 1L9SA 2HJFA 4FDWA 1C08B 1KJ2B 4PCYA 2VDRL 5L9DL 4ZMWA 2WKGA 4YXKL 4G6JH 4HWZA 1D5IL 3C6SA 3QCVH 4GO8A 1VF5C 3K0YA 3QZNA 4MX7A 2OSLB 4Y4FC 3RG1C 4BA0A 3L2MA 5ESQA 2IPKA 4MB1A 2CH8A 2RH0A 5BW7A 4MD4A 5AQ0A 1RU9H 5F44A 1HEZA 4EDWH 5IGXL 3GHBH 4B6ZA 5JPMB 1E6JL 2CK0L 1A1NB 4PCSA 3VM5A 3ULVL 5AOKA 1ZT4B 4YE4L 2C3GA 4Y8DC 1BYNA 2DKUA 4NRZA 2H6OA 1MCWW 4NOFA 4OJYA 1MI5B 5C0GA 2DTMH 2QHRH 2WWMD 1T7XA 2OTPA 1OGAE 1WAPA 3ZDYE 1AD9A 2IBZY 1QUNB 3RIFK 2NT0A 5C0FB 3MV9A 3C60C 1TF4A 3MO1B 4G11A 2CM5A 4X6CE 4ORZC 5T1MB 5IOPB 1FNEA 25C8H 5D7SH 2DD8L 3B56A 3TIEB 4KKBD 2X2UA 3FQXB 1G9ML 4M43H 1FQ9C 5DMGC 4R97B 3NVQA 3ZXAC 1ZDQA 4M61A 3FKIA 2CRIA 4Y9BA 1S7XA 3WNMA 3QDAA 5KN5B 5HYJD 4KZCA 3N2JA 4M56A 4TNVK 3KYMA 3BH4A 1GZHC 3MBEC 1GH7A 4LFHD 1KBBA 1FL5A 4Y2OB 1RURL 1OT4A 5AZUA 2OPCA 4J4PC 1H9DA 5D7KD 3SDCA 4XXCC 5FYJD 5D6CB 1WISA 3UROR 3TPUA 3P4NA 1OA9A 3QH3A 32C2A 4L3EB 4TYUA 2AJXL 1KCLA 4E41A 5CMAB 4UB0H 4LLVA 4AKQA 4OD3L 3D06A 2WIIB 1E9QA 4L9LC 4WTZA 2HG0A 1I9IH 1HXMA 2X7LA 1X5KA 3L7EB 3R06A 1E4XH 3DMMA 4O02A 5GGTL 4E9WA 5GZND 2HKHH 5JLZA 5DJDB 1FYTE 4LRNL 4MMYB 4AH2B 2VMFA 3QUGA 4LOUD 4PIRF 4HCFA 4GI8A 5IW1A 3RFZA 2NY6B 1UZ8A 3FQRA 3F7VB 3T0AA 4RRPM 5FB8A 3JWNE 3IDNB 3OWRA 4PRIE 3S88H 3GT6A 4Z78A 1QVOB 3MV7E 2WIMA 3AG2B 1QI5A 4CDHA 2R1XA 5FFGA 5HGHB 1XGYH 5I1CH 3US1A 5FYKL 4LCWA 4BUGA 1Z3GL 5SWSE 1TFHA 2NXYC 1WQVT 4O2CA 1EAJA 1FVDA 1WIPA 3BT2L 3PQYA 1XHHA 4RGOH 1YMHB 5FOJA 5IVXA 1GGIH 2V33A 2WXIA 5JXAH 4Z5RA 1F6FB 4EZJA 3HG3A 5E1AB 2X4PA 3MLVL 1B4RA 2CAKA 3DX8B 3C2SA 1JZ3A 4ZX5A 2A0LC 1T83C 2HJKB 3QEQB 2AI0H 2BM3A 2CZNA 1F3JB 1OP4A 3LZNA 3O6FB 3D3VE 2ZOLB 1TEFA 5E6ZA 2PP7A 4ZPVB 3QNYB 4M7ZC 4A66A 4Q9QH 3MXVL 5D7IE 1IC4H 3LZPA 3MLYL 1HHHB 4NN5C 4NO5B 4YHYC 3V9EA 2EKJA 1UH3A 2ALAA 2GTZB 4G6JL 3I9AA 3QCVL 4HP5A 3LB6D 1OZTG 2AEPH 3ESPA 4BKLB 2IDCA 1BFOB 1RU9L 3FH7A 2NY3D 3S97C 1SBSL 3SY0B 1WE5A 3MJ9A 1YEDB 3A21A 3N41F 1CD0A 2VXQA 2KLRA 3H6AA 2WLYA 3BPLB 3M8OL 3QDHA 3VQ2C 2YPLE 3VGDA 3L3OA 4UWQB 4P2RD 3CD4A 5I71C 2A6JB 2J56A 3D2UA 2XKNB 4OAWA 3MJ9L 1UH4A 2BHFA 1AIZA 2X09A 3B37A 3U6XA 1YN7A 2VXQL 1R75A 3X2GA 4WEBH 1SF3A 25C8L 2Q0ZX 4PJCE 5D7SL 1UXSA 5L4FA 3FSVA 4H4NA 2GSIA 3MRCB 1JYWA 4TVSa 1AQ8A 2J2ZB 1KFAH 5C0RL 1P9MC 3K0WA 3UTTE 2CWRA 5E8NB 3R19A 5TF1L 5DEGB 4UOW1 1MF2H 1NCDH 3DVIA 3B1UA 2VM9A 4RNRB 3WGUB 5IHLB 3VD9A 3QFDA 2XBDA 3GSQB 4ICWA 4HEMA 5ANMB 1A5FH 3LMJH 5E9DE 1JUFB 4OBRA 5F6IC 1JWSB 1CGWA 3HLAB 5IJKA 2NX5B 4X9BA 2BNRB 3RRQA 1KB9J 1MUJB 3SYPA 2V9TA 1X9QA 2EDBA 1NUNB 3HHRB 1KCVL 1HCVA 2OXHB 4PG2A 2DQDH 4XNAA 5D72L 1HL9A 5E6IC 5C70A 1D5ZA 1NGXA 1HH6A 4Y2NA 3CC5B 4PIBA 3IFLH 2ZQKA 2IANE 4N0FB 4NAMA 2GIXA 3IS0X 1QHOA 2O5YL 5DJZA 4PYGA 1LO5B 2QHLA 2IH3B 5IBLD 3EXJA 1JZEA 1I9IL 3T4AA 4ZMVA 4ZPTB 5LXGH 3LVEA 4Z7VB 1WBZB 1HZKA 5A6LA 4AVJA 1Y18B 4MDIB 1EEYB 4GSDL 3HCVB 2HKHL 5KVDE 2W91A 2W60A 4JFDE 1KCWA 1ZLDA 1XWVA 1S5IH 2ATPA 1MFAL 4QHPA 2ZG1A 3V0FA 4QKTA 3UO8B 4KZDL 2LFEA 2BCKA 3RWHA 4HLJA 4J23A 4PLKC 2B8OT 1CMOA 2MTPA 1H6EA 2EDHA 3QI9B 4IMLA 3NCEB 4UAOB 1HIMH 3RDTB 3D39B 4B60A 1ZK5A 1SHXA 5HI4C 3RJDA 5I5IA 2GK0A 1FA4A 2ARJQ 4J6IA 1QLEH 1K5NB 3JBG7 3HOGA 5TE6H 1W6WA 4KU1A 3SDAA 3D51A 1QA9A 4RGOL 1F02I 1NIBA 4FI8A 4GNKB 5I1JH 4HOZA 4PRPE 3D48R 5HDQH 1G0XA 5JXAL 2I07A 2CU9A 4YR6B 5B1BB 1W0VA 4K73A 4KKAC 4RMRA 2ZCHL 5FGCB 1IGYA 5I8EB 1D7CA 1IGFH 1TOXA 3U0TA 2AI0L 2KC0A 5GISL 1E43A 1ND0B 3HRZA 5CD5C 5DUBA 3QJHA 4OZ4A 5IM7A 5ICXB 3MUZ1 4CGTA 1KNOB 4WCYL 3FUHA 2YC1A 1GY1A 2XFXB 4H20L 4YHKH 4WUKL 3EGDB 3L16A 3JV6A 3FT9A 3ZT7A 1IC4L 1J1OL 3F7YA 3TF7C 2BFGA 3DPDA 3W9EA 1BAFL 3L5HA 4DT2A 4OZIE 3T2PA 1EHLL 4MA8H 3X11B 4AENA 4XO5A 3RGVD 1QZ1A 4APQA 4X9FA 3AS1A 1D6EB 2AEPL 4WRLA 5JTWA 3KR3H 1S7TA 5FF6B 4WWKA 5EUKA 4AQOA 1AOZA 3ES6A 2YXMA 3J2PA 4JLRB 2IALB 5FW8A 1QHQA 3T6XA 5I6PA 1KF9B 2C3VA 2ICES 1BHGA 1U8MB 5TH2B 4BSVB 1RIUH 3G6JE 2MCG1 2IVFC 5CLWA 2JIMA 3EOYG 1QLFB 1AHWA 2EDKA 4ODXB 1DJSA 4HT1H 5D1XD 1Z7JA 3KWUA 2DI8A 4U1KB 2A9DA 4WW2A 1O6VA 4WEBL 3NPSB 4KQ4H 2QQLH 3HE6C 5ESAA 3SKNB 3V7MA 2RQ8A 1JYNA 3CN2A 3PJSB 5TF0A 1QEXA 4XTRD 2YBRB 1A6TB 5IMKB 1KFAL 1BJ1J 1ADQA 3S3PA 1BFVH 1E7UA 4UT7H 2CJTA 2VDMB 2HVJB 1NCDL 2PYFA 1ZA3A 5EOTB 1JPFA 2NOYA 3A4DA 1EIBA 1ADQL 1IGMH 3KH4A 3QZWB 1KCSL 1XCTB 1OAZH 3VVWA 4U1IB 5C08E 2FJFB 3BAKA 2XWCA 4N2LA 1KLUB 4Z9KB 2L04A 4OLWL 3VFTB 4F80A 2DEXX 5JW3L 3DBXB 2VSCA 2DQDL 3CZGA 3KEDA 3O6FD 1KPRB 4PJHA 5T1LB 4PG9B 4B0MM 2PYEA 1XIWD 1C5CH 5FW6A 2IWFA 3GSVB 1URZA 1JE6A 4MBOA 3QA3A 1WC7B 1QQDA 3TGXA 4NKDA 3KVPA 3BPOB 5L8KB 3SE8H 3PUCA 1B0IA 5LXGL 1C16A 4UNVA 3TC9A 1M3IA 4HAGA 1OA7A 1P4IL 2EXWC 2XU9A 3FUKA 2YLHA 3D4CA 5GS0H 1OAYH 1A7NH 4YHOH 3OZ9L 4U6VH 2YN5A 4X2UA 2HLAA 3AABA 2Q20A 5DHVA 2WMPA 3ASOB 3NJFA 4ZMAT 1SQMA 1EAPA 4N90D 4TQHA 1A7RL 3P2DA 1CZ4A 3ZTDC 4PVLA 1HIML 1OY3B 5EZLB 3ARFC 4UNTA 3TYGH 1W2KT 4BH7A 3BAYA 5DQJA 1YUKB 1QLEL 4C4KT 3LOWA 1YSOA 4AIEA 3QULA 2NSMA 4UIKH 4A39A 2PXYD 1MCPH 4R5TA 4TVPH 1AIFA 4F91B 2NY5C 5TFSH 5I1JL 2JSFA 2NNXA 5AZ2H 3KPPB 2P45B 3N85H 4JQVA 4BQBA 1XGUB 3BQUD 4GOSA 1CFQA 3ECWA 5INDA 3X2LA 3ETBF 4ZW7A 5EORH 5C0CD 1S7WB 2XG5B 2DPKA 4U1SB 3V4PH 5BXFA 2J1YA 4LIQH 2DQFA 4DKEH 3U4BH 2ZOKA 4KTYA 3DURA 1W72A 1MFNA 1JGVL 2R1WB 4KXZH 2YN3A 3UTSB 3W0WB 3MV8B 3SGKC 3UBXI 2NX5D 1S9YA 3H9SB 2IO5A 3IFPB 3G5VB 4HV8A 2FJGB 4OZHE 3BKCH 4R4ND 1W72L 3BW9B 3P73A 2XKUA 4E9VA 5I8KL 1AXIB 2JKWA 1EPFA 3KR3L 2AFNA 1OOAA 4EZKA 5E8EA 4PSPA 3ZKMC 2ZCLH 1JSYA 2I9LB 2YGOA 5HYJE 4DGVH 5IHZA 3S96B 2LW3A 5DRWB 4HCRA 3QHTC 1ZLEA 1AH1A 3V7AE 1PYQA 2VC2B 1RIUL 2A2QT 4XP9H 4L37B 2H32H 2DAVA 2E2IA 1OGYA 3DVGA 4PVMA 5I73B 1EGJA 4HT1L 4XC1H 3H0TB 4KDVA 1UGKA 2J6EA 2AVFA 1BW8A 5D7KE 5FYJE 4KQ4L 2QQLL 3VXTB 1U33A 2QT6A 1NEZA 5E9NA 3PXLA 1EGJL 3OAZK 2D7QA 2J6EL 3O3BA 4K7PX 5JW4R 3C5ZC 1BFVL 4I13B 3IVKA 1PYUB 3RWIB 3U2SA 2WB1A 1VGKB 3MLUH 2R0LH 2EDOA 3V6OE 3EJZC 2FL5A 3OJVC 3OHXA 3W38A 3QRFM 1IGML 1VCAA 1I1FB 4GO9A 1LM8V 3SY6A 1Y1UA 2EH8H 2IDQA 3ZE2E 4MS6A 2PMZA 1IE4A 1JP5A 2DYRB 1F4YH 4WKZA 4XVTH 1WIOA 4AT6A 2X05A 4G9FB 4MMZA 1KUMA 5TDNB 1BZ9B 1NGQH 3Q6GH 4Z0BH 3NFNB 5D7EA 3B5HA 2WNXA 1KCBA 1CPUA 5GRXG 1OE2A 4XMXA 1SQ2N 4ADJA 2AQNA 5DS8A 1U3HB 2JJVA 1M3JA 1KV7A 2QR0B 3CG8A 3KDMA 3CDGA 1AC6A 3DOSA 2VR9A 3HG4A 2V5TA 2APTA 4KRMB 4PW4A 3GIVA 1D3CA 4IDLA 4F7EA 3APFA 3WJLC 3N1MC 1TPXB 1YYLH 3CCHA 1OAYL 1A7NL 1MJ8H 5GS0L 4XNMB 1XTLA 4U6VL 1YY8B 5CD3B 4HIHB 3O6KL 3MYZA 3PRZA 1FZMA 5ISZA 3ZKXC 4Y9CA 3NG5A 4IGBC 1DUZA 2EILB 3NP3A 3ZZQA 4DSYA 3RIKA 4OCXH 4X6EA 5GRUH 4Z3FA 2GIMA 4ZI8A 2EXYC 2W07A 1P5UB 5K1NA 3MRDB 2Q86A 1MFDH 3TNNB 4L18A 2WP3O 1BXAA 4TVPL 3O8XD 5AZ2L 1NCAH 1UHVA 4UF7C 3LDBB 2FBJH 3N85L 4X9HA 4XE5B 1EHNA 5DI8A 3GSXA 2DN7A 2PCFA 1MHHB 1T6BX 5JORA 2WBJC 1DBAL 4QUOA 1BF2A 1N2RB 4J1UA 4CADB 2XTJB 4LIQL 5DVKA 4J2XA 3HAEB 1ZHLA 4I2XB 4HJ1A 5HHQB 3R1GL 4HIXL 3SGDI 5E8PA 4A6YB 4P2RE 4NQEA 3ZYZA 3WN6A 1P1ZA 4W4OC 4GO6B 1JVLA 4I1PA 2XACC 1GCYA 1YMMD 4HW6A 4U3CA 1UWEL 1HHJB 3GS0A 4NUJA 1SHWA 4XBPA 2KZBA 3GHPA 3JUZA 1MW0A 2ED8A 2GTWA 5A2AA 4M7JH 2GJZA 1KBGH 2DWEA 2ZYHA 3L13A 1DVZA 2V3FA 5E4AA 4F3FB 3MJ7B 1UWXK 3FRPG 1WLFA 1BVKA 2H26B 1E5YA 5A43C 5EZOH 2Q8BH 3KW8A 1QBLH 4UTAA 4DGVL 3SGEH 5B38A 3WIHA 3BO8B 1I85C 3Q2LA 4X98A 1ES0B 4GQQA 3NCYP 3MODH 4DPAX 5DJXA 1KPVA 1ZVSA 5J9PB 1D5MB 2NW3B 2NNCA 3MRLA 4GRWH 2EABA 1Q9OA 3N1FC 3C5SB 4XC1L 2F5AL 4UTAL 3V2AR 1A8JH 4MDJB 5LQBH 3WIHL 4I4WB 2QZQA 3ARGD 4ALAC 1S9WA 3D30A 2WBXA 3V0VA 3IFNL 1BJ1H 3QW9A 2DLEA 4OFVA 1UVQB 3UEZA 1HDMB 1MDAA 2RALA 1O6TA 4MGXA 4NI3A 3K6DA 4PJXE 1QTSA 3MCKA 1I1AC 3WHE0 1DEEA 3ZHFA 2GI7A 2CXKA 1SGKA 2CNZA 4W9LC 3VMOA 4LSQH 3UTZA 2R0LL 3DTXB 4FD0A 3SYOA 4A2EA 1NBVH 2CDFA 5J11B 1H6FA 3HN8A 1YN6B 4U6XB 2FJHB 2XN2A 4U6TA 3WFDH 1BOGB 1RZ8B 3T08A 1BM7A 1JGDB 5B1KA 4ANKA 1TQUA 4N2MA 5I0ZA 1M9SA 3WFEH 2JIXA 5KYUB 2J6WA 1T1ZA 2X4QB 3AU1A 4GI6A 1UB5B 4GT0A 1SEQH 3HVNA 4WJKB 1JGIA 1NGQL 2WGXA 3GZOA 4PWJA 1XFPA 3W0WD 1XX9C 5IMLA 3U4EA 3H9SD 1YVLA 2NZ1A 2HJFB 4MXWH 3DHUA 3HMWH 3LS5L 4LSVH 3UAJC 5E5UB 3W37A 3IDXL 1GJIA 4RRPA 1PGRB 4HWZB 3KWTA 1Z5LA 4MX7B 4LPXA 3ZDXF 1YYLL 1AAJA 2IPKB 4C2MA 2FECL 5HJ3A 4PH8A 4MD4B 1OP5K 2A38A 1HEZB 3QUYC 4P04A 3JV5A 4IMKA 2PCXA 2F18A 1NOLA 5KYYA 2VISB 2VLRB 3U6XS 3ZHKA 5F7WC 2X4UA 1TZGH 5LGJA 4GW5A 5C0GB 5JXEA 3QUKA 1I3GL 5EB9A 4GG8B 3GI8H 3ZSTA 4XT1C 1AACA 4K15A 4OTXH 3I9GL 3SEPA 3ZZSA 1TG8A 3D0AA 4GP8B 1VRSA 5KEZA 4FTVE 1V3KA 2VMCA 5FDWA 5KSAD 1FNEB 5A16A 4YEFA 2HRPL 1NCAL 3ZBMA 4LGSB 2OTWA 3P3YA 2FBJL 3GXFA 1VFAB 1BDYA 3VU1A 3X2IA 1DQTA 2B15A 3I6SA 3O45B 5IB4B 3WFHA 4WWOA 5SWSB 4CVZA 3H0GA 1IKFL 3T3PB 2IBZX 3BVDB 3AXLA 4C56D 4LU5H 4M61B 1SDAB 4PCKA 3Q7JA 1RJLA 2OMNA 3ROLA 2FQGA 3EKCA 4BEIA 3OKDA 2LTQB 4HEPA 4N2DA 3T04D 1AOHA 5F9OH 4WGKA 3A3YB 5BUGA 4G82A 3KLAA 5D1XE 5FUCE 3MI6A 3SDCB 5I8OH 1P84J 4XMKH 3VXRD 1C1EL 4G9FD 3TPUB 4MCZA 3P4NB 4M62L 4MS8C 32C2B 3RIAF 2NSQA 4AYGA 1YDPB 1NWPA 3KYKH 4OFKA 1AGEB 4E41B 3HTLX 4M9OA 4Y4HC 1HXYA 4LLVB 4M7JL 4P48A 1U3HD 5IVOA 1INQB 3SCMD 4S0HA 4KKCC 3MFFB 3VRLE 2Q8BL 2X7LB 1UD2A 4O02B 1JZDC 4ABVA 5E08H 4FA8A 5KBDA 5EV7A 3R0MA 3VW3H 5JLZB 1JZ4A 2Z8VC 2CE6A 3MODL 4URKA 1BWWA 3VFPB 2YMXL 3MLPA 2CO2A 5JHDD 1UZ8B 3N06B 5LQBL 1QMUA 3M1CA 3WY2A 1F00I 4ZZFA 5FB8B 2R15A 3T0ED 4Z78B 2CCLA 4Y2DC 2R1XB 1EJFA 2BIOA 2CW0D 4KVPA 4PWHA 3BPNC 1A02N 2VWEE 3LZRA 4M1CC 1SFDA 2X4TB 4OGZA 4YX2L 3ZPDA 4PJBA 3U46A 1RY7B 5HHMB 4LSQL 2R7ZA 1FVDB 3RVUD 4PJCB 4D7BA 1NBVL 4ENEC 4F92B 3T6QC 1F42A 2DM2A 2VRAA 1KIQA 2PO6A 3ABLB 4XPAH 3WFDL 4YSUA 5IVXB 2OSXA 1EAOA 2A74A 2E27H 1MVUA 2WWKO 4N2HA 5L2KA 3EO0B 3QDJD 4YSPA 4N5UA 3LNHA 4CKVX 1V7ML 1QFPA 1BVOA 3FUFA 4BCZA 2XTJD 3WFEL 2ZUVA 1HSBB 5DK2A 4ANUA 5EEWA 3PNWA 3RA7H 5MEOA 3OJDA 4N90E 1XD1A 1A9BA 4LBAA 5CP7A 3MUJA 2JMRA 1UZGA 4ZW8A 2DICA 2X44D 1NMCC 3O2DA 4MXWL 3HMWL 1G0YR 4QHLB 9CGTA 1TFPA 4TNGA 4BXVA 4GG6F 1Q4NX 3QC6X 2EDMA 2Y7QA 2F8IA 3B2XA 3IMSA 4FLRA 2XQBH 4EE2A 2DS4A 3NA4A 5FLVA 3HMXH 3FUIA 4FQHA 4P3DB 4ELMB 1Z3RA 5D2LF 2YEQA 5GLXA 3BC9A 5DD5H 3UYOD 4EOWL 1TMQA 1P4UA 3B83A 1TZGL 4N28A 2JCCF 3GI8L 3L3OB 4OTXL 1KTCA 3T77A 2YOAA 3D2UB 3KL5A 4OAWB 3ABKB 4HZ1A 3UBGA 3OWEA 3HA0A 4P9HH 3SZ6A 2E3VA 1T0NA 2D7NA 3G04B 2J4WL 2K1MA 2ZUQB 1UXSB 3LNGA 5EBLB 4AQ8A 5E2UL 4DP8X 3GTNA 1ZXKA 1YNLL 4UQ3A 2FHBA 3VXUA 3FSAA 3GMLA 3SGJA 2QVMA 3ALPA 5DJ8B 3HE7B 1HINH 3UC0H 2X0WA 3FFOA 3ZL2A 4G5AA 4RETB 4AK1A 2K0RA 2J8UF 4QCIA 2CJ3A 3GBMH 4PRPB 3QFDB 3VD3A 2HX9A 2IH1A 1RHHA 3BYYA 3CWGA 4IRSD 3TN0C 1TJIL 2B7DT 1JNNL 3F7PC 4N5ED 1GW6A 3VFMA 5JW5B 1H15B 2QPFA 3MRHA 5FW7A 4AYSA 3HG5A 5KS9E 5I8OL 2QVTA 4XODA 5DUPL 5BV7C 2APBA 4ODHH 4GIPD 3NZ8A 1D5ZB 4LEXH 3FTZA 5E7FA 3HBPA 3GTLA 3IGKA 2Y7NA 3OMIB 3OKNA 4R7LA 4MMXC 1P7QB 4RSVA 5DJZB 7PCYA 2OMVB 4LSSL 1WH0A 3AG3B 3X2NA 3B2UD 3O0LA 3RKDD 4OZIB 3VI4E 3ULVD 7CGTA 2VW7A 1IFHH 2L7QA 4O2EA 4FC3E 5HDWA 2W60B 2V7NB 4YXLH 3FU9A 4R4BA 3ETBJ 2A6DB 1DSWA 3PU7A 3BAEH 3N44B 2XQYA 2BCKB 3ZU8A 2I26N 2O5XL 2ZD0A 3VH8A 3ME0A 1P2CB 4Z8FH 1QLRA 3FQ4A 2BWIA 4IMLB 5FA4B 2FHCA 1GGBH 3G6JB 3N0PB 2ZG3A 3M17A 4QHNA 3EJCA 2H1PL 1OKEA 1NIAA 1WWBX 3MV9D 4ISVA 2NUTB 3EOTL 1LP9A 2XSKA 3EH2A 5C2UB 3X1FA 2ITFA 3EFDH 3WTTA 1I1CA 4XPAL 1BFTA 5EOQH 4AAYA 1U42A 2E27L 1JRHI 3MCYA 1A9EA 3VXSA 4LHUD 5IB2A 5F72S 3O0RH 1IGYB 4N25A 4UOW0 4LGRB 4XB8A 3LPPA 5IB3A 1NGZB 2A4ZA 4LLMB 5H35B 1UM4H 1ZE3H 4L4VA 4G43A 5GIRA 3D07A 4KDTA 5ANHA 3QJHB 2QV2A 5G4OA 4JRXD 1QFWI 4TLKA 3STLA 3DKHA 3RWGA 2HMIC 1XMWA 2YC1B 4PGEA 5DYIA 1MQ8A 4ZSOB 5FO2A 1SYVA 1BZEA 3SDCD 1GZHA 1W8EA 3F7YB 3MBEA 4X6CF 2N7SA 1UG9A 4DVRL 3W9EB 3WDHA 3ARZA 3FUDA 5IFHL 5HGAA 2UWEB 3BXNA 4J4PA 4APQB 4NQUA 2J88H 3QXVA 2LVCA 4XXCA 3CFJA 1QHPA 3NABL 4LEBA 4MVBD 3RKPA 3HMXL 3HUJA 4WWKB 2C5DC 1URIA 4KVCL 5EUKB 1JRHL 1X9RA 2L0DA 1EZVY 2WD0A 4FJYA 3ZHLA 3V0DA 4Z7QB 3DMMD 3ES6B 1TZIA 4GMSL 2G2NA 5DJ6A 5CZVH 2P49B 2W9DH 1YNKL 4PRAB 1NL0L 4GEIA 5I9QB 5DA4A 1AHWB 5FYKD 2VERN 5GS2D 5LAPA 1SMOA 2CBTA 2ZSWB 1FE8H 3POCA 2HAZA 4M93C 5IW3A 3I3DA 1JPST 1WAAA 2OZ4H 3L9YA 1BD2A 4WI6A 4WW2B 4Z23A 1YMME 3U6RA 5GSRA 3PDDA 2XWXA 4KK9D 3GLAA 3KEHA 4LCWD 3NIFE 3ZHDA 3C5JA 5KAQF 1HINL 2CBQA 4OB5H 3WE6A 4F37K 2YRZA 2H3NB 4EUPG 3PUUA 3RX7A 2D31A 5E7BA 1P4BH 3PQYD 2DJMA 1R3IL 3GBML 4OQ1A 5AYTA 4DOHB 3I9IA 3MAWA 4G9DA 4GP5B 4UOJA 4HUCA 1JPFB 3T6VA 5BOJA 1LEIB 1OGTB 1BFSA 2AS5M 4U1NA 1JCVA 1T6VN 4S1DD 5FFLA 3D05A 2K70A 4U6HB 1CZ8H 2DEWX 1UA6H 3MRQA 5DUML 4HJ0D 2V7HA 1T2QH 4LEXL 2PYEB 2DJSA 2QADD 5FO9B 1HKFA 3A4AA 1L0PA 3GQFA 1E30A 1T83A 3QA3B 1QQDB 4PJ9A 3AXHA 4NKDB 1ZT1B 2NLJB 3OKMB 3GSWA 3QHZH 4WNQA 1C16B 1S7UB 1GGYA 4K3DH 4UAHA 4NN6C 4PTTA 1KB5A 3MVSA 3PNRB 4YXLL 2DYPD 3QG7L 5C0EA 3BAEL 1U2HA 4BGDA 1FFQA 1CLCA 2B3RA 3QC5X 4UILL 3BVWA 5DHVB 1ETJA 3BUIA 4P9ML 4EDXA 4M6AA 4Z8FL 4HXAH 4X6BA 4YH6A 1CVSC 1EAPB 1S6NA 2HZHA 2N59A 3S5LG 1GGBL 4NRXA 4PGDB 2ZOTA 3FOLA 1ZTXH 4W9KC 3D2UD 1WBXA 2H0PA 3CBJB 3MOQA 5DQJB 4BH7B 3MJ8A 5D7IF 2CA3A 3DJZA 4YN3A 2VUYA 4JEGB 3B8YA 3V0WH 1SY6H 5E1GA 3SUMA 3NFPA 1FL6B 4OGXL 1J9TA 4MJID 4XXDB 2YK1H 5I1KH 1CGTA 1DFBL 3VXQA 1VZGA 2OV0A 1GGTA 3OLEA 3ZMNA 5SWQB 1E3ZA 1CFQB 3APDA 4MFHA 4UV7H 2BOBB 5BXFB 5MEND 4HSCX 3FUEA 3RZCC 1UM4L 1RD6A 2DQFB 1SLVA 3ARSA 1MSPA 1P9MA 1TYEB 2XWBA 3DURB 3IGUA 1MQKH 4MKMA 5MP6H 1VC3B 4MNGE 1SFHA 4X5QA 4DGUA 3FDWA 5JW4N 1RERA 4AGQA 1S9YB 3HB3D 4HV8B 4L3FA 3KXFA 3QVAA 3K1KC 1SOSA 3PGFH 3UG4A 4N2CA 4G42A 3NACH 3CQPA 4ONOA 4DGYH 4P46B 1AA6A 2J88L 3B3BA 5GRWA 1A4AA 4C4UA 1DR9A 3SKJL 3DK0A 1OF0A 1I75A 2RFXA 5E6IA 4BKTC 3EYUH 1HKLH 3WLBB 4X9YA 5LBVA 3FMGH 4C56E 4ELKB 3T09A 2OULB 5I75C 4FEMA 9PCYA 5CZVL 5F7DA 3UBXB 1INEH 1E4KC 1PAMA 1TQSA 2HLEB 1P7BA 4KDWA 5D2NC 5KVEH 3KJ6H 3EF4A 4GB9A 3DVGB 4KPHH 4WO4B 3TASA 2G9KA 1KLGA 3BPCB 2OI9B 2VDPH 4IK7A 4JJHA 1ROWA 2JFCA 4Z7UE 5HY9A 2BJMH 5MEQA 3VXRE 1PAZA 2LAGB 3IWUA 2HG5A 1HC1A 4LLUA 1NEZB 3FAXA 2VABB 2XTSA 4BQ9A 3NMEA 1E5BA 1TIUA 2P5EA 3O3BB 3JV4A 1UUNA 2XPGA 2DH3A 2M26A 1M7DA 2XUWA 3IVKB 3OAZH 4ZUSA 3OKKB 1ADWA 2BE5D 2HXAA 2PWHA 3J7HA 1B0RA 3SDAD 1RUAH 1CXKA 2VH5H 4OF8A 2H45A 5L4IA 4F7PB 5CIPA 1ML0A 5FUZH 2J72A 4FQIH 2LU4A 3NCFB 4YC2C 3Q5OA 3W1ZA 3ZT5A 2I60H 1OF2B 5JHDE 2BNQA 1RUMH 3SIKA 3H3BC 1W6LA 1XD0A 4WKZB 3QJUB 1CZ8L 2FT8A 1UA6L 4GINA 5FCUH 2HFGH 4AT6B 1CXHA 3DV4A 1T2QL 3T0EE 4MMZB 5HHXH 3W11D 4TNWK 4PBVC 4S11A 2W80C 1I3QA 4A7SA 3NJIA 1JGLL 2HT3C 1GGCH 2IFFH 3QHZL 4Y1AA 4TMPA 1C8PA 1UHDA 2DV6A 2Y9RT 3WUWG 3KDMB 4ABQA 3FT4A 5CF3A 3JXAA 1OAUL 3DOSB 2DLTA 3PFQA 4FMKA 4K3DL 5I5MA 3GIVB 3MRGA 4F7EB 3V8CA 1N3NA 1U8JA 1NANH 1KTDA 2YD7A 3HPJB 4OCSL 3CCHB 4WWKD 4AJVA 3QDJE 1BZQK 3D2TA 3MMEA 1VSCA 6CGTA 3LRSA 4E5XA 1CIDA 3RYMA 1AXSA 5ISZB 1T3FA 3VB8A 3GJFB 1CLOL 3VXMB 1N12A 1ONQA 4NYLB 3CZLA 1SY6A 3LQAH 2R9HC 1A6UH 1XAKA 4HYTB 1GOFA 3DK2A 4Z95L 4XHQA 1YEHL 4CRPA 3QUXB 4FQJH 2Q86B 4Z18A 3V6ZB 3V0WL 5A2KH 1L6ZA 4NHCL 1SY6L 2D3LA 4P3CH 4U3XA 4QOKA 3LZFH 1JWMA 2YK1L 4KJPD 2NW2A 3ISWA 1WAEA 4G1MB 4PJXB 5B39G 1F18A 5JORB 3HE6A 3AG1B 4NXSA 4UV7L 1OQXA 1XCQA 4ZS6C 2YPKB 3ZZ1A 2MNWA 1Y5IA 2FEEL 2PTUA 3HC4H 2FLBT 5IHBA 3WAJA 1D7BA 3QIBC 1MQKL 2FB4H 3VFRA 1P6WA 1M7UA 4XMWA 5MP6L 3U25A 3DYPA 4KRPC 4NQEB 3IJ7A 3QXAA 1P1ZB 1MFVA 1QKZH 1ZDSA 2BS9A 3AS3A 1SN2A 3PGFL 1J8RA 1D5XA 4DGYL 4LSRL 4OD2A 5GGSY 3WKYA 1AQHA 2YSTA 4FMVA 4NUJB 3L3DA 2DWXA 3FN3A 1LEGA 3GXTA 4ZO9A 4Y19A 1KGJA 1Y6KR 5IJVA 2GJZB 2YGPA 3ILQC 3QDGA 1L4IA 1U92A 5IFJA 1WRFA 5C1BA 1T0MA 3FMGL 1BVKB 1C7TA 1ZGLM 1NH6A 4UUJA 2F74B 3FHEA 5B38B 5E70A 1UWXH 1INEL 2K7PA 4AEHH 5KVEL 2H8PA 4X98B 3KJ6L 3L4TA 3SULA 1ZVSB 1E60A 1A1OA 3MRLB 3VNYA 2KHAA 5KOMC 1Q9OB 4MTMA 3PP4H 1DLHB 4M5TA 1H5BC 3MKGA 4CA4A 1MCRA 5AW8B 2BJML 1S9WB 5JQHC 4PRDA 3FSZA 2GB2A 4XCCH 1BX2A 1VACA 2F1EA 4FOMA 4BK8A 5GZOC 4Z7WB 4ZMPA 4D0DB 4WFED 3ZOAA 1EERB 5C07B 2OXGB 3UBHA 3MCKB 5EOCJ 2OKMA 3CVIH 1DEEB 2V17H 1GVIA 5EN2A 1U95B 4D2NA 2Z0BA 5IB1A 3RL1B 4EQ3A 1SMAA 3UTZB 1RUAL 2IWGA 4CVXA 5JO5A 1NFDB 2CDFB 2O30A 5FUZL 4HS6B 3IGFA 5I5RA 4FQIL 4G8AC 3RL2B 5IROC 1RV6X 3WKMH 4JY5H 4X9IA 1MRCL 1NDGA 1RZQA 4P9HC 4YSQA 4LL9A 4X4MA 1RUML 4XP6L 1W0WA 3S0PA 3V6FA 4YUEH 5E5MA 2BCMA 4IIZA 4CBZA 2OCJA 1G1CA 3MACH 2PJHB 5FCUL 1FV1A 3AU1B 2PPAA 1VLXA 2FGWL 4Z3EA 1L0XA 4MZ3A 1DBJH 4HA1A 3VXPA 1NC4A 4ZMLA 5FWQA 1XGPA 3U4EB 3BLPX 4Q9RH 3ZDZE 1GGCL 2IFFL 1K4DB 5F7LB 3MV9E 2VN3A 5CKGA 2JI2A 3SGKA 4IEFA 3TT1H 1ZJBA 3GO1L 3ALWA 4L8DB 3BP5A 1CL7I 5AOZA 3RJOA 2GJ6A 4RFEA 5HJ3B 3CH8A 1WCMA 1U8CA 4Q56A 4QGYA 5FTMA 3AM8C 3UAAA 1GOGA 1NCWL 4WFGD 5HDBE 1T1YA 3ILEA 3LZLA 4Z7OB 5KYYB 3EFOA 2CD0A 5CUSL 1IL1A 5JHMA 5LGJB 3PV6A 1S7QB 5F6HI 4JRXE 3X12B 1A6UL 1S2EA 1PQHA 4KWUA 2BZ7A 1YEKH 1YYCA 1UD4A 4WU5A 1FVEB 3IDJA 1TEYA 3RHWF 4PV8A 2J21A 3GMNB 4OZHF 3IAQA 2NY0C 4P3CL 2VXUH 4QHUA 4WFHE 5FDWB 1ETA1 5A16B 2FE0A 5ABAA 2VSKB 3DX6A 4JVPA 3PL6B 1B3JA 4LPYA 1T89C 4UT9A 5SX5H 3TBWA 2MFNA 3KPSB 3ZR6A 3O6LL 5KJRH 2ZSVB 4Y5VC 3C12A 2DW5A 1G7QB 1QWHA 4P23B 3GBNH 5E2WL 1ROCA 2VQUA 2GK2A 2B9BA 1RJLB 4UT9L 2GHWB 4JM4H 1DMRA 3C5ZA 3OKDB 3U9UA 2PETA 3GTJA 4WFFD 3L4YA 3QIUC 4NM8H 1A64A 4UCFA 5FYKE 3W2DL 4IW4C 4YDIH 1QKZL 1TJHH 2K6WA 4WKXA 5F9JB 3H6JA 1I9RH 2QGEA 3B4NA 3SPHA 4HOWA 3I74A 3K5SA 3FZUC 3FCSA 2Y3NA 4QT5A 3R0NA 4LCWE 1Z0NA 4NZJA 1ZE3C 4HJUA 5GS0D 1RSFA 3LIZH 3RPKA 4A7GA 3PQYE 3IU4H 2RAMA 3KJ4B 3ZKND 3WNNA 2P8MA 3QJOA 2A6ED 1JZGA 1KN4L 3VRJA 1OAQH 2KDGA 2P1YA 1PG7H 3MOBH 3ZE2F 1RZ7H 4KHTH 1D9KD 4OIBA 4Z0XB 2HPTA 3BE1H 1V5JA 3WJLA 3HPLA 4HETA 3VSQA 4AKPA 3UGXA 1KTRL 1ZRUA 2COQA 4Q4EA 1O6SA 4I3GA 4XCCL 3S35L 3BEWA 2BNUA 2AXWA 4FZ8H 2HLFD 6PAZA 2LLLA 1G1OA 3THMH 2WQRA 3CU7A 3JWDC 3KZ8A 3CVIL 2VRQA 2V17L 4GA5A 4PJBB 3U46B 1ITCA 3C8KA 3W39A 5LCVA 3N04A 4WUUD 2UZIH 2R7EA 2WXNA 1YAZA 1KIQB 1ESOA 2PO6B 2YXFA 4LEOB 2ZOWA 4HLZH 3WKML 4JY5L 4A2MA 2A74B 1MVUB 1IAOA 4XMUA 1H3WM 1VEMA 1BQ5A 5IBUB 1U4FA 3CMOH 4YUEL 1WDAA 2QPUA 1TJXA 5FM5M 1IGTA 2WBJA 4LP8A 3PNWB 3OJDB 2AEOA 2UYLB 1A9BB 3F5WA 5CP7B 3WKPA 1AD0A 4WY7H 2C3XA 1E3FA 4Q9RL 4DP1X 3AB0C 3VRIB 2HH0L 5KANG 1K8DB 3O81A 5JQ6L 5KWYC 1OB1A 1BZDA 3DDFA 3GXUB 5F97E 2A4EA 2CO6A 2Y7QB 3ARBA 4XO4A 3TLRA 4P49A 4MJIE 5HHOD 2NXZD 3LXBA 1PIFA 3QO0A 43C9A 5HPMA 4OFYA 4QTHB 4FQHB 4W70A 5MENE 4U1LA 1OAJA 1A6ZA 1QFUH 1UM5L 4DEUA 4ZTOL 3N6YA 2ENJA 1N4XL 2WCPA 4JM2C 4HEME 4CC0A 5J6GA 3IFOB 4JFPA 1ZA6B 2EDJA 4N2EA 5DD0H 2KLTA 3C87A 4G7YL 3IBEA 1EQWA 4HBCH 1UJ3C 3T77B 2EINB 1YEKL 2Q5BA 3OC8A 4BZ1H 5H8DA 1I85A 3S34H 3ZGHA 1HQ4B 4WHYG 4G7QB 3WENA 2VXUL 5EO1B 4G70B 3CF2A 1UADC 3DWTA 2EKSB 2HWZH 2EUVA 5KYXB 4QO1A 4UQ3B 1ZYRD 3GMLB 1CLVA 4CSPA 4GAGH 5I82A 1MHEB 1WIUA 4JB9H 1TLKA 1U4EA 5IF0A 3CN3A 5KTEH 4QCIB 4JM4L 3S3CB 1I1AA 2AANA 3WKQA 1EUTA 2IH1B 5I1LA 4QRUB 3ATDA 5CXPA 4OZGF 4ETQA 5EDSA 3MRHB 1UD5A 5AL8A 1V3LA 4YDIL 3BFQG 1FO0H 2JIXD 1TJHL 5EF0A 3VXOB 1FF5A 1Q72L 3BRGC 2EIZA 2X9XA 3BAIA 1T66D 5HGGS 1WBYA 1Y1VA 1Z5YD 3R8BB 4HMDA 3SO5A 4AG4L 2WVVB 1LWHA 4MXVE 3OKNB 5F1OB 4RWYL 4Q2ZA 2YLKA 3ROOA 3KWXA 2HB0A 3LIZL 1QPXA 4KI5C 1FFRA 3B9AA 4PP1D 4QR7A 2YZ1A 3S4SB 1D5BA 1WFJA 4O2EB 3VI3F 3MOBL 1HH9B 2E4FA 3N55A 3NEOA 5FXCH 4KHTL 3NBNA 2Y5EA 2YEZA 4C83A 4HHAA 2Q9OA 4ADGA 1GC1C 1HSAA 2DL9A 2BY3A 3D33A 3HNTL 4NDMA 4Y4FB 1G1YA 3ME0B 3ZKQD 1BVNT 2BP8B 2DLFH 1F3DJ 3ETSA 5ILTH 2HFEA 3R7QA 3QUYA 1M57B 5JXED 3NSJA 4FZ8L 5EOCH 4E9YA 2ZXGA 4IDJL 2Q7AA 2GW5A 4ZFFB 4TULL 5HI5D 3GFUA 2YWYA 1LO0L 1IIIA 4ISVB 4JZNB 5AOLA 4RFNC 1PZ3A 4I0PC 1LP9B 2YD4A 3S2AA 1FORL 1I1YA 4E9SA 2P80D 2VYRE 3PF2A 2UZIL 1ASOA 2AK4A 3MLTB 5C3LD 3O9WA 1IQDB 5E56A 3C60B 5DZ9A 3EF7A 3QZWG 3TBTB 3VXSB 2IPUG 3F6IA 4Z3GA 1VPOH 1UM6H 1MOEA 4JHAH 4R97C 1QTYT 3CMOL 4V1DD 2HKAA 1PQEA 2CDEA 4L4VB 4M1DH 4C47A 5GIRB 1U8HB 3STLB 1N8ZB 3GSNH 4PGEB 1WD9A 5I18L 3RVWC 4EIGB 4WJ5B 2D03H 1SYVB 4G6KH 1E2WA 1A2YA 4UQEA 5F8QC 3MBEB 4AMKL 4N8CH 3POHA 1CR5A 5CJQH 5HGAB 2CKBA 1JCKA 3OAWA 4ZQKA 1EJ6A 4IRJD 3CFJB 3UABA 3F7QA 1CDGA 4NCC2 4POZD 3HUJB 4QXGL 1KCRH 2EC8A 3FQTA 3NIGE 1ZV2A 3MTRA 3TBVB 5EO9B 1ZLUK 3UYRH 2CKBL 1QFUL 4DHLA 2PPEA 2DBLH 2AJZA 4Y4HA 3KMDA 5J1SC 1TZIB 2VLKA 3ULUC 3QIWC 5DJ6B 2YQGA 1WHPA 4L9LB 2EXSA 4UDUA 3TBYA 3WEXA 4PB0H 4ZXBC 3KE0A 4HBCL 1RZJH 4X5LA 3V5HA 1HEHC 3C6LC 2J71A 4X4ZA 3BN9C 4UU9A 5I6OA 1AGBA 2IWEA 5KBKA 2EO7A 4QDGA 2TSAA 2L8AA 2QEJA 5CZXC 1QOKA 2RACA 4ZDHA 1BEYH 2VDNH 1R34A 2HWZL 3U6RB 5TQ2H 2WXJA 4LASH 4MD0A 2UY6B 2DI7A 2VDOB 1QWUA 1T5XA 1U91A 3K3QA 2RHEA 2DQIH 5EC1B 1J0ZA 3QFJE 1YECH 4KKLD 5E5LA 3WE6B 4AQZA 3PHQA 2XA3A 1IM3A 4Y2DA 4BIKA 2VZ1A 4RGND 1MRDH 2G3NA 1JZHA 4EN3A 1LO2H 4JG0L 2X2JA 4DGWC 1XF2A 3CFQA 5F1KC 1J5OH 5L2KD 2QGBA 5FA3A 3H8NA 2ZKHH 1ZXQA 3NUKA 3K4DA 4U1NB 1CN4A 2OM5A 5CGYC 5E1HB 5EHFA 1K3ZA 1FO0L 3L5WA 5SX4H 2NNRA 1YJDC 2V7HB 1F90H 5PCYA 2VNCA 4WFEE 5KSBE 1KY6A 3DO7A 1S7VB 1X4XA 3OLIA 1PD6A 2WSDA 4BH8B 4JFHD 3GSWB 2CIKB 1VZHA 4HK0B 1AS8A 4WNQB 4JBSA 3CZFA 4M7ZB 4WEMB 5JMOC 4MD5B 4N0UE 4PTTB 1KB5B 4YHYB 4NN5B 3HZ3A 2H2SC 1ZHNA 2Y1YA 3MNZA 2BFVL 4NQCD 2WSKA 4X50A 4B7IA 2YUVA 5CFHA 3LRGA 3OGCA 4EDXB 4TPRH 5FV1L 1BEXA 1Z9LA 3INUL 1EDYA 3CDZA 3TVMA 1LYQA 1EJOL 3ARXA 3HNSH 3DX9A 1U8QA 5H37H 3NJMA 4NPJA 4KJQC 1WLHA 2Y5TA 3FO0L 4DNLA 1NGWA 1A65A 1XF4B 4RISH 4WZ9A 4BXSV 4NKIH 5IJDC 3MJ8B 1IILE 4XX1E 1BQLL 1NGYA 3W3BA 3FU8A 3JWOC 4KMTH 1A6WH 3BH9A 1XT5A 3KLSA 2OP4H 4KK8C 3ZYOA 1CTOA 2BP3A 4JQIH 2VERA 4V11A 2KPNA 4KHXH 2JKRM 3OR6A 5CSGA 3RX5A 3VXUD 2C3HA 2A83A 2JTYA 4AKOA 2WKOF 3ETTA 2VLLB 1VPOL 1UM6L 3KG5A 3BZFB 4C59B 1TU2B 2Y3AA 4FXLA 1K4CA 4OJDH 4WFGE 4MA7H 3UJJH 2ENPA 4M1DL 5KSVA 1OWRM 1T5KA 5DEJA 4G6FD 4H8VA 1F58L 4ONHA 2ZWLT 3GSNL 1TVHA 4Z7NE 3DTUB 4TTDD 2D03L 3LTVA 4XAWL 4HXBL 4G6KL 4LPWA 3BSZH 5B6CA 3TN0A 1KC5H 3VO0A 5F6IB 4F1ZA 5CJQL 3AAZA 2PF6A 1JHTA 4AM0A 1N0LA 2GQHA 4LMQE 5DVNA 1N67A 2JJSC 43CAB 1OP3K 3AMKA 3DETC 1KCRL 2RFXB 1U8PA 1OPOA 3UYRL 3BMWA 1UOVA 2IAMC 4U7SA 3SDYH 3AQDA 4MMXA 1IC5L 3G08A 4FYSA 1SMDA 4B9CA 5BV7L 2CRYA 1OIOA 2XA8H 4XBEL 1R9TA 3JWNH 4UM9A 2YIHA 3PAZA 5D8JL 5GHWL 3T0XA 3VX0A 5HP5A 3CQQA 1WSST 1BREA 1RKRA 3F84A 1KLGB 5KS9F 3T2OA 3JTTB 5E51A 4LCYA 3V4LA 5HY9B 4AMXA 5MEQB 1BEYL 4ZFOL 4XOBA 2HG5B 2ZPKL 4LLUB 1MG2C 2ZIDA 3RUGE 3NTCH 5K39A 4X6FB 4M3HA 1JHLH 2P5EB 2HFFA 3JV4B 2DQIL 2F53E 2XPGB 3FRPA 5J4MA 5TDOA 1YECL 5F7MC 3RDTC 2QQNL 3UPCA 1M7DB 3GK8H 4OLZH 5B3JE 1GYUA 4ZUSB 1I8MB 3VI4F 1MRDL 3MRKA 2QSVA 2BHUA 3TONA 1LO2L 1FNGA 2RMNA 3HAEG 4TF4A 3L3GA 5DJ2A 1OL0A 5E2JA 5H94A 3O4LA 3VFUB 5E9AA 2I69A 4PJAE 2ZKHL 4QXTB 2I5YH 2IGTA 1J8SA 2BNQB 2C7FA 4J7RA 1FSKC 3GM0A 1I7RA 1F4AA 3PWJB 2XHNA 4J3OH 1T80A 3D0VB 4L4VD 5DMGD 5BOPA 3LKOA 1GXEA 4M6NH 4KFZC 4X7TB 2YD2A 3DV4B 1F90L 4PAZA 1ZGLA 1TTRA 4TVPE 2CSPA 1VFBB 2IAAC 3H55A 2YAMA 3DIFA 1RLWA 5CSZA 4MAYC 4Y1AB 3MBED 3DHJA 1K8IB 2JA6A 2ZYSA 3FT4B 2PCPA 2AABL 4WUUE 1V10A 4WO0A 3G5YA 2CO7B 1NIDA 3KDPB 3UP1A 1XZ0A 3X1EA 4J4PD 4HWNA 1COBA 5GGRB 1T7YA 1N3NB 4LIQE 4F7CA 1U8JB 2RBLA 3BAWA 4F8PA 2QDVA 2SEBA 3AY2A 1F3DH 3KPNA 2CO1A 3LRSB 4E5XB 3I3BA 1AO7D 4X80H 1AXSB 1MXDA 3BGMA 4PJEB 1MFCH 1T3FB 4JDTH 3KPRD 4QHKI 1ONQB 5ERWA 4PI0A 5CN3A 1BQHB 5TK4A 2OL3H 1MW2A 4QRAA 4BZYA 2ESVD 1PSKL 2YUZA 5F7NC 1UASA 4NKIL 5E2TH 3QE5A 5AW2B 3GTMA 2RCSL 2F8XC 1MCEA 5D5MA 4OD1L 1A6WL 1BD2D 4R90H 2OP4L 1JBJA 1DVFB 4JQIL 4L8SB 4QOKB 4KHXL 5KYNA 1WHOA 3HW7A 1MWAH 3IETB 5HHOE 2CCVA 3VGFA 2NW2B 4JFOB 3K72A 3DDGA 3EIFA 3HE6B 1E67A 4OKVA 2DM4A 1R4XA 1TZOA 2X0VA 4PS4H 4WNJA 3LAFA 3IJYA 2XVLA 4A7UA 1PCSA 4FFWD 4MA7L 2WPGA 3UJJL 3ARUA 4DKFH 5CP3H 3KPQB 4POUB 2WLZA 2NXYD 1W16A 3T1WA 3E8UL 3HI1B 2K6YA 3SDDC 2EVIA 1HNGA 3VFRB 2P8LB 4XB3A 1I50A 1QRNA 3I02B 4LRIA 3QXAB 4WTWA 5CM1A 5BJTA 3BSZL 1KC5L 2XT1B 1ZJAA 1D5XB 4FHKA 5AWNH 3BOVA 2H6UA 5FM8A 3L3DB 3N43B 4JPKH 3WELA 1LEGB 1NCBL 4PJ9D 3NIFF 5IJVB 1SN0A 3L1FA 3MUGA 1U92B 5IFJB 4AZDA 3QK0A 1AQKH 3TJEH 1T0MB 3QS3A 4PD4K 5BCAA 3V79C 3SDYL 1FCCA 2CLRA 1MFBH 3GRWA 4CDGC 4DUXA 3LEYH 5AVZB 3AZUA 2XA8L 3HJEA 1A1OB 1RMFH 4L48A 5GJSL 1XO8A 1Z2KA 2CLZA 2ICWA 3HLKA 4AIZA 4KRNA 3UP6A 1O9WA 4GAYA 2CBOA 1VZIA 3BZ4A 3U48A 4PRDB 5HSFA 1BX2B 3PFUA 5DHYB 2HTLC 1BJMA 1BGXL 4LVOC 2LU7A 3NTCL 5K9JH 4HZLB 3WXWL 1ERNA 4ZMXA 2CO4A 2HTKC 3TIWA 1GIGL 2V5RA 1NAKH 5EN2B 4X4KA 4K23L 3VFVA 1C12A 4HVBA 3ARFB 3ZE1E 5JO5B 1E8XA 2GITA 2QVKA 5F2FA 3PPSA 2AQ3A 4PM1A 4PWIA 1F4WL 4DGIL 4NT6A 2ADJA 3CLEL 2I5YL 3UX9B 3K6SA 3EJQA 2EE3A 2NY1C 2ZYRA 1PG7X 4HPOL 5C7XH 5DTFA 3V6FB 3LEVH 1ZLVK 4F7KA 1QASA 4M6NL 2VR7A 1PJ9A 2R83A 4OVVA 2NTFA 5AZEH 3QQNA 3FCGA 3O3AA 4W93A 3RZCA 3VXPB 1NC4B 4GAFB 4Z7AA 3GPEA 3Q9QA 1XGPB 2GCYA 1O5DT 4N4YB 4F5CE 5MI0C 3KXFD 5DJ0A 2NY2C 3ZYJA 5C9JA 1FG2A 1MH5B 3UYPA 2LQRA 3CAFA 3EH3B 4OM1H 2H0EA 1DQKA 2AJVH 1XF5A 5E6SB 4EIUA 3BP5B 1EX0A 1CR9H 2HT2C 2IPUK 5E6ID 4XPHH 4NNYB 1CFNB 1U8CB 5DZAA 5TJWK 4DESA 4PVBA 4BFIA 4L1BA 2B5IC 1IEAB 4X80L 3ZE0B 4V1DE 3RLSA 4OJAA 1MFCL 5AAMC 1T1YB 1A1MB 4Y9FA 3T1FA 5FTLA 3H56A 1CZ5A 3B5TA 3ESNA 3PV6B 4KOBA 1XXDC 4LLYA 1OZUA 3FF7A 3F64A 4WU5B 3IDJB 5D2NA 5L7XH 4RDBA 5KZCB 4QHUB 4LCVA 5CCJA 1LGVA 4NSKA 4IU3B 1R17A 1GSMA 5GGVY 1KYUA 3DX6B 2K7QA 3UACA 4ZUUA 3ULSA 1MWAL 1S9VA 2P5ED 4NS0A 1BW3A 35C8H 5FS5A 3TBWB 3RY5A 4GW4B 4PS4L 1KBWA 3BVXA 4GRWE 2FIKA 2LU5A 4QRSA 5HI4D 4GKNB 4OQTA 5EULV 4CSZA 3TESA 2MIZA 3C5ZB 3KPTA 2E0PA 4NZUL 3U9UB 2JKIS 4KI1A 3P4MA 4DCQA 3EFFA 1TSRA 1KYDA 1XH1A 3VFSA 1JPGA 1YO4A 2HCZX 4KROD 4RAVA 3GZPA 4OQTL 4P5RA 3PLYA 5CJ5A 1B3IA 1QPKA 3ATEA 4Z7UF 1YNND 3MR9A 3VMNA 4DEPC 1HFUA 2XWDA 3F7RA 5AWNL 5EC2B 4A63A 4DP7X 4I87A 2YARA 2ICCA 4AUUA 4C54A 3F62A 4JPKL 4AJ0A 1R3KA 2FUTA 1Q1JH 1AQKL 1G5AA 1VADA 2DDQL 4KRLB 4KTEL 2NYYC 3TJEL 1J11A 4P4RB 3G5XA 2OS7A 4NNPL 4RGNE 5IK3B 1MFBL 3STZB 1QWNA 4YQXH 3VD7A 3G6DH 3W5NA 2VLJB 3REVA 3LEYL 4UTBA 2P8MB 4M5ZH 1DBBL 3VRJB 1RMFL 3U82B 4JFEE 1F8TH 4FA7B 3BUTA 3GIZH 3ISRA 3I2CH 3Q2WA 5L6YH 1SN5A 1YZZA 2H9GA 3OMNB 1O6SB 3IRCA 1H3GA 4KK5C 3BEWB 2DJ4A 2VAAB 4PRBA 1IKNA 4P05A 5BMFH 5KVFL 5K9JL 3ZKXB 3DI2B 4IGBB 3WCYA 4P59H 1NAKL 2WLNA 3UXFA 2WJ7A 3C8KB 3ATBA 3FH8A 4LSDA 1S9XA 3W39B 2C9AA 3L1OL 4HC1A 4ODWA 4AUYA 3BIAX 1QR4A 1W9XA 3NH7L 4BK4A 5LXVA 3Q8AA 4JP7A 1RUQL 4NQCE 3CVHH 1CURA 3MRIB 4WHDA 3SKMA 5JIQA 3KHQA 3SDXA 4OI7A 4WV1C 3FU7A 4OLEA 4AYDC 2W94A 3F8UB 5AZEL 1IGTB 2CQVA 2P9RA 4ZBJA 5FOBA 1NSNH 4DFIA 1IB5A 2MKLC 3F5WB 4M6ML 3U0PA 3IJHA 1AD0B 5JR1L 1ZPUA 1NLDH 3HC3L 5FKAA 2EC9U 1EWHA 3FQUA 4KK6C 3QIBA 1OB1B 1X7TA 4OM1L 4TUOA 4Y7OC 3HG1A 1LE9A 1ORSA 1FNLA 2RD0A 2JVUA 2C9SA 2Y23A 4Y5YC 4X4YA 4L0ZA 4LB8A 3VXUE 1QSFB 4Y19D 2IJ0C 4P4KC 3WTXA 3FFCA 3QDGD 3QO0B 43C9B 1MCQA 3L4WA 1BXVA 3FO9B 4XPHL 3TCXA 5BRPA 2OJ1A 2V3DA 3BZ5A 2P4AB 4OF0A 2XX0A 1N5YH 1HCZA 5GGVH 1RUKH 2G0KA 2Z0UA 1SXSA 4XRCB 5J6GB 3CX2A 5FYJH 5BO0D 3VGEA 5D1QE 4I1RA 1LDSA 4YDVA 2VUMA 2IPTH 3HVDA 3FULA 3NCWA 3H4HA 4L23A 3VMPA 5TPWH 1B2WH 1HNFA 2AERT 4DTGL 4RFOL 5DS1A 1GRWA 1NTDA 1QUPA 4ZW5A 4QO1B 3UG3A 5HGBA 4XN1A 1A4JB 1V3JA 4WK4B 4I48A 1BQRA 4NO0A 5I1DA 3I50H 1AY1H 4BD4A 3T3MB 4BCYA 3FBKA 4L1DA 2BSSB 5ALCH 5IF0B 3Q0HA 1TEGA 1KIRB 1I1AB 3QUHA 3QPXH 5J11C 4PGZA 5I1LB 4WTQA 2AKRA 1QI4A 2FX9H 2EDTA 3G6AB 4JY4A 1RK1A 4KX7A 4G8GB 1H8LA 3MLSH 3BLBA 3IJ9A 5IROA 4GXFA 1L9RA 2X1OA 2H7WA 5J0BA 3SKOB 1ID2A 1E42A 1WBYB 4HH8A 2ITDA 1HZLA 5JYMA 2R69H 2OYPA 3T8VA 1JPTH 4EUPA 4YHPA 2ROXA 3IM1A 4XN5A 1NCNA 4P2OD 1Q1JL 3ROOB 2ZCKL 4WI2A 4YQXL 2Z34A 3QQ3A 4GFTB 3ULVF 2D7MA 2X70A 4M5ZL 2J43A 1EFXD 1SXZA 2GJ6D 4GRMA 4TLTA 3WIAA 5EIIA 1HYSD 4G6ML 3HBGA 1WS8A 1F8TL 4PTUB 2YEZB 4C83B 5L6YL 3I2CL 3GLDA 1HSAB 3BGFC 3TA4D 4NDMB 3UDWC 4EI6A 1LK3H 4RDQG 4IBYA 4Y16D 3QUYB 4JPSA 3MRPA 1BBJA 3AQXA 3UZEC 2X28A 3AM8A 4OV6F 1DJYA 4D8PA 4I0CC 1UYWH 3ZDZF 4OT1L 4EEEA 2QL1A 1WG3A 2AK4B 2JJWA 4FQ1H 4JZOA 1L5GB 3WE1A 4AOFA 4FQXC 1G9NC 1SXNA 3QFJB 4JCWA 3CVHL 3RTQC 1J0KA 4Z6AT 1T89A 3TJPA 4KO9A 3BWUF 1AO7E 3EH5B 5EU4A 5T5FH 3S5LA 4CJ0A 2N4IA 2IF7A 2CDEB 3KPRE 5ICYB 2DRUA 4TM9A 1UD8A 2AK1H 1NSNL 3KWWB 2XQ0A 2XKSA 2QSCH 3A6BH 4PLJD 2EDDA 1MCKA 1CD8A 2ESVE 4HG4K 3EJZD 1KJVA 5FO7A 5IY5B 1E8ZA 5G4NA 4XNUH 3LPFA 1FL3A 4WI8A 2QKSA 1MJJA 1A2YB 3DIVA 1WAAE 1BD2E 1PX4A 3QIUA 3QRBA 5J12C 1FGNL 1LWJA 1U30A 4ZAKC 4B9IA 4LNRB 2FO1A 1TQBB 4TSAH 4ZQKB 4P57A 1PT0A 5BVJA 3MLRH 3AREC 4LOFA 3II1A 3QJXA 5D4IA 1CFSA 3ML8A 3D5OF 1ZS8A 1N5YL 5GGVL 4Z3JA 3VWJD 1RUKL 1J0YA 3S5YA 2VLKB 1ZLUH 2J3SA 3RB5A 1ACYH 1GY2A 4PJDA 4UDUB 4NX0A 3TBYB 3V7AG 3WEXB 4DZBA 4FQLH 1ETB1 3HZKA 2NR6A 5BRZB 2XIIA 3PGDA 2IPTL 3TA3A 5LHDA 1AGBB 2L3BA 2OCFD 2XYCA 3PWLA 4AVHA 1JMZA 5G4MA 5TPWL 1B2WL 1KULA 4ZDHB 1KJ2H 3PWUB 3U7YH 1MLBA 1NCJA 1CICC 4MD0B 4F7TA 4LCIL 1T5XB 1BG9A 1WV7T 4X5WA 3B7RL 1FAIL 4NKOA 1AY1L 3S5ZA 1IM3B 4Y2DB 4B9ZA 4FQCH 1JFQL 4N3UA 3RVXD 1XZWA 2RJMA 1HCYA 3GS4A 1U3YA 3N40P 2X1QA 6FABL 2FUQA 2VR5A 2BHZA 1U6AH 5FA3B 2FX9L 1JNHA 2P5WD 4L1SA 3EJPA 5FO8A 4RGMC 4XCNB 2BP0B 2I9TA 3MLSL 3HC0A 2IWKA 3H1ZA 1IEBA 4EIBA 2R8SH 2ZT9C 4ODUA 4HQQH 1JGEA 3UAEA 3L5WB 4KTDH 1QAWA 2WBJD 4PJGE 5BS0A 1L8FA 3C09C 4YSOA 3LPOA 4XNDA 5DR5L 2R69L 3FCTB 2ADIA 4JO3H 3VYNA 4DPCX 1J8HA 1JPTL 2AQSA 3DO7B 1XXFC 4D9RD 4EZLA 3KH3A 1PZ5A 3GSUB 3IU3A 2O93L 3VFOB 4FQPA 1G7HA 3PGCA 1VERA 3UJTL 3VD0A 2ZJSH 1RZKL 3CZFB 3AY4C 1NMCB 1HOCA 3ARBD 3HFFA 3K74B 3KPOA 1J86A 4N2IA 5C0BA 3UBXG 3ZY7A 1A3RH 4L05A 4LHJB 2VLMD 4CMHC 5IBTH 1WS7A 1KTJA 4BDVB 3EBAA 2ETWA 1K6QH 2CDGA 3OSVA 2VZSA 1DJGA 1QR1A 1CI5A 4WDIA 4ZX6A 1S78D 4P5TA 4PMFA 3KBFA 1NBYB 3CXDH 5DO2C 5GRYA 2D73A 2ADYA 4J6RL 2R4SL 3DARA 3WUWA 3LPWA 3CHOA 1NGWB 4JM2A 1U8OA 3KXFE 1NGYB 3QUMA 1JXGA 2YRLA 1M71A 2F54A 3BH9B 4OSUH 1UJ3A 4W81A 5A3IC 3TO4B 1E18A 3OR6B 4H8UA 3B9DA 1S3RA 3RUGB 4JGJA 2A83B 1TTFA 2QVFB 4EJ1C 4H40A 6TAAA 3J8F7 4JREC 4L5FH 3HE7C 2VZVA 5G5DA 5T5FL 1K4CB 1CDHA 1NCUA 4PWFA 3REWA 2AW2A 4K7FA 1I1AD 2XRAH 4TQ8A 3RU8H 4R96B 5KSVB 1KYFA 4AQ1C 4NWUL 2E47A 5F7YC 2FQEA 5I8CA 4ONHB 3Q8CA 5I1HH 1PYWA 3N5AA 1GZQA 1ZV9A 4NGHH 4XNUL 1IBGH 1E27B 4L0PB 2DQUH 2C9VA 1BIHA 3R18A 4N6QA 3TN0B 4UZSA 1NLBH 5DT1L 1TNMA 1RXLA 2DQEL 3KWVA 2ISDA 4F2EA 3GYRA 4TSAL 1CE6A 5ICUA 5B39A 3AAZB 1JHTB 1Y4ZA 3KPMA 3OF6D 4AM0B 5ITBL 1N0LB 1OCWH 3SYAA 1CBJA 5FHBH 5CBAA 4LT7A 1FAKT 3INOA 4XNZC 3SN6N 3V4PB 3FYIB 1IEHA 4MMXB 3X2KA 4D8OA 5AD0A 5ENWA 4ZMZA 1ACYL 3CZBA 4J3XA 2BK8A 1FNSL 4FQLL 1C08A 3Q3GA 3RWJB 3ZQ9A 3WTSA 3F04A 2CM6A 4JN1H 3D6GA 2PNDA 2DL2A 5GGUB 2CA4A 2WXGA 2VZOA 3VQ1C 3HNVH 2VDKH 3IYLW 4LCYB 4JS7A 2OSLA 3IK2A 1KJ2L 1T21A 3QUYD 3EHBC 3H2PA 4YE0A 1MWOA 4QYAA 4F9LA 2FQDA 5JPMA 2LLGA 4MCNA 4MXVF 5K39B 3QEUA 4ZFGH 1PPIA 1FCGA 3S36H 1MI5A 3CQZA 1ACCA 1GC1L 3CLWA 3MLWL 2OR9L 4XNQA 3MRKB 1H5NA 5DJ2B 3O9WD 3NAAL 2R29H 1I8MA 3D8MA 4JKLA 5LKNA 3MO1A 5T1MA 5IOPA 4HUWB 2W9EL 1FFTB 1X9LA 1M1SA 1ZTXE 3RQ3A 2R8SL 3KLQA 4HQQL 3UMTA 4KTDL 5J1AA 3FQXA 3HR5A 2Y1ZA 3K6FA 2OFQA 3S37H 4JO3L 5B1AB 4IJ3C 2C45A 4N22A 4W9EC 3DIFB 2CK2A 5J13C 1TETH 5CSZB 3PS6A 4FQQB 4G6AD 5D7LA 2OYKA 3PHAA 4I18B 4A2GA 2PCPB 2IQ9H 2NNAA 1JI2A 1SXCA 4R5XA 2P7TA 4BSWB 5B38G 1SZNA 1A3RL 2E6JA 3G9VA 1A3QA 1QG3A 5IBTL 2EVGA 2SEBB 2BVQB 2BMKA 3WBDA 3KPNB 2DMHA 4Z7QF 4Y4HD 3LRKA 1NANI 1TYJA 3BGMB 3G5ZA 4IOFC 2VLKD 4K9EC 4OIIL 4DFHA 3ZDWA 2FRGP 4YFLI 3CXDL 5ETUB 2Y07H 2PR4L 1A7BA 1RPUA 2WIIA 1MHPH 5J8OA 4Y0GA 4PVNA 5FKPA 4GBXD 3JQOB 5BNXD 4ZYKB 2B4CC 4ZXBA 1JZJA 4FFVC 4WW2F 4OSUL 3CHRA 4MMYA 3C6LA 4W9CC 3CFBA 1U36A 3WU1A 3VGHA 3ULUL 3U30C 4M93B 4S10A 4Y19E 3RY4A 5KVEE 3X2MA 2AJSH 5D96C 3QDGE 4JANA 2Y6SC 2ODIA 3NIGF 3R4RA 4IKJA 5F1NA 1IM3D 3IDNA 4DWHA 4N2AA 3FSWA 1HTYA 1EHXA 3IJYB 2DQTL 2ID5A 3L7FA 4EN3D 2XRAL 3ZE1B 3KBPA 5ABDE 1CLYH 4M1CD 5EN3A 3C8HA 1L7TH 3BVTA 2Q2EB 4ENED 1E0OB 1QRNB 1G9EA 3WFBH 4NGHL 2G5BB 1IBGL 1QO3B 3VDBA 4PPTA 5BJTB 5I6NA 1I1RA 2RR3A 1SJHA 1BBDH 1M6OA 4RMWA 4PJHF 5E1AA 4Y4KC 2PW2B 1UKSA 3T0VA 3V5KA 2V2WA 3H7BB 2Y36H 1X7SA 1NGPH 1OCWL 5FHBL 1DQIA 2Z1KA 4FMFA 3MUUA 3E9TA 1U8KA 2EEAA 1GR7A 2HJKA 3MUGB 3QEQA 5EWIH 1E65A 1IFGA 2XWJA 1BVLB 1PIGA 3RPIA 2ZYIA 2CLRB 3QPQC 4G80A 4PBDA 4NQSA 5DLML 4L4TB 5TTRA 1OB0A 4HIIA 3MRBA 3QNYA 4EBQL 1YJDL 2W59A 1FIGH 5I1IL 4IKLA 2VSDA 4MA1C 4NQDE 4P2QE 1HHHA 4NO5A 3D4YA 4JN1L 1F3RB 3BD5A 5DD1H 2AQ2A 1R19A 2GTZA 4NN6B 4AIZB 3TT3H 5CLTA 2V2TA 1FNFA 1JV5A 1Q38A 3BZ4B 4RBPK 3TVMD 4BKLA 1JZ6A 4GXVH 1BFOA 4KLNA 4ZFGL 4NFBA 3TZVC 2JK5A 3K2UH 1EBPA 2O5ZH 3K2KA 1JHKH 3QWRA 4PR5B 3DHPA 4DH2A 1XSOA 1CB4A 2VCOA 3VFVB 3NFSH 1NC2B 3BSGA 4JRYE 4MJ4A 3ECQA 2A6JA 2JKTM 2XKNA 2Q3ZA 3LKPA 2GJ6E 1JYXA 1FBIH 2ADJB 2CHWA 2EO9A 2SODB 4QRPD 3K6SB 2BH0A 1VJSA 4XVOA 2CLVA 3SJVA 2PWGA 2ZUTA 3V6OC 3TM7B 3O3AB 3S37L 5GZNC 2FWLB 3CPLA 3RZCB 5E8NA 7PAZA 1AZVA 4LOUC 3W57A 2JIPA 1ECYA 1TETL 5DJ0B 1YUHA 4MCYA 4KXDA 4ZZKA 3GSQA 1FG2B 2IQ9L 3I6KA 3TBBA 3UYPB 5HD8D 4F8LA 5DD6B 1JUFA 1MZYA 2JJTA 4Q14A 2VTFA 4HG4J 5FDYA 1BZOA 4UV4H 2ZONA 1R3JA 4P46C 5C09A 2MTAA 3DV6B 4XP1H 1KACB 1JXKA 5I0WA 3F85A 3QDMD 4PJ8D 4G5ZH 2EACA 2JJSA 1PX8A 4Z3TA 1OAXH 5BVPL 5CWSA 5JYLA 2Y07L 1E40A 3FTXA 1ZTMA 4ZS7H 1LO5A 1BJ8A 3UJIH 1DVQA 4UM9D 1JYVA 1MHPL 3K71B 3V9CA 4JFEB 4LLYB 4Z7VA 1WBZA 3JUYA 4L2LA 3B9VA 1YEEH 4O51A 1JDAA 1EEYA 5ABZA 4ZMOA 2NNFA 3HCVA 4WO4C 4WSGA 5D2NB 1KENH 1VFUA 4NSKB 1J1XL 1F0LA 5KBNC 3V55A 2WQWA 4FCAA 1MZZA 1MCBA 2FWOB 3ISYA 4N87A 3FH5A