2EEOB

Crystal structure of t.th. hb8 l-aspartate-alpha-decarboxylase complexed with fumarate
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of T.th. HB8 L-Aspartate-alpha-Decarboxylase
rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2007-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2eeoB00
3GTMA 1VC3B 3O5AA 3OUGA 1CZ4A 2EEOB 2R93A 2WAQA 3IR5A 1UHDA 3GTJA 1Y1WA 1TWGA 2R7ZA 4KDLA 5DYIA 4KO8A 1TWFA 1QCSA 2JIOA 1S3SA 1PT0A 5T5ID 1H0HA 4CS0A 3GTPA 2PMZA 2JIQA 1AW8B 1OGYA 4GA5A 2PJHB 1TWAA 1DMRA 4QIWA 1K83A 1PYUB 5T5MD 3DMRA 1SIWA 1CR5A 1AA6A 4D7ZB 1Y1VA 1SFOA 3QQ8A 1FDOA 5FTNA 5C1BA 1PYQA 2Y0SA 4KLNA 2VPZA 2E2HA 1TMOA 1WCMA 1E18A 3QWZA 4KODA 3HU3A 3HU1A 2DMRA 3GTOA 4AAYA 3TIWA 4CRZA 1R27A 1E32A 2WB1A 4KDIA 2KI8A 3GTKA 1EU1A 3HKZA 1PPYA 4AONB 1G8JA 3ML1A 3HU2A 5DYGA 3IR7A 3GTQA 3FKIA 2JA7A 2NAPA 2JA6A 2IV2X 2B63A 1TWHA 2NVYA 1Q16A 1DMSA 1I50A 4GA6A 2V3VA 3IR6A 4AYBA 3QC8A 2NYAA 1KQFA 2E7ZA 2JIPA 2YU9A 3CQZA 4AOKB 5EPPA 1H5NA 3PLXB 1FDIA 1CZ5A 4AZDA 2E2IA 3CF2A 1PQHA 2V45A 4RV0A 2C45A 1R9TA 1Y5IA 5B6CA 3TM7B 3GTGA 5FTKA 4DMRA 1E5VA 1E61A 3QQ7A 2JIMA 4CRYG 1UHEA 2R92A 2VPWA 2NVXA 2JA5A 5FTJA 1KQGA 1IW7D 1YLEA 2VPXA 1QDNA 1Y4ZA 3H0GA 1E60A 1PQFA 2JIRA 1TWCA 5FTMA 1G8KA 5GLFA 1R7RA 4C2MA 1PT1A 2VUMA 1PQEA 5C18A 1WLFA 2VPYA 3GTLA 5FTLA 1I3QA
chains in the Genus database with same CATH superfamily
2A69D 3GTMA 1VC3B 3O5AA 3OUGA 3X2GA 4JP6A 1CZ4A 2EEOB 1ZYRD 2R93A 2WAQA 2A6HD 1UHDA 3IR5A 3GTJA 1Y1WA 1TWGA 2R7ZA 4KDLA 3X2NA 5DYIA 4KO8A 1TWFA 1QCSA 2BE5D 2JIOA 5H4UA 1S3SA 1PT0A 1ZC1A 5T5ID 1H0HA 3X2JA 4AVRA 4CS0A 3GTPA 2O5JD 1N10A 2PMZA 2GAEA 2JIQA 1AW8B 1OGYA 4GA5A 2HCZX 1TWAA 2PJHB 1DMRA 4QIWA 1K83A 1BW3A 3X2PA 1PYUB 3D30A 5T5MD 3DMRA 1SIWA 1CR5A 1AA6A 4D7ZB 1Y1VA 3X2OA 1SFOA 3QQ8A 4FG2A 1FDOA 5FTNA 3CZBA 5C1BA 1PYQA 2Y0SA 2BH0A 4KLNA 2VPZA 2E2HA 4JP7A 1TMOA 1WCMA 1E18A 4NOHA 3QWZA 1BW4A 4KODA 3HU3A 3HU1A 2DMRA 5GLXA 2ENGA 3X2IA 3GTOA 3X2KA 4AAYA 3TIWA 4CRZA 1R27A 2G5DA 1E32A 2WB1A 1SMYD 2KI8A 4KDIA 1EU1A 3HKZA 4JS7A 3GTKA 1PPYA 4AONB 1G8JA 4JCWA 3X2HA 3ML1A 3HU2A 5DYGA 3IR7A 3GTQA 3FKIA 2JA7A 3SUJA 2NAPA 2JA6A 2IV2X 2B63A 1TWHA 2A68D 3ENGA 2NVYA 1Q16A 4JJOA 1DMSA 2PJJA 1HD5A 1I50A 4GA6A 2V3VA 3IR6A 3SUMA 4AYBA 2G6GA 3QC8A 2NYAA 1KQFA 2E7ZA 2JIPA 2YU9A 1L8FA 2YUJA 3CQZA 2CW0D 4AOKB 3X2LA 2PI8A 5EPPA 1H5NA 1YNND 3PLXB 2PICA 1FDIA 1CZ5A 4AZDA 2E2IA 5GM9A 4ENGA 3CF2A 1PQHA 2V45A 4RV0A 1YNJD 2C45A 3SULA 4ZM7A 1R9TA 1Y5IA 1OA9A 5B6CA 1WC2A 3TM7B 4FERA 3GTGA 3M3GA 5FTKA 4DMRA 1E5VA 1E61A 2KQAA 3QQ7A 2PNWA 1OA7A 2AE0X 2JIMA 4CRYG 1UHEA 2R92A 2VPWA 2NVXA 2JA5A 5FTJA 5GLYA 1KQGA 1IW7D 1YLEA 2VPXA 1QDNA 1Y4ZA 3H0GA 1E60A 1PQFA 2JIRA 1TWCA 4FG4A 5FTMA 1G8KA 4FFTA 5GLFA 3X2MA 3SUKA 1R7RA 4L48A 4C2MA 1PT1A 2VUMA 1PQEA 5C18A 1WLFA 2A6ED 2VPYA 3GTLA 5FTLA 1I3QA
chains in the Genus database with same CATH topology
2A69D 3GTMA 1VC3B 3O5AA 3OUGA 1CZ4A 2EEOB 1ZYRD 2R93A 2WAQA 2A6HD 1UHDA 3IR5A 3GTJA 1Y1WA 1TWGA 2R7ZA 4KDLA 5DYIA 4KO8A 1TWFA 1QCSA 2BE5D 2JIOA 1S3SA 1PT0A 1ZC1A 5T5ID 1H0HA 4CS0A 3GTPA 2O5JD 2PMZA 2GAEA 2JIQA 1AW8B 1OGYA 4GA5A 2PJHB 1TWAA 1DMRA 4QIWA 1K83A 1PYUB 5T5MD 3DMRA 1SIWA 1CR5A 1AA6A 4D7ZB 1Y1VA 1SFOA 3QQ8A 1FDOA 5FTNA 3CZBA 5C1BA 1PYQA 2Y0SA 4KLNA 2VPZA 2E2HA 1TMOA 1WCMA 1E18A 4NOHA 3QWZA 4KODA 3HU3A 3HU1A 2DMRA 3GTOA 4AAYA 3TIWA 4CRZA 1R27A 2G5DA 1E32A 2WB1A 1SMYD 2KI8A 4KDIA 1EU1A 3HKZA 3GTKA 1PPYA 4AONB 1G8JA 3ML1A 3HU2A 5DYGA 3IR7A 3GTQA 3FKIA 2JA7A 2NAPA 2JA6A 2IV2X 2B63A 1TWHA 2A68D 2NVYA 1Q16A 1DMSA 2PJJA 1I50A 4GA6A 2V3VA 3IR6A 4AYBA 2G6GA 3QC8A 2NYAA 1KQFA 2E7ZA 2JIPA 2YU9A 2YUJA 3CQZA 2CW0D 4AOKB 2PI8A 5EPPA 1H5NA 1YNND 3PLXB 2PICA 1FDIA 1CZ5A 4AZDA 2E2IA 3CF2A 1PQHA 2V45A 4RV0A 1YNJD 2C45A 1R9TA 1Y5IA 5B6CA 3TM7B 3GTGA 5FTKA 4DMRA 1E5VA 1E61A 3QQ7A 2PNWA 2AE0X 2JIMA 4CRYG 1UHEA 2R92A 2VPWA 2NVXA 2JA5A 5FTJA 1KQGA 1IW7D 1YLEA 2VPXA 1QDNA 1Y4ZA 3H0GA 1E60A 1PQFA 2JIRA 1TWCA 5FTMA 1G8KA 5GLFA 1R7RA 4C2MA 1PT1A 2VUMA 1PQEA 5C18A 1WLFA 2A6ED 2VPYA 3GTLA 5FTLA 1I3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTM A;  1VC3 B;  3O5A A;  3OUG A;  1CZ4 A;  2EEO B;  2R93 A;  2WAQ A;  3IR5 A;  1UHD A;  3GTJ A;  1Y1W A;  1TWG A;  2R7Z A;  4KDL A;  5DYI A;  4KO8 A;  1TWF A;  1QCS A;  2JIO A;  1S3S A;  1PT0 A;  5T5I D;  1H0H A;  4CS0 A;  3GTP A;  2PMZ A;  2JIQ A;  1AW8 B;  1OGY A;  4GA5 A;  2PJH B;  1TWA A;  1DMR A;  4QIW A;  1K83 A;  1PYU B;  5T5M D;  3DMR A;  1SIW A;  1CR5 A;  1AA6 A;  4D7Z B;  1Y1V A;  1SFO A;  3QQ8 A;  1FDO A;  5FTN A;  5C1B A;  1PYQ A;  2Y0S A;  4KLN A;  2VPZ A;  2E2H A;  1TMO A;  1WCM A;  1E18 A;  3QWZ A;  4KOD A;  3HU3 A;  3HU1 A;  2DMR A;  3GTO A;  4AAY A;  3TIW A;  4CRZ A;  1R27 A;  1E32 A;  2WB1 A;  4KDI A;  2KI8 A;  3GTK A;  1EU1 A;  3HKZ A;  1PPY A;  4AON B;  1G8J A;  3ML1 A;  3HU2 A;  5DYG A;  3IR7 A;  3GTQ A;  3FKI A;  2JA7 A;  2NAP A;  2JA6 A;  2IV2 X;  2B63 A;  1TWH A;  2NVY A;  1Q16 A;  1DMS A;  1I50 A;  4GA6 A;  2V3V A;  3IR6 A;  4AYB A;  3QC8 A;  2NYA A;  1KQF A;  2E7Z A;  2JIP A;  2YU9 A;  3CQZ A;  4AOK B;  5EPP A;  1H5N A;  3PLX B;  1FDI A;  1CZ5 A;  4AZD A;  2E2I A;  3CF2 A;  1PQH A;  2V45 A;  4RV0 A;  2C45 A;  1R9T A;  1Y5I A;  5B6C A;  3TM7 B;  3GTG A;  5FTK A;  4DMR A;  1E5V A;  1E61 A;  3QQ7 A;  2JIM A;  4CRY G;  1UHE A;  2R92 A;  2VPW A;  2NVX A;  2JA5 A;  5FTJ A;  1KQG A;  1IW7 D;  1YLE A;  2VPX A;  1QDN A;  1Y4Z A;  3H0G A;  1E60 A;  1PQF A;  2JIR A;  1TWC A;  5FTM A;  1G8K A;  5GLF A;  1R7R A;  4C2M A;  1PT1 A;  2VUM A;  1PQE A;  5C18 A;  1WLF A;  2VPY A;  3GTL A;  5FTL A;  1I3Q A; 
#chains in the Genus database with same CATH topology
 2A69 D;  3GTM A;  1VC3 B;  3O5A A;  3OUG A;  3X2G A;  4JP6 A;  1CZ4 A;  2EEO B;  1ZYR D;  2R93 A;  2WAQ A;  2A6H D;  1UHD A;  3IR5 A;  3GTJ A;  1Y1W A;  1TWG A;  2R7Z A;  4KDL A;  3X2N A;  5DYI A;  4KO8 A;  1TWF A;  1QCS A;  2BE5 D;  2JIO A;  5H4U A;  1S3S A;  1PT0 A;  1ZC1 A;  5T5I D;  1H0H A;  3X2J A;  4AVR A;  4CS0 A;  3GTP A;  2O5J D;  1N10 A;  2PMZ A;  2GAE A;  2JIQ A;  1AW8 B;  1OGY A;  4GA5 A;  2HCZ X;  1TWA A;  2PJH B;  1DMR A;  4QIW A;  1K83 A;  1BW3 A;  3X2P A;  1PYU B;  3D30 A;  5T5M D;  3DMR A;  1SIW A;  1CR5 A;  1AA6 A;  4D7Z B;  1Y1V A;  3X2O A;  1SFO A;  3QQ8 A;  4FG2 A;  1FDO A;  5FTN A;  3CZB A;  5C1B A;  1PYQ A;  2Y0S A;  2BH0 A;  4KLN A;  2VPZ A;  2E2H A;  4JP7 A;  1TMO A;  1WCM A;  1E18 A;  4NOH A;  3QWZ A;  1BW4 A;  4KOD A;  3HU3 A;  3HU1 A;  2DMR A;  5GLX A;  2ENG A;  3X2I A;  3GTO A;  3X2K A;  4AAY A;  3TIW A;  4CRZ A;  1R27 A;  2G5D A;  1E32 A;  2WB1 A;  1SMY D;  2KI8 A;  4KDI A;  1EU1 A;  3HKZ A;  4JS7 A;  3GTK A;  1PPY A;  4AON B;  1G8J A;  4JCW A;  3X2H A;  3ML1 A;  3HU2 A;  5DYG A;  3IR7 A;  3GTQ A;  3FKI A;  2JA7 A;  3SUJ A;  2NAP A;  2JA6 A;  2IV2 X;  2B63 A;  1TWH A;  2A68 D;  3ENG A;  2NVY A;  1Q16 A;  4JJO A;  1DMS A;  2PJJ A;  1HD5 A;  1I50 A;  4GA6 A;  2V3V A;  3IR6 A;  3SUM A;  4AYB A;  2G6G A;  3QC8 A;  2NYA A;  1KQF A;  2E7Z A;  2JIP A;  2YU9 A;  1L8F A;  2YUJ A;  3CQZ A;  2CW0 D;  4AOK B;  3X2L A;  2PI8 A;  5EPP A;  1H5N A;  1YNN D;  3PLX B;  2PIC A;  1FDI A;  1CZ5 A;  4AZD A;  2E2I A;  5GM9 A;  4ENG A;  3CF2 A;  1PQH A;  2V45 A;  4RV0 A;  1YNJ D;  2C45 A;  3SUL A;  4ZM7 A;  1R9T A;  1Y5I A;  1OA9 A;  5B6C A;  1WC2 A;  3TM7 B;  4FER A;  3GTG A;  3M3G A;  5FTK A;  4DMR A;  1E5V A;  1E61 A;  2KQA A;  3QQ7 A;  2PNW A;  1OA7 A;  2AE0 X;  2JIM A;  4CRY G;  1UHE A;  2R92 A;  2VPW A;  2NVX A;  2JA5 A;  5FTJ A;  5GLY A;  1KQG A;  1IW7 D;  1YLE A;  2VPX A;  1QDN A;  1Y4Z A;  3H0G A;  1E60 A;  1PQF A;  2JIR A;  1TWC A;  4FG4 A;  5FTM A;  1G8K A;  4FFT A;  5GLF A;  3X2M A;  3SUK A;  1R7R A;  4L48 A;  4C2M A;  1PT1 A;  2VUM A;  1PQE A;  5C18 A;  1WLF A;  2A6E D;  2VPY A;  3GTL A;  5FTL A;  1I3Q A; 
#chains in the Genus database with same CATH homology
 2A69 D;  3GTM A;  1VC3 B;  3O5A A;  3OUG A;  1CZ4 A;  2EEO B;  1ZYR D;  2R93 A;  2WAQ A;  2A6H D;  1UHD A;  3IR5 A;  3GTJ A;  1Y1W A;  1TWG A;  2R7Z A;  4KDL A;  5DYI A;  4KO8 A;  1TWF A;  1QCS A;  2BE5 D;  2JIO A;  1S3S A;  1PT0 A;  1ZC1 A;  5T5I D;  1H0H A;  4CS0 A;  3GTP A;  2O5J D;  2PMZ A;  2GAE A;  2JIQ A;  1AW8 B;  1OGY A;  4GA5 A;  2PJH B;  1TWA A;  1DMR A;  4QIW A;  1K83 A;  1PYU B;  5T5M D;  3DMR A;  1SIW A;  1CR5 A;  1AA6 A;  4D7Z B;  1Y1V A;  1SFO A;  3QQ8 A;  1FDO A;  5FTN A;  3CZB A;  5C1B A;  1PYQ A;  2Y0S A;  4KLN A;  2VPZ A;  2E2H A;  1TMO A;  1WCM A;  1E18 A;  4NOH A;  3QWZ A;  4KOD A;  3HU3 A;  3HU1 A;  2DMR A;  3GTO A;  4AAY A;  3TIW A;  4CRZ A;  1R27 A;  2G5D A;  1E32 A;  2WB1 A;  1SMY D;  2KI8 A;  4KDI A;  1EU1 A;  3HKZ A;  3GTK A;  1PPY A;  4AON B;  1G8J A;  3ML1 A;  3HU2 A;  5DYG A;  3IR7 A;  3GTQ A;  3FKI A;  2JA7 A;  2NAP A;  2JA6 A;  2IV2 X;  2B63 A;  1TWH A;  2A68 D;  2NVY A;  1Q16 A;  1DMS A;  2PJJ A;  1I50 A;  4GA6 A;  2V3V A;  3IR6 A;  4AYB A;  2G6G A;  3QC8 A;  2NYA A;  1KQF A;  2E7Z A;  2JIP A;  2YU9 A;  2YUJ A;  3CQZ A;  2CW0 D;  4AOK B;  2PI8 A;  5EPP A;  1H5N A;  1YNN D;  3PLX B;  2PIC A;  1FDI A;  1CZ5 A;  4AZD A;  2E2I A;  3CF2 A;  1PQH A;  2V45 A;  4RV0 A;  1YNJ D;  2C45 A;  1R9T A;  1Y5I A;  5B6C A;  3TM7 B;  3GTG A;  5FTK A;  4DMR A;  1E5V A;  1E61 A;  3QQ7 A;  2PNW A;  2AE0 X;  2JIM A;  4CRY G;  1UHE A;  2R92 A;  2VPW A;  2NVX A;  2JA5 A;  5FTJ A;  1KQG A;  1IW7 D;  1YLE A;  2VPX A;  1QDN A;  1Y4Z A;  3H0G A;  1E60 A;  1PQF A;  2JIR A;  1TWC A;  5FTM A;  1G8K A;  5GLF A;  1R7R A;  4C2M A;  1PT1 A;  2VUM A;  1PQE A;  5C18 A;  1WLF A;  2A6E D;  2VPY A;  3GTL A;  5FTL A;  1I3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...