2EEOB

Crystal structure of t.th. hb8 l-aspartate-alpha-decarboxylase complexed with fumarate
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase
molecule tags Lyase
source organism Thermus thermophilus
publication title Crystal Structure of T.th. HB8 L-Aspartate-alpha-Decarboxylase
rcsb
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2007-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2eeoB00
4AAYA 2E2IA 4AONB 3HU3A 1E61A 3CF2A 1PQHA 5FTNA 1PPYA 2VUMA 4D7ZB 1G8JA 2DMRA 1R9TA 2JA5A 1PQEA 1DMRA 3QQ8A 4GA6A 3GTPA 4CS0A 1G8KA 1KQFA 1TWAA 1Y1WA 3GTQA 1SFOA 4AYBA 1PQFA 3CQZA 3GTOA 4QIWA 3TM7B 2V3VA 1E32A 1WCMA 1AA6A 3OUGA 3QQ7A 1PYUB 5DYGA 3QWZA 1AW8B 1CZ5A 5FTMA 2PMZA 1TMOA 1Q16A 1TWCA 3DMRA 3HKZA 1E18A 4CRZA 2E2HA 1EU1A 2E7ZA 2JIPA 2PJHB 5T5MD 1KQGA 4CRYG 1R27A 1I3QA 1UHDA 1WLFA 4KDIA 3GTGA 2Y0SA 2JIMA 1S3SA 3GTJA 2JA7A 1R7RA 3GTKA 4C2MA 2JIQA 1SIWA 1QDNA 1FDIA 1CZ4A 3GTMA 4GA5A 1TWFA 2V45A 1TWGA 1PT0A 1TWHA 2C45A 1FDOA 5FTJA 2NAPA 2IV2X 5T5ID 1VC3B 1QCSA 2VPZA 4RV0A 2JIRA 5FTKA 3IR7A 1CR5A 2JIOA 3HU1A 2R93A 3O5AA 3H0GA 1IW7D 1DMSA 3HU2A 1PYQA 1UHEA 3QC8A 2JA6A 4AOKB 1H0HA 1Y5IA 1I50A 2NVYA 5EPPA 3IR6A 2VPYA 1Y1VA 2EEOB 1Y4ZA 2R92A 1OGYA 2NVXA 2KI8A 4DMRA 1H5NA 5C1BA 5C18A 5GLFA 1E60A 1YLEA 2VPWA 4KODA 3TIWA 5B6CA 2VPXA 5DYIA 2YU9A 3ML1A 3PLXB 3GTLA 2B63A 3IR5A 5FTLA 4AZDA 2R7ZA 4KLNA 3FKIA 1E5VA 1PT1A 4KDLA 2WAQA 2NYAA 2WB1A 1K83A 4KO8A
chains in the Genus database with same CATH superfamily
4AAYA 4FG2A 2E2IA 4JJOA 4AONB 3CZBA 3HU3A 1E61A 3CF2A 1PQHA 5FTNA 1PPYA 2VUMA 4D7ZB 1G8JA 2DMRA 4FFTA 1R9TA 3X2IA 2JA5A 1PQEA 1DMRA 1HD5A 2PNWA 3QQ8A 4GA6A 3X2GA 4CS0A 1G8KA 3M3GA 4JP7A 1KQFA 3GTPA 1TWAA 1Y1WA 5GLYA 2G6GA 2PICA 3GTQA 1N10A 1SFOA 4AYBA 1PQFA 2ENGA 3CQZA 2YUJA 3GTOA 4L48A 4QIWA 3TM7B 2V3VA 1E32A 2A68D 1WCMA 1AA6A 3OUGA 3QQ7A 1PYUB 5DYGA 3QWZA 1AW8B 1CZ5A 5FTMA 3X2PA 2PMZA 3X2JA 1TMOA 1Q16A 1TWCA 3DMRA 3HKZA 1E18A 4CRZA 2E2HA 1EU1A 5H4UA 2E7ZA 2JIPA 2PJHB 5T5MD 1KQGA 3SUMA 4CRYG 1R27A 1I3QA 4JP6A 1UHDA 1WLFA 4KDIA 3GTGA 2Y0SA 2JIMA 1S3SA 3GTJA 2JA7A 2HCZX 1OA7A 1BW4A 3X2OA 1R7RA 3GTKA 2CW0D 4C2MA 2JIQA 1SIWA 1QDNA 1FDIA 3ENGA 1CZ4A 2KQAA 4FG4A 4AVRA 3GTMA 4GA5A 2A6HD 1TWFA 2V45A 3X2LA 4JS7A 1TWGA 1PT0A 3D30A 4JCWA 4ENGA 1TWHA 2C45A 1FDOA 5FTJA 2NAPA 2PI8A 1L8FA 1YNND 5GLXA 2IV2X 5T5ID 1VC3B 1QCSA 2PJJA 2VPZA 1BW3A 4RV0A 2JIRA 1ZC1A 3X2HA 2AE0X 5FTKA 3IR7A 1CR5A 2JIOA 3HU1A 2A69D 3X2MA 2R93A 3O5AA 3H0GA 2O5JD 3X2KA 1IW7D 3SUKA 1DMSA 3HU2A 1PYQA 1UHEA 3QC8A 2JA6A 4AOKB 1H0HA 2A6ED 1Y5IA 1I50A 5GM9A 3SUJA 2BH0A 2NVYA 5EPPA 2VPYA 3IR6A 1Y1VA 2EEOB 1Y4ZA 3SULA 2R92A 1OGYA 2NVXA 2KI8A 4DMRA 1SMYD 1H5NA 5C1BA 2G5DA 5C18A 5GLFA 1E60A 1YLEA 1ZYRD 2VPWA 4KODA 3TIWA 5B6CA 2VPXA 1WC2A 4ZM7A 1YNJD 5DYIA 2YU9A 2BE5D 3ML1A 3PLXB 3GTLA 2B63A 3IR5A 5FTLA 1OA9A 4AZDA 2R7ZA 4KLNA 3FKIA 4FERA 1E5VA 4NOHA 2GAEA 1PT1A 4KDLA 2WAQA 2NYAA 3X2NA 2WB1A 1K83A 4KO8A
chains in the Genus database with same CATH topology
4AAYA 2E2IA 4AONB 3CZBA 3HU3A 1E61A 3CF2A 1PQHA 5FTNA 1PPYA 2VUMA 4D7ZB 1G8JA 2DMRA 1R9TA 2JA5A 1PQEA 1DMRA 3QQ8A 2PNWA 4GA6A 3GTPA 4CS0A 1G8KA 1KQFA 1TWAA 1Y1WA 2G6GA 2PICA 3GTQA 1SFOA 4AYBA 1PQFA 3CQZA 2YUJA 3GTOA 4QIWA 3TM7B 2V3VA 1E32A 2A68D 1WCMA 1AA6A 3OUGA 3QQ7A 1PYUB 5DYGA 3QWZA 1AW8B 1CZ5A 5FTMA 2PMZA 1TMOA 1Q16A 1TWCA 3DMRA 3HKZA 1E18A 4CRZA 2E2HA 1EU1A 2E7ZA 2JIPA 2PJHB 5T5MD 1KQGA 4CRYG 1R27A 1I3QA 1UHDA 1WLFA 4KDIA 3GTGA 2Y0SA 2JIMA 1S3SA 3GTJA 2JA7A 1R7RA 3GTKA 2CW0D 4C2MA 2JIQA 1SIWA 1QDNA 1FDIA 1CZ4A 3GTMA 4GA5A 2A6HD 1TWFA 2V45A 1TWGA 1PT0A 1TWHA 2C45A 1FDOA 5FTJA 2NAPA 2PI8A 1YNND 2IV2X 5T5ID 1VC3B 1QCSA 2PJJA 2VPZA 4RV0A 2JIRA 1ZC1A 2AE0X 5FTKA 3IR7A 1CR5A 2JIOA 3HU1A 2A69D 2R93A 3O5AA 3H0GA 2O5JD 1IW7D 1DMSA 3HU2A 1PYQA 1UHEA 3QC8A 2JA6A 4AOKB 1H0HA 2A6ED 1Y5IA 1I50A 2NVYA 5EPPA 2VPYA 3IR6A 1Y1VA 2EEOB 1Y4ZA 2R92A 1OGYA 2NVXA 2KI8A 4DMRA 1SMYD 1H5NA 5C1BA 2G5DA 5C18A 5GLFA 1E60A 1YLEA 1ZYRD 2VPWA 4KODA 3TIWA 5B6CA 2VPXA 1YNJD 5DYIA 2YU9A 2BE5D 3ML1A 3PLXB 3GTLA 2B63A 3IR5A 5FTLA 4AZDA 2R7ZA 4KLNA 3FKIA 1E5VA 4NOHA 2GAEA 1PT1A 4KDLA 2WAQA 2NYAA 2WB1A 1K83A 4KO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAY A;  2E2I A;  4AON B;  3HU3 A;  1E61 A;  3CF2 A;  1PQH A;  5FTN A;  1PPY A;  2VUM A;  4D7Z B;  1G8J A;  2DMR A;  1R9T A;  2JA5 A;  1PQE A;  1DMR A;  3QQ8 A;  4GA6 A;  3GTP A;  4CS0 A;  1G8K A;  1KQF A;  1TWA A;  1Y1W A;  3GTQ A;  1SFO A;  4AYB A;  1PQF A;  3CQZ A;  3GTO A;  4QIW A;  3TM7 B;  2V3V A;  1E32 A;  1WCM A;  1AA6 A;  3OUG A;  3QQ7 A;  1PYU B;  5DYG A;  3QWZ A;  1AW8 B;  1CZ5 A;  5FTM A;  2PMZ A;  1TMO A;  1Q16 A;  1TWC A;  3DMR A;  3HKZ A;  1E18 A;  4CRZ A;  2E2H A;  1EU1 A;  2E7Z A;  2JIP A;  2PJH B;  5T5M D;  1KQG A;  4CRY G;  1R27 A;  1I3Q A;  1UHD A;  1WLF A;  4KDI A;  3GTG A;  2Y0S A;  2JIM A;  1S3S A;  3GTJ A;  2JA7 A;  1R7R A;  3GTK A;  4C2M A;  2JIQ A;  1SIW A;  1QDN A;  1FDI A;  1CZ4 A;  3GTM A;  4GA5 A;  1TWF A;  2V45 A;  1TWG A;  1PT0 A;  1TWH A;  2C45 A;  1FDO A;  5FTJ A;  2NAP A;  2IV2 X;  5T5I D;  1VC3 B;  1QCS A;  2VPZ A;  4RV0 A;  2JIR A;  5FTK A;  3IR7 A;  1CR5 A;  2JIO A;  3HU1 A;  2R93 A;  3O5A A;  3H0G A;  1IW7 D;  1DMS A;  3HU2 A;  1PYQ A;  1UHE A;  3QC8 A;  2JA6 A;  4AOK B;  1H0H A;  1Y5I A;  1I50 A;  2NVY A;  5EPP A;  3IR6 A;  2VPY A;  1Y1V A;  2EEO B;  1Y4Z A;  2R92 A;  1OGY A;  2NVX A;  2KI8 A;  4DMR A;  1H5N A;  5C1B A;  5C18 A;  5GLF A;  1E60 A;  1YLE A;  2VPW A;  4KOD A;  3TIW A;  5B6C A;  2VPX A;  5DYI A;  2YU9 A;  3ML1 A;  3PLX B;  3GTL A;  2B63 A;  3IR5 A;  5FTL A;  4AZD A;  2R7Z A;  4KLN A;  3FKI A;  1E5V A;  1PT1 A;  4KDL A;  2WAQ A;  2NYA A;  2WB1 A;  1K83 A;  4KO8 A; 
#chains in the Genus database with same CATH topology
 4AAY A;  4FG2 A;  2E2I A;  4JJO A;  4AON B;  3CZB A;  3HU3 A;  1E61 A;  3CF2 A;  1PQH A;  5FTN A;  1PPY A;  2VUM A;  4D7Z B;  1G8J A;  2DMR A;  4FFT A;  1R9T A;  3X2I A;  2JA5 A;  1PQE A;  1DMR A;  1HD5 A;  2PNW A;  3QQ8 A;  4GA6 A;  3X2G A;  4CS0 A;  1G8K A;  3M3G A;  4JP7 A;  1KQF A;  3GTP A;  1TWA A;  1Y1W A;  5GLY A;  2G6G A;  2PIC A;  3GTQ A;  1N10 A;  1SFO A;  4AYB A;  1PQF A;  2ENG A;  3CQZ A;  2YUJ A;  3GTO A;  4L48 A;  4QIW A;  3TM7 B;  2V3V A;  1E32 A;  2A68 D;  1WCM A;  1AA6 A;  3OUG A;  3QQ7 A;  1PYU B;  5DYG A;  3QWZ A;  1AW8 B;  1CZ5 A;  5FTM A;  3X2P A;  2PMZ A;  3X2J A;  1TMO A;  1Q16 A;  1TWC A;  3DMR A;  3HKZ A;  1E18 A;  4CRZ A;  2E2H A;  1EU1 A;  5H4U A;  2E7Z A;  2JIP A;  2PJH B;  5T5M D;  1KQG A;  3SUM A;  4CRY G;  1R27 A;  1I3Q A;  4JP6 A;  1UHD A;  1WLF A;  4KDI A;  3GTG A;  2Y0S A;  2JIM A;  1S3S A;  3GTJ A;  2JA7 A;  2HCZ X;  1OA7 A;  1BW4 A;  3X2O A;  1R7R A;  3GTK A;  2CW0 D;  4C2M A;  2JIQ A;  1SIW A;  1QDN A;  1FDI A;  3ENG A;  1CZ4 A;  2KQA A;  4FG4 A;  4AVR A;  3GTM A;  4GA5 A;  2A6H D;  1TWF A;  2V45 A;  3X2L A;  4JS7 A;  1TWG A;  1PT0 A;  3D30 A;  4JCW A;  4ENG A;  1TWH A;  2C45 A;  1FDO A;  5FTJ A;  2NAP A;  2PI8 A;  1L8F A;  1YNN D;  5GLX A;  2IV2 X;  5T5I D;  1VC3 B;  1QCS A;  2PJJ A;  2VPZ A;  1BW3 A;  4RV0 A;  2JIR A;  1ZC1 A;  3X2H A;  2AE0 X;  5FTK A;  3IR7 A;  1CR5 A;  2JIO A;  3HU1 A;  2A69 D;  3X2M A;  2R93 A;  3O5A A;  3H0G A;  2O5J D;  3X2K A;  1IW7 D;  3SUK A;  1DMS A;  3HU2 A;  1PYQ A;  1UHE A;  3QC8 A;  2JA6 A;  4AOK B;  1H0H A;  2A6E D;  1Y5I A;  1I50 A;  5GM9 A;  3SUJ A;  2BH0 A;  2NVY A;  5EPP A;  2VPY A;  3IR6 A;  1Y1V A;  2EEO B;  1Y4Z A;  3SUL A;  2R92 A;  1OGY A;  2NVX A;  2KI8 A;  4DMR A;  1SMY D;  1H5N A;  5C1B A;  2G5D A;  5C18 A;  5GLF A;  1E60 A;  1YLE A;  1ZYR D;  2VPW A;  4KOD A;  3TIW A;  5B6C A;  2VPX A;  1WC2 A;  4ZM7 A;  1YNJ D;  5DYI A;  2YU9 A;  2BE5 D;  3ML1 A;  3PLX B;  3GTL A;  2B63 A;  3IR5 A;  5FTL A;  1OA9 A;  4AZD A;  2R7Z A;  4KLN A;  3FKI A;  4FER A;  1E5V A;  4NOH A;  2GAE A;  1PT1 A;  4KDL A;  2WAQ A;  2NYA A;  3X2N A;  2WB1 A;  1K83 A;  4KO8 A; 
#chains in the Genus database with same CATH homology
 4AAY A;  2E2I A;  4AON B;  3CZB A;  3HU3 A;  1E61 A;  3CF2 A;  1PQH A;  5FTN A;  1PPY A;  2VUM A;  4D7Z B;  1G8J A;  2DMR A;  1R9T A;  2JA5 A;  1PQE A;  1DMR A;  3QQ8 A;  2PNW A;  4GA6 A;  3GTP A;  4CS0 A;  1G8K A;  1KQF A;  1TWA A;  1Y1W A;  2G6G A;  2PIC A;  3GTQ A;  1SFO A;  4AYB A;  1PQF A;  3CQZ A;  2YUJ A;  3GTO A;  4QIW A;  3TM7 B;  2V3V A;  1E32 A;  2A68 D;  1WCM A;  1AA6 A;  3OUG A;  3QQ7 A;  1PYU B;  5DYG A;  3QWZ A;  1AW8 B;  1CZ5 A;  5FTM A;  2PMZ A;  1TMO A;  1Q16 A;  1TWC A;  3DMR A;  3HKZ A;  1E18 A;  4CRZ A;  2E2H A;  1EU1 A;  2E7Z A;  2JIP A;  2PJH B;  5T5M D;  1KQG A;  4CRY G;  1R27 A;  1I3Q A;  1UHD A;  1WLF A;  4KDI A;  3GTG A;  2Y0S A;  2JIM A;  1S3S A;  3GTJ A;  2JA7 A;  1R7R A;  3GTK A;  2CW0 D;  4C2M A;  2JIQ A;  1SIW A;  1QDN A;  1FDI A;  1CZ4 A;  3GTM A;  4GA5 A;  2A6H D;  1TWF A;  2V45 A;  1TWG A;  1PT0 A;  1TWH A;  2C45 A;  1FDO A;  5FTJ A;  2NAP A;  2PI8 A;  1YNN D;  2IV2 X;  5T5I D;  1VC3 B;  1QCS A;  2PJJ A;  2VPZ A;  4RV0 A;  2JIR A;  1ZC1 A;  2AE0 X;  5FTK A;  3IR7 A;  1CR5 A;  2JIO A;  3HU1 A;  2A69 D;  2R93 A;  3O5A A;  3H0G A;  2O5J D;  1IW7 D;  1DMS A;  3HU2 A;  1PYQ A;  1UHE A;  3QC8 A;  2JA6 A;  4AOK B;  1H0H A;  2A6E D;  1Y5I A;  1I50 A;  2NVY A;  5EPP A;  2VPY A;  3IR6 A;  1Y1V A;  2EEO B;  1Y4Z A;  2R92 A;  1OGY A;  2NVX A;  2KI8 A;  4DMR A;  1SMY D;  1H5N A;  5C1B A;  2G5D A;  5C18 A;  5GLF A;  1E60 A;  1YLE A;  1ZYR D;  2VPW A;  4KOD A;  3TIW A;  5B6C A;  2VPX A;  1YNJ D;  5DYI A;  2YU9 A;  2BE5 D;  3ML1 A;  3PLX B;  3GTL A;  2B63 A;  3IR5 A;  5FTL A;  4AZD A;  2R7Z A;  4KLN A;  3FKI A;  1E5V A;  4NOH A;  2GAE A;  1PT1 A;  4KDL A;  2WAQ A;  2NYA A;  2WB1 A;  1K83 A;  4KO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...