2EEOB

Crystal structure of t.th. hb8 l-aspartate-alpha-decarboxylase complexed with fumarate
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of T.th. HB8 L-Aspartate-alpha-Decarboxylase
rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2007-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2eeoB00
2VPXA 2VUMA 1R27A 1TWFA 3QQ8A 1TMOA 3HKZA 2VPYA 1DMRA 2WAQA 1WLFA 2JIOA 4DMRA 1QCSA 1R9TA 3CF2A 1E18A 1PYQA 1TWHA 2R92A 3GTJA 4AAYA 1DMSA 2JIQA 4KDLA 1Y1VA 1H5NA 3IR5A 3PLXB 5FTLA 3GTGA 3H0GA 2R7ZA 3HU1A 1I3QA 3TM7B 1FDIA 2JIRA 1K83A 4KLNA 5GLFA 1PQFA 1I50A 2C45A 1EU1A 3IR6A 4QIWA 1PPYA 3FKIA 3GTPA 1VC3B 5EPPA 1YLEA 1Y1WA 3GTMA 1TWCA 3TIWA 1PT0A 3QC8A 3IR7A 5FTNA 4RV0A 5B6CA 1PQEA 3GTKA 1R7RA 1G8JA 1KQGA 2IV2X 2B63A 2E2IA 1SFOA 2PJHB 5T5ID 3OUGA 1FDOA 4AZDA 1IW7D 1H0HA 2JA5A 2JA6A 1Q16A 4CRZA 3ML1A 2V3VA 2NYAA 4KDIA 2NVYA 1SIWA 3DMRA 1AA6A 4KO8A 1G8KA 3QQ7A 2R93A 3HU2A 2Y0SA 1S3SA 2KI8A 4AOKB 2JA7A 3GTOA 1QDNA 4AONB 1CZ5A 5C1BA 3GTQA 2VPZA 1CZ4A 2WB1A 3GTLA 1TWGA 1KQFA 4CRYG 1UHEA 2JIPA 1E60A 4GA5A 1PYUB 2E2HA 1PT1A 1E61A 3CQZA 4AYBA 5C18A 1Y4ZA 1PQHA 2DMRA 4D7ZB 1Y5IA 5FTMA 1E32A 5T5MD 1E5VA 2V45A 4CS0A 5FTKA 2E7ZA 3O5AA 2NAPA 2EEOB 2JIMA 1OGYA 2NVXA 2PMZA 1UHDA 1TWAA 4KODA 3QWZA 4C2MA 1AW8B 2VPWA 1CR5A 5FTJA 2YU9A 5DYIA 4GA6A 1WCMA 5DYGA 3HU3A
chains in the Genus database with same CATH superfamily
2VPXA 2VUMA 4FG2A 3SUJA 1R27A 3SUMA 1TWFA 3QQ8A 1TMOA 3HKZA 2VPYA 1DMRA 3X2KA 2WAQA 3X2MA 2HCZX 1BW4A 1WLFA 2JIOA 4DMRA 2A69D 1QCSA 1R9TA 3X2IA 3CF2A 4NOHA 1E18A 1PYQA 1TWHA 2R92A 3GTJA 4AAYA 3SULA 1L8FA 1ZC1A 1DMSA 2JIQA 1HD5A 4KDLA 1Y1VA 1H5NA 1YNND 3X2HA 3IR5A 2BH0A 3PLXB 5FTLA 3GTGA 3H0GA 2R7ZA 3HU1A 1I3QA 3TM7B 2PICA 1FDIA 2CW0D 4L48A 1SMYD 2JIRA 4JP7A 1K83A 4KLNA 5GLFA 1PQFA 2PNWA 1I50A 2C45A 1EU1A 3IR6A 4QIWA 1PPYA 2A6ED 3FKIA 3GTPA 1VC3B 5EPPA 1YLEA 1Y1WA 3GTMA 1TWCA 3TIWA 1PT0A 2A68D 2G6GA 3QC8A 5GLYA 3IR7A 5FTNA 4RV0A 5B6CA 3CZBA 1PQEA 3GTKA 1R7RA 1G8JA 1KQGA 2IV2X 2B63A 2E2IA 1SFOA 2PJHB 5H4UA 3OUGA 3M3GA 5T5ID 1FDOA 2GAEA 3X2PA 3X2OA 4AZDA 1IW7D 1H0HA 2JA5A 2JA6A 4JS7A 1Q16A 5GLXA 4JP6A 3ML1A 4CRZA 2V3VA 2NYAA 1OA9A 2NVYA 4KDIA 5GM9A 4ZM7A 1SIWA 3D30A 3DMRA 1AA6A 4KO8A 1G8KA 3QQ7A 2O5JD 2PI8A 2R93A 3X2JA 3HU2A 2Y0SA 1S3SA 1YNJD 2KI8A 4AOKB 2JA7A 3GTOA 3X2NA 1QDNA 4AONB 1CZ5A 5C1BA 3GTQA 2VPZA 1CZ4A 2WB1A 3GTLA 1TWGA 1KQFA 4CRYG 1UHEA 2AE0X 2G5DA 2JIPA 3ENGA 1E60A 2ENGA 1PYUB 4GA5A 1PT1A 2A6HD 2PJJA 3X2GA 2E2HA 1E61A 2BE5D 3CQZA 4AYBA 1Y4ZA 1PQHA 2DMRA 2YUJA 4D7ZB 5C18A 1Y5IA 5FTMA 1OA7A 1E32A 5T5MD 4ENGA 1E5VA 2V45A 4CS0A 5FTKA 4JJOA 2E7ZA 3O5AA 2NAPA 4JCWA 3SUKA 1BW3A 2EEOB 2JIMA 4FG4A 1OGYA 2NVXA 2PMZA 1UHDA 1N10A 1TWAA 1WC2A 4FFTA 4AVRA 4FERA 1ZYRD 4KODA 3QWZA 4C2MA 1AW8B 3X2LA 2VPWA 1CR5A 5FTJA 2YU9A 2KQAA 5DYIA 4GA6A 1WCMA 5DYGA 3HU3A
chains in the Genus database with same CATH topology
2VPXA 2VUMA 1R27A 1TWFA 3QQ8A 1TMOA 3HKZA 2VPYA 1DMRA 2WAQA 1WLFA 2JIOA 4DMRA 2A69D 1QCSA 1R9TA 3CF2A 4NOHA 1E18A 1PYQA 1TWHA 2R92A 3GTJA 4AAYA 1ZC1A 1DMSA 2JIQA 4KDLA 1Y1VA 1H5NA 1YNND 3IR5A 3PLXB 5FTLA 3GTGA 3H0GA 2R7ZA 3HU1A 1I3QA 3TM7B 2PICA 1FDIA 2CW0D 1SMYD 2JIRA 1K83A 4KLNA 5GLFA 1PQFA 2PNWA 1I50A 2C45A 1EU1A 3IR6A 4QIWA 1PPYA 2A6ED 3FKIA 3GTPA 1VC3B 5EPPA 1YLEA 1Y1WA 3GTMA 1TWCA 3TIWA 1PT0A 2A68D 2G6GA 3QC8A 3IR7A 5FTNA 4RV0A 5B6CA 3CZBA 1PQEA 3GTKA 1R7RA 1G8JA 1KQGA 2IV2X 2B63A 2E2IA 1SFOA 2PJHB 5T5ID 3OUGA 1FDOA 2GAEA 4AZDA 1IW7D 1H0HA 2JA5A 2JA6A 1Q16A 4CRZA 3ML1A 2V3VA 2NYAA 4KDIA 2NVYA 1SIWA 3DMRA 1AA6A 4KO8A 1G8KA 3QQ7A 2O5JD 2PI8A 2R93A 3HU2A 2Y0SA 1S3SA 1YNJD 2KI8A 4AOKB 2JA7A 3GTOA 1QDNA 4AONB 1CZ5A 5C1BA 3GTQA 2VPZA 1CZ4A 2WB1A 3GTLA 1TWGA 1KQFA 4CRYG 1UHEA 2AE0X 2G5DA 2JIPA 1E60A 4GA5A 1PYUB 2E2HA 1PT1A 2A6HD 2PJJA 1E61A 2BE5D 3CQZA 4AYBA 1Y4ZA 1PQHA 2DMRA 2YUJA 4D7ZB 5C18A 1Y5IA 5FTMA 1E32A 5T5MD 1E5VA 2V45A 4CS0A 5FTKA 2E7ZA 3O5AA 2NAPA 2EEOB 2JIMA 1OGYA 2NVXA 2PMZA 1UHDA 1TWAA 1ZYRD 4KODA 3QWZA 4C2MA 1AW8B 2VPWA 1CR5A 5FTJA 2YU9A 5DYIA 4GA6A 1WCMA 5DYGA 3HU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPX A;  2VUM A;  1R27 A;  1TWF A;  3QQ8 A;  1TMO A;  3HKZ A;  2VPY A;  1DMR A;  2WAQ A;  1WLF A;  2JIO A;  4DMR A;  1QCS A;  1R9T A;  3CF2 A;  1E18 A;  1PYQ A;  1TWH A;  2R92 A;  3GTJ A;  4AAY A;  1DMS A;  2JIQ A;  4KDL A;  1Y1V A;  1H5N A;  3IR5 A;  3PLX B;  5FTL A;  3GTG A;  3H0G A;  2R7Z A;  3HU1 A;  1I3Q A;  3TM7 B;  1FDI A;  2JIR A;  1K83 A;  4KLN A;  5GLF A;  1PQF A;  1I50 A;  2C45 A;  1EU1 A;  3IR6 A;  4QIW A;  1PPY A;  3FKI A;  3GTP A;  1VC3 B;  5EPP A;  1YLE A;  1Y1W A;  3GTM A;  1TWC A;  3TIW A;  1PT0 A;  3QC8 A;  3IR7 A;  5FTN A;  4RV0 A;  5B6C A;  1PQE A;  3GTK A;  1R7R A;  1G8J A;  1KQG A;  2IV2 X;  2B63 A;  2E2I A;  1SFO A;  2PJH B;  5T5I D;  3OUG A;  1FDO A;  4AZD A;  1IW7 D;  1H0H A;  2JA5 A;  2JA6 A;  1Q16 A;  4CRZ A;  3ML1 A;  2V3V A;  2NYA A;  4KDI A;  2NVY A;  1SIW A;  3DMR A;  1AA6 A;  4KO8 A;  1G8K A;  3QQ7 A;  2R93 A;  3HU2 A;  2Y0S A;  1S3S A;  2KI8 A;  4AOK B;  2JA7 A;  3GTO A;  1QDN A;  4AON B;  1CZ5 A;  5C1B A;  3GTQ A;  2VPZ A;  1CZ4 A;  2WB1 A;  3GTL A;  1TWG A;  1KQF A;  4CRY G;  1UHE A;  2JIP A;  1E60 A;  4GA5 A;  1PYU B;  2E2H A;  1PT1 A;  1E61 A;  3CQZ A;  4AYB A;  5C18 A;  1Y4Z A;  1PQH A;  2DMR A;  4D7Z B;  1Y5I A;  5FTM A;  1E32 A;  5T5M D;  1E5V A;  2V45 A;  4CS0 A;  5FTK A;  2E7Z A;  3O5A A;  2NAP A;  2EEO B;  2JIM A;  1OGY A;  2NVX A;  2PMZ A;  1UHD A;  1TWA A;  4KOD A;  3QWZ A;  4C2M A;  1AW8 B;  2VPW A;  1CR5 A;  5FTJ A;  2YU9 A;  5DYI A;  4GA6 A;  1WCM A;  5DYG A;  3HU3 A; 
#chains in the Genus database with same CATH topology
 2VPX A;  2VUM A;  4FG2 A;  3SUJ A;  1R27 A;  3SUM A;  1TWF A;  3QQ8 A;  1TMO A;  3HKZ A;  2VPY A;  1DMR A;  3X2K A;  2WAQ A;  3X2M A;  2HCZ X;  1BW4 A;  1WLF A;  2JIO A;  4DMR A;  2A69 D;  1QCS A;  1R9T A;  3X2I A;  3CF2 A;  4NOH A;  1E18 A;  1PYQ A;  1TWH A;  2R92 A;  3GTJ A;  4AAY A;  3SUL A;  1L8F A;  1ZC1 A;  1DMS A;  2JIQ A;  1HD5 A;  4KDL A;  1Y1V A;  1H5N A;  1YNN D;  3X2H A;  3IR5 A;  2BH0 A;  3PLX B;  5FTL A;  3GTG A;  3H0G A;  2R7Z A;  3HU1 A;  1I3Q A;  3TM7 B;  2PIC A;  1FDI A;  2CW0 D;  4L48 A;  1SMY D;  2JIR A;  4JP7 A;  1K83 A;  4KLN A;  5GLF A;  1PQF A;  2PNW A;  1I50 A;  2C45 A;  1EU1 A;  3IR6 A;  4QIW A;  1PPY A;  2A6E D;  3FKI A;  3GTP A;  1VC3 B;  5EPP A;  1YLE A;  1Y1W A;  3GTM A;  1TWC A;  3TIW A;  1PT0 A;  2A68 D;  2G6G A;  3QC8 A;  5GLY A;  3IR7 A;  5FTN A;  4RV0 A;  5B6C A;  3CZB A;  1PQE A;  3GTK A;  1R7R A;  1G8J A;  1KQG A;  2IV2 X;  2B63 A;  2E2I A;  1SFO A;  2PJH B;  5H4U A;  3OUG A;  3M3G A;  5T5I D;  1FDO A;  2GAE A;  3X2P A;  3X2O A;  4AZD A;  1IW7 D;  1H0H A;  2JA5 A;  2JA6 A;  4JS7 A;  1Q16 A;  5GLX A;  4JP6 A;  3ML1 A;  4CRZ A;  2V3V A;  2NYA A;  1OA9 A;  2NVY A;  4KDI A;  5GM9 A;  4ZM7 A;  1SIW A;  3D30 A;  3DMR A;  1AA6 A;  4KO8 A;  1G8K A;  3QQ7 A;  2O5J D;  2PI8 A;  2R93 A;  3X2J A;  3HU2 A;  2Y0S A;  1S3S A;  1YNJ D;  2KI8 A;  4AOK B;  2JA7 A;  3GTO A;  3X2N A;  1QDN A;  4AON B;  1CZ5 A;  5C1B A;  3GTQ A;  2VPZ A;  1CZ4 A;  2WB1 A;  3GTL A;  1TWG A;  1KQF A;  4CRY G;  1UHE A;  2AE0 X;  2G5D A;  2JIP A;  3ENG A;  1E60 A;  2ENG A;  1PYU B;  4GA5 A;  1PT1 A;  2A6H D;  2PJJ A;  3X2G A;  2E2H A;  1E61 A;  2BE5 D;  3CQZ A;  4AYB A;  1Y4Z A;  1PQH A;  2DMR A;  2YUJ A;  4D7Z B;  5C18 A;  1Y5I A;  5FTM A;  1OA7 A;  1E32 A;  5T5M D;  4ENG A;  1E5V A;  2V45 A;  4CS0 A;  5FTK A;  4JJO A;  2E7Z A;  3O5A A;  2NAP A;  4JCW A;  3SUK A;  1BW3 A;  2EEO B;  2JIM A;  4FG4 A;  1OGY A;  2NVX A;  2PMZ A;  1UHD A;  1N10 A;  1TWA A;  1WC2 A;  4FFT A;  4AVR A;  4FER A;  1ZYR D;  4KOD A;  3QWZ A;  4C2M A;  1AW8 B;  3X2L A;  2VPW A;  1CR5 A;  5FTJ A;  2YU9 A;  2KQA A;  5DYI A;  4GA6 A;  1WCM A;  5DYG A;  3HU3 A; 
#chains in the Genus database with same CATH homology
 2VPX A;  2VUM A;  1R27 A;  1TWF A;  3QQ8 A;  1TMO A;  3HKZ A;  2VPY A;  1DMR A;  2WAQ A;  1WLF A;  2JIO A;  4DMR A;  2A69 D;  1QCS A;  1R9T A;  3CF2 A;  4NOH A;  1E18 A;  1PYQ A;  1TWH A;  2R92 A;  3GTJ A;  4AAY A;  1ZC1 A;  1DMS A;  2JIQ A;  4KDL A;  1Y1V A;  1H5N A;  1YNN D;  3IR5 A;  3PLX B;  5FTL A;  3GTG A;  3H0G A;  2R7Z A;  3HU1 A;  1I3Q A;  3TM7 B;  2PIC A;  1FDI A;  2CW0 D;  1SMY D;  2JIR A;  1K83 A;  4KLN A;  5GLF A;  1PQF A;  2PNW A;  1I50 A;  2C45 A;  1EU1 A;  3IR6 A;  4QIW A;  1PPY A;  2A6E D;  3FKI A;  3GTP A;  1VC3 B;  5EPP A;  1YLE A;  1Y1W A;  3GTM A;  1TWC A;  3TIW A;  1PT0 A;  2A68 D;  2G6G A;  3QC8 A;  3IR7 A;  5FTN A;  4RV0 A;  5B6C A;  3CZB A;  1PQE A;  3GTK A;  1R7R A;  1G8J A;  1KQG A;  2IV2 X;  2B63 A;  2E2I A;  1SFO A;  2PJH B;  5T5I D;  3OUG A;  1FDO A;  2GAE A;  4AZD A;  1IW7 D;  1H0H A;  2JA5 A;  2JA6 A;  1Q16 A;  4CRZ A;  3ML1 A;  2V3V A;  2NYA A;  4KDI A;  2NVY A;  1SIW A;  3DMR A;  1AA6 A;  4KO8 A;  1G8K A;  3QQ7 A;  2O5J D;  2PI8 A;  2R93 A;  3HU2 A;  2Y0S A;  1S3S A;  1YNJ D;  2KI8 A;  4AOK B;  2JA7 A;  3GTO A;  1QDN A;  4AON B;  1CZ5 A;  5C1B A;  3GTQ A;  2VPZ A;  1CZ4 A;  2WB1 A;  3GTL A;  1TWG A;  1KQF A;  4CRY G;  1UHE A;  2AE0 X;  2G5D A;  2JIP A;  1E60 A;  4GA5 A;  1PYU B;  2E2H A;  1PT1 A;  2A6H D;  2PJJ A;  1E61 A;  2BE5 D;  3CQZ A;  4AYB A;  1Y4Z A;  1PQH A;  2DMR A;  2YUJ A;  4D7Z B;  5C18 A;  1Y5I A;  5FTM A;  1E32 A;  5T5M D;  1E5V A;  2V45 A;  4CS0 A;  5FTK A;  2E7Z A;  3O5A A;  2NAP A;  2EEO B;  2JIM A;  1OGY A;  2NVX A;  2PMZ A;  1UHD A;  1TWA A;  1ZYR D;  4KOD A;  3QWZ A;  4C2M A;  1AW8 B;  2VPW A;  1CR5 A;  5FTJ A;  2YU9 A;  5DYI A;  4GA6 A;  1WCM A;  5DYG A;  3HU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...