4NOHA

1.5 angstrom crystal structure of putative lipoprotein from bacillus anthracis.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
ATGIVMYGDETGVQQTMDQYKDKIESQNKFEAKLGTVNEKKVLIMNKTTAEKMVKENMLKKVVKEDVEPIKALPAISDEAGIVFAKEEQKDVVIDGKKMKYEGNVVIGDARKYTDMYAVVSDAEYAKISEPVKTIGLASFKENPKEKIFPDIKRGSKVEEAHMVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.5 Angstrom Crystal Structure of Putative Lipoprotein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Lipid binding protein
molecule keywords Lipoprotein, putative
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17294 Lipoprotein_22 Uncharacterised lipoprotein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.60 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4nohA02
3.30.70.3060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nohA01
4NOHA
chains in the Genus database with same CATH superfamily
3CD0A 2ILYA 1FRLA 3DOKA 2ACYA 2VZ9A 3OFGA 4K5SA 4RWXA 3ZNUA 1NDCA 4USHA 1SVDA 3D2WA 4E0DA 2WRMA 2E7VA 3MUVP 4ERDA 4RU9A 3Q8QB 2GHVC 3MCSA 3R97A 4MK8A 2JEFA 2ZC3A 2K3IA 5KFPA 3CNQP 2B4PA 2Q79A 4CO2A 4PKDB 6AT1B 2RKIB 5LT5A 4A47A 1Q79A 4I7FA 3VALA 4FKXA 2R42A 3D0HE 3IXQA 2M9KA 2XMTA 5E0OA 2D41A 3G86A 1PILA 4FNHA 2R8GA 1XMQJ 1HNIA 3ZZTA 2JNJA 4Q8FA 3VAFA 3M1VB 2NZCA 1TWFA 5K8OA 2XSJB 1GT8A 1F5BA 2XMUA 2YKOA 3DRSA 3LUYA 1FDOA 4O3QA 1Y0HA 3H4BA 4JI1J 3O6QA 1N0VC 2SXLA 4DV3F 3ADAC 5D6GA 2CW0D 1LW2A 2P6TA 3IO1A 3A4TA 1KFDA 4ECZA 1S1UA 1P1TA 3TUJC 4TU8A 3RB0A 1VBXA 1B4SA 1Q5YA 3EX7B 1HNWF 3PDNA 1HARA 2YKNB 4ATNA 1FXRA 3T6JA 4ETXA 3FCVA 2MSSA 4L3KA 2CQGA 1S0MA 1Q5VA 3LAMA 2GIRA 4X4UA 4WFNQ 1KOOA 2AWZA 1RAIB 2P9EA 2V68A 4HTJA 2XC9A 1FF2A 4W92B 4B3SJ 2FVQA 3O2IA 3DYAB 3CMAS 4CLTA 1MU2A 5CYMA 1S9EA 5HVGA 2MZQA 1Y3JA 2GFFA 3LW5C 2ZEJA 1UFWA 1SH0A 1SKRA 5GLYA 1XR5A 2AYBA 2J7UA 1NZ8A 2BE2B 2HAFA 2G0IA 3DHWC 1BC6A 2WW4A 2DYAA 1CPZA 2P5VA 1F6TA 2N7CA 3EZ5A 4GKKF 4L76A 1MWQA 1IXKA 2I0XA 2BM1A 1S0OA 2A2CA 2FLNA 1UAWA 2HAIA 4USUA 2DY1A 3IA0A 2HVHA 1DY3A 2I5JA 2MZTA 4ENGA 3H2UB 3T19A 5KG7A 1FXLA 5EWFA 4O3OA 1FKAF 1IQTA 1DTQA 4ECVA 1FVQA 2G5DA 3HU1A 3THVA 3EDRB 1DARA 1FDDA 2V67A 3M8PB 3WBZA 4ZCIA 3M2VA 1B0TA 3D1QA 2DVIA 3OQ2A 1TVRB 4OV1A 4O3NA 4B3RF 5IT9Y 4NLXA 2RF2B 4KT0C 1B64A 3PHEA 2PN6A 3AD9C 4B9TA 2XHWA 4KQZA 1T02A 4MK9A 1X4CA 1I51B 2BJ8A 3M7VA 2HHWA 1OA7A 3EZOA 1FFWB 4U8YA 1CLFA 2ALYB 3HM9A 2HW3A 4ZMMA 4I67A 2X1FA 2H51B 4PPZA 4LVNP 4RW7A 4QW9A 4LFAF 5B7WA 3MPYA 1AT1B 5CYJA 4UT4A 2KTQA 2QZ8A 3C66A 4AZDA 2FD2A 3FKBA 3HFKA 3NXZA 1M5HA 4WCEQ 3SULA 2QA4S 2Y9HA 1RT7B 1GTHA 4DUTA 4RUHA 4Q8EA 1S4FA 1IJEB 4QWCA 2R93A 2W2OP 3POTB 3JB9k 3HLUA 5F3TA 2BYCA 2V8PA 1LXJA 4AAYA 3PYFA 5L39A 4YS2A 2IV2X 1SC1B 2NSCA 3KUEA 2MGZA 2N7YA 2I2YA 2LEPA 1IBCB 3ZTPA 2FTRA 2ZH8A 2BKOA 2UXBJ 3CC4S 1H2UX 1NPPA 1LWEB 1TV6B 2DXFA 2GC8A 3MDFA 1ULRA 1X5SA 4HI2A 4WJBA 3I0RA 1Z2ZA 1N5QA 3QC8A 2ZFHA 3R6GB 5AJ3J 1OGYA 3WC0A 2VQFF 4KHPF 2N3OA 1LWFB 4CQ1A 1HBNA 4DR7F 1VC5A 2LDIA 5L1IA 4WIIA 2YQ3A 1W2IA 3U7JA 4PABA 1JXVA 2OSQA 3IR7B 5HQ8A 5HQLA 2MB0B 1C1CA 2D3O1 4KBIA 2IRXA 2NS1B 1TKXA 2EFGA 4EGLA 4URQU 1SJ4P 3R7NB 4CI0B 2PT0A 4DQSA 2E5GA 1REGX 2W24A 2Y1RI 1SL2A 5A2QY 3ILLA 2G2YA 1S1TB 4FNIA 2R7WA 4NL5A 4OJ3A 3TJAA 3V6KA 1HFEL 3D6MB 1VQPS 1GXLA 3NAIA 4LF8J 1BWVA 4F50A 1KLMA 3UN2A 2GCFA 2UXBF 1K0VA 1UHDA 3A3PB 3E3XA 4EO8A 3CD6S 4EZ6A 1NDLA 4AL5A 2WSCC 3PYGA 4FPIA 4X64J 1S1UB 1WACA 4QWEA 4D3HA 5GAEU 2ADCA 2OPQA 2XLIA 3CZBA 4AQYF 2IMWP 3OUYB 4A8FA 3DOLB 2W25A 3H59A 2LU2A 3PRBA 1N8RT 4DV7F 4DXLA 2HHVA 5KFOA 2F5GA 2EWHA 2PGCA 4UUXA 2YNIB 2KJVA 3K89A 3M1VA 4C3KA 4Y0FA 4YR2A 3SI8A 4IRCA 2V4RA 4MYTA 1NO8A 3HHLD 5IV4A 3D6HB 1XEZA 1M5VC 4RL1A 3NGRA 4KYZA 3V4IA 2V3VA 2JX2A 2BA9A 1VHFA 2LXIA 4OLOA 2BEFA 1SC3B 5DG9A 1VQ7S 3R9LA 2I9SA 4PQAA 1HNVA 4EYHB 4GC6A 2UUBJ 4FXDA 3GU0A 3A8KA 2YNHB 2A6ED 1CSJA 3KNAA 2VIHA 2DRDA 3ET6B 1ZH5A 2MQNA 1MN7A 2MKJA 2DGUA 3L7OA 1XERA 2L48A 2QA1A 4O44A 1XTZA 4DCOB 3T5LA 1S76D 4N47A 3KG0A 1JMTA 3W5ZA 3TP2A 4QBUA 1DRZA 1OIAA 5CCLA 2RQCA 1C2PA 3I82A 4A8OA 4G1QA 3GV7B 1DMRA 4Y65A 2Q6BA 2RDIA 4ZVRB 4ECYA 2VU5A 3QT7A 2XMAA 4PXBA 5CQGA 1DQAA 4OV6A 3VGVA 3OR2B 3CW2C 3ML1A 4YDXA 1RWNB 3EVMA 2KB2A 4Y2KA 4ZVOB 3C46A 5CXTA 2BUNA 1MROA 1SJ1A 2DRAA 1BQMB 3P5TL 3CJKB 5LXRA 1T95A 1J5EF 1PSDA 3NOGA 1IKVA 1B3TA 2UUAF 3GYGA 1YJ9S 3T1YJ 1PBAA 1C1BA 2NQPA 2WOMA 2WBRA 3OTEA 5DLGA 4J9QA 1CJTB 1FKOA 1SJRA 1QE1B 2F63A 2GAHC 3NS5A 5KTQA 1LKZA 1Q86T 2E66A 3K8WA 1SQFA 3T9ZA 1K73T 1FX4A 5KT4A 1YJ7A 1VISA 4HH0A 3KMSA 2K7KA 3ICLA 4UY85 4FYDA 2DIUA 3AJ2A 3I31A 1ZAWA 2V4QA 2Z58B 2GIQA 4OQJA 3K5LA 2GQ2A 1IM4A 1SH3A 4OX9F 3SQGA 3UI3A 3HPOA 2V94A 1U45A 4UOFA 2IYGA 2UXDF 1T9YA 3KOAA 2AX0A 5J2PA 5G0RA 2J0XA 1WCMA 2BJEA 2HKEA 2F1FA 2WAQD 2E5HA 4OHXA 1SBRA 5L46A 2CPYA 4DSEA 4JI4F 3PKYA 2RAQA 2B9EA 2BJ7A 3FRZA 3BN7A 3E51A 2RIJA 2FZGB 4ZIVA 3K5MA 3QAEA 1E6YA 1UKUA 3MMBA 4DSKA 1FDIA 3QRQA 1WC0A 5KG6A 3MTKA 1K83A 1EARA 3CJ0A 4R25A 4WE1B 3DYAA 4DZDA 3H20A 3BH7B 2PMZD 4JI5J 3MOZA 3AODA 1TKTB 1WEYA 4CLPA 3KLEA 2CJKA 2AGQA 1LWCB 3MOJB 4PPDA 4ECWA 5KFYA 5K14A 5DM6Q 3LGNA 5HK4A 2E1AA 5KFCA 1WSRA 5HATA 2CQDA 3EGZA 3FQLA 1ZETA 5FTKA 1K8AT 3KLFB 1AYEA 1GMVA 2HQ3A 1Q0NA 1T0TV 1ZPVA 3O44A 2LA4A 4J9VA 2M52A 2H9ZA 1T03B 2BOPA 1NM2A 2QO3A 1U0SA 1OMSA 5ADZA 4Y6IA 2AD9A 1FX2A 1NH8A 2MKYA 1FRXA 3MM5B 4OZ5A 3B4DA 3PKMA 1TWCA 4DV4F 3S1TA 3MEEA 2DTJA 2XZWA 1OY8A 3P96A 1WC6A 2C2NA 4PXEA 1FD8A 3T41A 4DN0A 2IJNA 3SV4A 1HR0F 3TUIC 4ED0A 1IBMF 3D0GE 1U6FA 4YB5A 2VQEJ 4DV1F 2NVYA 2D9OA 3HHNB 1JLQA 2J8AA 2ZWOA 1U2CA 4XAKA 1NK9A 2J7WA 2NCKL 3I6PA 4LR9A 3DOKB 4ZJOA 3GYXB 1S97A 2HWTA 3FVYA 1YJTA 2C2KB 2LVWA 3NBPA 4LSNB 2MMYA 3HSJA 3HSZA 4MFBB 4YB6A 1URRA 1U2FA 5HI7A 4HACB 1WHXA 4NLPA 4DMZA 5C2CA 5J1EB 4CO0A 1VK3A 2F9DA 3BKUA 5KT2A 3T1HJ 2QYGA 3RGIA 2R92A 1ROFA 3EPGA 1UW4A 3B82A 2YQ0A 1DTQB 1TTHB 2VKRA 3I5CA 3QIPB 1S9GB 4JB8B 4YN3B 4CTAA 2QA4G 3V6HA 2NAPA 2VPYB 2MXYA 3X1LB 3Q8YA 5C24A 4DX6A 3V81B 4Y2AA 2EXUA 1TUVA 2IMOA 2CPEA 1N10A 3CF5Q 2DR7A 2BXJA 4C3MA 2FJVA 3NY0A 2LQ8A 3C14A 4TLQA 5B08A 1FJGJ 4AE5A 5JXSA 2CPXA 4KGXB 1BY9A 2ZM6F 4M95A 2JLFA 3B54A 1PQHA 3CSKA 1HHQA 1VOMA 5F3ZA 2MZRA 3HHDA 1FNXH 5B09A 4M5GA 2D74B 2KXHA 4ZP6A 2DB1A 4B3RJ 3OLBA 1ZYQA 4LFCF 4GO7X 1HI8A 3O3LA 4G1IA 4DCJB 2ZD1B 5JJBA 1N36F 1EJ7L 1H38A 3BDEA 3L9ZA 2JC1A 3R8YA 3NL0A 1RB0A 3A3NB 4YOEA 1WHWA 2KT5A 3UVJB 4DL7A 3FFIA 5I4MA 4TKTA 3QJPA 2AJFE 3PY8A 1S12A 4IDKB 1HIYA 3MM6A 2F3JA 2MLZA 2IJFA 1FTCA 1JKHB 2HURA 4HL9A 5IZHA 1C4AA 3R5AA 2JVRA 5FIIA 2O66A 3SZ2A 3HHKA 5HLFA 1U24A 5F8IA 3RUBL 2HS4A 4QWDA 3OTCA 3H7HB 5M2RA 4WZQA 1NXIA 4X4NA 5T7LA 1U1QA 1PQEA 3ZZ0A 4X4RA 3GPAA 1CJUB 3RR8A 2FY1A 4DR2J 1VHIA 3CWJA 3TR5A 2RB7A 4KH1B 3SMZA 4EWTA 5C7PA 3VR1A 2KZMA 4MIBA 1G7CB 2BACA 5DYGA 2QJ3A 3GFXA 1Q8BA 3EM1A 3TAMB 3ENVA 1CJTA 1FKOB 4JI0F 3VQSA 1EHWA 2IA6A 2VA3A 4ZP7A 3JAMU 1VBKA 1RHQB 3M8WA 4LRCA 2HRUA 2OEKA 1ACMB 1VQ4S 2DR9A 3AY0A 4F2SA 4M5MA 4MKBA 2ZM6J 3ETMA 1QDNA 1XNRJ 1A6LA 4O4GA 2CWKA 2DCUB 2MZSA 1N5VA 1KDNA 5F9LA 3QYYA 3IBFB 3KDNA 3TEHB 1SXLA 3WIVA 5JUMA 1SKWA 2V63A 5CD4A 5KG3A 3J7AN 2HK3A 3HVAA 3BO4A 1BGXT 3TQEA 3D4JA 3VTIA 4LF5J 4NEZA 3GP9A 5HP1A 1MN9A 1QAJA 5FTMA 1AROP 1TL7B 4MIWA 3A3OB 4JV0A 3W5XA 1X4AA 5A6WA 2XGPA 3VAJA 1OA9A 1IR2A 2DJWA 2KYZA 2HFVA 1N88A 3EE3A 2N82B 4J9OA 2AYGA 4NYOA 1FJGF 3ZFVA 4NXMJ 5KFDA 4CO4A 3RB4A 4DX8H 4DSFA 4CH1A 5HJYA 4M1KA 5LMNJ 4HHHA 1VQKS 2YXLA 4OJ1A 1SL1A 2G1DA 1VIXA 3IRXA 4JI6F 1D1UA 4NYPA 3X2MA 2L41A 4O4RA 1XNQF 5T14A 4KJIA 1XN9A 3DRRB 2Z2MA 1WOSA 5CZXA 3T6BA 5C24B 3MMAA 3GIMA 3KLIA 1YK9A 2G9OA 3SSQA 1VRUB 4DFPA 1I50A 1TKTA 3KLEB 2DBBA 2VG6A 2B56A 1HNXJ 3R5GA 1SUQA 2QLXA 2VH7A 1HD1A 1NU4A 5JMNA 4LBIA 2XY6A 3VVTA 1RU2A 1T9XA 3NNAA 4R0JA 2G1HA 3PJXA 2XLJA 3OXFA 4WWSA 3M8RA 4EO6A 2CPDA 2JA5A 2JZ5A 4M94A 1VK8A 4KPYA 2YNGB 1T9VA 2CPHA 5D78A 3PYDA 2D3UA 1WORA 4IH6A 4DQQA 1RUSA 3DI6B 4ALZA 1Y4ZA 4JP7A 2B7CB 4MKAA 2BV3A 5D77A 1QSLA 1ITPA 4DPUA 1S7HA 3L4BC 3G82A 5KFIA 3MFHA 1TKZB 2E9RX 1CC7A 3OTBA 2RHQB 2VG6B 2Z0GA 4FS1A 4I1TA 3JAMY 4I2PB 3HFVA 2CG8A 3O1LA 3QATA 2YKAA 2ZITA 4QPXA 4D7ZB 3PIPQ 4LRAA 3NLCA 4FXWA 1H2VZ 4OX6A 3IP0A 2DGQA 4Y2IA 3W5YA 3UD4P 1IR0A 5KG4A 1EZZB 1RQ0A 5K8NA 3TW0A 1VBZA 1C0UA 4TU7A 3EVOA 2HFZA 2CQ1A 4NLVA 2B6AA 3RB3A 4DQIA 2HRYA 2BZ2A 1V5IB 4PQUA 2B9YA 2FYXA 1CJUA 5GAEI 1HQUB 3X2NA 2ZH4A 4IR9A 4NA1A 2XMMA 2RUSA 2ZKTA 4OMFG 4ZOSA 1CR5A 2GVZA 1D8ZA 2HZAA 2OKQA 2QMUB 4ZA1A 3E01B 4NLDA 2ATCB 3R1LA 3OVBA 1HBUB 1VGYA 3SDEB 2BJDA 9RUBA 3J80Y 4JJOA 1YHQS 5CYQB 1J5OA 2HMIB 3MM7B 2Y1IA 2K2PA 4KR0B 2ZE2B 3LALA 5K5MA 3P3DA 3TZWA 3LO3A 5A8RB 3GSDA 3I0SA 5L8RC 1HBOA 4M5IA 2GJFA 4DR5J 3M30B 1T9UA 1RBLA 2E7ZA 1GXUA 4K59A 3E01A 2V6AA 2EG1A 5G0RB 3LWLA 1SV5A 5GMKa 2ZH7A 2OIHA 1VIOA 3DGPA 3GIIA 1QDUB 3MM5A 1RCXB 1SIZA 2WB1A 4YFUA 4CLYA 5KFRA 1K1SA 5LOQA 4YHHJ 1RK8A 2R8HA 3AA9A 2DXEA 2KM8B 4C0BA 1D3WA 5DETA 5D3GB 3G2XA 3X2HA 3M8SA 2G4BA 3DU6A 4Y2CA 4NEYA 1I94F 2BKPA 3TANA 2O5JD 3DLGB 3ZXWA 3W2VA 1YZ6A 3P6YC 3HT3A 1GQEA 3OSPA 1NSPA 3BPDA 1KC8T 2MZ1A 1XJWB 4RNHA 5EX0A 1TUGB 1URNA 2ZVSA 3H5SA 4MK7A 1RT5A 2ZOFA 3IC1A 5DGBA 4GRSA 3DLBA 4MTPA 1J27A 4B3MF 4KKOB 2I8EA 1RWKB 5FLXU 2KFZA 2COLA 2PDAA 1QAIA 3Q24A 1YDLA 4C8YA 1TKZA 1BQMA 3RJMB 5DG8A 3EMTA 1U02A 4FP9A 4P10A 3AD7C 2YX1A 4ER8A 1JLCB 1S1XB 2ERRA 2KN4A 3MM9B 4DV6F 5H4UA 1NK8A 2DNYA 2HQIA 2IRYA 4P2XA 3G8SA 2L3MA 1R8AA 3IS9B 2GMLA 5KFMA 2VFSA 3KHGA 1X9WA 4LBPA 4YDDB 2ZE2A 2JFKA 2KRRA 3PFEA 8AT1B 1XMBA 4X4TA 3M6VA 4RBVA 2MQ8A 4UOCA 2MDAA 2J9DA 4AOKB 1CZ4A 4UZBA 4KY3A 4RJVA 1D8YA 2DNRA 3BGOP 1SUQB 5E3CA 2YKMA 1H5NA 1GX6A 1S5ZA 3SQGB 2QN6B 5D4PA 3KHRA 1VMBA 2IVFB 2QIFA 1V3RA 1EP4A 4WU2A 5J2QB 2CZ4A 1PG5B 3Q83A 2RILA 5B0GA 2ZH5A 2R8IA 3AOCA 4NE9C 3RR7A 2XWXA 2V9KA 1LW2B 2IC3A 3KLFA 2Y8YA 3IRXB 4DHVA 4WFAQ 3KLVA 5AE1A 2CQPA 2EPIA 2VG7A 4DPXA 2E44A 3NGSA 4P7VA 2EEOB 3MFIA 2LCWA 3MGJA 1RAJA 2F7VA 4DQRA 2LQBA 1HLWA 2CA9A 3OVSA 1QSSA 1TWGA 4M8LA 2V8HA 4LVOP 2AE0X 3CMES 1HKAA 2JIMA 2FUG9 1Y5LB 1JK9B 1QAYA 1RAOA 4RW9A 5DDPC 3M32B 1CBKA 1SJQA 2DPIA 3HCXA 3BS9A 3MD3A 4JYAJ 2VBYA 2GVDA 1WOPA 3FFIB 4CLFA 3RAXA 3QRPA 2VPXA 5B6CA 2CQBA 3W8GA 1UWBB 2HPUA 2VB6A 1ZTWA 1YIJS 4LT6A 3MUMP 3HVWA 4NLYA 1SFOA 1Y00A 4ZPBA 4ZP9A 3W2WB 4X64F 2QFJA 4UY8T 4M5KA 1WC3A 4ZHRA 3DMRA 1RSCA 3SUMA 1C0TB 4ID8A 2LQ9A 2QLBB 4V1Ak 4K4XA 1B99A 4O3SA 3CDEA 2G0JA 4S0MA 2UVWA 1G8KA 2AEMA 3OXLA 1NBEB 4V19X 3KK1A 2HIQA 3N01A 3AFGA 1PC5A 4AYBD 4PXCA 4OYWA 1NHKL 4ILRA 4V19J 4PG6A 1JX4A 3D30A 1RAAB 2CJXB 1H73A 4NCGA 1RWVB 3LF0A 4E8UA 1RTZA 1CQNA 2QMXA 2J8SA 3H5YA 2FC9A 3ELHA 1PAEX 1O51A 1TK0A 1HMVB 3UCGA 2AJ0A 4DU8A 1HBMB 4ELUA 3GFZA 2I1RA 4W4MA 4Q0BB 3LOUA 4K4VA 3FGVA 3DU5A 2XHCA 2OJ3A 1S4EA 4WE1A 1WG4A 4A4JA 5K8MA 5D4LA 3OL7A 3K57A 2M3DA 1Y5IB 2VQFJ 2MKHA 4J9RA 4DLGA 3TJ9A 3VGSA 2IBOA 4UUWA 1GH8A 4JI8F 4LREA 2JSXA 5A76A 2R8JA 2CQ0A 4KDLA 3FEYB 3BSCA 3W9JA 5HQMA 3LA0A 4XK8C 4DN9A 4LMZA 3ZTQA 3SYZA 5RUBA 1NKEA 4AD6A 3F56A 4DF4A 3RBDA 1LW0A 3VVUA 4NXNJ 4LFAJ 2D69A 4LFBF 1PJ6A 2HVEA 2RRAA 5F0WA 3ENAA 4P74A 2UU9F 3BYRA 2R7UA 2FJBB 1CS4A 4B3OA 3CE8A 3R2CJ 1KHWA 1X8DA 2B0GA 4IG0A 4PYDA 4U67Q 4O4GB 4RKUC 3HT0A 1I6JA 4QIWD 3CJ5A 2NVXA 2QT7A 1C1CB 1UW9A 3PW0A 3KMQA 1RT3B 4ZPCA 4RZRA 1JNRB 1CULB 4B02A 2WONA 2JJ4D 4CM0A 3GV8B 2EFOA 2XG8A 3KK3A 1U0HB 1S48A 4J9PA 4LF5F 3AB2B 4TLRA 4HDHA 5GLFA 1M5PC 2N4CA 3GCXP 1T05B 3KJNB 4QCLA 5D0EA 3M2UA 5BYQA 2RJZA 2XZDB 3H2LA 2AZ3A 1S49A 2HK2A 2P2CB 3LP1A 1FD2A 1JIHA 2IDEA 1XQIA 1IKWB 2VPWB 1YSJA 3DGVA 3IFEA 3OUGA 1IKWA 2H5IB 4OZLA 4IOCQ 4W90B 2B4VA 2MSTA 1VQ5S 1HQEB 5ETSA 3OUYA 2RHSB 2GAEA 3MF5A 4IG0B 5E5NA 3PTWA 3O5AA 2DHAA 4CLKA 5EHHA 2IYIA 2MQQA 3GIJA 2ZJRQ 4DFMA 1N48A 2ALZA 4WF9Q 2JA7A 5IXUA 3CD7A 3DLHA 4FYYB 1X31C 3MEDA 4NASA 3VHQA 1CULA 5IFMA 1TUWA 2YX7A 3DM2A 3M2RB 2HS0A 4YB7A 1YNND 3UDVA 4RUCA 1U1PA 2P9GA 2DGWA 4GMKA 1SMYD 3H42A 3G9CA 2ZNYA 2H5JB 2CXEA 1B0PA 4QWAA 1KD1T 2PMWA 3KUHA 2E1CA 1EQMA 1LOUA 1WG5A 2GGPB 3FRYA 3HZEA 1S57A 4KRWA 4RW6B 5DZ6A 2IY5B 2GQCA 3EGNA 3QT6A 2LQJA 1MU2B 4ZCKA 3NRBA 2FHKA 2NXNA 4LF4F 1VQYA 4RBTA 1N32J 2MHNA 3NG8A 2KRBA 2L9DA 3GTYX 4FYXB 1JLGA 3A1YG 4USTA 2MLXA 2IAJA 2XB2D 1BUXA 1GMWD 2IM3A 2O3DA 3D0IE 1N6QB 1HI0P 3KWMA 3HHLA 4QR2A 4TQRA 1RAFB 4D3GA 4OYAA 4USKA 4X62J 1EQ0A 1UL3A 3QSIA 2XMWA 3CXCR 4DV6J 1AXQA 1HHSA 4RNMA 4F25A 4DOZA 1G6BA 2OPRA 4C8NA 1G1XA 3VZIA 3QQ7A 3B8HA 4I2QA 4PG5A 2DITA 2RT3A 3TZZA 2BMBA 3BB5A 3UD5A 1S10A 4ETZA 3ENGA 3OFEA 1HA1A 3CJKA 3U1MA 2CQ2A 3TVYA 5JVGQ 1AA6A 4I0WA 1RT1B 1SV5B 1Q16B 3I9ZA 3Q8UA 3QGIA 1AW0A 1REVA 2DHXA 2AW0A 2IAJB 4WBFA 2H4YB 2I38A 5IWAF 1VYAA 2WK4A 3KK1B 2W01A 4Z2XA 1VC0A 2RDDA 1WD6A 5GAGI 3J7ZT 3G6ES 1KLMB 3I4PA 2LQ5A 4USJC 5KOWA 4FFTA 3EYZA 1PKUA 1HI1A 2R4FA 3IBWA 3KLGB 1S1VB 4L6V3 3BBCA 1W25A 3QFWA 1FDNA 2CWXA 5CZVA 1HBUA 1IKXB 5FTLA 2D9PA 4RW6A 5IV3A 4MKVA 4B9MA 2M70A 1RHKB 1VI7A 4NPOA 1RZMA 3OPKA 4HDGA 4NI2A 1TFYA 5D0HA 4P2FA 1TKXB 4FG4A 3A12A 1TWHA 2QA2A 1QD1A 1ZZFA 1VDHA 4F0MA 1RP5A 5IT9U 4PYAA 2ZBCA 2YTCA 4RV0A 5AJ3F 5LJ5Y 2A0FB 1W2BR 2FVSA 2VICA 2VC0A 4NMLA 3M2UB 1QJHA 2QE5A 3OXGA 2CPIA 1NNDA 4ZM7A 5JVHQ 1PC4A 1T9TA 1K1QA 1Y3KA 2L9NA 4J91A 1DLOB 3OTOJ 3ILJA 4K0KJ 1HQEA 1WC2A 4LF1A 2Z2ZA 1U1RA 4C8OA 5CH7B 3PCOB 4FPRA 1P8GA 4ES1A 4AXJA 1R27A 3PG9A 5KFBA 1N6QA 4MJKA 2OSRA 2G2OA 1MROB 3K59A 2QL9B 4EUVA 1Q82T 2C1EB 2VASA 3W1YC 1VRQC 1YZ7A 1RDRA 5KG2A 2DH8A 2P9CA 5LJ3Y 3SV3A 4ZVTB 2QGFB 3PEJA 1IBMJ 3FKIA 2ZDPA 5DO2A 3AOBA 1RXOB 1RT3A 3UW1A 5HMWA 3S8SA 3D9BA 4KGVB 2Y0SA 5IWAJ 3HDSA 3PR5B 2WCXA 1WEZA 3W62A 2GJIA 4OJHA 2JLGA 4OYIA 5I3UA 1X9MA 2X3GA 1IKYB 1NDKA 2QSFA 3ZTOA 1SKSA 3NNCA 4DLEA 5HROB 1ZM9A 4I6AA 4X4VA 4UW2A 3F0NA 1VQMS 5KAKA 2IVMA 3QLHA 4ZPTR 3KLHA 3GTLA 4ZITA 2E9TA 3DRPA 4BWJA 2GAGC 5CCMA 1FJEB 4N8OA 5D15A 3NS7B 2KVQE 5GAHI 2J9DE 5GADU 3GE9A 1FESA 1HNVB 1UJ4A 2PMZA 4LRDA 1X4FA 2YPYA 3QQCD 3FBFA 2CJAA 3QIDA 4EU0A 3RRGA 4NA2A 2XO6A 1U1OA 3EWGA 5KFXA 3RRHA 3RBXA 1R8CA 3QGHA 2J7KA 2KHCA 3FSIA 5E3RA 3ZTRA 4DS4A 1PIEA 1R6YA 2FIUA 4KGMA 4ECRA 4XIUA 1IBLF 4QU6A 1AA1B 3DOLA 1TWAA 2OFGX 3W65A 5E3PA 1Y11A 2YWEA 3GMGA 2A69D 2FGOA 4OHYA 3GWCA 1U7LA 1RT6B 3BKFA 3AQPA 1TL1A 2A2DA 3AHPA 3HU2A 3HHLB 4DV5F 3LP2A 4OIXA 4ZVFA 2JEJA 2OPSB 4USVA 3QWZA 3RU0A 4DI6A 2DNHA 4PR6A 4Q43A 2C28A 1F0XA 2PMHA 3M6UA 4H4OA 4DWIA 1LWXA 3EJMA 1TL3A 1P6TA 2AMCB 2GVDB 4TVAB 3CJ8A 4G1QB 4XO0A 3CPWR 1YRUA 4DMRA 4RW8A 4YEAA 5E33A 3UCUP 2UXDJ 3MEEB 5CAAA 1PYOB 1FT8A 1CZ5A 2O01C 2WB1D 4NZ7A 1NB7A 4ECSA 1QCSA 2GGPA 3EGWB 3M8QA 5ETQA 2LFVA 3LWMA 3AA8A 4M5DB 2R2SA 3BSNA 3C2PA 1WKJA 4OI3A 2JHEA 4IR1A 3ET6A 2MQMA 2W7OA 4J9MA 1Z4UA 1NK0A 3HHEA 4R0EA 5EWEA 2QYCA 5HBMA 3DM2B 2YWFA 2EBGA 2EKNA 1S3SA 2V4JA 2HWIA 4RW9B 2FVRA 1OQ3A 4KFBA 3L09A 1WHVA 2O67A 4U95A 2GMJA 4M5LA 1N4LA 4LFCJ 2MKIA 2MLYA 2WHOA 5D0GA 2ATLA 1J5EJ 2X1BA 4ED2A 1FCAA 3HJVA 1KQSR 2KFYA 3TI0A 3CJRA 3B6BA 3GILA 2IDLA 4JI2F 2ZBQA 4I2PA 4FVMA 3UN3A 3UO0A 2I5JB 2JH3A 3CJ2A 5CABA 4LF9J 1RTJB 3W64A 3MR7A 4KO0A 4P72A 1HD0A 3GTOA 4DDFA 3KK3B 3H90A 4WPAA 5A8WB 4PZVA 1WDTA 2QC3A 3N0VA 4WXOA 2RE1A 1TK8A 1AUSL 1Z1ZA 1RT7A 3DC2A 1LNQA 1F3FA 3W8PA 2Q43A 3T5KA 1RKIA 3IS9A 3W7BA 3M4XA 3Q8SB 3VGTA 4IQXA 3CIMA 4B9UA 2HHTA 5F8JA 3QO9A 1APSA 2K1RB 2RUGA 2WVFA 1HL6A 3G82B 2IPOB 3IM8A 4NWBA 4CLZA 2IBKA 3FBEA 1R89A 1FRIA 4AQYJ 5J2PB 2APOA 2DGSA 2GIFA 2H54B 3GFYA 5ETRA 5KFJA 1KQKA 3PHTA 2HNZB 4K8RA 2Z4PA 2BQ3A 4YY3F 2JC0A 2ZH1A 3UFCX 2HZCA 1FJ7A 4KPCA 2DGVA 2PI8A 1R9TA 2OPSA 3FCWA 2DO0A 1MSWD 2Z2LA 2R8KA 5IM0A 3BDPA 1XIQA 2HCZX 2PD1A 1N36J 2F8HA 1DURA 1FA0A 1S0VA 1N56A 2FLPA 1S6PB 3MR3A 2NXCA 1WHYA 2Y1JA 1Y1VA 3M3GA 3QNWB 1FDBA 1OY9A 2W4DA 1SJ3P 4HACA 1ZZNA 1WEXA 3HMJG 2H5EA 2ZNZA 3QT5A 2CZ9A 1BW3A 4F4XA 1H6KX 1PGZA 5H9EJ 1FE4A 3JS9A 2CJ9A 3DMJB 4A8SA 1NKBA 3SCKE 1HPZA 2AJ4A 1KKHA 1P9QC 1TELA 1Z2LA 3DFEA 5C5JA 5F8GA 1EX8A 5J2MB 5BYRA 4U7CA 4IFYB 3ZZZA 2WTFA 2MKKA 3CCVS 2IHR1 3D6FB 1C0TA 4ZVEA 5IQQA 2HHHF 4JV2A 4USIA 4RW4B 3BZQA 3B4MA 3NKYA 2HYIB 4KIAA 3K2YA 3T1HF 2KG1A 1V9OA 2AYEA 4O44B 1T9WA 2AU0A 1RHUB 2JEGA 5I3QA 3X2LA 2R7SA 1MW7A 2FJAB 1UA1A 3J80U 3NMRA 3CDAA 5C42A 4LF6F 4AONB 3WDOA 2H48B 5DGAA 1RGVA 4USWA 3CIZA 3I5AA 5A8WA 1IBKF 1N33J 4CLSA 2J6TA 4FDFA 3BJYA 5E41A 5EUHA 3LGMA 2CJBA 4CYUA 2M0GB 2AJQA 3QFHA 4HEA9 5L1LA 3BGRA 4NMXA 2HGLA 4UOGA 2Q66A 3WX4A 4BBYA 2K7JA 3VCDA 5IS2A 3PO4A 1SI9A 3OV7A 3CCTA 2NXEA 4B3TF 1M1GA 2F4FA 4NA3A 3M9MB 4PUOB 3GJSB 2EFVA 4ZVUB 5AE3A 3FZBA 1S1WB 2Y0BB 2ABYA 4RBUA 4NLOA 1U8WA 5A6PA 3I32A 4HHJA 4TXSA 4ZVGA 1DTTB 4ES2A 4CYUB 3CCMS 1FNMA 4L72B 1RWPB 4DUZJ 4HYKA 1YJWS 2CIMA 3S7RA 2WONB 2AKWB 2F4VJ 3PRVA 3UDLA 3OHAA 2UUCF 2W4CA 1DJ0A 2CQ4A 3AJDA 4ZVHA 2AF6A 4JYAF 3UVJA 5T7LB 4RNNA 1SQEA 2H4WB 2C2ZB 4B3OB 2YKMB 3Q23A 1U1KA 2DPJA 2B4UA 1Y5NB 2JRSA 2OD6A 2WZ1A 3UE2A 1CJKA 3OL6A 2DNKA 2WVEA 3J7A1 1JJ2R 1IKYA 3IAM9 1UEUA 3K58A 2CPFA 4NLUA 2B9XA 2BQRA 3WIUA 4F3QA 2HBZB 1WUUA 3RB6A 1SC4B 2D3OR 3C15A 4Y3CA 3HKZA 1KQGA 1KLNA 4I6YA 1Y9OA 2ROEA 4N41A 1I94J 4C7QA 3K0JA 2A68D 1PJ5A 1RT4B 1OSDA 2XTJP 2ZBIA 4IG3A 5J1NA 2VHGA 4NX9A 2WOMB 3RAMA 2ADBA 2XNQA 5MLCV 2W9BB 4DR2F 4KKOA 4ZLNA 2KO1A 4UF4A 3UR0A 5B0BA 2W9BA 4B9VA 4OX9J 1S6PA 8ATCB 3TO8A 2IVYA 4ZLLA 3FJ2A 4R5PA 4X4QA 4R8UB 4JS7A 1UHEA 2VOOA 3X2KA 2M88A 4MFBA 4PCQA 1WOOA 1TMMA 2DT9A 4BWMA 3JSRA 1KEKA 1QVGR 4Z37A 5L9XA 3Q8RB 1CVJA 1KONA 2LKZA 2PEBA 3CVKA 3HVTA 3OJUA 1HQ2A 2DNGA 3C15B 2ZH9A 1WNEA 1JLEB 1X4GA 2HNYB 3G8TA 3QIPA 1JQGA 3D28A 4CTAB 2H65B 4OX7A 5DG7A 1O8BA 5KFSA 1LFWA 4IRKA 3CEDA 1PYTA 2NYHA 1ZYRD 4JOUA 3JTPA 4AUKA 1NSAA 2L9WA 5A0YB 4RPFA 3BYPA 4B3SF 2K3KA 3BQ2A 4NLRA 3CDUA 1UMJA 2LA6A 3NBPB 1CQMA 3TYTA 4N77A 4J5OA 2M8DB 4CRJA 3D6TB 2HFNA 2Y1LB 3CB4A 3FK4A 3TRGA 4LF9F 3QWPA 1L3KA 4NRTA 1QVFR 3C16A 1TP7A 5T5ID 1A0OB 4H4OB 3HXMA 5E3QA 1GAOA 5EPPA 3GJQB 2E1MC 1D9DA 3HVTB 2XS5A 3TZYA 3BN4A 2A6OA 1UVIA 2OD4A 4FF4A 5C25B 1M5KC 3JSBA 2DNOA 5LMUJ 1XMQF 1HQUA 5KFHA 2R7ZA 5KT6A 1WTFA 1LV5A 3OD2A 2OMLA 3WQPA 5SUHA 4I68A 3M8ZA 4CS0A 2BJ9A 4DSJA 3CT9A 2UVUA 3SFGA 4NCAA 1T94A 2DHHA 3ZZPA 1N32F 4ELVA 3HSGA 3W61A 3CJ3A 4DBQA 2OPQB 2KH9A 3ZO7A 1QLNA 3PX0A 3DNCA 3IG1A 2EG2A 2XO7A 1WC4A 2K06A 4LRFA 1X4DA 3M6XA 4CO3A 1QTNB 1UP1A 3CCES 1KQGB 1IM6A 4JBCA 5DRKA 1U6ZA 3DRYA 3PNIA 2XY5A 1TK5A 3K7RA 3QAUA 2VQEF 1H7XA 1JXEA 4DV1J 3PV8A 3BQ0A 1M5OC 1IBKJ 1E6VB 2Y0SD 4DL3A 1YJRA 3HFZB 3FEXB 2XI3A 4DPOA 2G13A 2HSEB 1CS4B 1RWWB 3AB4B 2XCPA 4DUZF 1OWXA 5IT0A 4GO5X 4L3NA 3PR4A 3CCZA 5GAGU 1U2RA 2CKWA 4HVZA 1RBAA 2CNOB 3BSAA 4G1PA 2V8VA 4L74A 5HO4A 2F8EX 2Y3YA 2ZHOA 4NLQA 4P71A 4WK3A 4C11B 1VCTA 3GFHA 4I69A 4JI7F 4GKJJ 2ZZTA 4C8ZA 4FKYA 1NAQA 1REVB 5DM7Q 1P1LA 4QU7A 2ZUAA 4XDDA 5SZTA 1TFWA 1QE1A 2VC1A 3TVKA 1YJVA 2QX0A 3I0RB 2ENGA 3N6LA 4ENOA 4NXMF 4K4UA 1H7WA 1IR1A 4YQWA 4K4WA 5H9FJ 1NJIT 3N79A 2CADA 4WP3A 1S7IA 4X66F 4KTQA 3S6EA 1R6VA 3SIPB 4CNZA 3FBBA 4ZK7M 1GEHA 1NZAA 1HNIB 4DR1J 1NJZA 3K8VA 1RYSA 3W9HA 3PFOA 1GXTA 3R5BA 1Q53A 4ZDNA 2RRBA 4ZVQB 3HF5A 4DEZA 5FD1A 4I7FB 2ZHBA 3MXHP 2J0WA 4OYBA 4PEOA 4DL2A 4DR7J 2OI2A 2KHDA 4OHVA 2CVEA 1NLKL 5D0RA 3OTOF 1KRPA 2HHQA 4CCHA 1HD5A 2RU3A 2Z8QA 1JLQB 1R0CB 3MPUB 3AD8C 1R31A 3KUGA 4EMDA 2VA2A 3PX6A 2V50A 1X5TA 3TWZA 5GADI 3QLHB 1DFDA 1PQFA 4C48A 3IR6B 2MGZB 2ASLA 8RUCA 4F4WA 1ZA1B 3UPFA 2UV8G 2HRTA 2LDYA 1IJFB 1E60A 1BWEA 3CJTA 3W60A 1UWBA 2KYXA 1UPMB 2V34A 2Z56B 4RW8B 5T41A 2JIPA 3TEGA 3PRDA 4IO9Q 1VQNS 4ILMA 5GMDA 5J2NA 1S59A 1IW7D 1RTHB 4J37A 4YB1P 3J81Y 1WKKA 2J6UA 2BDPA 5CA5A 5KFVA 2UXCJ 5EGYA 1M1KT 1XNQJ 2VFUA 1YBTA 2NZ4A 3LTOA 2IIHA 2YBVA 3TVZA 3SBMA 5T5MD 3MCOA 3OR1A 3TZXA 1YBUA 4NLGA 2PFDA 4LQ9A 4WYLA 1ZS6A 3GCWP 1HBMA 4A8WA 2VBXA 2VFRA 1KHVA 1LWCA 2MPUA 3HD1A 5IC6B 3R3TA 3RRKA 3MR6A 1X9SA 1L5UA 4LQ3A 3UNGC 1IWGA 1GMUA 1RWUA 4CO1A 1XBWA 4J9KA 2WVCA 2C3YA 5DYIA 3H0PA 5EWGA 1N0UA 2M5YA 3PVXA 2O1PA 2V4JB 1F3VA 5AE2A 2QTWA 4OZ2A 4C0OC 1GMWA 4XPCA 3M8YA 2G6GA 2MZJA 3DLEA 2M7SA 1WELA 2QL7B 3HSDA 3M8QB 3R5JB 3S01A 2XYPB 1FTRA 1J2VA 1CJKB 1PBUA 3H8YA 4UOHA 3N6MA 1VQOS 1ZA2B 2MJUA 3GG1A 2DNNA 2J9CA 3CJSA 1JWWA 4DL6A 4QIVA 1NK7A 2FHJA 4WK1A 2B8QA 2UV8A 3EICA 1V3SA 4DR4F 2VL1A 3ULHA 4ICLB 3J81U 1LXNA 1R8HA 2FGCA 2RQ4A 3BV8A 2ZD1A 4DR5F 4IOAQ 3LP2B 2MYFA 3IAS9 2QSWA 1Q16A 1GFWB 3ETOA 1F9FA 5E3AA 2NPFA 1N5TA 4K4YA 4YR3A 4ED7A 1Q7YT 1MMNA 3GLJA 4ID5B 1ZC1A 2HNDA 4ZN3A 1Y7PA 2BM0A 2B3TB 2KG0A 2PICA 3HVRA 4QYZJ 4I6WA 4PG4A 5DDQC 1W7WA 1ZBTA 2VONA 1VLYA 2QL5B 1D9FA 4IH5A 4LSLB 2XEXA 3TNVA 2W9CB 1LFPA 3I9V9 1HBNB 1YITS 3MPDA 1L3UA 2YWWA 2LEBA 3O8WA 2NREA 3Q2TC 2HVZA 1F2HA 1NJXA 4CH0S 3V81A 1S9FA 3K5PA 4ELTA 3ILIA 1ZTTA 5LXYA 1UVJA 2ZVIA 3N5FA 1UTAA 2FJEB 2V0NA 2ASDA 1RACB 3FQKA 1X4HA 2HBYB 4KGKA 1N54B 2XQCA 2HHUA 2DISA 4BC7A 1FHTA 3C6TB 3JTOA 4CLWA 2XSFA 2Z2YB 4H54A 1UVKA 4Q45A 4HHUA 4LR7A 2E5JA 5I42A 2MY8A 2YKQA 5KT3A 1U1NA 3KDOA 3TM7B 1H2TZ 5C2GA 1TQLA 3TX8A 2R2TA 1SPBP 2MEWA 1QUVA 4IO1A 3MMJA 5ETKA 2XYGB 2MQLA 2X7IA 3OFHA 2R7TA 1IBLJ 4N56A 3N4WA 4I56A 2CJYB 3AAWB 1J5OB 2HNYA 3NNHA 3SSSA 3DXSX 3MTJA 3DMJA 2ACMA 2DY9A 2VDHA 2E7XA 4WFXA 4YR0A 4N5SA 2CAJA 3G6XA 5DQIA 4KHPJ 2NLWA 5DLFA 3IR6A 1RT1A 4ZLJA 1TVRA 3SCLE 1X5OA 4HR2A 3V2UC 3JYTB 1SC6A 3FSXA 3EPIA 3MZIA 4TN2A 1FE0A 1XR6A 3KYLA 3BR8A 4PQUB 2ILZA 2C3OA 2YNHA 4TQSA 1RE1B 4C8LA 2XMJA 2R7RA 2VG7B 1KWMA 2PI5A 4DX7A 1UZDA 3DKDA 1TAQA 4X65J 3CGIA 4CZCA 1EU1A 3EDQB 2E2HA 1RT4A 3NAHA 3VWSA 2CDQA 2EEYA 3TOQA 4JP8A 4MH8A 4RUAA 3HI9A 3UDCA 3TIWA 3DLGA 1A7GE 1QTMA 4CH7A 2AJ2A 5DZ7A 1Q7LB 3L95X 1EP4B 2ZZMA 4C6AA 4F2RA 4AYBA 2KDOA 3JTNA 4DR3J 2N4DA 4A46A 1U4BA 2OFHX 4ID5A 2J0SD 5L1JA 2J9EA 2GQQA 3MEKA 1AZSB 1BD6A 3MM8A 1IKXA 3ISZA 2GJ2A 4DV4J 3ILOA 1MMLA 2BX6A 3MAAB 1X4BA 1NRKA 1RHMB 4QPTA 1E6YB 2RS8A 1RYRA 2CPZA 2MJNA 1T8EA 3P49B 2ASJA 2DH7A 1OYEA 3JQKA 1SH2A 1T11A 4N76A 1LQ9A 1K0TA 1UZHA 4U7UK 2GZOA 2FHJD 2V5HG 1OPIA 3RBZA 1EIYB 1A9NB 2ZUGA 2FJWA 3ZTSA 5AXKA 4C3LA 2D7SA 4KE5A 3BSOA 4GA6A 1S1WA 3BR9A 1LWEA 1TV6A 3BREA 4F4AA 1R27B 1P9YA 2VUMA 2HWHA 2OHDA 4X4SA 3Q22A 3R1HA 4DR6F 3UWTA 1YRXA 3FC9A 4B9NA 1TZ0A 1FJCA 2DH9A 1N5YA 3LP0A 4LF7F 1LWFA 1JLBB 1XC9A 3WX8A 7FDRA 4CM2A 2VFTA 3JQJA 4NYZA 2DNZA 5C25A 4WTOB 4QIGA 2R7QA 3U1LA 2R2RA 2VPYA 2KKHA 1VBYA 5D4NA 1L3VA 4IRDA 4P2SA 3A8JA 5LMUF 3BGFA 4MKYA 2AT1B 1EETA 4WKRA 5KFEA 2FJDB 4U7UD 2KFNA 4ZCLA 2IA0A 2DKOB 2RDJA 4DCPB 4ANEA 1FK9A 5D4OA 4WZMA 2DNPA 2CQ3A 4DSIA 1BLUA 3BEGB 2R7XA 2H1YA 2CDRB 1B70B 1ZM4A 4ECUA 2V2KA 4RW4A 2HGNA 1UEKA 3VF0B 3KHLA 4LF4J 3MHYA 1FRHA 1R7RA 3GTPA 4ZN1A 4YMEA 4P7TA 9ATCB 1D0EA 1M1HA 4ECTA 3H98A 4QJVA 4DUYJ 4JI2J 4RLEA 4DPYA 1HPZB 5KFGA 3NMAA 3IWLA 2HHXA 4QOTA 2QG9B 2VDIA 1H98A 5I42B 1RT6A 5A8KB 3KK2B 1XK8A 3KFWX 5IC4B 1S6QB 3OHBA 1YGYA 2M8HA 1GTEA 3P45B 4PAAA 2BE7D 1RKJA 2YKPA 3CF2A 4F8RA 1IUJA 1RU1A 3D54A 4LF7J 2WB4A 2VF3A 2WW8A 3BF4A 4P73A 3T5HA 2JEIA 2FHOB 1VQ8S 1FERA 1VJQA 3GYNA 1BE4A 1RTDB 3C19A 1WF0A 3C6UA 1RLDA 2C2RA 4ILLA 3M8PA 1AFJA 1D9AA 3N28A 2OH2A 4J7CA 1JXLA 1JLGB 3LAKA 3HO1A 2C2OB 3ITHB 1NJWA 2UUCJ 4Y34A 2HHSA 1TU0B 5F8NA 2VG5B 5LL6d 3UN5A 3CCWA 4A8XA 4ZIWA 1RAEB 2DXDA 1U1MA 4FF3A 3MMCA 3SUKA 3UCZP 1SB6A 4GA5A 2GA7A 2V2VA 4MAKA 5GAHU 1WC1A 2A6MA 3NGUA 2G0CA 4OX8A 3TA0A 1SQGA 1PYQA 2PO4A 1QM9A 5AXMA 4YHHF 2J0QD 1FFSB 4ICLA 5KFTA 1RHRB 1VRTB 1F60B 4DR6J 4CRYG 3W9IA 3A8IA 2CRLA 2KJWA 1BMQB 2IRUA 3VAKA 1YNJD 3GSIA 1LK5A 2WVDA 3BGUA 4EK2A 2ZOGA 4W98A 4Z7CA 5KFLA 1L3SA 2DEJA 1Y5IA 5AT1B 1H74A 4K2JA 5CYMB 4NRUA 1XWLA 5IT4A 4OYOA 4DF8A 3FNNA 2YNFB 3RYLA 4QR0A 1OQ6A 2VG5A 4CNYA 5AXLA 1SJFA 1VRUA 3LGHA 4I4BA 3THPA 1YJUA 1RT5B 2OPPA 4GC7A 3PO5A 3UD3P 1H0HB 2IM2A 4DZ6A 3R5CA 3OT9A 3W2VB 1U25A 3NCQA 3T9NA 5BJRA 1N5SA 1U0HA 2W4PA 5ETOA 3DDKA 2KXNB 3CDWA 1RI7A 2HEKA 3NS6A 4TY8A 2CVIA 2NXJA 3BPSP 4A8MP 1DZ5A 2B43A 5FDLA 1N52B 2ZBPA 5LMNF 1I1GA 2J6SA 2IFXA 4M5DA 4ED5A 3D66A 4NI2B 2R7OA 4JI7J 3GB0A 1RLCL 3W2WA 2RKIA 2BQUA 2ZZNA 2B7BB 2H3EB 1XMOF 1S1VA 5LSLA 3MECB 4KHMA 3W3SA 4FN5A 2EVZA 2EW9A 5ETVA 2BANB 3OJSA 2RH3A 4EZ9A 3CJQA 1LK7A 3JSMA 2A3JA 3X2OA 4UTGA 4MT1A 2BE5D 2HS3A 3PLXB 2N3LA 3ZZRA 2XLKA 5DDOC 2PSZA 4ANCA 4EBDA 4HI1A 4H4MB 3SDEA 4X62F 2V2QA 2KVIA 4JUZA 4Y00A 3V5RA 1MWYA 3ONQA 4RW7B 4F7VA 3IRWP 3G71S 4ED6A 1HYSB 5KFUA 5I3PA 3DCAA 2WBMA 4DV2J 2IM1A 1JLAB 4AL7A 1RAHB 4ECQA 1Q4RA 1KS2A 1FRKA 4YY3J 1U49A 1XNRF 3C14B 2KT2A 4KAIA 3RAQA 2C45A 3IGVA 3MMAB 4ZJQA 3U27A 2C22A 3K17A 1VJWA 1FWKA 3RW7A 3TA1A 2BJ3A 3JXOA 1E5VA 1KSPA 2V8GA 1SCJB 2BE9B 2MQOA 5THWA 4JI0J 4C2MA 1OO0B 4CWBA 4PG8A 3MAQA 1IVZA 1MNEA 3V4IB 4J9UE 3CO9A 1YTYA 2BR0A 4E2FB 2DNMA 2HNDB 3MPWA 2YNFA 1Q1KA 3IM9A 1S99A 1AW8B 4HLBA 4Q7AA 2AEJA 2ROPA 3DGPB 3KXDA 2HQCA 3MEGA 2BOAA 4FXVA 4OI2A 1JKHA 3V4MA 1HW9A 4CP5A 3T5JA 5K9FA 1I3OB 4F0HA 2CQIA 2W8LA 4OJGA 2HGMA 3BO2A 2GMHA 4F04B 1HNWJ 2HNZA 3F41A 4KLNA 1ZM2A 5B0FA 2ZJPQ 4PWDB 3MM7A 2HFOA 2CYYA 4LF2A 2Z30B 3MEDB 1JJ4A 1WJ9A 1JLCA 1S1XA 2AV5A 2KT3A 3L3CA 3CCSS 3MEGB 1KQFA 3TX0A 2XMVA 2HVIA 1C4CA 2F9JA 4KC5A 5C18A 3PACA 2R2UA 2DNQA 1UJ5A 1WKLA 2W8KA 4K4TA 1NK6A 5GM9A 5B0EA 2F4VF 4L48A 3E8OA 5ITHA 2VJUA 1FXDA 3HKWA 4E98A 3CTRA 3DLKA 1X0FA 2ZC4A 5BYSA 4RU2A 1YWXA 5FLXY 1UWAA 3TA2A 5F8HA 2J76E 2DRBA 2RVJA 2ZOMA 1DMSA 1H0HA 1ZPWX 1NHUA 2OTJS 5B0AA 3LP0B 3BH6B 5MAOA 1F9HA 1S9GA 1WLFA 5H9FK 3QBCA 1SKUB 1Q81T 3MR2A 4DPTA 3DLKB 1VQLS 5KFFA 3J7YU 1X5PA 4IFVB 2UVVA 2EI5A 4P2MA 3AXMA 3T1AA 1FWLA 1F9EB 2L08A 3BGRB 3CDBA 2GV1A 3JYTA 4JI3F 4KDIA 2NR0A 4DV5J 3IR5A 4AT1B 3ZC4A 2BJ1A 2KL8A 3KG1A 1HBOB 4K7QA 1NKCA 2JLEA 1YKWA 4HTIA 4WIQA 5HBMB 2YNGA 1ICEB 2PE8A 2VUGA 2XYHB 2UUBF 4PRFA 2KZZA 3D5MA 4OI6A 2ROGA 2FHMA 2YWKA 3IMQJ 4F36A 1O5JA 2BVZA 2IM0A 5CD4H 2FLLA 4EBCA 4DQPA 1BXNA 2EKYA 2VBZA 5CHCB 4X4OA 1VQ9S 1VFJA 3MAAA 3FCHA 4CO5A 1ZM3A 3QZ8A 1HR0J 3X3UA 4OI4A 1FK9B 3OLAA 1D09B 3F44A 5A0YA 5KT7A 3RBEA 4JI8J 2QLWA 3ZZUA 3R5DA 4OHZA 1Q8LA 3NGKA 1R0AA 1VC3B 1EETB 2DHSA 4LF6J 1U47A 4I2QB 6FDRA 5D8HB 3NGDA 3DLLQ 2C2EA 1UVLA 3IWNC 1C0UB 1MMDA 5L9NA 3TAMA 3I56S 1TL1B 2RRNA 2RU9A 5BXIA 5K8PA 4O3RA 2EC2A 4ZPAA 2AGOA 2HLTA 4OLPA 2OELA 1ZAXA 1UFLA 2LP4A 1V5VA 3QPIA 4QW8A 4J90A 2YH1A 1OJ4A 4WYWA 4X84A 3BGLA 1XR7A 4EI2A 1E18A 2AQ4A 3CJ4A 4F67A 2ZJQQ 5LM7E 4DFKA 2UVRA 4HKQA 3SCIE 3SXLA 3AXKA 3PW4A 3PW5A 2PA8D 4XPEA 1YX2A 4ZVSB 4ZHRB 3MR5A 4A8KA 2KU7A 3TARA 2XBPA 3DI6A 1PYUB 1TL7A 2RNEA 3MM6B 2K1RA 3UDEA 1NMEB 4TY9A 1P27B 3I0SB 2O5DA 2DMRA 3FBCA 4B17A 2VJVA 4M5HA 1R43A 2YQ1A 3K5OA 3CC2S 3X2GA 3KLHB 4OL8A 4P52A 4B08A 2Q3PA 3R7BB 2D1CA 1NEEA 2EFNA 4A8QA 2UP1A 3UNYA 4K2XA 4KB7A 3GIKA 4NCBA 2DHGA 2B63A 2CFXA 2CNKB 3C6TA 4YUDA 3ITHA 4OYZA 4K50A 3BQ1A 2VPWA 5HVFA 3GV5B 1DBDA 1RHJB 3HZGA 4ES3A 4ED8A 2A18A 3P5BP 4KO0B 1X4EA 4NZ0A 2LU1A 3KJFB 1WG1A 1X0PA 2QEXS 2AZ1A 5DJBA 4ZCMA 3TQ1A 1PO6A 4FF1A 1AUDA 2E5LF 1CJVB 5EX3A 2OAUA 4Z7YA 1UCNA 1DLOA 4BLGA 3RTVA 2NXUA 1DQ8A 3CC7S 2GHWA 4LSNA 1K9MT 1YVFA 2GHPA 4F4ZA 3MD1A 3OR2A 4LRBA 5HJXA 2W7AA 1Y4ZB 4CIOA 1H72C 2HQGA 3Q0AA 4QIEA 1DAXA 1L3TA 4OFZA 3CQZA 2DGXA 4JV5F 2YY3A 3EUNA 5J2NB 3F73A 2DEIA 2R7VA 2GX8A 3OBIA 4L75A 4JI3J 3UR3C 1H3DA 1M5SA 3L7PA 5M2PA 2AP6A 1WF2A 3NWRA 4QYRA 3CD5A 5L1KA 3U02A 2JFDA 2VV5A 2C2DA 1NH7A 2VPZB 5KG1A 2C3MA 4DL5A 1FVSA 3DOMA 4O23A 2HVDA 3PW2A 1RWMB 2VODA 4KV8A 4TY8B 2GO8A 4M63A 5E2QA 3BM7A 3D1OA 4F02A 2V2ZA 1JLEA 1LEOA 1FDAA 3R6LB 5GMEA 3IR7A 2YH0A 4CDIA 1X7VA 1NSKL 4Q44A 4GKKJ 4DG1B 1UJ6A 1HWKA 1NK4A 1EKRA 1T7PA 1RTDA 3SCJE 4JP6A 1YG0A 1ELOA 2BABA 4TYAA 4WP8A 4AL6A 4PXDA 2DGTA 2FZCB 2ZH3A 4G65A 4NLTA 3HKZD 1YI2S 2E5LJ 4KO8A 3DDNA 3GG0A 5BR8F 5BR8J 1B7YB 1JLAA 1W26A 2X1GA 3N9UC 2XGQA 2OGUA 3LANA 2VPZA 3THTA 2FQQB 4CLLA 4EEYA 4JI1F 3RG6A 3CO0P 3R2DJ 2E1RA 2EK1A 4OYXA 4GVLA 1NCLA 4IDKA 2OUGA 3NOCA 4ED3A 2G2ZA 3W66A 2HFSA 3EXYA 1VRTA 2GS8A 3KJVB 1DHMA 1EAYC 2XMKA 3HULA 3HD2A 3PJ9A 3EGVA 3JSMB 2RS2A 2FVPA 3M2RA 4I64A 1VQ6S 5DQHA 2MKCA 2QFIA 4H4KA 4C8MA 5KFAA 3MAHA 2CQHA 4DV3J 2MHEA 2PEHA 2BW7A 3H2VE 4UZCA 5KFNA 1QUPA 1JJCB 4O0IA 5HROA 3KJQB 1SIWA 4JV1A 2VBWA 4QIFA 1NPKA 2X51A 2JIQA 2KXFA 1Q8IA 4U8VA 4URGA 2FJXA 3KG4A 7FD1A 3NCPA 2C3PA 3G96A 2KI8A 1EKSA 4OZ3A 1KBRA 4WU3A 2B6AB 2MQPA 3LP1B 4EFAC 5KOXA 4TU9A 2DR5A 4ZP8A 3QZ7A 4F3OA 3GR0A 4B9SA 4IUFA 4QWBA 1NB2A 1T3NA 1JLBA 1V3ZA 1KVKA 4OYMA 4DV2F 1WTBA 4RNOA 2HFUA 1M0SA 1S0NA 3DRSB 3H0GA 3M6WA 4FYVB 4MIAA 3QWUA 1U1LA 2CNNB 4ED4A 1T3OA 4ZLPA 1VC6A 2DNLA 2JL9A 4IQMA 4DR3F 3UQSA 2B8PA 2XULA 1WF1A 5H1SV 4DV0F 1S72S 1KVJA 2FZKB 4DS5A 1FI4A 2UUTA 2JVOA 2A1BA 3FDSA 2XY7A 4KFBB 3H5XA 1TKDA 2W2MP 1S6UA 1S77D 2U1AA 1LW0B 4DSLA 3GIRA 5A2QU 3PX4A 3WC2A 5IOLA 2HG4A 3VAMA 3D3CJ 4ZPWR 1BQNA 3H4DA 3MM9A 2XM3A 3MCMA 5KG5A 1KTQA 4M5NA 3CCQS 3KLGA 3N5BA 2M4MA 4UQGA 4LF8F 1E61A 3DLEB 1AFIA 2OEJA 2KM8C 3O5TB 1JLFB 3NCRA 1HMVA 5U47A 1K44A 1NSQA 4IH7A 3L7UA 4DX5A 3BO3A 2B51A 2OPRB 4IKAA 4XTTA 4PG7A 2R3VA 3BKTA 4RUBA 1FEHA 2CZVC 4QQBA 3H25A 1N5YB 1O6XA 2DIVA 4FERA 4LSLA 2X1AA 2W9CA 3PJWA 1KR4A 4BDPA 5K14B 1PCAA 3H5UA 1B7FA 5D3GA 5FTJA 3LPYA 3M9OB 1IKVB 3VGUA 4KV8B 1PYSB 4TYBA 5K20B 1S6QA 2WSFC 1V6HA 4RNFA 1EB0A 2B9WA 3CCUS 4N7TA 3H40A 5F0UA 5J1EA 3IBCB 2Q6CA 3HU3A 5HN0A 3QJJA 1F5AA 2W7PA 1WSVA 2A6HD 1KVIA 3MMBB 3PEHA 1RTIB 4JI5F 3M30A 5L38A 3FMBA 5KG0A 2VPXB 2XNRA 1Q8KA 2CUYA 2MKSA 2OO4A 3SQOP 4C98A 1MLAA 2V45A 2BANA 1HWUA 3EVWA 2VOPA 2ZH6A 2HMIA 3X2PA 5KFWA 1VR6A 3CMQA 5B0CA 3RZAA 5HMYA 5KT5A 2YWHA 3R7SB 5LSOA 2RQMA 3GQCA 3E2EA 3D3BJ 1X60A 3WHIA 1Q78A 4RX6A 5FDLB 3ENWA 4NLWA 5HSPA 1BQXA 2BRKA 3VV2B 3VAIA 4ZKAA 5FTNA 3VAGA 4WKYA 3QQ8A 1TMOA 2POKA 4CLUA 1UETA 2DD8S 4URSA 3PXGa 4C0HA 3IGNA 3IG1B 1GK8A 4FS2A 3VAHA 4AFFA 1DTTA 2CG4A 1KNZA 4ZPDA 1U09A 3R27A 4LSZB 4R5PB 1CJVA 4BS2A 2QRRA 1JNZB 3DN9A 1PJ7A 2YPZA 4FYWB 1NPRA 3ISND 3FSYA 4J9SA 2PC6A 3J7Z5 5DDRC 2PNWA 2ZWPA 1UA0A 1SIWB 2IC3B 4L73A 3OFFA 1FRMA 3LH2S 1N34J 2OTLS 4C9DA 3CCLS 1FFGB 2AHOB 1FO1A 2YUJA 3G6VA 4Q2MA 2QMWA 4DR4J 1F2GA 3SSRA 3AJ1A 1RTHA 2C2MB 1SL0A 1BW4A 1R8BA 2LXFA 2EFQA 2NYIA 3IWXA 3WZ0A 4QIWA 1KOHA 4KSEB 2AYMA 2ASYA 3HX9A 3GJRB 3ENQA 2JOQA 4RO0A 1RA6A 2HQDA 2W2QP 2XWYA 4OZ0A 1N34F 1TL4A 2NPIA 2HBRB 3OTDA 3AOAA 1KFSA 1FEEA 5GVQA 4DL0C 1G2EA 4IFYA 2WSEC 4Q0BA 3GONA 1TL3B 4FBTA 1RWOB 3QGPA 2UXCF 4LUBA 3LPEA 2AGPA 2Y8WA 3U1NA 4EYIB 1I5OB 4DU7A 1RTIA 4GVBA 2FVCA 3DRRA 4KGZB 4MMOA 3C6UB 3V6DA 2W9AA 3X2JA 5H9EK 3PYEA 3GTQA 2KQAA 2J5AA 1TMJA 2Z57B 3M2VB 5HMZA 4F4YA 1S6OA 1OY6A 1GX5A 1C1BB 1HW8A 3NEKA 3PM9A 2E1PA 3BBBA 3NGTA 4G6VB 2DGOA 4LIWA 5ETPA 1BHNA 2XSJA 4HH1A 4DJBA 7AT1B 4ZVPB 4PUOA 1JB0C 2VFVA 4H4KC 3DOMB 1TAUA 4ZPVR 4Y2MA 1WWHA 2YVSA 3W63A 1YLEA 1RABB 2OP5A 1N33F 4NCGB 3V6DB 3HK2A 1YLXA 5HL7Q 4U6PA 4UQTA 5AXNA 2UZAA 3POTA 4JCWA 5ETNA 4USMA 1JLFA 1TR0A 2NUHA 3KNGA 2BE2A 2GNKA 2BBEA 2VKZG 3OL9A 3M32A 3GTJA 2WVBA 2I6WA 1S1TA 4ANDA 2OEMA 3C8YA 4WFBQ 3B78A 4ECXA 2EC0A 1M90T 3QJLA 1BQNB 3QO9B 2GVZB 1R0BG 2ZDOA 4O3PA 1YJNS 1E6VA 2LMIA 4OHWA 5A8RA 4DV7J 2F8MA 4IFVA 3TAPA 2QLFB 5M2UA 4ED1A 2AJ1A 3C3LA 4BCAA 2F40A 1K47A 3PIOQ 1HWJA 1MG7A 4X65F 3G6YA 1VLOA 1QAXA 5KFZA 1FKPB 2RD5C 5ETLA 5F9NA 1VQSA 2FDNA 3DDIA 3KHHA 4DR1F 2PJHB 2UU9J 1S79A 2K8GA 1JJHA 5HLFB 3I55S 4FVCA 2LXUA 4K0KF 2NUUG 1UVMA 2JWNA 4LR8A 2BW2A 2C42A 2YNIA 3ZNJ1 2JIRA 3EZUA 1T03A 5EN1A 2JDJA 2RMLA 3Q2SC 1G8JA 3OR1B 5HANA 1PAUB 4LJMA 1YRTA 4Q5VA 2HBQB 3D7SB 1T05A 1CEZA 1WI8A 1UPPA 3OL8A 1OYDA 4J9LA 1RBOB 1WI6A 3MURP 1QSYA 5DQGA 2NSBA 3QGGA 5C42B 4PWDA 4A8YA 3JSYA 1Q95G 1KP6A 2QV6A 3MWBA 3ZZYA 3A13A 4C11A 2W2PP 4ZJLA 5KFKA 1RAGB 2CNLB 3G87A 4U96A 1RT2A 1NDPA 2YU9A 2FC8A 2RSQA 4F0KA 3HP6A 1R3NA 1MWZA 2AIRB 1OS5A 2E2IA 1S9EB 1HWIA 1AZSA 5GLXA 4FG2A 1QY7A 2W1BA 2CQCA 3I5BA 3MM8B 4ZS6A 5G4DA 3OSNA 3PZPA 2GW8A 4JI4J 3TUZC 2MTLA 3FMWA 4AXIA 3G4SS 3KJVA 2UUAJ 1I3QA 5J2MA 1F5CA 4LIRA 4DUYF 1B0VA 4K4ZA 1HYSA 1CC8A 3KLIB 2XS2A 4EBEA 4WXWA 3OW2R 1HNZJ 2ZKUA 1L8FA 3P4UB 4FZVA 1R8PA 3V6JA 3AT1B 1E32A 3D1HA 3CUNA 2ZBRA 2HLUA 4R8UA 4F3MA 4B9LA 1GNKA 2GO9A 2CJQA 1WC5A 1RA7A 4F26A 2UUWA 3ISNC 3VQTA 4J9NA 3DRXA 2PI4A 5F8MA 2WAQA 1NHVA 2E9ZA 3M05A 5HAOA 5HMXA 3T3FA 2HHPA 4IG3B 5C1BA 4O0NA 3X2IA 2LYVA 1PT0A 2X3DA 5F41A 3VZHA 5B0DA 4OI0A 1G3OA 5EDWA 2AX1A 3QRRA 3GTMA 1NK5A 4KODA 4C97A 3FZ2A 2HZVA 4G3IA 4WP9A 2DR8A 4OI1A 3TUPA 2JA6A 2M2BA 3PW7A 4JV5J 3HJFA 2CPJA 3I4HX 1U8SA 2EFPA 4KHRA 4OYPA 4B3MJ 2RQKA 4QZVB 4DPWA 1TL5A 1U26A 3MECA 2BKNA 3CULA 1DQ9A 6FD1A 4KH0B 1RISA 2A10A 2DR6A 3OVAA 3DHXA 4PWUA 4OZNA 4C4WA 3IN5A 2R9LA 4AVRA 2OMOA 4M5JA 3MCNA 1XMOJ 1R7IA 2FPHX 2P6SA 5IQ6A 3T1YF 5F8LA 5I3UB 1KTVA 2V8DA 5CYQA 3GTKA 3Q8PB 4P6QA 4IOBA 2RF2A 2E29A 4P75A 3TJ8A 1RJJA 3IR5B 3SEOA 3J7YI 4CT9A 3KTQA 4WFZA 2JIOA 2F65A 1FWPA 4K5RA 4PWWA 3AH6A 5E7OB 4XDCA 2LECA 3DLJA 1ZOTA 4LBHA 2PJJA 2DCLA 3G8QA 3MI7X 4QYZK 4X4PA 2B5JA 3D67A 2P8IA 1F1BB 3J81j 4FF2A 1IQZA 3Q8VA 3M9NB 5J1PA 1UEVA 3SFUA 2XZTB 4Y28C 3ZZOA 2PFFB 3KKFA 4A48A 2HIYA 1RCOB 2FY8A 1KQFB 5IM0B 4BHQA 2LLZA 1NUEA 4OZ1A 3DXBA 2XS7A 2B4OA 4NOHA 5ETMA 3FEZA 1Y1WA 2OPPB 4YP3A 1PT1A 5J2QA 3RW6A 2OLWA 3C16B 1KN6A 1WDDA 2EBEA 2U2FA 2V69A 1PPYA 3GJTB 3MUTP 4DL4A 2ZH2A 3DRPB 3AQOA 4X66J 2BRLA 1HNZF 4NXNF 4LFBJ 2YWGA 2DK2A 3CCJS 3NWGA 3JQMA 3QSYB 3QMQA 3GR1A 3US5A 3TAQA 3SUJA 3FUYA 3MMCB 1RT2B 2BH0A 2E5IA 1FNOA 2LEAA 2MY7A 2YX4A 4P9SA 4RWWA 2W2NP 4K4SA 1HHTP 4HT5A 2NYAA 4QR1A 2DO4A 4ITSA 5ETTA 2FLOA 3N6NA 5LSRA 2PA3A 5KFQA 2C3UA 2HQFA 3I87A 3GTGA 3Q89A 1OPZA 2YKNA 5DS7A 1NJYA 1HNXF 4F4KA 4Q2LA 1YQHA 4X2BA 2D3ZA 1U48A 4CRZA 4N8NA 1RTJA 1UFKA 4BC9A 4CT8A 1YBAA 2ZHAA 2V9WA 1U6BA 4B3TJ 1ZAVA 4RR5A 1HWLA 3A8EA 2B5JB 3EXCX 4TNOA 3D68A 1AB8A 2XCAA 1UVNA 4WTYA 4JI6J 4GKJF 4DV0J 1O0PA 3I96A 2PIIA 1RADB 2KI2A 5A8KA 3KK2A 1CG2A 1RWXB 5FJ4A 4FBUA 3LQVA 2IJRA 4DG1A 2QLJB 4GVBB 3HHLC 4H4MA 1FKPA 2FB0A 3Q86A 4IYQA 3CCRS 3NP5A 2AEFA 1OSCA 2VD3A 5HP1B 2XI2A 2Q1LA 4HT7A 3QT8A 3K5NA 1R0AB 1Y10A 1G4CA 4OZJA 1IN0A 3GZ7A 4MYUA 4U9RA 2E7WA 4C8KA 4NLSA 4WFYA 5HVHA 2EK6A 3P8BB 4NZ6A 1IWAA 1VS3A 4DFJA 2HHHJ 3MPVA 1FRJA 3BBFA
chains in the Genus database with same CATH topology
3CD0A 2ILYA 1FRLA 3DOKA 2ACYA 2VZ9A 3OFGA 4K5SA 4RWXA 4USHA 4E0DA 3D2WA 2WRMA 3MUVP 4ERDA 4RU9A 3Q8QB 2GHVC 3MCSA 4MK8A 2JEFA 2ZC3A 2K3IA 5KFPA 2B4PA 2Q79A 4CO2A 4PKDB 2RKIB 5LT5A 4A47A 1Q79A 4I7FA 3VALA 3PW4A 3IXQA 3D0HE 5E0OA 2M9KA 2XMTA 2D41A 3G86A 1PILA 4FNHA 2R8GA 4Q8FA 1HNIA 3ZZTA 3VAFA 3M1VB 1TWFA 5K8OA 2XSJB 1GT8A 1F5BA 2XMUA 2YKOA 3DRSA 3LUYA 1FDOA 4O3QA 1Y0HA 3H4BA 3O6QA 1N0VC 2SXLA 4DV3F 5D6GA 2CW0D 1LW2A 2P6TA 3IO1A 4ECZA 1KFDA 3RB0A 1S1UA 1P1TA 3TUJC 4TU8A 1VBXA 3EX7B 1HNWF 3PDNA 1HARA 2YKNB 4ATNA 1FXRA 3T6JA 4ETXA 1S0MA 2MSSA 3CC4S 2CQGA 4X4UA 3LAMA 2GIRA 4WFNQ 1KOOA 2AWZA 2P9EA 2XC9A 4HTJA 1FF2A 4W92B 2FVQA 3O2IA 3DYAB 3CMAS 1MU2A 5CYMA 1S9EA 2MZQA 1Y3JA 2GFFA 3LW5C 1UFWA 1SH0A 1SKRA 1XR5A 2AYBA 2J7UA 2BE2B 3DHWC 1BC6A 1CPZA 2P5VA 2N7CA 3EZ5A 4GKKF 1S76D 1IXKA 2I0XA 2BM1A 1S0OA 2A2CA 2FLNA 1UAWA 2HAIA 3IA0A 2HVHA 2MZTA 2I5JA 3T19A 3H2UB 5KG7A 1FXLA 5EWFA 4O3OA 1FKAF 1IQTA 1DTQA 4ECVA 1FVQA 2G5DA 3HU1A 3THVA 1DARA 1FDDA 3M8PB 3WBZA 4ZCIA 2DVIA 3M2VA 1B0TA 3D1QA 3OQ2A 1TVRB 4OV1A 4O3NA 4B3RF 5IT9Y 4NLXA 2RF2B 4KT0C 3PHEA 2PN6A 4B9TA 2XHWA 4KQZA 1T02A 4MK9A 1X4CA 2HHWA 1CLFA 3HM9A 2HW3A 4ZMMA 4I67A 2X1FA 4QW9A 4PPZA 4LVNP 4RW7A 4LFAF 5B7WA 3MPYA 5CYJA 2KTQA 2QZ8A 3C66A 4AZDA 2FD2A 3HFKA 4WCEQ 1M5HA 2QA4S 1RT7B 1GTHA 4RUHA 4Q8EA 1S4FA 1IJEB 4QWCA 2R93A 3POTB 3JB9k 3HLUA 5F3TA 2BYCA 1LXJA 4AAYA 5L39A 2IV2X 2NSCA 2MGZA 2N7YA 2I2YA 2LEPA 2FTRA 2ZH8A 1H2UX 1LWEB 1TV6B 2GC8A 3MDFA 4HI2A 1ULRA 1X5SA 4WJBA 3I0RA 1Z2ZA 1N5QA 3QC8A 2ZFHA 1OGYA 3WC0A 2VQFF 4KHPF 2N3OA 1LWFB 4CQ1A 1HBNA 4DR7F 1VC5A 2LDIA 4WIIA 2YQ3A 1W2IA 3U7JA 5HQ8A 2OSQA 3IR7B 2MB0B 1C1CA 4KBIA 2IRXA 2NS1B 1TKXA 2EFGA 4EGLA 4URQU 1SJ4P 4CI0B 2PT0A 4DQSA 2E5GA 2W24A 2Y1RI 1SL2A 5A2QY 1S1TB 4FNIA 2R7WA 4NL5A 4OJ3A 3V6KA 1HFEL 1VQPS 1GXLA 3NAIA 4F50A 1KLMA 2GCFA 2UXBF 1K0VA 1UHDA 3E3XA 4EO8A 3CD6S 4EZ6A 4AL5A 2WSCC 1S1UB 1WACA 4QWEA 4D3HA 5GAEU 2ADCA 2OPQA 2XLIA 3CZBA 4AQYF 2IMWP 3OUYB 4A8FA 3DOLB 2W25A 3H59A 2LU2A 3PRBA 1N8RT 4DV7F 2HHVA 5KFOA 4UUXA 2EWHA 2PGCA 4C3KA 2YNIB 2KJVA 3M1VA 4Y0FA 4YR2A 1VQOS 4IRCA 3SI8A 2V4RA 4MYTA 1NO8A 3HHLD 1XEZA 1M5VC 2V3VA 2JX2A 2BA9A 1VHFA 2LXIA 4OLOA 1VQ7S 5DG9A 2I9SA 4PQAA 1HNVA 4EYHB 4FXDA 2YNHB 2A6ED 1CSJA 3KNAA 1ZH5A 2MQNA 2MKJA 3L7OA 2DGUA 4O44A 1XERA 2L48A 2QA1A 3T5LA 1XTZA 1WNEA 4N47A 3KG0A 1JMTA 3TP2A 4QBUA 1DRZA 1OIAA 5CCLA 2RQCA 1C2PA 3I82A 4A8OA 4G1QA 3GV7B 1DMRA 4Y65A 2Q6BA 2RDIA 4ECYA 4PXBA 5CQGA 1DQAA 3OR2B 3ML1A 4YDXA 2KB2A 4Y2KA 3C46A 5CXTA 2BUNA 1MROA 1SJ1A 2DRAA 1BQMB 3P5TL 3CJKB 5LXRA 1T95A 1J5EF 1PSDA 1IKVA 2UUAF 1YJ9S 1C1BA 2NQPA 2WOMA 2WBRA 3OTEA 5DLGA 4J9QA 1FKOA 3NS5A 1SJRA 1QE1B 1Q86T 1B64A 5KTQA 1LKZA 2E66A 3K8WA 3T9ZA 1K73T 5KT4A 4HH0A 3KMSA 2K7KA 3ICLA 4UY85 4FYDA 2DIUA 3AJ2A 3I31A 1ZAWA 2V4QA 3K5LA 2GIQA 4OQJA 2GQ2A 1IM4A 1SH3A 4OX9F 3SQGA 3UI3A 3HPOA 2V94A 1U45A 2UXDF 2IYGA 3KOAA 2AX0A 5J2PA 5G0RA 2J0XA 1WCMA 2WAQD 2BJEA 2F1FA 4OHXA 2E5HA 4DSEA 1SBRA 4JI4F 2CPYA 3PKYA 3FRZA 3BN7A 3E51A 2RIJA 3K5MA 3QAEA 1E6YA 1UKUA 3MMBA 4DSKA 1FDIA 5KG6A 3MTKA 1K83A 3NNHA 3CJ0A 4R25A 4WE1B 3DYAA 3H20A 2PMZD 3MOZA 1TKTB 1WEYA 3KLEA 2CJKA 2AGQA 1LWCB 3MOJB 4PPDA 4ECWA 5KFYA 5K14A 5DM6Q 3LGNA 2E1AA 5KFCA 2CQDA 3EGZA 3FQLA 1ZETA 5FTKA 1K8AT 3KLFB 2HQ3A 1ZPVA 3O44A 2LA4A 2M52A 2H9ZA 1T03B 2BOPA 2QO3A 5ADZA 4Y6IA 2AD9A 1NH8A 3MM5B 1FRXA 4OZ5A 3B4DA 3PKMA 1TWCA 4DV4F 3S1TA 3MEEA 2DTJA 2XZWA 4PXEA 3P96A 3SV4A 1FD8A 4DN0A 1IBMF 2IJNA 1HR0F 3TUIC 3D0GE 1U6FA 4YB5A 4DV1F 3HHNB 2NVYA 2D9OA 1JLQA 2J8AA 1NK9A 2J7WA 3I6PA 3DOKB 3GYXB 1S97A 2HWTA 3FVYA 1YJTA 4LSNB 2LVWA 3NBPA 2MMYA 4YB6A 4MFBB 5HI7A 3CCLS 1URRA 1U2FA 5J1EB 4NLPA 1WHXA 4DMZA 5L1IA 2UU9F 4CO0A 1VK3A 2F9DA 5KT2A 2R92A 1ROFA 3EPGA 1UW4A 3B82A 3I5CA 1DTQB 2VKRA 3QIPB 4CTAA 3V6HA 1S9GB 2QA4G 2NAPA 2VPYB 2MXYA 3X1LB 5C24A 3V81B 4Y2AA 1TUVA 2IMOA 2CPEA 3CF5Q 2DR7A 2BXJA 4C3MA 4TLQA 5B08A 4AE5A 5JXSA 2CPXA 1BY9A 2ZM6F 4M95A 2JLFA 1PQHA 3CSKA 5F3ZA 1VOMA 1FNXH 2MZRA 3HHDA 5B09A 2D74B 2KXHA 4ZP6A 2DB1A 3OLBA 1ZYQA 4LFCF 4GO7X 1HI8A 3O3LA 4G1IA 1H38A 2ZD1B 5JJBA 1N36F 4YOEA 3BDEA 2JC1A 3NL0A 1WHWA 2KT5A 4DL7A 3FFIA 5I4MA 4TKTA 3QJPA 2AJFE 3PY8A 4IDKB 3MM6A 2F3JA 2IJFA 1FTCA 1JKHB 4HL9A 5IZHA 3SZ2A 1C4AA 3R5AA 2JVRA 5FIIA 2O66A 5HLFA 3HHKA 1U24A 5F8IA 2HS4A 3OTCA 4X4NA 5M2RA 5T7LA 1U1QA 1PQEA 3ZZ0A 4X4RA 3RR8A 2FY1A 3CWJA 3TR5A 2RB7A 3SMZA 4EWTA 2KZMA 3VR1A 1G7CB 2BACA 5DYGA 3GFXA 1Q8BA 3TAMB 3ENVA 1FKOB 4JI0F 3VQSA 2IA6A 2VA3A 4ZP7A 2HRUA 2DR9A 4F2SA 1VQ4S 3AY0A 4MKBA 1QDNA 1A6LA 4O4GA 2DCUB 2MZSA 1N5VA 5F9LA 3QYYA 1SXLA 5JUMA 1SKWA 5KG3A 3HVAA 1BGXT 3VTIA 5HP1A 1QAJA 5FTMA 1AROP 4MIWA 4JV0A 1X4AA 5A6WA 2XGPA 3VAJA 2DJWA 2AYGA 2KYZA 2N82B 1N88A 4J9OA 4NYOA 1FJGF 3ZFVA 5KFDA 4CO4A 3RB4A 4DX8H 4DSFA 4CH1A 4M1KA 1VQKS 4OJ1A 1SL1A 2G1DA 1VIXA 3IRXA 4JI6F 1D1UA 4NYPA 2L41A 4O4RA 1XNQF 5T14A 4KJIA 1XN9A 3DRRB 2Z2MA 5CZXA 5C24B 3T6BA 3MMAA 3GIMA 3KLIA 2G9OA 3SSQA 1VRUB 4DFPA 1I50A 1TKTA 3KLEB 2DBBA 2VG6A 2B56A 1SUQA 2QLXA 2VH7A 1HD1A 1NU4A 2XY6A 3NNAA 4R0JA 3PJXA 2XLJA 3OXFA 3M8RA 4EO6A 2CPDA 2JA5A 2JZ5A 4M94A 1VK8A 4KPYA 2YNGB 2CPHA 5D78A 2D3UA 4IH6A 4DQQA 2R8KA 3DI6B 4ALZA 1Y4ZA 4MKAA 2B7CB 1QSLA 2BV3A 5D77A 1S7HA 5KFIA 3MFHA 1TKZB 1CC7A 3OTBA 2VG6B 2Z0GA 4FS1A 4I1TA 3JAMY 4I2PB 3O1LA 2YKAA 2ZITA 4QPXA 4D7ZB 3PIPQ 3NLCA 4FXWA 1H2VZ 4OX6A 4Y2IA 2DGQA 3UD4P 1IR0A 5KG4A 1RQ0A 5K8NA 3TW0A 1VBZA 1C0UA 4TU7A 4NLVA 2HFZA 2CQ1A 3RB3A 2B6AA 4DQIA 2HRYA 2BZ2A 4PQUA 2B9YA 5GAEI 1HQUB 2ZH4A 4IR9A 4NA1A 2XMMA 2ZKTA 4OMFG 4ZOSA 4EU0A 1CR5A 4ZA1A 1D8ZA 2OKQA 2MGZB 4QWDA 3E01B 4NLDA 3R1LA 3OVBA 1HBUB 1VGYA 3SDEB 2BJDA 3J80Y 1YHQS 5CYQB 1J5OA 2HMIB 3MM7B 2Y1IA 2K2PA 4KR0B 2ZE2B 3LALA 5K5MA 3P3DA 3LO3A 5A8RB 3GSDA 3I0SA 5L8RC 1HBOA 3M30B 2E7ZA 1GXUA 4K59A 3E01A 5G0RB 2EG1A 3LWLA 2ZH7A 1SV5A 5GMKa 2OIHA 3DLLQ 1VIOA 3DGPA 3GIIA 3MM5A 4YFUA 1SIZA 2WB1A 5KFRA 1K1SA 2R8HA 1RK8A 3AA9A 2KM8B 4C0BA 1D3WA 5DETA 5D3GB 2G4BA 3M8SA 3DU6A 4Y2CA 1I94F 3TANA 2O5JD 3DLGB 3W2VA 3P6YC 3HT3A 1GQEA 3OSPA 1KC8T 2MZ1A 4RNHA 5EX0A 1URNA 2ZVSA 3H5SA 4MK7A 1RT5A 2ZOFA 3IC1A 5DGBA 3DLBA 4MTPA 4B3MF 4KKOB 2I8EA 2KFZA 2COLA 2PDAA 1QAIA 3Q24A 4C8YA 1TKZA 1BQMA 5DG8A 4FP9A 2YX1A 1JLCB 1S1XB 2ERRA 2KN4A 3MM9B 4DV6F 1NK8A 2DNYA 2HQIA 2IRYA 3G8SA 2L3MA 1R8AA 3IS9B 2GMLA 5KFMA 2VFSA 3KHGA 1X9WA 4YDDB 2ZE2A 2JFKA 2KRRA 3PFEA 4X4TA 1XMBA 3M6VA 4RBVA 4UOCA 2MDAA 2J9DA 4AOKB 1CZ4A 1D8YA 2DNRA 1SUQB 5E3CA 2YKMA 1H5NA 1GX6A 3SQGB 5D4PA 3KHRA 1VMBA 2IVFB 2QIFA 1V3RA 1EP4A 4WU2A 5J2QB 2CZ4A 5B0GA 2RILA 2ZH5A 2R8IA 3RR7A 2XWXA 2V9KA 1LW2B 2IC3A 3KLFA 3IRXB 4WFAQ 3KLVA 5AE1A 2CQPA 2EPIA 2VG7A 2E44A 4P7VA 2EEOB 3MFIA 2LCWA 3MGJA 1RAJA 2F7VA 4DQRA 2LQBA 3OVSA 1QSSA 1TWGA 4M8LA 2V8HA 4LVOP 2AE0X 3CMES 2JIMA 2FUG9 1Y5LB 1JK9B 1QAYA 4RW9A 5DDPC 3M32B 1SJQA 2DPIA 3BS9A 3MD3A 2VBYA 3FFIB 3RAXA 2VPXA 5B6CA 2CQBA 1UWBB 2HPUA 2VB6A 1ZTWA 1YIJS 4LT6A 3MUMP 3HVWA 4NLYA 1SFOA 1Y00A 4ZPBA 4ZP9A 3W2WB 4X64F 2QFJA 4UY8T 1UVMA 4ZHRA 3DMRA 1C0TB 4ID8A 2LQ9A 4K4XA 4O3SA 3CDEA 4V19X 2UVWA 1G8KA 3OXLA 3KK1A 2HIQA 3N01A 1PC5A 4AYBD 4PXCA 4ILRA 4V19J 4PG6A 1JX4A 4NCGA 4E8UA 3LF0A 3H5YA 1CQNA 2QMXA 2FC9A 1O51A 1TK0A 1HMVB 3UCGA 2AJ0A 1HBMB 4ELUA 3GFZA 2I1RA 4Q0BB 3LOUA