4NOHA

1.5 angstrom crystal structure of putative lipoprotein from bacillus anthracis.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
ATGIVMYGDETGVQQTMDQYKDKIESQNKFEAKLGTVNEKKVLIMNKTTAEKMVKENMLKKVVKEDVEPIKALPAISDEAGIVFAKEEQKDVVIDGKKMKYEGNVVIGDARKYTDMYAVVSDAEYAKISEPVKTIGLASFKENPKEKIFPDIKRGSKVEEAHMVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.5 Angstrom Crystal Structure of Putative Lipoprotein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Lipid binding protein
molecule keywords Lipoprotein, putative
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17294 Lipoprotein_22 Uncharacterised lipoprotein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.60 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4nohA02
3.30.70.3060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nohA01
4NOHA
chains in the Genus database with same CATH superfamily
4FYWB 3POTB 3PZPA 2IJNA 4RW8A 1F6TA 3IG1B 5FIIA 1MWQA 4NCGA 1NPKA 1X4AA 4ES2A 1NSKL 1U02A 4KPCA 1XR6A 2IVFB 3G96A 3VALA 1Q5YA 1IR0A 4O3PA 2ZHAA 3LPEA 4WIIA 4AOKB 2HVZA 3MM8A 2VQEJ 2HQDA 1R8CA 3AOAA 4C9DA 1TAUA 4DR5J 3HSGA 4UW2A 2ZOFA 1P9QC 2LU1A 5KFOA 2A6HD 1R8PA 3DDIA 1WSRA 3VAJA 3D54A 2ILZA 4J9SA 2J0QD 1DLOB 1RTIB 1T9VA 1V3ZA 3P5TL 4RKUC 2DMRA 3M7VA 4M5NA 2VFVA 1RAAB 3VAIA 1TL5A 2V8PA 3RBEA 1VBZA 1NB7A 1RT4B 1HQUB 4OYXA 1TP7A 4A8XA 4WFAQ 2UUCF 3VTIA 3UCGA 2D41A 1CVJA 2R42A 1OJ4A 4I6YA 4C4WA 3RU0A 2HLUA 4FP9A 3CPWR 4DUYF 3M8WA 3KMSA 2EPIA 2V34A 3OFEA 4F4AA 2Y9HA 3A4TA 1N54B 4ZN3A 5DDPC 1IVZA 1TK8A 1HWKA 3BGLA 4USIA 5KFYA 2CADA 3GR0A 3R27A 3ZZUA 3FEZA 4Y2IA 3H25A 4P7TA 3H2VE 3NNCA 4KHRA 2E7ZA 2GJFA 3L09A 5GMEA 5KFIA 2DXFA 5HMZA 1GXTA 2E5GA 1IKVB 1EP4B 1N5SA 2DHSA 3LUYA 2ZM6J 1FXLA 1RWMB 1S49A 5J2QA 2J7WA 4J37A 4P2FA 2D3UA 2XNQA 2XB2D 4NLUA 1RKIA 4M5HA 2UUCJ 1S4EA 1OGYA 4DPXA 4JI5F 3DLGB 4G65A 4OZ5A 4LVNP 2DBBA 4C6AA 4M5DA 1L3KA 5K8PA 1XK8A 3X2OA 3CDEA 1Q8BA 1VISA 2EFOA 1FD8A 1S0NA 3KLIB 3DOLB 2V8DA 4QIVA 1KOOA 1ZOTA 3TVZA 4AVRA 4HHJA 3R1HA 4ZS6A 5GLXA 2Z4PA 4MK7A 2LQ8A 2DHAA 3KDNA 4QR0A 2DR9A 2BQRA 2AYEA 4OZ0A 2CPZA 2DVIA 1RT5B 2AEJA 1N34J 2HHHJ 4LR8A 4I69A 4WXWA 2X1AA 1WUUA 1FERA 4QCLA 4WP3A 3UNYA 4AYBA 3BBFA 3BH6B 3DMJA 2YWGA 3R5DA 4GRSA 1DLOA 4DV4F 2J0SD 1UEVA 5IT0A 3V6KA 2C2MB 1VIXA 5KG1A 3CJKA 4P73A 4C97A 2RS2A 4LF6J 2DCLA 3KTQA 2KI8A 1IWAA 1RLDA 3CMQA 3LH2S 2ZBCA 3L4BC 2BQ3A 2OELA 4YN3B 3V2UC 5A8WB 3R8YA 3GILA 2WVFA 2G6GA 2VPYA 2YNIA 4YEAA 4DOZA 2DHGA 5C5JA 4YR0A 5KFKA 4X4PA 3MEDA 3ZTPA 3IG1A 4LF6F 4TY8A 4FF1A 3KMQA 2B6AA 4J91A 2HG4A 3UDLA 2FJEB 1SQEA 2OMOA 1WDTA 3GJSB 1FRHA 2J6SA 1FJGF 4CO2A 3L7OA 3DOKB 3O8WA 4N5SA 4DFMA 4AD6A 1YJVA 2BANB 1HPZB 1AUSL 3GJTB 3H90A 4LUBA 1H0HA 2WVEA 4OX7A 4ZN1A 5LXRA 3CDAA 2HQGA 5J2QB 3H5XA 3KOAA 2QL5B 1VRTB 2Z0GA 4P10A 4P6QA 2UU9F 4D3HA 2V8HA 5ETQA 4K8RA 3W7BA 1HNZJ 1OIAA 1YVFA 2F4FA 4A4JA 3V81B 2I0XA 2Y0SD 2LECA 2FZKB 5JUMA 1F60B 1Z1ZA 4C3KA 5J2MA 2E44A 1UCNA 4QU7A 4X64J 1H2VZ 1TKXA 1APSA 4F3MA 1WACA 4GC7A 3SULA 2CNOB 2HGMA 4NA1A 5E3CA 3LP1B 2AT1B 4OV1A 4CLWA 2E66A 3ETOA 2AJ4A 1N5VA 4ID5B 3PJWA 3BM7A 1Y5LB 2YH0A 1FRKA 1TKZB 3SUMA 2O5DA 2M9KA 1YTYA 3MECA 2QA4G 1EZZB 1XEZA 1RWVB 1HMVA 3R9LA 1HNZF 2HHTA 1D9DA 2V68A 3HKZD 1A9NB 5IOLA 2CQ0A 3M6XA 2P6SA 1KEKA 3HVTA 3QO9B 4ECSA 1PSDA 4RPFA 3FNNA 1S12A 4R8UB 5ETLA 3PKYA 1M1HA 1SJQA 2OSQA 6AT1B 4NLRA 4HH0A 3CWJA 1VQYA 2BYCA 2QMUB 1SC1B 1AW8B 2PC6A 4X66F 2W2QP 1N52B 1RBOB 3EPGA 2B6AB 3H98A 3X1LB 2EFVA 3W64A 2YNGA 1IR2A 2HGNA 4ECXA 3P45B 3TI0A 1C1CA 2D9OA 2LLZA 1XMOJ 3F73A 4ICLB 1KQFA 4LFAJ 2RUSA 4NA2A 5DLGA 1F5BA 3BSOA 2HQFA 1FE0A 5B09A 4ECRA 2FVPA 4F4YA 1X0PA 2XZDB 3AAWB 3BEGB 3CE8A 5SZTA 3FCVA 3KLFB 3KHGA 3EZ5A 2ZNZA 3GV7B 4B3OB 3S8SA 3M9NB 2MY7A 4I6AA 1QCSA 2RQ4A 4OZ1A 2XY6A 1Q86T 2CUYA 1F5CA 4KGXB 4ECWA 2DNPA 2R2UA 5KOXA 5HI7A 4DSIA 1FXDA 1HKAA 5KT7A 5IWAJ 4JYAF 1HWLA 3DLLQ 2YKNB 3EMTA 4MYTA 4YB6A 2Y8WA 4IFVA 4RR5A 4J9OA 1UVKA 2M3DA 5HL7Q 3W9HA 1UEUA 2JJ4D 5DG7A 1AT1B 1ZZFA 2ZBQA 1SKUB 1GAOA 4ELUA 2Q1LA 5CABA 5J2NA 3OHAA 1OQ6A 4DHVA 1VJQA 1V3SA 1NKBA 1WKLA 2F4VF 1FWLA 2HHPA 4Q0BB 4LFBF 2IVMA 4KQZA 3T9ZA 1BQNA 5M2PA 2MKSA 3SUJA 1QSLA 1X8DA 1JLAA 4G1PA 1R6YA 2HCZX 1RWXB 1WORA 3CO9A 4NX9A 1IM4A 2OO4A 4WE1B 4Z37A 1PQHA 1RT1B 3EYZA 3M8YA 2FJAB 4A8QA 2DCUB 3GP9A 4MKBA 4CLUA 3HK2A 3EVWA 3M6UA 4OHVA 3ENWA 2JX2A 2VKZG 2ZBIA 5J2MB 2YU9A 1RI7A 2RDIA 2WBRA 3FMBA 1S9GB 2Q43A 3S6EA 2ZM6F 3F0NA 4J90A 6FDRA 3HZEA 4O3QA 2FUG9 2CPEA 1K83A 2DNGA 4IRCA 4PCQA 1SL2A 4PXBA 1F5AA 2HFNA 4HACB 4LF5F 4C2MA 3UN2A 1FFWB 2JVRA 3C3LA 3R7BB 3W2VA 2IAJB 2E1MC 4U67Q 3D9BA 1ZS6A 1WEYA 2E1PA 2QJ3A 3LOUA 4O3NA 4DV4J 1N0VC 4X4QA 3HZGA 3MM6A 4FDFA 4LVOP 2AGOA 3W3SA 3X2IA 1YK9A 2RSQA 2CJYB 2IJRA 2RDDA 4NRTA 2GVZA 3BQ1A 5D3GA 2ZBRA 2B9WA 3PYFA 1TTHB 4OI1A 1H38A 4Y2AA 2VL1A 3NCQA 1HBOB 3OR1A 3SDEB 4BDPA 4UF4A 1CS4B 4YHHJ 3QC8A 1ULRA 2V2QA 1KDNA 4ED5A 2R7UA 3CJRA 2GVZB 2DJWA 3X2PA 2QLWA 3DU5A 3HSJA 4DN9A 5IV3A 4OZLA 4RLEA 4J9LA 1UVLA 1Z4UA 3IA0A 4LIRA 4DLEA 1YJRA 2APOA 2C3MA 5A8RA 4DL4A 1NK5A 2MHEA 3HKWA 3LO3A 3D6FB 2CQGA 4JP6A 5C1BA 2XHWA 2CA9A 5T7LA 3D5MA 3KLGB 4J9RA 3M30A 2QA2A 4FBTA 4J9VA 5LMNJ 1V6HA 2AJ1A 2DITA 2HZCA 3ITHB 3UQSA 4QWEA 1KFSA 1IN0A 1OQ3A 2IBOA 2FHJA 3C6TA 2BE9B 2W9BB 2IHR1 1IKWB 4RJVA 5K14A 5KG3A 2PGCA 1IJEB 2XG8A 4I68A 2IA0A 2LA4A 5KFPA 1U6ZA 5E3RA 2MEWA 2OPSB 1NXIA 3R5GA 3RYLA 1DBDA 4Q44A 3T1HJ 4U8YA 2IA6A 2JEGA 2NXCA 3OR2B 4UOGA 4KDLA 4FVCA 3VGUA 1Q79A 5F8IA 1UL3A 5F9LA 5DDRC 2W9BA 1XMOF 2C3YA 1V9OA 5KT6A 3H5YA 5KT4A 4YMEA 3MM7B 5HQMA 3D28A 1M5VC 3AXKA 2ZVSA 4B02A 4I4BA 4IG0B 4UZCA 1K1SA 1I1GA 5D78A 2OPPA 4ZHRB 2HNDA 1HBMB 3PW2A 2XNRA 3L7PA 4C3LA 1REGX 1NUEA 4ZPWR 4CO5A 2Z58B 4F7VA 1HL6A 4TU7A 3MR6A 3OFFA 1QUPA 4NPOA 3QIPA 2E5HA 4XAKA 4CQ1A 1Q5VA 5FD1A 2J9DA 3ZZYA 2B8QA 2IM2A 2ZE2A 1H2UX 3TA2A 2ZH7A 4DQSA 2UU9J 1PIEA 2X3GA 3PJ9A 3KHLA 3LGHA 3SDEA 4ZMMA 3EPIA 1RHQB 3MR3A 4AT1B 4X65J 3BGRA 2LDYA 4F2RA 1FDAA 1YKWA 3H5SA 4HDHA 3OW2R 3CO0P 1FA0A 4USKA 4DU7A 5A2QY 1SH0A 1VK8A 3G82A 5EWGA 2GMLA 1JLGA 1HBNA 2PMWA 4OYZA 4PXEA 3QRRA 3G8SA 4KHPJ 4ZJLA 5LOQA 1PBAA 3UCZP 4NZ0A 3W2VB 1A6LA 2HRUA 2EXUA 4F0KA 3ET6B 3QLHB 3V6DB 4KAIA 4O44B 3BGUA 2A6OA 3CXCR 4KPYA 4FG2A 4MTPA 1OPZA 4ED3A 2AMCB 2VG6B 3GCXP 4DL2A 5CQGA 2F63A 4Y2CA 2RHQB 1Y0HA 2H5EA 1UZHA 3MEEB 2DH9A 2J6TA 3BDEA 3DHWC 2WSFC 3H8YA 3EGVA 4U9RA 2YUJA 1EX8A 1JLQA 1XC9A 2Q3PA 2MKHA 2OD6A 2BJDA 3MCOA 5HMWA 2GAGC 3DLJA 1U4BA 1X4DA 3CJQA 2PEBA 3MM7A 4HHUA 2J8SA 5D0GA 1RACB 2W24A 3C15A 3HHLA 2PD1A 1LWCB 1R6VA 2W7AA 3JQKA 2CQ4A 3M1VB 3MDFA 4TN2A 4ED4A 4DV1J 2ACYA 3UD3P 2LQ9A 3DRYA 1VLOA 4O23A 4L3KA 4PG5A 1T05A 4DQPA 1KN6A 5LSOA 2JA7A 3HCXA 1RWNB 5A0YB 1FDDA 2VDIA 1TK5A 2E1CA 3GYXB 4ES3A 4Q45A 2HWIA 3EM1A 4IRKA 1JMTA 2ZE2B 1QD1A 1E6YA 2Y3YA 4PABA 4C3MA 3K2YA 3A8KA 4MK8A 5D0EA 1YG0A 4ECVA 4NZ6A 3UR0A 2AWZA 4NLPA 4X4VA 2CJKA 3PW7A 1OPIA 4PWDA 4Y6IA 4Z7YA 2DO0A 3RTVA 5IS2A 2HURA 4EZ6A 4USJC 4LJMA 3THVA 2B3TB 1PYSB 1M5HA 1RHRB 1UJ5A 2MQ8A 1RHJB 3IS9B 5J1NA 1UA0A 1OSDA 3IC1A 1HR0J 4V19J 2HZVA 4RW7B 5IT4A 1XN9A 1RCXB 3GTYX 2PFFB 3ISZA 4JYAJ 2R92A 1WG1A 2I38A 3GV5B 4ECYA 1TELA 4DFKA 4OX9F 2G5DA 1LFWA 1S0OA 3HSDA 1LQ9A 3EUNA 2VPWA 4DUTA 2ZZTA 4A8WA 1BQMA 2KT5A 4DFJA 3AOBA 1QVFR 3FSYA 4RW9A 4RNMA 4DR4F 3Q24A 4A8MP 1DARA 5L1IA 2EKYA 2ZITA 3NEKA 3MWBA 2FHOB 4KC5A 4PPZA 4FNIA 3GWCA 4R0EA 1MLAA 4WFZA 5C25B 2E5IA 5JVGQ 1X0FA 3PO4A 3N01A 1W25A 2BJ3A 5F3ZA 3HHNB 2I5JB 4WWSA 1FRIA 2YY3A 5L8RC 5DZ7A 4A8OA 4ED2A 1U2RA 3SQOP 1TL1A 1AA6A 2AX1A 2VPXA 3AD8C 4NLDA 3L7UA 3CQZA 3LGMA 5IQQA 2F9DA 1SCJB 2E9ZA 2NQPA 2EBGA 4LR7A 2WCXA 3OT9A 4CH7A 4DSEA 2UVRA 2JIOA 2NVYA 4TY8B 4CH0S 4LF1A 2JH3A 1M5SA 2AGQA 2MJUA 3AHPA 2VPXB 1KVKA 3EZOA 3TOQA 4DV6J 1HHSA 2EKNA 1T3OA 4ZVPB 4YQWA 2B4OA 2UXDJ 2L08A 1QJHA 2Q6CA 2B43A 3D1HA 1CJUA 1OYEA 4ZVOB 1P1LA 2RHSB 3ZNUA 4F36A 3MR7A 4QOTA 4RZRA 1MROA 2COLA 3EJMA 1B4SA 4DR3J 3HD2A 3KYLA 1A0OB 4QW9A 3BF4A 2ABYA 3CTRA 3KG4A 3QWUA 1HWUA 4C8MA 2OPQB 4URQU 1RT2B 4TLQA 2WVBA 1KNZA 4R5PA 2LEBA 2DNMA 4ZPTR 2XY5A 1VJWA 3H59A 3W5XA 3BGFA 2HNZA 2MKIA 3R5AA 4QWCA 4DPOA 5LJ3Y 4XIUA 3DXBA 4MFBA 1NSPA 4CLTA 2GJ2A 1FVSA 2Y0SA 1RBLA 1TKXB 1BW3A 3JQJA 1CULB 1JLEA 4Z7CA 2LFVA 3O6QA 1U1PA 2CFXA 3J7YU 3J7A1 3KUHA 1NEEA 1URNA 2K7KA 1EB0A 4LF9F 4QZVB 4U7UD 2KJVA 1FEEA 3BO2A 4GA6A 8RUCA 5HLFB 4KHPF 4DU8A 3E01A 2R2SA 3MCSA 4HI2A 2CG4A 4USHA 3G86A 5H9FK 3PYGA 4Q8FA 3KFWX 1W2BR 2C1EB 2ROGA 4P52A 3H4BA 3AH6A 4ZPVR 4V19X 3P96A 3CCTA 3W63A 2VFTA 1QTMA 1VQ9S 2J6UA 4FN5A 5DRKA 3VF0B 4ZVSB 3CCUS 5BYSA 4DL5A 2XSFA 2ERRA 1TU0B 1SL1A 4KE5A 1D8YA 2QA4S 5D6GA 5H9FJ 1I3OB 2V4JA 4ALZA 1KQGA 1X4GA 2KYXA 4USUA 2NR0A 5KG0A 2W01A 2WAQA 3HJVA 1LXNA 1P1TA 2A18A 2RD5C 5MAOA 2VPZA 1ZC1A 3MM9B 3M9MB 3K59A 2DEJA 3OXGA 2RRAA 4ZP6A 3ISNC 1KTVA 2WHOA 5DS7A 2XI3A 5DO2A 1SKRA 4E2FB 2UZAA 4GVBB 1X60A 4Q2MA 3RRKA 3S1TA 4KFBB 2PNWA 4HKQA 2CIMA 3DDNA 3IGVA 3HU3A 1P8GA 3RAMA 1UETA 2PSZA 3TANA 2FJXA 4OZ2A 3CMAS 3X2KA 1JLCB 3MFIA 4NEYA 1VDHA 4YB5A 2B63A 1WG4A 3R6LB 3QT7A 2GVDA 4HT5A 4NRUA 1BQXA 2ENGA 1N33J 2CQIA 2V8GA 2PDAA 4CDIA 4WZMA 2RQCA 2HHUA 4NL5A 1OWXA 4PUOB 1H0HB 5EWEA 2HIQA 3VR1A 4L76A 3DFEA 4TLRA 2IV2X 3SSSA 2YKNA 4LSZB 5LMUJ 2C2ZB 2HHXA 3MMCB 3LW5C 4QYZJ 1PJ7A 3I5AA 3VQSA 3RBZA 5A2QU 4ZPBA 3FEYB 2HAFA 1S9FA 2M7SA 3T1AA 3TZYA 3TAQA 1WEZA 1FRMA 3QGGA 1YITS 1VQ6S 2CJXB 5CZVA 2AW0A 5K20B 1UZDA 4LFCF 3EXYA 4EO8A 2V4RA 3LPYA 4KYZA 1NCLA 3W9JA 4UT4A 3OSPA 5HVHA 1DURA 5JMNA 2WW4A 3OTOF 3DN9A 4LF5J 4QQBA 1HQ2A 3TQEA 3RB4A 2ZH1A 1RYRA 2YKPA 3NS7B 2XZTB 1FFGB 3CNQP 5BR8F 4DV1F 4U7CA 1RT2A 4QIWA 2Z30B 4FVMA 4U6PA 3RBXA 3Q22A 4DFPA 5ETOA 3PW0A 1NK7A 4N41A 5AJ3F 3R5JB 2B7CB 2BKNA 4G6VB 2ZH4A 4ZLLA 4NLTA 4FS1A 4W90B 2AYGA 2WW8A 2POKA 1F9HA 4RO0A 2EEYA 2PEHA 2JNJA 4ID5A 3RAQA 4JJOA 3SV4A 2D3O1 4F3OA 3C2PA 4ZCIA 5THWA 2KHDA 3FKBA 3T5LA 1HNXF 1MU2A 1JLBA 1VRQC 3BBBA 2AYMA 1IKYA 3ZFVA 1TMJA 1WOOA 1N8RT 3GTQA 1U49A 4DI6A 5IQ6A 1ZZNA 3D0HE 1VC6A 3DMJB 1G7CB 3HLUA 3GQCA 3H2LA 3JXOA 4KO8A 1LEOA 2ZHOA 5KG5A 3QZ7A 3GIMA 4O4GA 1IBKF 2F1FA 1WJ9A 2XSJA 4JI5J 3IAS9 3J7YI 4DV2J 4Q43A 1WC3A 2QFIA 2R9LA 1UEKA 4RWXA 1UJ4A 3GTLA 3I4HX 4CT8A 1HNVA 4PUOA 4IO1A 5E7OB 1SKSA 2VU5A 2C3OA 1Y00A 4F4ZA 1YI2S 2ZNYA 1V3RA 3ILIA 1UHDA 3MM9A 2NREA 1WKJA 2Z56B 3F44A 2V63A 2FIUA 4DL3A 2PI4A 3J7AN 1RYSA 1HHTP 4M95A 3QT5A 3MPDA 2KM8C 3KLFA 2C42A 2CVIA 2M70A 3KK3A 4JI8J 3QJJA 4K50A 1MSWD 2G2YA 1UKUA 3BZQA 2B4PA 1RA7A 1HPZA 4FKYA 1X4EA 1MWZA 3HHEA 2HFOA 5E3AA 3ICLA 3ADAC 2HVHA 4XPEA 3KLEA 2CJQA 1SUQA 2BMBA 4OX9J 1CJVA 2CQ3A 1F3FA 1RWPB 2VC0A 3N6LA 1GMWD 2B5JB 2MQMA 2GO9A 3U02A 4YY3F 3QQCD 2VZ9A 2EC2A 4I67A 3MMCA 3EVOA 4JS7A 3RB0A 2ZKUA 3IR5B 1RE1B 5IV4A 2J7UA 1R8HA 4B3SF 4FFTA 3TVKA 2R7XA 3VAFA 4DV7F 5C24A 4CLZA 2GS8A 1SJ1A 4ELTA 4H4MA 1TKTB 2B9XA 3GFHA 4HTIA 2QIFA 2UVWA 4FXWA 1P9YA 2UUTA 3TA1A 2JFDA 3GFZA 2FD2A 3E51A 3V4IA 4G3IA 1M1KT 2FLOA 3GYNA 3PW4A 4EFAC 1JQGA 2AKWB 1S9EA 2GX8A 5HQ8A 3CJ4A 4CNYA 4ZP8A 1VLYA 1VQ8S 4LF7J 2MLXA 4NCAA 1YRXA 5KG7A 3PFEA 3UNGC 3AJ1A 3DLHA 2XYPB 4WJBA 5ETSA 3TP2A 4K4XA 2O3DA 1DJ0A 3CVKA 5ETVA 5G0RA 1S72S 2LQBA 3MUMP 2OEKA 5T7LB 5B0EA 3LWLA 1T8EA 3OL7A 4DLGA 2P2CB 4MK9A 3I31A 4NASA 5MLCV 1CS4A 4K4WA 3A3NB 3UVJA 5D4OA 1FO1A 4X2BA 3W61A 1IKYB 2XBPA 2XZWA 3DRPB 1FTRA 1LOUA 3ET6A 3QLHA 4CWBA 3HVTB 2CZ9A 2BE7D 1YBAA 2H65B 2ZD1A 5KFDA 4X62J 1VR6A 1C1BB 3TX8A 5GLYA 1K47A 2GQCA 2E7WA 2WRMA 2AE0X 3JTNA 3QPIA 4RX6A 3UPFA 2NZ4A 1Y4ZB 3GONA 3H7HB 4ES1A 1GXUA 4M5LA 5J1EA 3T1YJ 1QVGR 2DD8S 3C14A 2CDRB 1BLUA 4AL6A 4ZLJA 1BWVA 5IFMA 3MAAA 3QGIA 4IFVB 5GAHU 2KZMA 1G3OA 3BN7A 4K7QA 2CWKA 6FD1A 3QZ8A 1ZM2A 2HIYA 2FPHX 2BACA 2MMYA 3HT0A 2PMZD 5KFXA 4FYXB 4H54A 4EGLA 4F3QA 4C11A 3CC2S 4FF2A 3H40A 1BE4A 1IKWA 2XQCA 2M8DB 3HT3A 1Q4RA 4TNOA 4B17A 2PE8A 1U1RA 1RKJA 4TYBA 3BQ2A 4W92B 1BHNA 2CPYA 2HBQB 4IG0A 5EX0A 2M88A 3UWTA 4F50A 1HD0A 1NDKA 2RB7A 4CO4A 2E5JA 5BR8J 1IBLJ 3L9ZA 2AJ0A 3ILJA 1VQMS 1TFYA 2CPHA 3CDBA 3TWZA 3Q8QB 2ADBA 1CQMA 1Q81T 2XTJP 5AXKA 2X1FA 1T9XA 3V6JA 7AT1B 2QN6B 4OJHA 4UTGA 1HBUB 2DY1A 4CO1A 2OFHX 3BN4A 2NCKL 3DRSA 1HA1A 2HBRB 4U7UK 3TX0A 3J81j 3KJVA 2YX4A 4RNOA 3IWXA 3M2UB 3HXMA 1SKWA 4PYAA 1M90T 4IG3A 1S5ZA 4K2XA 2DGUA 2IJFA 4D7ZB 1RAIB 1WC4A 2MKJA 2YVSA 5CXTA 4B9VA 4WP9A 2JRSA 4DR6J 1VIOA 2XEXA 3I9ZA 4BBYA 5EGYA 5IM0B 1RTHA 3FSIA 1M0SA 2KVQE 2G0IA 2E9RX 3MM6B 4C98A 3ZZPA 1C1BA 2JWNA 3HFZB 2GAEA 4C48A 2ASLA 2VJUA 2GQQA 2W9AA 2YNHA 4NYOA 4HL9A 2VG7A 3NOGA 1U7LA 2FGOA 2QRRA 5LJ5Y 2ZJQQ 4C8OA 2DH8A 1HI1A 2W2MP 1VQKS 1VQNS 1J5OB 2KU7A 4JI0F 4MKAA 2CYYA 2MXYA 3CULA 3MHYA 4DZ6A 2JC1A 3K5OA 3DI6A 3I5BA 5EUHA 4P72A 5K8MA 2RJZA 3IRWP 2IC3B 4DV0F 1UA1A 4LF4J 3BREA 3P4UB 1NU4A 2FJBB 2QL7B 3MFHA 2NLWA 3BKFA 4PWWA 2VV5A 3J7Z5 2ROEA 3HO1A 1H2TZ 4USMA 1HBOA 3OR1B 1NHKL 3PEJA 5A76A 3NP5A 4Y3CA 9ATCB 1KQSR 1FESA 2DIUA 3ZO7A 2HEKA 3DCAA 4IKAA 1P6TA 3PKMA 1E6VB 1NMEB 2V2VA 4PXCA 4LF8J 2JIQA 1S0VA 1S1XB 2QA1A 1SIWB 4DPWA 1FWKA 3JSBA 4PKDB 2DHXA 2BJ7A 2YKAA 5GAHI 1NK6A 1JJ4A 3DM2B 1TUWA 2KYZA 1B0PA 2I1RA 1REVA 1RT6B 2IMOA 3WX4A 4F4WA 1WNEA 1PAUB 1ITPA 1E6YB 2CPJA 4F4XA 3CZBA 3CDUA 5K5MA 2RQKA 2O5JD 3FMWA 3ZZOA 5RUBA 1WHVA 5BJRA 4F8RA 2JVOA 1HWIA 3MOJB 3M8ZA 2QLJB 4KY3A 5K8OA 2CQ2A 3GFYA 3V5RA 3I6PA 1YX2A 1EQ0A 2KKHA 4TY9A 1NRKA 3IWNC 3QJLA 2AQ4A 2RF2B 4K59A 1KVJA 4I2PB 2WVDA 3HF5A 4ATNA 1Q0NA 3GIIA 1WC1A 3BGOP 2P5VA 3HHKA 5D0HA 2DNQA 2X51A 1IBMJ 1BMQB 1HBUA 2VA3A 2A2CA 5C25A 1R9TA 1SL0A 5DLFA 1X4CA 2MQLA 5GMKa 4WF9Q 1Y3JA 4RW7A 1FRXA 2GMJA 2NPIA 3GMGA 2CJ9A 2QT7A 1RJJA 5AXNA 4NLWA 2DRAA 3SIPB 3GSDA 4YOEA 1TMOA 4RW9B 1EJ7L 3ZTSA 1OSCA 1FNXH 1CJTB 3CJKB 1T3NA 4ZVQB 4DR2F 2FGCA 3J81Y 1NJXA 3NOCA 4HR2A 2O67A 4OHYA 2RMLA 4K4UA 1ROFA 4NLXA 5IWAF 5BXIA 3OJUA 4NI2B 3G82B 5AXLA 1N10A 1KD1T 2PMZA 2CPIA 2CDQA 3D6TB 2WAQD 3UD5A 1SQGA 4AYBD 1UW4A 2CQBA 3UFCX 1EHWA 3NS5A 1BWEA 4QBUA 5HROA 4LSNB 4B3SJ 4W4MA 3C6UA 3TIWA 2F8EX 4UOCA 3WQPA 2JZ5A 3OTOJ 5CYJA 3EDRB 4ILLA 3MGJA 1LFPA 4QWBA 1GK8A 1HW8A 4J7CA 1DMRA 2K2PA 2IDLA 1WSVA 2X1GA 2DXEA 4BC7A 2ZBPA 4A8SA 2ATCB 1VC5A 1VRTA 3QRQA 4QYZK 1VQSA 3D3BJ 1ZM9A 3A3OB 1ZBTA 2OEJA 2DR5A 2OTJS 3IR7B 1RK8A 4ZOSA 3BSAA 3G6VA 4AFFA 5HQLA 5C7PA 1I94J 3M3GA 3I5CA 2CJAA 2WB4A 5E41A 5KFMA 2GIFA 1JNZB 2QTWA 2W2OP 5ETKA 1RWOB 1Z2LA 4N56A 2XO7A 3F41A 2VG5B 2R7OA 4KLNA 3MM5A 1UMJA 3PYDA 3KK1B 3AQPA 4DCJB 1YJNS 2L41A 2XGPA 4GKJF 2EC0A 3K5MA 2R2TA 1S48A 1SIZA 3MAQA 1RT3B 4CT9A 2DGVA 3TUJC 2FY1A 1PO6A 4B9LA 4KODA 4FPRA 3H20A 3U1MA 2WBMA 3N6MA 1NBEB 1TL3A 2WB1A 2K1RA 2V2KA 1HMVB 3NCRA 5IC4B 4ECUA 2CXEA 3D6MB 4CYUB 3NMRA 3EVMA 2W9CB 5F8JA 1R31A 2RNEA 4WFYA 2RU3A 3AB4B 2IRXA 1EKSA 2AEFA 1Q1KA 3PR5B 4KTQA 3V6HA 3PIPQ 1FF2A 2CWXA 1IM6A 3JSYA 1HFEL 1V5IB 3MD3A 4KGKA 3LQVA 3B6BA 4NLSA 5CH7B 1TKDA 1Y5NB 2W9CA 2JC0A 4HVZA 4RNFA 1WF2A 3CJ3A 1RGVA 3M8RA 4CRZA 1WF1A 3W5ZA 3CIMA 2PMHA 2BRKA 2M8HA 2VPYB 2YNIB 4NWBA 1D8ZA 3HHLD 3RZAA 5B0BA 2QSWA 5C2CA 4Z2XA 3ILLA 4OQJA 2VBYA 3B4MA 4I64A 5E2QA 3JSMB 5DYGA 4S0MA 2A69D 1Q16B 4DX5A 3J7ZT 3D7SB 2J9CA 3POTA 1RT5A 3HI9A 4P2SA 4NMXA 3PYEA 4IFYB 4K4ZA 3ISND 2J9EA 1LWFA 4EI2A 2MYFA 1RAEB 4ER8A 3T1HF 3K5LA 4HT7A 4FS2A 1ICEB 5H4UA 1J5EJ 2MB0B 2V69A 1EETA 3THPA 2A6ED 4F0MA 1FX2A 4AXIA 5EDWA 2DNYA 1OA7A 3U1NA 3OUYA 4IH6A 3LP2A 2XHCA 3M6WA 5D0RA 4CLYA 4EUVA 5F9NA 1JXLA 3KK2A 4ZIWA 1S6QA 5LMNF 3VAMA 1KRPA 2HFVA 2GIRA 2XYHB 3D68A 4JB8B 5DQIA 1S1VB 3FBCA 1VQ4S 1KBRA 4QPTA 1O0PA 1TL7B 1EP4A 4X65F 2NVXA 1RT4A 1YSJA 2NYHA 2G1HA 2QMWA 2V94A 4KO0A 3SXLA 3UR3C 5L1KA 1GFWB 1S7IA 2IPOB 1T02A 4WP8A 4YP3A 2YKMA 3MOZA 3SV3A 4DQRA 2MGZB 3LAMA 2FTRA 5M2RA 1NJIT 1S6PB 4DS4A 2UUWA 4MAKA 1NH7A 1YIJS 2ALZA 2JEJA 2GO8A 2OD4A 2YQ1A 1L3UA 4F4KA 2UXBJ 1NH8A 3LP1A 2HNYA 3FBEA 3ZZZA 3Q8SB 2ZKTA 5JVHQ 4AQYJ 2EW9A 1O51A 4BC9A 2ZUAA 4YR2A 3GSIA 2C22A 2VOOA 3RR7A 2VF3A 3HPOA 4CLKA 1MROB 4PQAA 1I3QA 1RDRA 5I3UA 1S10A 1M5KC 4HLBA 2AJQA 2ASDA 2KXHA 1NKCA 2KI2A 4TVAB 1N5TA 1S7HA 2FC9A 2YNFB 1RT7A 4ZVUB 3ZC4A 1LK7A 1YBUA 4M5DB 3BB5A 1A7GE 2LP4A 4OHXA 4R5PB 2ZH2A 5I3UB 4EBDA 2VFRA 3OL6A 3B82A 2KRRA 3QSIA 5D4PA 1JLBB 1ZPWX 1HNVB 2V0NA 2HFUA 2QYCA 4MFBB 2PFDA 3PRVA 4P7VA 4CYUA 1R8BA 2ZDPA 5DM7Q 1IBMF 1KQFB 4WCEQ 2B56A 1Z2ZA 2DR7A 3P6YC 1DMSA 1S1WB 4AZDA 5KFSA 3WHIA 1M5PC 1XNQJ 2BABA 3AT1B 1E60A 1TAQA 1U24A 1XJWB 2R7VA 4V1Ak 4OI4A 4WU3A 3MEDB 2DGWA 4ANDA 2DY9A 3G71S 1WC5A 1PYTA 4YS2A 1F9EB 1PG5B 1FDIA 1RZMA 2HQIA 5AJ3J 1PT0A 3CF5Q 1FJEB 4K4VA 2FLNA 4Q8EA 1MMDA 4DF4A 5HP1A 2ACMA 1KWMA 2IBKA 3DOKA 4NCGB 3TJ9A 3GIKA 3BKUA 2MZQA 4DUYJ 4C8YA 3NAHA 3JTPA 4LSLB 2VJVA 2H4WB 2G1DA 4LBPA 4OI3A 4AONB 3SI8A 1RTDA 3RUBL 1CZ4A 2NPFA 2FYXA 2BRLA 1X4FA 3WX8A 3NS6A 1PQFA 3GG1A 1PC4A 4M5JA 1HD5A 4A8FA 3PDNA 3PXGa 2FJWA 4FXDA 4FYDA 1FJCA 1U0SA 3QMQA 5F8HA 2ROPA 5T5ID 1G4CA 1RABB 3THTA 3LP2B 3MZIA 1JXEA 1JKHA 1BQNB 3CD5A 4H4KA 1ELOA 3VGTA 4OHZA 2HK3A 3SFGA 1UTAA 1CJKA 1E32A 4OYWA 2N3LA 2LCWA 1FKPA 1EKRA 1MMLA 4QIWD 1AUDA 4ANEA 4LREA 3HKZA 1ACMB 1VHFA 4U8VA 1HHQA 2G13A 1HNWF 2NAPA 3QT8A 2AYBA 1GX6A 1Y11A 1NK8A 1S97A 4RUHA 4KT0C 5HMXA 1FKPB 3X2MA 1IKVA 1S99A 4OJGA 2JIRA 8ATCB 2HHHF 1CG2A 2AHOB 1N36J 2IMWP 4F0HA 4GKJJ 3H4DA 1YJWS 4CP5A 1FVQA 2DH7A 4L74A 4F04B 3DLKB 4NA3A 2C3UA 3EE3A 1GQEA 2F4VJ 3I82A 3MMJA 1DTTB 2FHMA 2C2KB 3VZIA 2E9TA 4DR4J 2HVIA 1SJ4P 5CHCB 2CPXA 2ZD1B 3MCMA 5F41A 1M5OC 4TKTA 3R5CA 3UD4P 4CS0A 2OH2A 5LM7E 1S9EB 4GMKA 3H42A 1R0AB 2XS5A 4ENOA 1XNRF 4DR3F 3FQLA 4OYOA 3KNGA 3U27A 1KC8T 1B0TA 5L39A 3JYTA 1KLNA 2W4CA 3FVYA 1R0AA 1DHMA 5E33A 3T6BA 3LF0A 5HJYA 2OGUA 4EBEA 4Y2MA 2JL9A 3AD9C 1MU2B 4OJ3A 2HSEB 1U25A 3FK4A 5KFTA 2JA6A 5I3QA 5KOWA 2V5HG 1C1CB 2CW0D 3ZZRA 4IO9Q 3KHHA 1DRZA 9RUBA 3KLGA 1C0TB 3CCES 5J1EB 2HMIA 3HHDA 3CJ0A 2BW7A 4J5OA 4YFUA 3LGNA 4ZPAA 1LWCA 5GLFA 1RBAA 2LEPA 2PN6A 4OLPA 2CZVC 4URSA 3TUPA 2N7CA 2EEOB 1SC6A 4NLOA 1NZAA 2KT2A 3FFIB 3HX9A 4M5KA 3WIUA 2PA3A 2VBWA 3X2NA 2A1BA 3OL8A 2ZH3A 2XMVA 3RBDA 3TAMB 1RISA 2WONB 4L3NA 2XMJA 2HVDA 1IBKJ 3BJYA 4X4SA 3HFKA 3NL0A 4WYWA 2AZ3A 4QR1A 3BBCA 4KGZB 4M5IA 5DG9A 3H5UA 3FQKA 4PEOA 1PYUB 3VHQA 1S1UA 5KTQA 2KFZA 3OJSA 4EYIB 1FEHA 1TL4A 3RR8A 4K4SA 4QR2A 1UP1A 5KFEA 1DFDA 1C0UB 5EWFA 4B9SA 5H9EK 2OPRA 3A12A 1ZYQA 1ZH5A 3Q2SC 2R7TA 1CZ5A 2V3VA 1HI8A 3D0IE 3S01A 2ZOMA 3KWMA 1PGZA 1FKOA 3TEHB 4DJBA 4IR1A 3WDOA 1HWJA 4O3RA 1IR1A 2VDHA 3OXFA 2OIHA 5KFJA 2DK2A 3DGPA 4DCOB 2CG8A 2W1BA 3OD2A 1ZTWA 1FRJA 2QZ8A 3EDQB 4OHWA 1S1TA 4X66J 3M2UA 2BOPA 2KXFA 1K0TA 2LXUA 4IG3B 3K5PA 1U1QA 4IDKA 5BYRA 1Y5IA 3TO8A 4DN0A 3I4PA 3M8SA 1T9UA 3DRXA 2V67A 2BEFA 5A8KB 1D9FA 4JI7J 2GZOA 2HPUA 3OFGA 4NCBA 4N77A 4LRCA 1RAHB 5KFUA 2UV8G 3TR5A 4P2MA 1CC7A 3ENGA 3DXSX 3M2RB 2ALYB 4EYHB 2XLIA 3VAKA 1K1QA 2B4UA 1RA6A 2YPZA 4P74A 4RL1A 3IR6B 3O44A 4KH1B 3ZXWA 4DSLA 3MR2A 1HNIA 1KOHA 3JYTB 1FNOA 3FCHA 1VBKA 1I6JA 4MT1A 1REVB 5K14B 3DLEB 2KVIA 2IIHA 4DG1B 1Y4ZA 2DNZA 2F65A 2VFUA 4MIBA 3UDCA 2J5AA 1T05B 2VG6A 1YZ7A 2PICA 1RXOB 2MKCA 2OPSA 3C15B 3HHLB 4W98A 5KT2A 2W8KA 4DS5A 3TZZA 3PY8A 2CQHA 3OVBA 3GJQB 4KGVB 5HK4A 1C0UA 1VQ7S 1OYDA 2YX7A 4ZVTB 3CJ5A 2HGLA 2JIPA 2BX6A 2IM0A 4MH8A 4RUCA 5CCLA 3PV8A 2VQEF 1LNQA 3PX0A 1TVRA 2G9OA 2VICA 3D6HB 3DLGA 2IM1A 3VVTA 4NYPA 4AUKA 5L46A 2FVQA 2UXCF 2YTCA 2IM3A 1WC6A 4N7TA 4RNHA 1QE1B 4YB7A 1RT6A 4KBIA 5HJXA 2XCAA 2K06A 1ZAXA 2UP1A 1AW0A 1EQMA 1X9SA 3QATA 3NY0A 3CCJS 3C16A 3NBPB 4QIGA 5I42B 2FVRA 1FDNA 1U0HA 1GX5A 2AV5A 3I55S 4MMOA 4BCAA 3K5NA 3Q89A 4KJIA 3MTJA 1NZ8A 4PAAA 3W2WB 4C0BA 4GKKJ 3NBPA 2KJWA 4O3SA 1S4FA 3CSKA 1AZSB 3M9OB 4ERDA 2D9PA 1W26A 4H4KC 3HDSA 1CLFA 4WYLA 5F3TA 1QAJA 4G1QA 3C19A 3NLCA 2CJBA 1JB0C 1V5VA 3O1LA 2DNLA 1FTCA 4RWWA 2XO6A 3MURP 4QPXA 3MCNA 4RBVA 3DGPB 2DKOB 5LT5A 3QIDA 2PJJA 1U8WA 4I7FB 2Y1LB 5ETTA 5A8WA 5B08A 3ENVA 2RH3A 3DLEA 1LK5A 2QMXA 3A13A 2HFZA 3D1QA 1XWLA 2XMAA 1DQ8A 2W2NP 3JQMA 4ZKAA 1G8JA 1TWFA 1WG5A 2FVSA 3PCOB 2CPDA 1T03A 5BYQA 5J2PA 2E5LF 2P9GA 4O0NA 3SCJE 2R8IA 3FGVA 1VMBA 1CJTA 2BJEA 3GTPA 1R7IA 2DRDA 5AE1A 5L9NA 4EBCA 4NEZA 2QO3A 1HQEA 3GZ7A 5GAEI 3D1OA 3PIOQ 2XLJA 3JSRA 4C8NA 2R7WA 4UY8T 3M8PB 4J9MA 2GHVC 1TQLA 1N48A 1GH8A 1TK0A 1EAYC 1SMYD 2XYGB 2G4BA 2XS2A 1NPPA 1Y9OA 4B3RF 3MUTP 2VUMA 3CT9A 3M6VA 2HYIB 1CJUB 2PI5A 1FDOA 1PYQA 1LWFB 2BKPA 1K8AT 3M8PA 2KHCA 1HR0F 2UUBF 2ATLA 4NXMF 3OTEA 3ULHA 4Q2LA 4DL7A 4QYRA 3HD1A 1SIWA 3K7RA 3C16B 3OUYB 1RUSA 4RW4B 4EO6A 3LWMA 3QBCA 1JLFA 2V8VA 4FZVA 3KUGA 5HANA 1TL3B 2K1RB 2NXNA 5HVFA 2LQ5A 3JB9k 4XTTA 2U1AA 1LW0B 1EIYB 1U6FA 2V2ZA 2WVCA 2DNOA 3BDPA 4BWJA 3J80U 3QQ7A 4ZPDA 4IOBA 4L6V3 3GR1A 4BWMA 5EHHA 1TKZA 4A8KA 1O8BA 5C42B 3CEDA 3FUYA 4DPUA 1ZM4A 1CR5A 1S1XA 1WWHA 2AJFE 5B0FA 5FJ4A 1PILA 2DPJA 5KFLA 1S6PA 4I0WA 3T41A 1F3VA 4NLVA 3R97A 1H5NA 2VG5A 3A8JA 1YNND 3A3PB 1QE1A 3X2JA 2BXJA 3M2VA 5DJBA 1FK9B 4PG7A 4DSKA 2M4MA 2DNRA 5F0UA 1B0VA 3M32A 1WD6A 2RE1A 3NMAA 3T5JA 2GQ2A 1FKAF 1AB8A 4DR1F 5FDLA 2HNZB 3NGDA 2IYGA 3GLJA 4B3TF 2BE2A 2YWFA 2YNFA 3N28A 2ZH5A 3ZNJ1 4X64F 2C2NA 1RHMB 5CYMB 3BGRB 2W2PP 1X5OA 1KKHA 3MI7X 3BR9A 2Y1JA 3CCWA 1T7PA 4URGA 4DR1J 4HI1A 4LQ3A 4ZP9A 2F9JA 2A6MA 1OY9A 4H4OB 1JJCB 4RW8B 3K57A 1UPMB 2R8KA 2DRBA 1YWXA 1U1MA 2VOPA 4OLOA 3CF2A 1HQUA 1RAOA 2FJDB 2M52A 2WOMA 4J9PA 1S6QB 4LT6A 2EFQA 4WPAA 5JJBA 1NKEA 2KRBA 1YJUA 5L1LA 2EBEA 4X4RA 2YWHA 4LF2A 4ECQA 4PG4A 4DQQA 2KN4A 4RW4A 1DZ5A 1AROP 5J2PB 4HEA9 3VCDA 1XMQF 3AJ2A 4JI0J 3C6UB 2N3OA 2JEFA 4IQXA 1DQAA 1YJTA 2RKIA 3W62A 3KK3B 1TWGA 2KXNB 4J9NA 4IFYA 3T5HA 5DGAA 2YH1A 3QNWB 1JLQB 2CPFA 5LMUF 4Q0BA 2H4YB 5B0DA 2LXFA 1F2HA 2VFSA 2WSEC 4HDGA 3HM9A 4JI4J 2GJIA 2GIQA 1U6BA 5FTJA 2CNNB 3NG8A 4NI2A 2KFNA 4JI1J 2AU0A 4ILMA 4MIWA 3A1YG 4KR0B 4LFAF 3M1VA 3US5A 3PX6A 2NZCA 1NK9A 2KL8A 3IMQJ 2GVDB 3DDKA 3MEKA 4J9QA 2B9EA 2BZ2A 2J8AA 3FC9A 4WIQA 1K73T 1KLMA 3DOLA 3QRPA 1Q82T 1PQEA 4K5RA 1IQZA 1H98A 1GT8A 1RTJB 4OI2A 4QIEA 5A0YA 1E18A 1U09A 1M1GA 2HVEA 4F67A 3IN5A 4KHMA 1JKHB 3G6YA 4DR2J 1RP5A 4MKYA 2R4FA 4RW6B 1HNWJ 4TXSA 3VAGA 4RBUA 3LALA 3NGSA 2X1BA 3HU2A 4ZVRB 4B9UA 1NLKL 1L5UA 4NLGA 4LIWA 5HLFA 1ZA2B 3D0GE 4Y2KA 2DNKA 4PG6A 4DPYA 4PQUB 3IO1A 3NWGA 2CQ1A 1JIHA 3WZ0A 4FG4A 1NJWA 4NXMJ 4X4UA 4J9UE 2E7XA 4EU0A 3T19A 2FQQB 7FDRA 2EG2A 1GMWA 4LRAA 3S7RA 3CJSA 3TZXA 3RB3A 5D3GB 1WTFA 1TUGB 4K0KJ 1QAXA 2RVJA 3AB2B 3W5YA 4YY3J 4A48A 2FHJD 2WOMB 2Z2YB 2D7SA 3KLIA 4OZ3A 4FYYB 5KFQA 3KJNB 1N5YA 2RILA 3D30A 2YWKA 2GGPA 4LMZA 3Q86A 2R7RA 4KIAA 1L3TA 1IKXA 1S1WA 1KHWA 4QIFA 4AQYF 1CBKA 3I0RA 1U48A 3U1LA 3UVJB 2JLFA 2OI2A 1B7YB 5T14A 2HBZB 4IQMA 2GGPB 2BM1A 4ECZA 4ZVEA 2LA6A 2AF6A 3L95X 1TWHA 2YWWA 1TWAA 4YHHF 3DHXA 1Q16A 4CLLA 1SXLA 2JHEA 5FTNA 3OVSA 4Y28C 3TRGA 4WK3A 2ZH9A 2F8MA 3DC2A 3O2IA 4ANCA 1E5VA 1URRA 2DGSA 4ZVHA 5KFRA 4M5GA 4DL0C 2MTLA 2C28A 3SQGA 1NAQA 2LVWA 2P6TA 4P75A 2NXEA 4ED7A 1HI0P 1JX4A 3N5FA 1S59A 4ZHRA 1FNMA 1XNRJ 1U26A 4CTAA 1SC4B 1BGXT 2I5JA 2HK2A 1DAXA 3IFEA 4XDCA 2E2IA 5H9EJ 1C0TA 1SUQB 2Y8YA 1RQ0A 3CIZA 4GKKF 2QV6A 3NGUA 1N4LA 4RW6A 4QW8A 2GFFA 5ITHA 3NKYA 3MUVP 4C0HA 2HNDB 4CTAB 1QTNB 4WE1A 5HATA 1LWEA 1ZTTA 1LV5A 3K0JA 5F8NA 4YB1P 5F8GA 3HMJG 4PXDA 4B3MJ 3NGKA 3X3UA 4WFNQ 2J0XA 4KO0B 2UVVA 3KJQB 2OMLA 3NNHA 2PIIA 2RU9A 5KFVA 1U2FA 3O5AA 3AA8A 4LRBA 2D3ZA 4PQUA 1JWWA 1B70B 3AY0A 2ZZNA 3SEOA 4P9SA 4WTOB 2XY7A 1SQFA 3ENQA 1SV5A 4KSEB 3TUZC 5E3PA 1U1OA 1U45A 2W8LA 5FLXY 1B64A 3D66A 1Y10A 4OJ1A 3BPSP 5KFBA 2F40A 2YWEA 4UOHA 2GCFA 4ED6A 1VQ5S 3I9V9 3RGIA 3E3XA 2FB0A 2JOQA 1AXQA 2OEMA 3VGVA 3QGHA 1VYAA 5M2UA 2VB6A 2E1AA 2JIMA 1GTHA 1NNDA 1T11A 2W4DA 2XM3A 2HFSA 1UW9A 2CQPA 4F26A 3I56S 3V4IB 1FDBA 1Q95G 3PW5A 1RWKB 3BO3A 4CM0A 3O3LA 2G2ZA 1VC0A 2WZ1A 2L9WA 1DTTA 4JBCA 4WKYA 1YJ7A 1YHQS 4PYDA 4JI3F 2N7YA 4R8UA 1N5QA 3BS9A 2PT0A 4NXNJ 1R0CB 1GMUA 1FRLA 3ETMA 1KONA 1CPZA 2EG1A 1SPBP 3MEGB 3NGTA 4LBIA 1FJ7A 3KLHB 2OP5A 1F0XA 1I51B 2NUUG 2BOAA 4ZM7A 3IGNA 2RRNA 2X7IA 1H7WA 1S57A 1WEXA 1J27A 2YNGB 3I96A 3MMBB 4IOCQ 5E5NA 3QFWA 2PJHB 1RAGB 5D4LA 4JV0A 1ZPVA 2M5YA 1NHUA 1N33F 3IBWA 1HW9A 4OX6A 3X2LA 3B78A 1N36F 1QDUB 4ETXA 1XMBA 2WK4A 1YGYA 3GTMA 4R0JA 4UOFA 1NJYA 1IQTA 2FJVA 2QEXS 1WI8A 4MJKA 1LW2A 2MY8A 4X84A 5KFGA 3FJ2A 5CA5A 4TU8A 2OJ3A 1QAIA 2KFYA 3KG0A 3C14B 2XI2A 2G0CA 5B0GA 3P8BB 4P71A 5A8RB 3OR2A 3DU6A 2AGPA 4C11B 2YQ0A 3D3CJ 3T5KA 3N6NA 4ZDNA 2F7VA 5D4NA 2R8HA 5IT9Y 3SQGB 4DZDA 4OV6A 3BSNA 2P8IA 1WCMA 1FE4A 3UI3A 1U1NA 3AQOA 3N5BA 4OYMA 1R89A 2DXDA 2WB1D 1VK3A 2HBYB 2R3VA 4BHQA 1VQLS 1CC8A 1N56A 2IRYA 2VBZA 4L73A 3E8OA 3SUKA 3IXQA 4OZJA 2L48A 3K8VA 3KUEA 2MLZA 4WTYA 4E98A 2W7PA 1Q7LB 2L9DA 1WKKA 3GTKA 3EXCX 1MMNA 4WXOA 1LXJA 3B54A 4OMFG 4FF4A 1WELA 3DOMA 5ADZA 2MQQA 3IM8A 1VQOS 2H51B 2ZJRQ 4Q5VA 2BQUA 2HQCA 4DX7A 1IUJA 5F8LA 5L1JA 3W9IA 3KJVB 1FFSB 3MECB 4GO7X 3RJMB 4JI4F 3ZZ0A 3NXZA 4NZ7A 3R7NB 3MMBA 1UJ6A 5GAEU 2CNLB 1DQ9A 1S9GA 2QYGA 1FKOB 1HARA 1TKTA 2ILYA 5G0RB 2BH0A 1NO8A 2MSSA 3Q8YA 3G8QA 4DR7J 1C4AA 2MDAA 5IM0A 1PAEX 1ZYRD 4RU9A 4DV2F 3SCIE 4ELVA 4N8OA 4ITSA 3QWPA 5DQGA 1ZETA 3DRPA 1WTBA 3TW0A 2GAHC 1LW2B 2J9DE 2MQPA 2VASA 3WIVA 4RUAA 3G4SS 2VG7B 3BYPA 1NDPA 1XERA 3FEXB 3G6ES 4CLSA 3H0PA 1R0BG 2XMTA 4IDKB 1N32F 1UWBA 3GYGA 2O01C 1T9TA 5B7WA 3MTKA 3NGRA 2G0JA 1RTHB 3F56A 1DY3A 1MN9A 2BJ9A 3RG6A 3BO4A 2GMHA 4BLGA 4DSJA 3CJ8A 5F8MA 3PEHA 1AFIA 3VGSA 1Y7PA 4HYKA 2VHGA 1T03B 3OQ2A 4CNZA 2H48B 2CQCA 3P3DA 4O4GB 2XSJB 5ETNA 3FRYA 3NWRA 1TUVA 4I2QA 3CD7A 1RWUA 3Q2TC 3CD0A 1PJ5A 4LF8F 2XCPA 1N6QA 1X7VA 1UAWA 1P27B 3C6TB 5E0OA 2QFJA 4NE9C 4DL6A 2VUGA 3HFVA 1IWGA 2BKOA 3CJTA 3M30B 3CCLS 1XTZA 4A8YA 2MZSA 2ZVIA 4ZA1A 3DOMB 4RNNA 4KDIA 1UFLA 3DRRA 3PACA 2VIHA 4CZCA 1H72C 3CD6S 1CSJA 5LSLA 4QU6A 3IRXA 4WFBQ 2HHQA 3IWLA 3TEGA 3VV2B 3AD7C 3GCWP 2QG9B 5K8NA 3TZWA 4IUFA 4ID8A 1JLEB 3DRRB 3G87A 5U47A 7FD1A 3KK1A 2H54B 4FPIA 4DV7J 1VBYA 3C46A 2CRLA 4FBUA 5GMDA 4PRFA 2RDJA 3KLVA 2MQOA 1NSAA 4UZBA 1XR5A 3R5BA 3Q83A 4Y0FA 3BSCA 3V6DA 1X4HA 3NNAA 2ZH8A 4NOHA 3ILOA 3W2WA 4N8NA 4DV5F 5K9FA 3MPUB 5HBMB 1Q53A 5KFFA 4LF7F 1TV6B 2VONA 1U0HB 4XDDA 4HH1A 1L3SA 3WC2A 1I94F 2GC8A 4AL7A 3B8HA 5CYQA 1L8FA 3GIRA 4B3TJ 4CLPA 2KZZA 4UUXA 2LMIA 3OSNA 1TR0A 3Q8RB 3GTOA 2JDJA 1WOSA 2OPRB 5I3PA 3CCMS 4DSFA 2Z8QA 3MF5A 3M32B 4I56A 2ASJA 1AZSA 1JNRB 4ZVFA 4ZJOA 5FLXU 5GM9A 3X2GA 1RWWB 2QL9B 3TQ1A 2UXDF 3I32A 3QYYA 3R2DJ 1HIYA 4JV5J 4OYPA 3OLBA 3KJFB 2IDEA 3CCRS 2M0GB 1D9AA 1RADB 2JSXA 1JLCA 3LP0B 3RW6A 1BQMB 5HROB 2BJ1A 4KB7A 3MMAA 1RU1A 3WBZA 3SSRA 3MM8B 4B9TA 2C2RA 3PVXA 4N76A 4K2JA 2B0GA 2KM8B 2KTQA 4OZNA 3LP0A 2Z2LA 3FKIA 3W8GA 2FLPA 1UWBB 3EWGA 1CQNA 1GTEA 4LSNA 3SCLE 2HS4A 5A8KA 1EETB 1N88A 1X31C 4K5SA 2X3DA 4M63A 2N4DA 1FD2A 1WC2A 4M5MA 4MKVA 4FXVA 4OYIA 4B08A 4DPTA 2AD9A 1QDNA 1D0EA 3BPDA 1TL1B 1B3TA 4JI6F 3CW2C 2B7BB 5C42A 2HHSA 8AT1B 4RU2A 1PYOB 4DUZF 1AFJA 2VBXA 4PWDB 2RKIB 3RAXA 1HNXJ 1FI4A 1SI9A 1C2PA 3TNVA 3IP0A 1RCOB 4ZCMA 4NXNF 2LDIA 4JI2F 4DG1A 4OI6A 3Q8PB 1SJ3P 2YKMB 1RLCL 4M94A 3QGPA 1QUVA 1IJFB 1R27B 2QSFA 2ZEJA 3UDEA 2D69A 4LBHA 3RRHA 4KRWA 1IXKA 2HWHA 2K3IA 3GPAA 4MYUA 2ZUGA 4N47A 4PG8A 1BD6A 1HBMA 3CMES 2JLEA 1U1LA 2GNKA 2QC3A 1J2VA 1J5EF 5KFCA 4IH5A 1KLMB 2GA7A 3JS9A 2ZOGA 4QWAA 4IOAQ 2NXUA 3HHLC 3R1LA 3PHEA 2OPQA 4HTJA 3E01B 1X4BA 3QJPA 3PR4A 1UPPA 2Y0BB 3EGNA 4PWUA 4ZLNA 4ED1A 2AZ1A 3KDOA 4DMZA 5DYIA 2LEAA 2FC8A 2CNKB 1XR7A 2MKYA 3IS9A 1KS2A 2LYVA 5KT3A 3QQ8A 1W7WA 2EI5A 1CULA 4DMRA 2NXJA 3SCKE 3FBFA 2HZAA 5IZHA 4I2PA 2ZDOA 2R8GA 3OV7A 3MMAB 3R2CJ 2RQMA 1MWYA 1NHVA 2MHNA 5FTKA 3K89A 4JV2A 1JLGB 1HBNB 4M1KA 5I42A 1VRUA 1TV6A 1FHTA 3OPKA 1T0TV 5HAOA 2NS1B 5L38A 4I7FA 2WSCC 3LTOA 1X9WA 4GO5X 2KQAA 3GG0A 5LL6d 1VBXA 5B0AA 5DDOC 1GNKA 1NDCA 1O6XA 1SFOA 1VRUB 2ASYA 2I8EA 4KKOA 1BUXA 2QLBB 2DGTA 3SFUA 3W8PA 1XNQF 2VPWB 3CJ2A 1IKXB 4X4OA 4B9MA 4LF4F 1FT8A 4G1QB 4EWTA 2D74B 2Q66A 3FDSA 2VH7A 2YNHB 4JCWA 2B9YA 3Q8UA 5T41A 2XMUA 3ELHA 2OSRA 3LAKA 2NYAA 4FYVB 5KFAA 4KKOB 4JP7A 2NSCA 1SVDA 2DYAA 2RIJA 5AT1B 2XGQA 3PO5A 3UN3A 2ADCA 1H73A 2HW3A 3V81A 1U1KA 2H5IB 2B51A 4CI0B 5GADI 2VQFJ 1Y1VA 3TA0A 2XULA 2IC3A 2R7SA 3W66A 4CIOA 4GVLA 4ZCKA 2MKKA 3WC0A 1TL7A 1R43A 2EWHA 2O66A 3DYAA 3FSXA 4FKXA 5G4DA 1Y1WA 4LR9A 5AE2A 3QAEA 5CAAA 2W7OA 5I4MA 1UWAA 3DGVA 1UVJA 5KG6A 2ZHBA 1TMMA 4P2XA 3DKDA 4I1TA 3ZTQA 4ENGA 5DG8A 4NLYA 2OKQA 2V9WA 3MM5B 1D09B 5LXYA 1JLFB 2DB1A 2FDNA 1RTIA 1X9MA 4C8ZA 1OS5A 2MZJA 3PHTA 3SMZA 4DBQA 1BC6A 2Q79A 3TVYA 1PKUA 3VQTA 2RRBA 1LW0A 4TYAA 5C24B 5HO4A 3ENAA 2QGFB 2FLLA 2B4VA 1UVMA 5HVGA 1Q7YT 3DLBA 3JTOA 2JEIA 3OTBA 2KO1A 2HKEA 2VQFF 3L3CA 5SUHA 1KSPA 2FZCB 2HNYB 5IXUA 3N79A 3PNIA 1G6BA 3KKFA 4CH1A 5CD4A 5IT9U 3UO0A 1R27A 3PLXB 4ZIVA 2C2DA 1JXVA 1UVNA 1SV5B 4FERA 2QLFB 3EICA 3FCWA 3OVAA 2R8JA 4C8KA 2R7ZA 2CQDA 3GB0A 2V4JB 3MPWA 1TWCA 5LSRA 2R2RA 2BV3A 2UV8A 4ILRA 3G6XA 2MPUA 1YJ9S 4WKRA 3NRBA 3VAHA 3MAHA 2BW2A 4EEYA 4EZ9A 1AYEA 1TZ0A 3QO9A 5ETMA 2RF2A 4LF9J 1KTQA 3HULA 4GVBA 1UHEA 1YBTA 2JFKA 2OUGA 2KH9A 4DV3J 3QSYB 4LFBJ 3JAMU 3P49B 5T5MD 5IC6B 3JSMA 2HWTA 1Y3KA 1JK9B 4WFXA 4GA5A 1KQGB 1U2CA 3I0RB 4USTA 3J80Y 2J0WA 3UDVA 2XMKA 4L48A 2BJ8A 5HP1B 3W60A 1RAJA 1FX4A 3Q23A 2W4PA 5CZXA 3K58A 3SYZA 2IVYA 3DYAB 2QX0A 3PRBA 4FNHA 2FY8A 1WF0A 3TM7B 2BE2B 3KG1A 1N5YB 2UXBF 2EFPA 2MZ1A 2VPZB 1S76D 2V50A 2DEIA 4ED8A 5CYMA 2UXCJ 2DT9A 3UW1A 4ETZA 3IBFB 2BANA 2DGOA 3FZ2A 3ONQA 3FBBA 4LSLA 1QSYA 2GHPA 3A8EA 4DDFA 1HYSA 4EK2A 2GHWA 2V45A 2DNHA 2M2BA 2OFGX 2A68D 4G1IA 3ZTRA 4RV0A 2B8PA 2CVEA 2L9NA 1KR4A 4UY85 1SJRA 3VZHA 5J2NB 2L3MA 2LXIA 2DR8A 4F2SA 1HD1A 3NAIA 3HVWA 3HVAA 1BXNA 2OTLS 3IR5A 1O5JA 2DGQA 3OBIA 4KV8B 4WZQA 4UUWA 5H1SV 1JLAB 2K8GA 3MXHP 1KFDA 2Q6BA 2AX0A 1LWEB 2DGXA 3IR7A 3DMRA 1RT1A 3AJDA 3TJ8A 1CJVB 2RUGA 4BS2A 3BH7B 2XWYA 1H74A 1RB0A 2XMWA 1AA1B 1LWXA 1F9FA 2I9SA 1YQHA 4LRDA 4LFCJ 2XLKA 3W1YC 1RT7B 2HHWA 1NJZA 1T95A 4Y65A 2IYIA 1TFWA 4OYBA 3SBMA 4B3RJ 1S3SA 1RTZA 1JJHA 3LA0A 4HACA 4USWA 3T6JA 2CAJA 4L72B 3GJRB 4DR7F 2K3KA 2FHKA 3PTWA 3CDWA 1RT3A 3D67A 3UN5A 1GXLA 2EK1A 3AXMA 4WU2A 2BE5D 4AAYA 1NPRA 4NMLA 2HRYA 3MR5A 2MSTA 3KHRA 3RB6A 2E5LJ 5KG2A 1OA9A 1X5TA 4NYZA 2F3JA 1IBLF 3SSQA 5AE3A 4C7QA 1QSSA 4LRFA 5DQHA 3CGIA 4Y00A 1G8KA 1FWPA 5EX3A 3GU0A 3ITHA 5KT5A 3HVRA 1L3VA 3RRGA 1HYSB 1CEZA 3QT6A 2HS3A 2KB2A 2ZC4A 1K0VA 2VC1A 3PJXA 3MEGA 1PT1A 1W2IA 3I87A 3K17A 4AE5A 1N34F 2KG1A 4IRDA 1N0UA 2JA5A 1GEHA 3M4XA 2KDOA 4DEZA 1ZM3A 3CUNA 1OY6A 4M8LA 2ZH6A 5HSPA 3I0SB 4O0IA 2V4QA 1OO0B 3MAAB 3DNCA 3KLEB 4F02A 2AIRB 3SZ2A 4EMDA 2EFGA 4DV6F 2G2OA 4KV8A 1F1BB 4A47A 4DV3F 5FTMA 2O1PA 2SXLA 2WONA 3G8TA 5C18A 2YQ3A 5JXSA 3DM2A 4OX8A 3HP6A 1S79A 1NB2A 3ZTOA 4CLFA 3QFHA 1Q8LA 3FFIA 2DNNA 1FCAA 1KHVA 2LU2A 2Z2ZA 2UVUA 4JI7F 3C66A 1H7XA 1VHIA 3N9UC 4U96A 2U2FA 1S1UB 4HHHA 5ETPA 1CJKB 4WK1A 5D77A 5L9XA 3TAMA 5A6PA 1VQPS 1NK0A 1D1UA 1RTDB 3OTCA 3N4WA 1D3WA 1QM9A 1BW4A 1RHUB 1RU2A 2A10A 3EZUA 2CKWA 2D1CA 2YPYA 3HSZA 5HMYA 1MW7A 3GTGA 1KP6A 5AXMA 1TVRB 4CM2A 3VVUA 2ZFHA 2LQJA 3MPYA 1C4CA 4RUBA 5ETRA 2E7VA 2IRUA 3AFGA 2PO4A 5E3QA 2VKRA 2XMMA 4E0DA 5CCMA 3KXDA 4ZK7M 4DX8H 4XO0A 2YBVA 4YR3A 3CCVS 1NSQA 2CZ4A 2YX1A 4AL5A 5DGBA 3J81U 2EK6A 2IAJA 1R8AA 2H5JB 2H1YA 1EARA 4CO3A 2MQNA 3OHBA 2HQ3A 4O44A 4DV5J 4X62F 1RSCA 2A0FB 2EVZA 2Z57B 4PR6A 2DISA 4IR9A 1XQIA 2NYIA 2YXLA 1QY7A 1WOPA 3M8QB 1YNJD 4MIAA 4Y34A 4F25A 2XC9A 2UUAJ 4H4MB 1YLEA 1LKZA 3NCPA 4X4NA 1WHYA 4JV5F 5D15A 3Q8VA 4CCHA 3CC7S 1UFWA 3QWZA 2OAUA 3DLKA 4DX6A 3T3FA 3CC4S 1SC3B 2J7KA 4XK8C 1SH3A 1NK4A 4ICLA 1MN7A 4I2QB 4ED0A 3CB4A 3R7SB 3E2EA 2ZJPQ 2A2DA 1VFJA 3IR6A 4TQSA 1K44A 2HRTA 2HLTA 1E61A 4B3OA 2MLYA 2C2OB 3FRZA 3D2WA 2DHHA 3MEEA 2C2EA 5CD4H 2RS8A 4ECTA 3C8YA 1S1TB 5KFWA 2P9CA 5DETA 2NUHA 2V9KA 4JV1A 2WTFA 2FZGB 3BV8A 4PPDA 5EPPA 4JUZA 2KG0A 2BR0A 3IBCB 2E1RA 4JI6J 4ZCLA 3H2UB 2BUNA 4JI1F 4USVA 3KLHA 3UCUP 3KNAA 2BA9A 3BKTA 4OIXA 5FTLA 1U47A 2BVZA 3EGWB 1KVIA 2P9EA 1N6QB 5GAGU 2W25A 3UE2A 4DR6F 1G2EA 2C3PA 1B99A 3I0SA 2AJ2A 2EFNA 3IAM9 2HAIA 3FZBA 1XMQJ 5KFHA 2J76E 2AP6A 1XIQA 3TAPA 3MD1A 1ZA1B 2OPPB 1YLXA 3OUGA 4CRYG 1T9YA 2H9ZA 1X5PA 1OY8A 3G2XA 2MZTA 3BYRA 4R25A 4ZVGA 2VA2A 1SBRA 1S6UA 4B9NA 4TU9A 3DRSB 5F0WA 2B5JA 5HBMA 1NDLA 1VOMA 2N4CA 1WC0A 2ZC3A 4A46A 2HMIB 2VODA 3GIJA 2HHVA 3GTJA 1RAFB 2C45A 2H3EB 2ZWOA 4DV0J 2DPIA 1S77D 3TARA 1SH2A 1XBWA 3PFOA 3OXLA 5KFZA 4ZJQA 1ZAWA 5KFNA 3LANA 4D3GA 3B4DA 2QLXA 4JI2J 1KQKA 4NLQA 4XPCA 3CCQS 4JI3J 2IY5B 2A3JA 1FJGJ 2I2YA 4C8LA 5C2GA 2YKOA 3X2HA 2VD3A 1FK9A 5DDQC 2N82B 3W65A 1WLFA 3TJAA 3O5TB 1PC5A 4TQRA 1SJFA 2GW8A 1QLNA 4K0KF 2GV1A 4WBFA 4ZPCA 5DM6Q 1WHXA 1PPYA 3AA9A 3IM9A 2FVCA 4LQ9A 4OFZA 2DIVA 1WI6A 3ZZTA 3PRDA 2OHDA 5FDLB 3K8WA 3JAMY 3CCSS 3HU1A 4X4TA 1G1XA 3T1YF 1NM2A 3OL9A 2R93A 1QAYA 3M8QA 3OLAA 5D8HB 4YDXA 4JOUA 1T9WA 5CYQB 2QE5A 2ZZMA 4CRJA 5J1PA 1EU1A 1K9MT 5EN1A 2PI8A 3BQ0A 4OI0A 3P5BP 1U8SA 3PX4A 1HQEB 5KG4A 2F8HA 1HNIB 1Y5IB 2PA8D 3AODA 1B7FA 1SB6A 3DI6B 2BDPA 1E6VA 1JJ2R 3MPVA 5A6WA 4DXLA 3PM9A 4DCPB 4GC6A 3T9NA 1J5OA 4JI8F 3M2RA 1DTQB 3H0GA 1X5SA 3RW7A 2D3OR 3R3TA 1Q78A 1YDLA 2XWXA 2BM0A 3KK2B 2JLGA 4RBTA 1F2GA 4KGMA 1HLWA 2Y1IA 2UUBJ 4OL8A 1S1VA 1VI7A 3PG9A 3N0VA 4YUDA 3ML1A 1S6OA 1ZAVA 2IFXA 1H3DA 2Z2MA 3CCZA 1T94A 3EX7B 4J9KA 3A8IA 2ZWPA 1R3NA 1FXRA 4K4YA 1BY9A 3QAUA 4I6WA 4DWIA 1VCTA 3Q0AA 1I5OB 2MZRA 2AEMA 2MGZA 3G9CA 4QJVA 4B3MF 2E2HA 3HJFA 1Q8IA 4O4RA 4DQIA 1WHWA 4UQTA 5GVQA 5GAGI 1N32J 2DO4A 3TYTA 1OMSA 1IBCB 1VGYA 2NSBA 1PCAA 1RHKB 5B0CA 1MNEA 3IRXB 2OLWA 3U7JA 1RTJA 5HN0A 2HS0A 4E8UA 3BR8A 2KT3A 3QIPB 3AOCA 1R7RA 5B6CA 1UFKA 2RAQA 4IYQA 4U95A 4QWDA 1YRTA 4ZLPA 1YZ6A 2YKQA 1WDDA 3OTDA 4IH7A 4C0OC 2DR6A 1MG7A 4ZITA 2XS7A 3GFXA 2DTJA 4UQGA 4DUZJ 4AXJA 2V6AA 3R6GB 4L75A 3GV8B 3TUIC 4O3OA 1IW7D 1PBUA 1PJ6A 1VC3B 2Y1RI 4K4TA 3VWSA 4DR5F 2BBEA 2R7QA 3EGZA 1GMVA 5GADU 2E29A 1YRUA 1VS3A 4KH0B 2LKZA 4JP8A 4KFBA 4DF8A 2K7JA 4CO0A 2MJNA 4YDDB 2F5GA 4H4OA 5DZ6A 4OYAA 1H6KX 2UUAF 1UVIA 5KAKA 3D4JA 3GE9A 1DTQA 1Q8KA 3M05A 3OFHA 3M2VB 4Q7AA 4ZP7A 4PZVA 2I6WA 3V4MA 1S0MA 4FF3A 1I50A 2RT3A
chains in the Genus database with same CATH topology
3POTB 3PZPA 2IJNA 4RW8A 5FIIA 3IG1B 4NCGA 1X4AA 3VALA 4ES2A 2IVFB 1XR6A 3G96A 1IR0A 4O3PA 2ZHAA 4WIIA 1U45A 4AOKB 2HVZA 3MM8A 4C9DA 1R8CA 4UW2A 2ZOFA 1P9QC 2LU1A 5KFOA 2A6HD 1R8PA 3VAJA 3D54A 2ILZA 4J9SA 2J0QD 1DLOB 1RTIB 1V3ZA 3P5TL 4RKUC 2DMRA 2VFVA 3VAIA 1TL5A 3RBEA 1NB7A 1VBZA 1RT4B 1HQUB 4A8XA 1TP7A 2UUCF 4WFAQ 3VTIA 3UCGA 2D41A 1CVJA 4I6YA 4C4WA 3RU0A 2HLUA 4FP9A 3CPWR 4DUYF 3KMSA 2EPIA 3OFEA 1N54B 5DDPC 1TK8A 1HWKA 3BGLA 4USIA 5KFYA 3GR0A 3R27A 3ZZUA 3H25A 3FEZA 4Y2IA 3NNCA 4P7TA 3H2VE 4KHRA 2E7ZA 3L09A 5KFIA 5HMZA 1GXTA 2E5GA 1IKVB 1EP4B 1N5SA 2DHSA 3LUYA 1FXLA 1S49A 5J2QA 2J7WA 4J37A 2D3UA 2XNQA 2XB2D 4NLUA 1RKIA 1OGYA 4JI5F 3DLGB 4OZ5A 4LVNP 2DBBA 4M5DA 1L3KA 5K8PA 1XK8A 3CDEA 1Q8BA 2EFOA 1FD8A 1S0NA 3KLIB 3DOLB 2V8DA 4QIVA 1KOOA 1ZOTA 3TVZA 3R1HA 4HHJA 4ZS6A 2Z4PA 4MK7A 4QR0A 2DHAA 2DR9A 2BQRA 2AYEA 4OZ0A 2CPZA 2DVIA 1RT5B 4I69A 4WXWA 2X1AA 1FERA 4QCLA 4AYBA 3R5DA 3DMJA 2YWGA 2J0SD 1DLOA 4DV4F 1UEVA 5IT0A 3V6KA 1VIXA 5KG1A 3CJKA 4C97A 2RS2A 2DCLA 3KTQA 2KI8A 3LH2S 2ZBCA 2BQ3A 3V2UC 5A8WB 3GILA 2G6GA 2VPYA 2YNIA 4YEAA 4DOZA 2DHGA 5C5JA 4YR0A 5KFKA 3MEDA 3IG1A 4LF6F 4TY8A 4FF1A 3KMQA 2B6AA 2HG4A 3UDLA 2FJEB 1SQEA 2OMOA 1FJGF 1FRHA 2J6SA 4CO2A 3L7OA 3DOKB 3O8WA 4N5SA 4DFMA 1YJVA 2BANB 1HPZB 4LUBA 4OX7A 5EX3A 1H0HA 5LXRA 5J2QB 3CDAA 3H5XA 3KOAA 2Z0GA 1VRTB 4P6QA 4D3HA 2V8HA 3W7BA 1OIAA 1YVFA 4A4JA 3V81B 2I0XA 2Y0SD 2LECA 5JUMA 1F60B 1Z1ZA 4C3KA 5J2MA 2E44A 4QU7A 1H2VZ 1TKXA 4F3MA 1WACA 4GC7A 5E3CA 2HGMA 4NA1A 3LP1B 4OV1A 2E66A 3ETOA 2AJ4A 1N5VA 4ID5B 3PJWA 3BM7A 1Y5LB 2YH0A 1FRKA 1TKZB 2O5DA 2M9KA 1YTYA 3MECA 2QA4G 1XEZA 1HMVA 1HNZF 2HHTA 1D9DA 1A9NB 3HKZD 2CQ0A 3M6XA 2P6SA 1KEKA 3HVTA 3QO9B 4ECSA 1PSDA 3FNNA 4R8UB 3PKYA 1SJQA 2OSQA 4NLRA 4HH0A 3CWJA 1VQYA 2BYCA 2PC6A 1AW8B 4X66F 1N52B 3EPGA 2B6AB 3H98A 3X1LB 2EFVA 2YNGA 2HGNA 4ECXA 3TI0A 1C1CA 2D9OA 2LLZA 3F73A 4ICLB 1KQFA 4NA2A 5DLGA 1F5BA 3BSOA 1FE0A 5B09A 4ECRA 2FVPA 4F4YA 1X0PA 3CE8A 3AAWB 3BEGB 5SZTA 3KHGA 3EZ5A 3KLFB 3G9CA 4B3OB 2ZNZA 3GV7B 3S8SA 3M9NB 2MY7A 4I6AA 1QCSA 2RQ4A 4OZ1A 2XY6A 1Q86T 1F5CA 4ECWA 2DNPA 2R2UA 5KOXA 5HI7A 4DSIA 1FXDA 5KT7A 4JYAF 1HWLA 3DLLQ 2YKNB 4MYTA 4YB6A 4IFVA 4J9OA 1UVKA 2M3DA 5HL7Q 5DG7A 1UEUA 2JJ4D 1ZZFA 1GAOA 4ELUA 2Q1LA 5J2NA 3OHAA 1OQ6A 4DHVA 1V3SA 1NKBA 2F4VF 2HHPA 4Q0BB 4LFBF 2IVMA 4KQZA 3T9ZA 1BQNA 5M2PA 2MKSA 1QSLA 1X8DA 1JLAA 4G1PA 1R6YA 3CO9A 4NX9A 4Z37A 4WE1B 5J1PA 1IM4A 2OO4A 2QFJA 3EYZA 1PQHA 1RT1B 2FJAB 4A8QA 2DCUB 4MKBA 3HK2A 3M6UA 4OHVA 3ENWA 2JX2A 2VKZG 2ZBIA 5J2MB 2YU9A 2WBRA 1RI7A 2RDIA 3FMBA 1S9GB 2Q43A 3S6EA 2ZM6F 6FDRA 3HZEA 4O3QA 2FUG9 2CPEA 1K83A 2DNGA 4IRCA 4PCQA 1SL2A 4PXBA 1F5AA 2HFNA 4LF5F 4C2MA 2JVRA 3C3LA 3W2VA 2IAJB 2E1MC 4U67Q 1WEYA 4O3NA 3LOUA 3W3SA 1N0VC 4X4QA 3HZGA 3MM6A 4LVOP 2AGOA 2RSQA 4NRTA 3BQ1A 5D3GA 2B9WA 1H38A 4OI1A 4Y2AA 2VL1A 3NCQA 1HBOB 3OR1A 3SDEB 4BDPA 2R7UA 3QC8A 1ULRA 4ED5A 2DJWA 2QLWA 3DU5A 4DN9A 4OZLA 4RLEA 4J9LA 1UVLA 1Z4UA 3IA0A 4LIRA 4DLEA 1YJRA 2APOA 2C3MA 5A8RA 1NK5A 1JJ4A 2MHEA 3HKWA 3LO3A 4F2RA 2CQGA 5T7LA 5C1BA 2XHWA 4J9RA 4FBTA 3D5MA 3KLGB 3M30A 2QA2A 1V6HA 2AJ1A 2DITA 2HZCA 3ITHB 3UQSA 4QWEA 1KFSA 1IN0A 1OQ3A 2IBOA 2FHJA 3C6TA 2W9BB 2IHR1 1IKWB 5K14A 5KG3A 3PW4A 2PGCA 1IJEB 2XG8A 4I68A 2IA0A 2LA4A 5KFPA 1U6ZA 5E3RA 2OPSB 4Q44A 3RYLA 2JEGA 1DBDA 2IA6A 3OR2B 5DDRC 4KDLA 4FVCA 5F8IA 1Q79A 1UL3A 5F9LA 2W9BA 1XMOF 2C3YA 1V9OA 5KT6A 3H5YA 5KT4A 4YMEA 3MM7B 3D28A 2ZVSA 4B02A 4I4BA 4IG0B 1K1SA 1I1GA 5D78A 2OPPA 4ZHRB 2HNDA 1HBMB 3PW2A 2XNRA 3L7PA 4C3LA 4CO5A 4ZPWR 1HL6A 4TU7A 3MR6A 3OFFA 1QUPA 4NPOA 3QIPA 2E5HA 4XAKA 4CQ1A 5FD1A 2J9DA 3ZZYA 2IM2A 2ZE2A 1H2UX 3TA2A 2ZH7A 4DQSA 2X3GA 3KHLA 3EPIA 3SDEA 4ZMMA 3MR3A 3BGRA 2LDYA 1FDAA 3H5SA 4HDHA 3OW2R 1FA0A 5A2QY 1XNQF 1SH0A 1VK8A 5EWGA 2GMLA 1JLGA 1HBNA 4PXEA 3G8SA 3UCZP 4NZ0A 3W2VB 1A6LA 2HRUA 3V6DB 3QLHB 4KAIA 4O44B 3BGUA 4KPYA 3CXCR 4MTPA 4ED3A 1OPZA 2VG6B 4DL2A 5CQGA 4Y2CA 1Y0HA 2H5EA 3MEEB 2DH9A 2J6TA 3BDEA 3DHWC 2WSFC 3H8YA 4U9RA 2YUJA 1JLQA 1XC9A 2Q3PA 2MKHA 2OD6A 2BJDA 5HMWA 3DLJA 1U4BA 1X4DA 3MM7A 2W24A 3HHLA 3TVKA 2PD1A 1LWCB 3MDFA 2W7AA 3M1VB 2CQ4A 4TN2A 3BQ2A 2ACYA 3UD3P 2LQ9A 3DRYA 4O23A 4PG5A 1T05A 4DQPA 1KN6A 5LSOA 2JA7A 5A0YB 1FDDA 2E1CA 3GYXB 4ES3A 4Q45A 2HWIA 4IRKA 1JMTA 2ZE2B 1E6YA 4C3MA 3K2YA 4MK8A 1YG0A 4ECVA 4NZ6A 3UR0A 2AWZA 4NLPA 4X4VA 2CJKA 3PW7A 1OPIA 4PWDA 4Y6IA 2DO0A 3RTVA 5IS2A 4EZ6A 4USJC 4LJMA 3THVA 2B3TB 1UA0A 1M5HA 1L3UA 1UJ5A 1M5VC 3IS9B 5J1NA 1OSDA 3IC1A 4RW7B 5IT4A 1XN9A 2PFFB 3ISZA 2R92A 1WG1A 2I38A 3GV5B 4ECYA 4DFKA 4OX9F 2G5DA 1LFWA 1S0OA 1LQ9A 3EUNA 2VPWA 4A8WA 1BQMA 2KT5A 4DFJA 1QVFR 3FSYA 4RW9A 4RNMA 4DR4F 3Q24A 4A8MP 1DARA 5L1IA 2EKYA 2ZITA 3MWBA 2FHOB 4KC5A 4PPZA 4FNIA 3GWCA 4R0EA 4WFZA 5C25B 2E5IA 5JVGQ 1X0FA 3N01A 1W25A 5F3ZA 3HHNB 2I5JB 1FRIA 2YY3A 5L8RC 4A8OA 4ED2A 1U2RA 1TL1A 1AA6A 2AX1A 2VPXA 4NLDA 3CQZA 3LGMA 5IQQA 2F9DA 2NQPA 2E9ZA 2EBGA 4CH7A 2WCXA 4DSEA 2UVRA 2JIOA 2NVYA 4TY8B 4CH0S 2JH3A 1M5SA 2AGQA 2MJUA 3AHPA 2VPXB 3TOQA 1HHSA 1T3OA 4YQWA 2B4OA 2L08A 1QJHA 2Q6CA 2B43A 3D1HA 1P1LA 4RZRA 4QOTA 1MROA 2COLA 3KYLA 4QW9A 3BF4A 2ABYA 3CTRA 3KG4A 3QWUA 1HWUA 4C8MA 2OPQB 4URQU 1RT2B 4TLQA 1KNZA 4R5PA 2LEBA 2DNMA 4ZPTR 2XY5A 1VJWA 3H59A 2UU9F 3BGFA 2HNZA 2MKIA 3R5AA 4QWCA 4DPOA 5LJ3Y 4XIUA 3DXBA 4MFBA 2GJ2A 1FVSA 2Y0SA 1TKXB 1U1PA 1JLEA 3J7A1 3O6QA 4W90B 2CFXA 3J7YU 1URNA 1NEEA 2K7KA 4LF9F 4QZVB 2KJVA 1FEEA 3BO2A 4GA6A 5HLFB 4KHPF 2R2SA 3E01A 3MCSA 4HI2A 2CG4A 4USHA 3G86A 3KFWX 1W2BR 2ROGA 3H4BA 3AH6A 4ZPVR 4V19X 3P96A 3CCTA 2VFTA 1QTMA 1VQ9S 2J6UA 4FN5A 5DRKA 3VF0B 4DL5A 3CCUS 5BYSA 2ERRA 2XSFA 1SL1A 1D8YA 4KE5A 2QA4S 5D6GA 5H9FJ 2V4JA 4ALZA 1KQGA 1X4GA 2KYXA 2NR0A 5KG0A 5MAOA 2WAQA 1N5YB 1LXNA 1P1TA 2A18A 2RD5C 3M9MB 2VPZA 1ZC1A 3MM9B 3K59A 4EYHB 2RRAA 3OXGA 4ZP6A 3ISNC 1KTVA 2WHOA 5DS7A 2XI3A 5DO2A 1SKRA 2UZAA 4Q2MA 3RRKA 3S1TA 4KFBB 2PNWA 4HKQA 2CIMA 3DDNA 3IGVA 3HU3A 1P8GA 3RAMA 1UETA 2PSZA 3TANA 2FJXA 3CMAS 1JLCB 3MFIA 4YB5A 1TK5A 1HNXF 2B63A 1WG4A 4NRUA 4HT5A 1BQXA 2CQIA 2V8GA 2PDAA 4WZMA 2RQCA 2HHUA 4NL5A 1OWXA 4PUOB 1H0HB 5EWEA 2HIQA 3VR1A 3DFEA 4TLRA 2IV2X 3SSSA 2YKNA 2HHXA 3MMCB 3LW5C 4QYZJ 3I5AA 3VQSA 4ZPBA 3FEYB 1S9FA 2M7SA 3T1AA 3TAQA 1WEZA 1FRMA 3QGGA 1YITS 1VQ6S 5CZVA 2AW0A 4LFCF 3EXYA 4EO8A 2V4RA 3LPYA 3OSPA 1DURA 3OTOF 3DN9A 4QQBA 2ZH1A 1RYRA 2YKPA 5BR8F 4DV1F 4U7CA 1RT2A 4QIWA 3Q22A 4FVMA 4U6PA 3PW0A 1X9MA 4DFPA 4N41A 1NK7A 5AJ3F 4G6VB 2B7CB 2ZH4A 4FS1A 4NLTA 2AYGA 2WW8A 2POKA 4ID5A 2PEHA 3C2PA 3RAQA 3SV4A 4F3OA 4ZCIA 5THWA 2KHDA 3T5LA 1MU2A 1JLBA 2AYMA 1IKYA 3ZFVA 1N8RT 3GTQA 1U49A 5IQ6A 1ZZNA 3D0HE 1VC6A 3DMJB 1G7CB 3HLUA 3GQCA 3H2LA 4KO8A 2ZHOA 5KG5A 3QZ7A 3GIMA 4O4GA 1IBKF 2F1FA 2XSJA 3IAS9 3J7YI 4Q43A 2R9LA 4RWXA 1UJ4A 3GTLA 3I4HX 4CT8A 1HNVA 4PUOA 4IO1A 5E7OB 1SKSA 4F4ZA 2C3OA 1Y00A 1YI2S 2ZNYA 1V3RA 3MM9A 1UHDA 2NREA 3F44A 2FIUA 4DL3A 2PI4A 1HHTP 4M95A 2KM8C 4K50A 3KLFA 2C42A 2CVIA 2M70A 3KK3A 3QJJA 1MSWD 1UKUA 3BZQA 2B4PA 1RA7A 1HPZA 1X4EA 1MWZA 3HHEA 2HFOA 5E3AA 3ICLA 2HVHA 4XPEA 3KLEA 2CJQA 1SUQA 2CQ3A 3N6LA 4YY3F 2VC0A 3U02A 2B5JB 2MQMA 2GO9A 2VZ9A 4I67A 3MMCA 3RB0A 2ZKUA 3IR5B 2J7UA 1R8HA 4B3SF 2R7XA 3VAFA 4DV7F 5C24A 1SJ1A 4H4MA 1TKTB 2B9XA 3GFHA 4HTIA 2QIFA 2UVWA