4NOHA

1.5 angstrom crystal structure of putative lipoprotein from bacillus anthracis.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
ATGIVMYGDETGVQQTMDQYKDKIESQNKFEAKLGTVNEKKVLIMNKTTAEKMVKENMLKKVVKEDVEPIKALPAISDEAGIVFAKEEQKDVVIDGKKMKYEGNVVIGDARKYTDMYAVVSDAEYAKISEPVKTIGLASFKENPKEKIFPDIKRGSKVEEAHMVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.5 Angstrom Crystal Structure of Putative Lipoprotein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Lipid binding protein
molecule keywords Lipoprotein, putative
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17294 Lipoprotein_22 Uncharacterised lipoprotein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.60 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4nohA02
3.30.70.3060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nohA01
4NOHA
chains in the Genus database with same CATH superfamily
3CO0P 1I51B 1RAEB 1RISA 1X4CA 3JQJA 1ZM3A 2VA2A 3DRXA 1AROP 4ZOSA 2HNZA 3UFCX 4KKOB 4DV4F 3BJYA 2FJBB 2VZ9A 2VONA 1SIWB 3GJTB 4I1TA 2XM3A 2DGOA 2ZD1A 3EVMA 4C8KA 2N3LA 3DGVA 3QLHA 1KR4A 4KGZB 2ENGA 2OD6A 1ZTWA 2DMRA 4FS2A 3ZZUA 2HWIA 2BQ3A 3DRYA 2AGOA 4ZVHA 3I6PA 5E41A 2JL9A 4WBFA 5F3TA 1SJ1A 4YR2A 4JI7J 1VQ6S 1M5VC 4N76A 3HHNB 3VF0B 2FLOA 2F5GA 5J2QB 2HMIA 2OFGX 3I0RA 1N5YA 4OX9J 2RILA 2GHVC 5D0RA 4C7QA 2HRUA 4J9OA 2YH1A 2UXCJ 4CT9A 4Q8FA 4O44B 2D69A 2XLIA 2V94A 1HR0J 2DR8A 4JI0F 2WK4A 4O4RA 4R25A 3K5MA 1RT3A 3CPWR 3TANA 4YB1P 4ZDNA 5IWAF 3KK3A 4GKKF 1LQ9A 3M30B 2F4VF 2QTWA 2GCFA 1CULA 3HD1A 1B64A 3A3NB 4B9TA 2K3IA 3PJWA 3V5RA 1BWEA 3ENAA 4OZ1A 1C1CB 2CNKB 4YB5A 3V2UC 5AE2A 4WE1B 4UQGA 2MB0B 4QCLA 4DN0A 2NYHA 1LW2B 2B4VA 2DNMA 1WSVA 2VDHA 3HSGA 2UUAJ 3LF0A 1FRXA 3MPVA 1O51A 1QAIA 4B9VA 4X4UA 4ED7A 5FTJA 1KTQA 3SCLE 3HVRA 4OZLA 3CCQS 3RB3A 5D3GB 2J5AA 1YJTA 2J7KA 4C11B 4JUZA 3K5LA 2DO4A 2C2OB 2QG9B 2P9GA 3D28A 3G82B 4IFVA 1S1UB 4LF1A 3Q8PB 2YPYA 3EMTA 4DX6A 1NK0A 4QR0A 3ILOA 4DV6F 1U47A 3GG1A 4NYOA 2DNZA 5KFSA 4DF8A 2QL9B 3ETOA 4CYUB 3B4MA 1VQ5S 2OEKA 2R42A 2J6UA 1MMNA 3R5DA 1Y5IB 4JP8A 3BDPA 4EZ9A 1V5VA 3IC1A 3BR8A 4QPTA 1N5VA 3M7VA 4USWA 2W9CB 4DV1J 5KT4A 1HNXF 4NCGA 4ZPCA 2UUBJ 4PRFA 3MDFA 2W2QP 4X4QA 4NZ0A 4P2MA 2J0WA 3SCJE 4YY3J 2ADCA 2WB4A 2VFTA 3HULA 5I3PA 3Q8SB 3EM1A 4Z7CA 2QYGA 3J81U 1NJYA 3OTEA 4AXIA 3L7OA 1ZOTA 2BABA 2FHKA 3LWLA 4UZBA 2UU9F 4FNHA 1F9FA 4OYWA 2DNKA 1RAIB 3OV7A 2HQFA 3TUZC 3EVOA 5JVHQ 3CEDA 1UP1A 4CM0A 5IM0B 2NQPA 3MPWA 4BLGA 1TAUA 2Q43A 1YJVA 2ZH1A 2ZUGA 2G6GA 4I4BA 1FXDA 2C2DA 5KFFA 4HYKA 3N28A 3CMAS 2AYBA 4NYZA 1WG4A 1YJ9S 5EWGA 2I2YA 4K5RA 4DQRA 3M8PB 2FD2A 3JSMA 2HLTA 1RT5B 1P27B 1UVIA 1NZ8A 3O5AA 3HJFA 2EG2A 4PUOA 3QRPA 2FYXA 1DMSA 3OUGA 2EFVA 2QT7A 1XMOJ 2L41A 5EHHA 3F0NA 2ZC4A 2PNWA 2I0XA 3LW5C 1HNZJ 3NS7B 2Z58B 3AFGA 4TYAA 3RBXA 4DUYF 4YOEA 3OSPA 3U1LA 1VC0A 1EETB 1H0HB 1RTZA 2N82B 4F4YA 3VWSA 2J0QD 1PBUA 1S49A 1X0PA 2YQ0A 3N01A 3WZ0A 4ES2A 4B9LA 3CCZA 1U2RA 3GFHA 5IV4A 4J9PA 2JJ4D 4AL5A 3R9LA 4JI4J 3D9BA 3O8WA 4GKJJ 8AT1B 2Z57B 2MHEA 1T8EA 1ZYRD 1HW9A 3FBEA 3VGVA 4KV8A 1NK7A 3T1YJ 4K4UA 1SQFA 1YBTA 1F9EB 3NL0A 2G1DA 3LP0A 2ZE2B 1KQGA 1RTHA 2A2CA 3O6QA 1HD1A 1IKWB 2LXIA 3MTKA 2WRMA 5KFIA 1SJ4P 3BYRA 2QMWA 4LF4F 3SQGB 3VZHA 3EZOA 2YX1A 5L9NA 2OPPA 4B17A 2POKA 1HNIB 2B4PA 3KHHA 1NHVA 4FVMA 1CC7A 1S6QB 5K8OA 1D0EA 2IVFB 4CTAA 4ZLJA 5F9NA 1R0AB 2DNOA 3GU0A 1CJKA 2UZAA 4ZN3A 2YU9A 4CLUA 3JSBA 2UUCF 3W1YC 2VQEF 2ASDA 3NY0A 1SQEA 2XMMA 2B56A 4F67A 5F8GA 1XWLA 4PG7A 2ZJQQ 1S5ZA 2H65B 3DMRA 1HMVA 4J9SA 3CUNA 1JXLA 4CNYA 4LJMA 5KG3A 1VQ9S 1V3ZA 1S7IA 2M8DB 1FEEA 4B3SJ 1BW4A 1BQNB 1UWBA 2DNYA 2DTJA 3AAWB 4IH5A 5J1EB 1ZA1B 3PR4A 4A8FA 1PYUB 4P2FA 1UL3A 2G0CA 3LP2B 3MR5A 1U1KA 4P2XA 2KFZA 2DKOB 3ZNUA 1FX2A 1WHVA 1FVQA 1TMJA 2OPQA 3A3OB 2GW8A 3SCKE 4I7FB 1Q81T 5KT7A 1DFDA 1R31A 3ETMA 3X2GA 4QU7A 4B9SA 5B0EA 4H4MB 4WP8A 1FXRA 2CQGA 2JX2A 5J2PB 1H98A 4HACB 1TQLA 2OSRA 3TP2A 4YMEA 1E5VA 2ZDPA 3SI8A 1S9EB 4AFFA 4L6V3 4QIGA 3BBFA 2E7ZA 1BD6A 1B99A 2IYIA 4R0JA 4DR5F 4IDKB 1S0OA 1RADB 3RZAA 1HD5A 1CS4B 3BQ0A 3QGIA 3G6VA 1X4FA 3C14B 4YFUA 1RACB 3RYLA 3PHTA 4DS4A 2UXCF 3TJAA 5FTNA 1O5JA 1SUQB 4WU2A 1Q8LA 1SQGA 4JI8F 1KLMA 3DN9A 2ZBRA 4XK8C 4JP6A 3SFGA 4DR1F 1QUPA 2QRRA 3RG6A 1BQMB 4KR0B 1N5TA 1QY7A 2DGSA 4CI0B 1U49A 3F44A 4F7VA 1HBUB 5IWAJ 2NLWA 3VAFA 3FUYA 3QJJA 2Y0SD 4Y3CA 1VRTB 4Y34A 4A8MP 5KOXA 1JIHA 3C3LA 4BC7A 3DLLQ 1J5OA 2AZ1A 1I50A 1Q78A 2O66A 3HHEA 4DEZA 1SVDA 4U8YA 3VAHA 4ES3A 3Q8YA 3DLEA 1K1QA 3R1LA 1FCAA 3NOCA 5H9EJ 1S4EA 2XZDB 2YNGB 5JVGQ 2RT3A 3TJ9A 1PQFA 2B6AA 1TL3B 1ZAXA 2GS8A 1S4FA 1H2TZ 4NLOA 3KLIA 4W92B 3DOMA 2DIVA 3PYGA 4IH6A 5C25A 4A8KA 3NGRA 3UVJB 1PYOB 5BR8J 3EGNA 4ECXA 2BKNA 2J8AA 5CD4H 1SJFA 1WUUA 1RWVB 5IQQA 2HVHA 4DV3J 4LFCJ 3R7NB 4QYZJ 1CLFA 5AT1B 4XDCA 3HSDA 2LMIA 3DLJA 1F2HA 2V4RA 3T1HJ 4KGXB 1VS3A 4P10A 3CNQP 4C97A 3GJRB 6FDRA 4DU7A 1IR1A 5HLFB 1N34J 4DV1F 2MXYA 2UVWA 3GTPA 3B6BA 1YBAA 1ZBTA 2N7CA 4F2RA 3GYNA 1RWUA 2DY9A 3BBCA 2ZBPA 1Q82T 4MKVA 1SL2A 4YY3F 1WOSA 1MW7A 1R9TA 4ZK7M 4DV0J 2HGNA 1CEZA 5HK4A 4RU2A 3PYFA 1VMBA 2EG1A 2WW8A 1LW0A 1S1XA 2KB2A 5KFOA 3PX4A 1HKAA 2D3UA 4TNOA 4RL1A 2EFPA 2OLWA 3FFIB 3KHRA 5E3QA 3IRXB 2R92A 3MM5A 4OL8A 2DGQA 2W2NP 5AE1A 4LFBJ 2HZCA 2VPXA 3QBCA 3TZXA 2UP1A 1A0OB 3PV8A 4KIAA 4A48A 2VG5B 4Q5VA 1QE1A 4L72B 1JWWA 5F41A 5J1PA 1H38A 1GK8A 2JRSA 2KKHA 1TL7A 4BHQA 2H9ZA 3SMZA 2YNIA 1T11A 2FVCA 2L9WA 1VGYA 2O5DA 4MYTA 4ED0A 2YKNA 3IGNA 1KTVA 3WBZA 1KQFB 1VIOA 5AXMA 3I82A 3G96A 1HNWJ 5HSPA 4QYZK 2E1PA 4ED1A 1F5BA 1GFWB 3MR3A 2EKNA 3EZ5A 3C15A 1VQKS 4QU6A 4C8OA 2AIRB 2CQHA 4ZVGA 3S7RA 2HRYA 3CJQA 5JXSA 1IKYA 1IKXA 3C8YA 2ROEA 3POTA 4BWMA 3TEHB 1XR6A 1IVZA 1GX5A 3IWLA 4GKJF 1OY6A 2BE9B 3NCPA 4HHUA 1T95A 3KJVA 4GC6A 7FDRA 4ED4A 1HA1A 1PPYA 3SULA 3MMCA 4RPFA 4O4GA 4TY9A 3MM8B 5ETKA 1L3VA 1LW0B 1S1XB 4TYBA 5G0RB 4AE5A 1KOHA 1AZSB 2E5LF 1U0HB 4FBUA 5L46A 4B3MF 3BYPA 2GAEA 3S1TA 3JAMU 5GAGI 2JEIA 3I56S 4N8OA 2R2SA 4PWDB 1Q1KA 1RLDA 3FQKA 1WTFA 1M5KC 1M1HA 3OR1A 4DL6A 3MD1A 1EQ0A 3CCRS 4LR7A 3QFWA 3DLGB 3R6LB 2XI3A 3W5YA 4ZITA 1VQPS 3TX0A 1KEKA 1VRQC 4NLXA 2V4JB 4ZCLA 2PI4A 4KJIA 4UQTA 2UUCJ 2V9WA 2CQ0A 2C3UA 2NSCA 1Q79A 2XY5A 3DOLB 2MSTA 1RBLA 1IW7D 1PC4A 4NMLA 2DGWA 3ML1A 4K59A 1RHKB 3UVJA 2OAUA 1YJUA 5C25B 4NXMJ 4LF2A 3EX7B 2PMHA 4BS2A 4UF4A 4Y2CA 3KLEA 1TL3A 3X2JA 3R5JB 4DR4J 2LFVA 2XO6A 2M5YA 2EPIA 3D68A 5E3AA 2DPJA 2CPEA 1R27B 2YWHA 3BPSP 2H1YA 2NPIA 1N52B 2BE2B 3GV7B 2QA4G 2QJ3A 5FTKA 4GMKA 2XZWA 4WIQA 3HF5A 4Z2XA 5LOQA 3J81Y 3DLKA 4MKBA 3X2KA 2KT2A 5HLFA 3W9IA 1E6YA 4DSFA 1E6YB 1M1KT 4X4NA 2ERRA 4MAKA 3PRDA 1W2IA 1RZMA 3GLJA 3Q0AA 1RDRA 4M5DA 2WAQD 1UVNA 4K4YA 2E2IA 3OXLA 2HQIA 2XMWA 1UHEA 2AEJA 1NUEA 3BKFA 3W2VB 2CQPA 1QAYA 5C2CA 3M8QA 4QW9A 2FJVA 4DL0C 5FDLB 2ZH8A 4IRDA 1MWZA 3S6EA 3CTRA 3VAGA 1F9HA 2OO4A 1ZYQA 2ZH3A 3MAQA 3C14A 1L3TA 3GB0A 5C24A 3HI9A 5F0UA 1U1RA 1TWFA 2RH3A 1HPZB 5B09A 3NXZA 1GT8A 3T3FA 3BO3A 2GHWA 4GC7A 3IR6A 2YVSA 3DRRA 1BMQB 4AYBD 1MU2A 2DR9A 1D09B 4RW6A 4N41A 1GAOA 4F3QA 5DGAA 1PJ6A 2D1CA 1EKSA 4RUBA 2ZZTA 4PYDA 2IM3A 2OGUA 3CCES 2LQ9A 1TWHA 1R8BA 3PW4A 1R43A 3GJSB 2W9BA 1KHWA 3FSYA 4EBDA 1JX4A 3R5GA 3MM7B 2HHQA 1N54B 2AV5A 2JIMA 4QIEA 1UWBB 2M52A 3MMCB 4WIIA 4PQUA 1RAOA 2ABYA 2CIMA 2G9OA 1TU0B 5D0HA 2XSFA 2GVDA 1HMVB 2V8HA 3WQPA 3KK1B 2CPZA 2FVRA 3Q24A 3T5LA 4KGMA 1X5OA 1EP4A 1ZETA 2WBRA 5DG8A 1RUSA 2UV8G 1RHRB 3VQSA 2PFDA 3A12A 4LUBA 2RDJA 1IQTA 2JLGA 1NO8A 4CTAB 1V3SA 4CM2A 4OYIA 4O3SA 1X5SA 2DEJA 3IR7B 4C8NA 1KS2A 4X2BA 2V8DA 3OR2B 1TP7A 1J2VA 2OPPB 5DO2A 3M6UA 2IPOB 4R0EA 3SQGA 4F0HA 2IVMA 1WTBA 1NJXA 2FLPA 2VASA 1M5HA 4XO0A 3BGLA 2Y0SA 4DFPA 4LT6A 1TL7B 5CXTA 3D3CJ 5C5JA 5DM7Q 3BSAA 2HS0A 2NPFA 1PT1A 2IC3A 4Y2MA 5DG9A 2GO8A 1JLAB 1WOOA 2V63A 2OI2A 1LXJA 3KJQB 2X7IA 4EMDA 3J7YI 1LKZA 2QA2A 4V19X 2DRAA 2MZTA 3G71S 3R5AA 3KMQA 5IC4B 1CVJA 2NVXA 2XLKA 3ILIA 3AOCA 1CJTB 1UCNA 3MXHP 2B51A 5AXNA 2HK3A 2KQAA 1S1TA 5BXIA 3PZPA 2CXEA 3DRPA 4OZ2A 5C2GA 1N4LA 1QLNA 3QPIA 2HHSA 5T5MD 1HNVB 2LQ5A 4M5IA 3RRKA 2NZCA 2V0NA 2ASYA 3TVKA 2NR0A 4K50A 4CP5A 5B0AA 2MQLA 1PYTA 3DYAA 1N10A 2KYZA 4O3PA 3K57A 1X5TA 1VISA 1U24A 1GXTA 4OX6A 4GO5X 1MG7A 2JVRA 3NMRA 2B9YA 3BN7A 4C48A 3MEGB 1O6XA 3TI0A 4Q43A 2KM8C 3ULHA 1UVJA 3GV5B 2VJUA 3IN5A 4MJKA 2LU1A 2CPDA 1VQYA 2COLA 1XQIA 5B6CA 2N7YA 3IXQA 5A8WA 3KLHA 1URNA 4KODA 4EZ6A 3CT9A 2RDIA 1TKZA 2I38A 1JLGA 3W66A 4JYAF 1JLAA 9RUBA 2E5LJ 2IC3B 1ZTTA 2KZMA 1XMQJ 1YKWA 5D4LA 2MQ8A 5T7LB 2FZKB 1QCSA 2W8KA 4NE9C 2MY7A 1X4AA 4M5JA 4RW4A 3W60A 1B70B 1ZS6A 4RZRA 3H0GA 3DHWC 1VJQA 2CJ9A 3BH7B 3TARA 5GAEI 4Y00A 1Y0HA 2B43A 4D3GA 1TWAA 3ISND 3ZZ0A 3KK2B 3VGUA 3J81j 1N33J 1JLFB 3RGIA 1QSLA 2HHVA 4U7CA 2BKOA 5KG1A 3OPKA 2ZH9A 2E7XA 3PIOQ 3C46A 3ET6B 1T02A 3QJPA 1H7WA 1S7HA 1SCJB 4O3NA 1NEEA 1EP4B 3I4PA 4Y28C 1WKKA 4X4OA 1KDNA 1SUQA 3PX6A 2P5VA 3OJSA 4WZQA 1N48A 2HHUA 3MMBA 4NA1A 5D8HB 5DYGA 4FF4A 1TFWA 2PJJA 3N6MA 2WOMB 1FEHA 3M6VA 4AVRA 1TELA 2H4WB 2X1FA 1YK9A 2W4DA 2X1BA 1WORA 3BGRB 3I31A 3N5BA 4QWAA 3H5YA 3OFFA 4WE1A 4CIOA 1EARA 4WF9Q 1GXLA 1QSYA 4PXEA 4L48A 1YSJA 3H5SA 4BCAA 2W7AA 2AQ4A 5LJ5Y 1X9MA 1EB0A 1UVLA 4DFKA 4RW6B 4MK7A 2FB0A 3NCRA 4KLNA 3U1MA 3M6WA 3IR6B 2HBQB 4M5GA 1SH2A 2DR7A 1FE4A 2RVJA 4DPOA 3TQ1A 1HPZA 2KVIA 4CH7A 2E1RA 3HU2A 1S79A 2DISA 3P8BB 2QFIA 2ZM6J 2VKZG 2YNFB 1YHQS 2V4QA 4HHJA 2RQ4A 3OFEA 2CQ3A 3KMSA 3L9ZA 3BO4A 1AFIA 1BE4A 1F5AA 5FDLA 1T9WA 4OV6A 2R93A 3SXLA 1PT0A 5K8MA 1VBKA 2HMIB 1D9AA 4DG1A 4J9MA 3DFEA 1CSJA 2HK2A 2R8HA 4K2JA 3M3GA 2VQFJ 1R0AA 4YS2A 3W63A 4FYDA 1E6VB 1REVA 2HFNA 1R6YA 1Q7LB 1DLOB 4NLSA 3RB0A 3TAQA 2DNRA 2Y1LB 4NX9A 2X1AA 2BE2A 5GVQA 3H4DA 3THVA 4JI7F 2Y8YA 3TZZA 1EU1A 1FJEB 4RBTA 5KFKA 2R2TA 1GMWA 1PILA 5KFMA 4ZPTR 2BJ7A 1ITPA 3WC2A 1NRKA 1F3FA 3UI3A 2C22A 4K0KJ 2GQ2A 4KV8B 2HFOA 4ITSA 2G13A 3HX9A 2BV3A 1RBOB 2XS2A 4IRCA 2V8PA 2AJQA 4FFTA 4BBYA 2QV6A 1LWCB 2G2OA 1CR5A 2NVYA 1S6PA 4PPDA 3J7AN 2GGPB 3M2VA 5DYIA 2QLJB 1ZPVA 2JOQA 2YNHB 3R7BB 2V4JA 4Q45A 2OIHA 4DR7J 3AY0A 1SC3B 3LOUA 1CG2A 4J9RA 2AGQA 4WFXA 2PMWA 4BDPA 1FXLA 4QBUA 4K4SA 3JSRA 5H9EK 1WC2A 3OR1B 5LSOA 2XHCA 4LFCF 2XB2D 2OP5A 1WD6A 3UR0A 2V9KA 4W98A 1R7IA 3RW7A 5EX3A 2ASLA 3EXCX 3L4BC 1WC6A 4NLPA 5LSLA 1PO6A 1U0HA 4M95A 4LF9F 3T5JA 2NXJA 2HFVA 1RSCA 2DD8S 3MM8A 2DH7A 4IG0A 1RTJB 1CQMA 3M2UB 2BOAA 3KJVB 4ECVA 3CXCR 4DCPB 2RRAA 4JV0A 3IP0A 2DH9A 1CJUB 2WB1D 1HHQA 1OQ3A 1TZ0A 4OJ3A 4CO5A 2BJ8A 2NUUG 4ZLLA 4B3RJ 3K5NA 4TU9A 3BSNA 1RWXB 2HAIA 3BEGB 2HWTA 2EFGA 2HWHA 1A9NB 1FE0A 3UN5A 2KH9A 2J9CA 4TVAB 3NGTA 2HQGA 4RV0A 1Z2ZA 3RU0A 4LF8F 4CO2A 4F0KA 1TUWA 2E1CA 4NCGB 4FPIA 3AB4B 1NDCA 1Y4ZA 2BXJA 4PKDB 4ENGA 4DFMA 2VPZA 2H51B 3WIVA 3JS9A 2IM1A 3NCQA 2E7WA 5DETA 1JJ4A 1QE1B 3NKYA 3K59A 4CYUA 4QIVA 1RTJA 1H74A 2L9DA 4WTYA 5ETRA 4DLEA 2VUGA 2RUSA 5I42A 3IRXA 3EICA 7FD1A 5DLGA 2D9OA 2LVWA 2DNLA 5HVFA 1AA6A 1Y10A 3ITHB 1T05B 4JI5F 3JQMA 1OPIA 2V2KA 3I0SA 1YJRA 3R6GB 2GZOA 4KRWA 2QZ8A 3GCXP 3M1VA 4OI2A 4ZCKA 4USMA 1XMQF 2B8QA 1OPZA 3DOKB 2RB7A 5KFXA 2MZJA 5LMUF 2XYHB 2CPJA 1U6BA 2FTRA 5D77A 4ZP6A 3MM9A 1C1CA 3PLXB 4V19J 3ENVA 3V4IB 3GTQA 5IT0A 3GIRA 1S6PB 2HLUA 2GJFA 1F0XA 2J7WA 1CBKA 2ROGA 1VRUB 3X2PA 4M5MA 2CDQA 5B7WA 3PW0A 2H48B 4FF3A 2HBYB 3P3DA 4IQMA 4L75A 4PAAA 2JDJA 5GMEA 6AT1B 1EQMA 1IWGA 5A76A 3NWRA 4RJVA 5B08A 4NLVA 4X4RA 1NLKL 2XULA 4ICLB 2B63A 1XC9A 1D8YA 1AYEA 3GWCA 4KH0B 4KQZA 5MAOA 1NH7A 3PIPQ 3CCJS 2G2ZA 4K2XA 4F36A 4LREA 3KDNA 3M2RA 4DX8H 2LDYA 1YWXA 3KLIB 1NDKA 3IAS9 3W5XA 2EEYA 5AJ3F 2CVIA 2W24A 2MGZA 2AYGA 4PYAA 1NPPA 2CNNB 2RKIA 2KZZA 1RJJA 2MEWA 4GVBB 4HVZA 3JAMY 4WZMA 4LIRA 4XPCA 4F26A 3VAMA 4N47A 4YR3A 4DV5F 3HSJA 4DPUA 1IKVA 2CJXB 3GTKA 2UUTA 4CLYA 3C19A 1DBDA 1PAUB 3GJQB 3GONA 3B82A 3FDSA 3T1YF 1P1TA 2L3MA 1T0TV 1MN9A 2DEIA 2EBGA 4FKYA 1Q8BA 5EDWA 3IRWP 2LKZA 1HBUA 3RUBL 4K5SA 1HI1A 1FFGB 1SBRA 2YNFA 3ZZPA 1Q86T 1BQMA 2D74B 3A8KA 3OT9A 4X4PA 1VQNS 2ZM6F 4F2SA 1HHTP 2F4FA 3D1QA 3EE3A 4ZMMA 5C42B 2VPYA 3TO8A 1U45A 1U25A 1F3VA 3U27A 1N8RT 2FZCB 3BV8A 3DDNA 1FJ7A 3GIIA 1YX2A 1FFWB 1JKHA 1Q8KA 4WXWA 4FZVA 2IM0A 2VBWA 4WU3A 4CT8A 1WDDA 5F8LA 4FF1A 5IT9U 2DHHA 1WHXA 1T9YA 2HSEB 2RSQA 3GMGA 4J9VA 5IC6B 3UD5A 1ZM4A 2JWNA 3DM2B 4YUDA 3HT3A 3IWNC 2Q6BA 1JQGA 3ADAC 1YRXA 4DN9A 4DL2A 2HHHJ 1VC3B 3SDEA 1IBKF 3JTOA 3H5UA 5ETTA 4LF5F 4IO9Q 4F02A 1RHJB 3O2IA 2Z56B 4NA2A 2JIQA 2EFNA 4I7FA 1WC5A 1SB6A 2EBEA 3SUJA 2Z0GA 3MMBB 5GLFA 1C0UA 3QT5A 4I2PB 4OYBA 1RKJA 3UD3P 1SKWA 1L5UA 4HL9A 4URQU 1U1QA 4OX8A 1PQEA 4J9QA 2R7TA 3PNIA 2FY1A 3KG0A 3ZXWA 1OA9A 1APSA 1I1GA 2CZVC 3MCNA 4ED5A 2PMZD 1KOOA 2FC8A 2QLWA 3HHLB 4CLWA 1WG5A 2OEMA 4X62F 1JLEB 1SXLA 2Q6CA 2B9WA 4I0WA 5HO4A 4WFAQ 4A8OA 3NNCA 2NZ4A 1LWXA 2PI5A 3W64A 1NSAA 3F73A 2JLFA 1RB0A 4NI2B 5L8RC 3BZQA 4JI2F 2YXLA 1IUJA 1SI9A 2KT3A 4C3LA 1K9MT 2DPIA 1RHQB 4DR7F 3A13A 4L3KA 4A8XA 3KLFB 2PEHA 5CHCB 4LFAJ 2YUJA 2XI2A 1NK6A 1S3SA 5T7LA 1D9FA 2R7VA 3P49B 2FDNA 3FMBA 1DHMA 2OD4A 4WTOB 4ECWA 4DSKA 1JLGB 2M2BA 3HHLA 4RNOA 4ALZA 5KT3A 4C8ZA 2J76E 1IKWA 2QO3A 4ZVOB 4BC9A 4DQPA 4NL5A 1FF2A 1NK4A 4TN2A 2YKPA 1ICEB 1IWAA 1FT8A 3CDWA 2CJAA 4LSNB 3WC0A 5A6PA 5I3QA 1FDOA 2RF2A 2V69A 1S77D 1P9QC 5F9LA 4CCHA 4JI1J 2M8HA 3PTWA 4RW9A 3WDOA 4J9LA 1QTMA 3MEGA 3OHAA 4XPEA 3CVKA 4FN5A 3R27A 2CW0D 3HVWA 5GAHI 4G6VB 3QATA 2O1PA 4USTA 4ZVRB 2HNDB 2J9DA 2VG7B 5KFZA 4DR6F 3SCIE 3OTOF 1M0SA 4RW8B 5B0GA 4OX9F 4AXJA 3AJ1A 1G3OA 1HNVA 1OYEA 1TV6A 2A3JA 2MKSA 3R3TA 2WONA 4OYPA 5KFJA 1K73T 3PKMA 2A10A 2CQ4A 1S1TB 1TKTA 1RTIA 1KC8T 2R4FA 2ZHOA 4S0MA 2VOPA 5E3CA 2CPXA 4OZNA 2KRBA 2WVCA 3Q86A 3G4SS 3KYLA 5HAOA 3P5BP 3KOAA 4HLBA 4IYQA 2YBVA 2AJ0A 2W7OA 1Q95G 3N4WA 3N5FA 4JI6F 4CO1A 4EO8A 2HFUA 4KDLA 2IRYA 2NXUA 3W65A 5DRKA 1YNND 3MFIA 3K5OA 4ETXA 2N3OA 1J5EF 2V2VA 4C8MA 3LALA 4C3MA 5CH7B 4DV2F 4F3OA 1VLYA 2ZDOA 4GVBA 3HP6A 3PJ9A 2GX8A 2E5HA 4LR8A 1I3OB 5DZ7A 1R8HA 3H25A 2CUYA 2XBPA 3Q22A 4ID5B 2BANA 1TL5A 5E5NA 4YHHJ 4U67Q 1U1MA 1BW3A 2HRTA 2K06A 8RUCA 4FG4A 1M1GA 3MHYA 3MPUB 5G4DA 1FX4A 5ADZA 3H0PA 1FRIA 2HVZA 5E0OA 3DGPA 2V2QA 2W2MP 3G6YA 5A8RB 3R5CA 3T9ZA 4C3KA 3PVXA 1NJZA 2JIPA 4AAYA 4OYZA 2RS2A 4ECZA 3CJ0A 4RUHA 1P6TA 3AODA 3W2WA 4QWBA 4WCEQ 5HJYA 2ZWOA 1RT7A 2VHGA 1TKXB 3BF4A 3FEZA 4CH0S 2W8LA 5T5ID 1TK8A 1T9XA 1TK5A 3MEEB 2NYAA 3G8SA 1OO0B 2IAJB 2VG6A 2OELA 1SH3A 1VQ7S 2IJNA 1Y7PA 2LP4A 1HNXJ 4LF7J 4QJVA 2UUBF 5EWFA 4Y2KA 3GIJA 3HK2A 3K5PA 4FYVB 3AT1B 3X3UA 4FNIA 5LXYA 5D3GA 2AX1A 5K9FA 4J91A 2U1AA 2FGOA 1YNJD 3UWTA 4ELVA 4TXSA 1LW2A 5L9XA 1Q8IA 1BWVA 1N88A 3ITHA 1T05A 5AE3A 1BC6A 3DRRB 4QR2A 3CD7A 4ELUA 2AF6A 2QSWA 3EXYA 3JTPA 2Q1LA 3BH6B 4UW2A 5B0FA 1S10A 1N0UA 2DBBA 3KLVA 4KTQA 1KSPA 5AXLA 1KBRA 1WC0A 2QYCA 4P7TA 3PW7A 5C24B 1XNQF 2CQ1A 3DNCA 5DDPC 1UPPA 4F04B 2E5GA 2IBOA 4DMRA 3DI6A 4P73A 4ANDA 2O5JD 3W61A 3W7BA 2VPZB 2MKYA 1FD2A 3BKTA 4RNHA 4Y6IA 5HQLA 1CC8A 1Y4ZB 1FESA 3ICLA 2VC1A 3M8QB 5HJXA 4RO0A 2H3EB 3PRVA 2WZ1A 4YDXA 3BDEA 3CQZA 1UEUA 2DR6A 7AT1B 4EYIB 2F8MA 4WFZA 1HBOB 2AWZA 4LSLA 4NWBA 1JNZB 3MOZA 1URRA 3NOGA 4TQSA 1TMOA 2K1RA 2VFRA 3QJLA 2OJ3A 2Z2MA 2YH0A 2ZHBA 2ACMA 1QDNA 3O3LA 1NB2A 3FC9A 3UCUP 2D3O1 2QGFB 4X66F 4GKKJ 1VHFA 4F25A 4P72A 1NPRA 4PXDA 3EUNA 4HT7A 1RCXB 3TA1A 1IBKJ 1FRKA 2FHOB 3OTDA 1RT4B 4FBTA 1YQHA 4RLEA 3EDQB 4OV1A 4OHXA 4IG0B 1PCAA 2IMWP 4PG5A 3KXDA 3BN4A 4ED6A 3GR0A 2Q3PA 1KKHA 5CYQA 3R8YA 1PBAA 4A47A 1VIXA 2DGVA 1VDHA 4Y2AA 2C2NA 2W9AA 2R2UA 4B3TJ 4JV2A 1X5PA 1PJ7A 4ZPAA 4LF6F 1A6LA 2H5IB 3UE2A 2R8IA 1HFEL 4L76A 1FDDA 4CDIA 2KI8A 2PSZA 5EUHA 3TUJC 3SQOP 4UT4A 2J6SA 3ZTSA 4EGLA 2C45A 1XMBA 4JB8B 4DPYA 2C2EA 1WEXA 3JQKA 5M2PA 1L3SA 4MIBA 2VD3A 3C2PA 4WYWA 3FZBA 2HCZX 3D66A 1YVFA 1U09A 2GGPA 5HBMA 1FJCA 3W9HA 4EI2A 3FCVA 2AJ2A 4DMZA 2GHPA 2IYGA 5JJBA 4P2SA 3MECB 5CYQB 4EBEA 4DL5A 1NBEB 1GMVA 5G0RA 4B9NA 4KY3A 5KFNA 1NM2A 2BE5D 2NXEA 3GTYX 4OI0A 4CO4A 4EEYA 4B3SF 2ZVSA 4WK1A 2CPHA 2JC1A 3BBBA 2MQPA 1HIYA 4OZ5A 4ILRA 1YI2S 2X1GA 1RYSA 4V1Ak 1Y3KA 4ETZA 1N36J 1F2GA 4DOZA 4EBCA 3CDBA 4XDDA 2IVYA 2N4CA 5IOLA 2ASJA 2LYVA 3MR6A 3S01A 2AJ1A 4UOCA 4JI4F 5BYSA 4JI1F 3SUKA 1F5CA 2PEBA 4H4OA 3HLUA 3NBPB 3GFZA 2LDIA 4ZPDA 3BQ1A 1XK8A 3MEDA 4CLZA 2ATCB 1HBOA 4JI3F 4OZ0A 5L1IA 2G0JA 2KI2A 3CJ5A 4NXNJ 3BGUA 4LSZB 2H54B 5M2RA 1S76D 5F8HA 5E3RA 4LBIA 3OTOJ 5HP1A 2XC9A 2MMYA 2Q79A 1FKPA 1S59A 5DZ6A 5J2NA 3CMES 2E9RX 2MKJA 5B0BA 4AQYJ 4W4MA 2AT1B 3DLHA 5A2QY 4MTPA 1TAQA 2VOOA 3GV8B 2QA4S 1CZ4A 1IJEB 1KLNA 3H4BA 2CNOB 3O1LA 4PCQA 4I6WA 3MM5B 4ILMA 1DY3A 1LOUA 1QD1A 2VH7A 2SXLA 3FKBA 3HJVA 5A0YB 4OYOA 5D6GA 3RR7A 3SYZA 2CJBA 2M9KA 3OTCA 2CJKA 3DXBA 4JI6J 4K4VA 1X4HA 3ENQA 1UTAA 3LH2S 2FUG9 4M8LA 3MFHA 4ZN1A 5IT9Y 3HSZA 1ELOA 2BJ3A 2EVZA 3CD0A 3HKZD 3OUYA 2FY8A 4ED2A 1J5EJ 1HQUB 3NEKA 2DH8A 3TAMA 4DV2J 1VC6A 4DUTA 1QVGR 1WHYA 4DR2F 2FVPA 3NNHA 1JLCA 2AYEA 2VG6B 5HATA 2WSFC 2ILZA 3QO9B 2ZEJA 2ZC3A 4F50A 3KJFB 1QAJA 1RT7B 4YHHF 1WCMA 3TIWA 3E01B 3DLBA 1SMYD 1E61A 1B0VA 1S6OA 4U9RA 3KG1A 3TNVA 1ZH5A 2BOPA 1FRLA 2MZRA 5BR8F 3PO4A 2MJUA 3DGPB 4Q7AA 3OLAA 2E5IA 1JMTA 4DV3F 4X65J 3I55S 1YRTA 1L8FA 2KL8A 2VJVA 2MKKA 5L1KA 3ZZYA 4K4XA 3H7HB 1OMSA 3KTQA 4A8SA 4AONB 3T1HF 4EO6A 1JLFA 2KG0A 4DQQA 4ZJQA 3BPDA 2RMLA 3K8VA 3KK2A 1BQXA 2HIYA 4FKXA 5F3ZA 1N34F 1N6QA 2HS4A 4G3IA 1DTTA 4USJC 1WDTA 4UOFA 5GADI 3HT0A 3AD8C 1VYAA 2HNYA 1BLUA 2RRNA 1U8SA 1Q0NA 3CW2C 3HHLC 5B0DA 2BACA 2VC0A 1IBLF 4ER8A 2XS7A 2LLZA 5BYRA 3V6KA 2HQCA 2WVFA 3DDIA 4LVNP 4CRJA 1M90T 3NNAA 2L08A 1H2UX 2K7KA 3ZC4A 1AUSL 4J7CA 2HHTA 1HARA 2DNHA 2ZVIA 3A3PB 3IBWA 4P7VA 2M0GB 5L1JA 1S72S 3X2MA 1TWGA 1DARA 3R5BA 4PG6A 2VL1A 1LFWA 2KJVA 1RTIB 2XMUA 3KG4A 4MYUA 1RLCL 5H9FJ 3UW1A 4X4TA 1WI8A 2QL5B 1V3RA 5BYQA 2D3ZA 3ZTOA 2JC0A 5HN0A 1SJ3P 2AMCB 2HW3A 4Q2MA 3THPA 1W2BR 1KVIA 4KYZA 2VG7A 3NAIA 1FNOA 3UPFA 4F4XA 1JLCB 2R8GA 3QRRA 1RAJA 3D0IE 4ATNA 3J80U 3HM9A 2R7UA 1HQUA 1AW8B 3TAMB 3DYAB 2DNQA 2ZZNA 2OHDA 2V34A 4HACA 4ZM7A 1IJFB 4TKTA 5J2PA 4WFYA 2P8IA 1NCLA 1U26A 2E7VA 2BA9A 2BW7A 2Y1RI 4H4MA 2F8EX 2CQ2A 5FTLA 1SIZA 5GMKa 5EWEA 5KFLA 4JV5J 2OPQB 4IR9A 2A2DA 4X66J 2Z8QA 1TKDA 4PWWA 4ZIVA 2HEKA 4P75A 1GMUA 2EXUA 1JLQB 4ZS6A 2P9EA 1TTHB 3NMAA 1T9UA 4AT1B 4LVOP 2DGTA 1Q5YA 2KHDA 4IG3B 4RR5A 3H5XA 1XIQA 4K7QA 4LRBA 2PICA 2B0GA 2RD5C 3MAHA 3QZ8A 1LEOA 1FWPA 3OL7A 4J5OA 4IOAQ 3FNNA 5B0CA 4DSEA 4LF6J 4F4WA 2CJQA 2H4YB 2YX7A 1T9TA 4PR6A 3WX8A 3THTA 4DFJA 2DGUA 3ZZTA 3OR2A 4JP7A 2DXEA 1X4BA 5KFPA 1E32A 3IR7A 2ZBCA 3AA8A 3V6DA 2ROPA 2ZOMA 4OZ3A 2QLXA 2B7BB 2HFZA 1UEKA 4ZP9A 3OVSA 3AOBA 1RK8A 1N5QA 1GTHA 1S1WB 3IAM9 2N4DA 2ZE2A 2KN4A 4JJOA 5FD1A 2FQQB 4NLDA 4BWJA 5KFGA 1LWFA 3FCWA 2MSSA 4DR4F 5GADU 2BUNA 2FIUA 4PPZA 1JJCB 3U7JA 2ZZMA 2PDAA 1P8GA 4I68A 1S57A 2ZJPQ 2W9BB 1WI6A 2R7QA 3DM2A 1YLXA 5SUHA 1PKUA 4DJBA 3V6JA 1N36F 5JMNA 1GH8A 1TMMA 2Z2LA 3W9JA 2DNNA 1UMJA 2CFXA 2MDAA 2XHWA 3PFOA 1VQMS 3DXSX 1DQAA 3B8HA 3K89A 2F63A 4CLKA 1F1BB 1KONA 1MU2B 2WVBA 5CYMA 4OFZA 3GILA 1FDBA 1RWNB 4M5KA 1UFWA 3EGWB 2ZKTA 1WKLA 4M1KA 1RWOB 4MT1A 5E3PA 5A8KA 2WTFA 5C7PA 3PW5A 4NXNF 3D4JA 1WF2A 4FVCA 2CPFA 5EGYA 4YB6A 3SV3A 3BREA 3SUMA 2M7SA 1M5SA 3JSMB 4G65A 4R8UB 1ZAWA 1WELA 2CDRB 4KAIA 4N77A 4NRUA 3P4UB 5HL7Q 1DTQB 2AP6A 1RT4A 3NGSA 3TAPA 1WWHA 1G1XA 2IDEA 1ZC1A 5THWA 5HANA 3AJDA 1H6KX 4O3OA 1WEZA 2FHJD 2MJNA 4OLPA 3R7SB 2Q66A 1GX6A 1KVJA 2UVUA 2FHMA 1S99A 2HHPA 3LQVA 3QYYA 1N32J 3UCGA 1X4EA 2HFSA 3DLKB 3WHIA 2KFYA 1NDPA 1SL1A 2BJ9A 1DTTB 2WSCC 2JA5A 2CWXA 3AD9C 4EUVA 5CCLA 2H5EA 3I5AA 4N7TA 4ZJOA 2KT5A 1ULRA 4C6AA 1M5PC 1L3KA 1YRUA 2DXDA 3Q8UA 1Y5IA 3IGVA 1ZM2A 3KLEB 1VOMA 1UHDA 1R8CA 1ZAVA 1WF0A 3LP1A 1QVFR 3E2EA 4MKAA 3GG0A 1EHWA 2R8JA 1G7CB 2LEAA 4E98A 3TX8A 2CG4A 1IM4A 2B9EA 3QGGA 4Q2LA 4C0BA 2KHCA 2HAFA 3G82A 1RWMB 3LTOA 4FXWA 2WW4A 3SEOA 3V4IA 3D3BJ 2BMBA 1WSRA 1WC4A 3E01A 4JCWA 2B5JB 4C11A 2RU3A 1MWQA 5KFQA 5A2QU 2U2FA 2YWEA 5I3UA 1UVMA 3DOKA 3UO0A 3UDCA 2K7JA 3Q8QB 2BRKA 1LFPA 3M1VB 4XTTA 4ECUA 3ZZRA 3RB6A 2G1HA 1HYSB 3T5HA 2VFSA 5F8JA 4YR0A 3H42A 3CD5A 1IBLJ 2MQOA 3LPEA 3MR2A 4FG2A 1AZSA 2IAJA 3KWMA 3N0VA 4ZP8A 4AD6A 1Q16A 2YKOA 1XTZA 2ZITA 1PYSB 3FSIA 4H54A 3TZWA 1PC5A 3M30A 4LBHA 3OBIA 3W2WB 4USVA 5CA5A 2F65A 1G6BA 2XO7A 2CQBA 3POTB 4OQJA 1IKXB 1VR6A 3SSRA 4DCOB 4QR1A 1RWWB 2PIIA 3M8WA 3M9NB 5C1BA 1K1SA 1X7VA 2RS8A 1REGX 2E9TA 1JNRB 3M8YA 3AA9A 4X4SA 4AL6A 3RRHA 2DY1A 1VK3A 1HLWA 1RE1B 5DJBA 1YBUA 3W5ZA 3N6NA 2YTCA 2MQQA 2BANB 3JTNA 3QZ7A 4MKYA 2KXFA 1R7RA 1T3OA 2QLFB 3BGOP 1HQ2A 3CGIA 4QIFA 5J2NB 2Y1IA 3MCOA 1UJ6A 4DPWA 4KDIA 2EEOB 1D3WA 2YKNB 2KG1A 1FHTA 4ID8A 2D7SA 4UOGA 1XJWB 5KG4A 2E1MC 3AOAA 5CYJA 3J7YU 3MEDB 4DQIA 2EK1A 4CLLA 3MWBA 3CJRA 1LNQA 4H4OB 1GMWD 3HKWA 4PQUB 2AEFA 4XAKA 4ZP7A 2VG5A 2D3OR 3DMJB 2W1BA 4QOTA 3H2UB 4G1QA 2VPXB 2XSJA 3AB2B 3MMAB 1K0VA 1G2EA 3CJTA 4PEOA 2W25A 4WYLA 3FVYA 3LWMA 5ETSA 3TWZA 2XLJA 2B7CB 5HVHA 2LA6A 1X31C 1TKTB 2ZOGA 4DX5A 2WVDA 5HQ8A 2K3KA 2ZHAA 1J27A 2YQ3A 1X4GA 1HQEA 3CDUA 2XWYA 1HHSA 1TV6B 1GEHA 1LK5A 2GV1A 4OMFG 2BX6A 2C2KB 1U1PA 1UEVA 4WKRA 2BJEA 1HI8A 3JSYA 4HH0A 1O8BA 3IS9A 3I5CA 4IOBA 4PQAA 1SFOA 1T94A 2HURA 1NZAA 4PWUA 5H1SV 3DDKA 1RKIA 2HHWA 3M2VB 1IR2A 2DHAA 3VVTA 3K58A 2OKQA 4OYAA 1LWCA 5D15A 5M2UA 2RQKA 2HG4A 3CB4A 3HVTA 3I5BA 3ILJA 3UDVA 1I94J 3CULA 1N33F 4J90A 4DR3F 2RF2B 3FCHA 3G6XA 1I5OB 5CZVA 5JUMA 1UZHA 3BSCA 2IMOA 5D4OA 1GNKA 3IR5B 3OL6A 3LA0A 1NJWA 2F8HA 1FERA 3DOMB 3DRSB 4I2QB 3C16B 2GVZA 2B6AB 2QLBB 2GQQA 2WBMA 3H59A 3OVAA 4Q44A 1JLBB 3FZ2A 5K14A 2PGCA 4TU8A 2G5DA 1DLOA 2E5JA 4M5HA 1REVB 3KNGA 5KG0A 2VIHA 3H8YA 2IRUA 3DLEB 1FDIA 2E29A 3QSIA 4KH1B 4DV7F 1R8PA 3NGKA 4LRDA 3MZIA 1ZPWX 3KLGA 1CJVA 2ZWPA 1RYRA 3EPIA 3VV2B 5GMDA 2FLLA 1ROFA 2RRBA 4Y65A 2GMJA 1HWKA 1RAFB 2AKWB 1VQSA 3EDRB 1N56A 2YPZA 3K0JA 2AE0X 3IG1B 2CYYA 2QMUB 3AXKA 4OI1A 1UVKA 3M4XA 1NK9A 4DSLA 1QAXA 3CC2S 4TY8B 1VQ8S 1XERA 3GPAA 3OXFA 2MKCA 1M5OC 3DI6B 3Q2TC 4USHA 4C8LA 3X1LB 3FKIA 3X2NA 1PSDA 4LRCA 2OEJA 3ELHA 2HKEA 2RE1A 3C6TB 2M3DA 1V9OA 4NLUA 4P74A 2CADA 1BXNA 2QEXS 5H9FK 3IWXA 1R0CB 2E66A 3P6YC 4HKQA 3I9V9 1G8KA 2RIJA 3BQ2A 2AJFE 2OFHX 2RHQB 3KUGA 4ERDA 2CJYB 1ZA2B 4MK9A 3OLBA 4UOHA 2JLEA 1JKHB 3Q23A 2V8GA 2A6MA 1UW9A 2XNQA 1N32F 2JH3A 2RUGA 2MQMA 1W7WA 2DRBA 4OHYA 3E51A 3BKUA 1U1NA 2VPYB 2WVEA 4OI4A 1HBMA 2YWGA 3Q2SC 2A68D 3LP2A 2OPRB 3BM7A 5D0EA 3OJUA 4MIAA 4ED3A 4TY8A 3K7RA 1HR0F 1AW0A 4HEA9 2MZ1A 2DNPA 2AX0A 1DURA 1TL1A 4OI3A 2W7PA 2R3VA 3UD4P 3RRGA 4K0KF 1SH0A 1F60B 1NSKL 3ET6A 3D0GE 3CIMA 3IG1A 3PXGa 2XGQA 3BS9A 1KFDA 3IMQJ 3PHEA 2DO0A 2BRLA 1XN9A 4MFBB 2B9XA 1KQKA 1C1BA 1KNZA 4LQ9A 1K0TA 1JXVA 6FD1A 1CJVB 2ILYA 1I3QA 1EKRA 1SV5B 3M32B 4KO0A 5IFMA 3FEYB 1YIJS 1T03A 4DWIA 2UXBJ 3J7ZT 3NS5A 1FDNA 3UN2A 3J7Z5 2KFNA 3PEJA 3N79A 3O44A 4RW4B 4YB7A 2X51A 3TA0A 2UUAF 1HNIA 4QZVB 1EIYB 4CZCA 1S1VA 2MGZB 2IIHA 3CJ3A 5T14A 1KVKA 4I2QA 1L3UA 1HWUA 1TKZB 1WG1A 1VQOS 1ZZFA 2IBKA 3CCTA 3M2RB 3G2XA 4OJHA 3KHGA 4ENOA 3MAAB 3LP0B 2VB6A 5LL6d 2AD9A 4OZJA 1AA1B 3QRQA 3RB4A 4K8RA 2P9CA 4ICLA 3LANA 4USUA 4ZVEA 5CD4A 4DV6J 2GAGC 4O3RA 3CJKA 3KJNB 2JNJA 1FRMA 3MM6A 3B54A 4NOHA 2FZGB 1OSDA 2VPWB 1V5IB 3T41A 3UDLA 4F4KA 2R7RA 1SC6A 2ZUAA 2QMXA 4C0OC 2HQ3A 1H5NA 4MH8A 1UJ4A 2NSBA 2W4PA 4LRFA 2WONB 4B9UA 1NMEB 3TRGA 4RW8A 4OJGA 2P6TA 1GXUA 2HNDA 2GAHC 2PA3A 3JXOA 1HQEB 3LAKA 3DRPB 3KFWX 3LGHA 2UU9J 2PN6A 4DSJA 3M8ZA 4Y2IA 1CJTA 3LGNA 8ATCB 1OQ6A 4RW9B 2VPWA 2HBZB 5I42B 3LPYA 3DCAA 3GP9A 3QFHA 1NK8A 3OL9A 3SSSA 3MCMA 2YQ1A 3RTVA 1C0TB 1KN6A 1AXQA 2WAQA 1RTDB 3MAAA 4CLSA 1SC1B 1WJ9A 4LBPA 5FLXU 2ZOFA 2ZJRQ 1RAAB 2C3MA 4JI5J 1XMOF 3R97A 3QT7A 4HTIA 4O0NA 5T41A 1S1VB 5DQHA 4RWXA 5GAHU 5KFWA 4DUYJ 5IV3A 2PA8D 1AB8A 5LMUJ 4EYHB 2CPYA 4ZVQB 2O67A 5BJRA 1QUVA 4FP9A 1FJGJ 4NI2A 3QAEA 1RU2A 2R7OA 4KC5A 1RT2B 1C1BB 1NAQA 4WJBA 2W9CA 2J6TA 2CZ4A 2AW0A 4GVLA 1MROA 3ENGA 1S12A 2I1RA 4I56A 4QW8A 1JLEA 1C4CA 5ITHA 2ZH7A 5E7OB 4ECTA 1RT1B 2CQCA 5E2QA 2LXUA 2WCXA 4RUAA 3AHPA 3GE9A 2NYIA 3VGTA 5H4UA 1S1UA 3QNWB 3M8RA 1Y3JA 2A1BA 5DS7A 3DHXA 2VICA 5HQMA 2OPRA 2CVEA 2O3DA 5D78A 1C0UB 2D9PA 2RHSB 4DU8A 4ED8A 4LF4J 4UY85 2XWXA 2YKAA 5IXUA 1RP5A 1YG0A 4L74A 3CCSS 3I96A 4DXLA 2FJEB 4KSEB 2R7WA 3HZGA 5DGBA 2ZH5A 5I3UB 4NRTA 3PR5B 1NU4A 1XR5A 4DV5J 4U8VA 1W26A 2MZQA 4I69A 3VALA 1NDLA 3BSOA 3GTJA 4FS1A 2XMVA 4WFBQ 1OY9A 3QWZA 4D7ZB 2NXNA 4KHRA 1HBNB 3C6TA 3CDEA 4RBUA 4DI6A 3CCUS 1HWLA 1RI7A 2V50A 4DL7A 4AUKA 1K8AT 4JV1A 3H90A 2ZKUA 4IFYB 5C42A 5KFVA 5GLXA 1S9GA 3PM9A 4NYPA 2C3OA 4NEYA 1RT3B 3Q89A 3HHDA 3W2VA 2ALZA 4WXOA 3U02A 2FVQA 2XCPA 1RBAA 1HL6A 3K8WA 4Z37A 2F3JA 4M5DB 4PXCA 1VI7A 2BW2A 4FXVA 2DT9A 3VTIA 3I0RB 4USKA 4YQWA 1VK8A 3FJ2A 4JOUA 2G4BA 1B0PA 3US5A 2Z2YB 3MD3A 3QT8A 4TLQA 3B78A 3QQ8A 1IKVB 1FFSB 4HDGA 4N5SA 1E6VA 1U6FA 3GTMA 1LK7A 3VAKA 1KP6A 1ACMB 3UCZP 1FRJA 3L3CA 1TK0A 2VBXA 1NJIT 2LEPA 4LR9A 1EAYC 2HHHF 3HPOA 4DR5J 3AH6A 4DG1B 2V6AA 1D9DA 2RKIB 4NLQA 2ZD1B 4CLPA 5IS2A 3LAMA 1XR7A 3RBEA 3CCWA 3ZTRA 3I4HX 4R8UA 4JI8J 3OXGA 1PIEA 4DR1J 2HNZB 3HCXA 3I32A 4J9NA 2C2RA 3GFXA 1OS5A 1RHUB 3ZZZA 5FLXY 3OQ2A 4NZ6A 1NXIA 2DHGA 5ETLA 4IFYA 4DPTA 2KTQA 4ZJLA 4AOKB 5CYMB 4NLWA 1LXNA 1HBNA 5KT6A 4NASA 5DG7A 3MF5A 4JI2J 2GJ2A 1NPKA 2CNLB 5KFUA 1HWJA 2VBYA 5LXRA 5KFBA 2UXBF 3A4TA 3QQCD 1H3DA 3HFVA 4HDHA 3IS9B 4HI1A 4WPAA 3I87A 3QSYB 2HS3A 5CAAA 2A69D 1WC1A 2NCKL 3D5MA 4HHHA 2J7UA 3BB5A 5F8NA 1WHWA 2WOMA 3QWUA 3GZ7A 1OA7A 1KWMA 2UV8A 1NKBA 2MPUA 1D1UA 1JK9B 3QIDA 3NLCA 2APOA 3V4MA 1NKCA 3GYGA 1RWPB 4F0MA 4WKYA 5J2MA 2R8KA 2F1FA 1U1LA 1S1WA 4ES1A 3HFKA 2UXDJ 2DCUB 2Y8WA 1MWYA 2XSJB 2Y3YA 2QN6B 3MMAA 4G1QB 5MLCV 3JYTB 3PG9A 3Q8VA 4C98A 3RBDA 4YEAA 3DMJA 1UETA 3B4DA 4ZVSB 4ZHRB 3EYZA 4UTGA 3M9OB 4OHVA 2VFVA 1UFLA 1JXEA 3P96A 4NLYA 2JSXA 4NZ7A 4DX7A 3FQLA 2JEJA 2NAPA 2JFDA 4WK3A 1SJQA 1KQFA 2BQUA 1PJ5A 1R0BG 3W3SA 2CWKA 2MYFA 3EVWA 1WKJA 1U0SA 2GMHA 4DR6J 1FO1A 3SIPB 2PFFB 1RABB 2YNIB 2YWFA 5KT5A 3HHKA 4H4KC 3AJ2A 3L09A 2MTLA 3T19A 4DV0F 4AYBA 1G4CA 3CCMS 1NK5A 3T6BA 3GTGA 4TQRA 5ETMA 1FA0A 1FKOB 3H40A 4ANCA 3AXMA 4GA5A 3NRBA 5ETVA 2GJIA 3DKDA 2C2ZB 5K8PA 3PO5A 1UA0A 1OYDA 3ZFVA 1FNMA 1PG5B 2C1EB 4HTJA 5A8WB 3KLHB 1C0TA 2GQCA 3SV4A 4A8YA 5DLFA 2UVVA 4LFBF 4RNFA 2D41A 1XEZA 4DZ6A 3V81B 2BEFA 2HIQA 3TUPA 3RAMA 3CE8A 5DDOC 3PRBA 4H4KA 4N56A 2BR0A 4A4JA 3CCVS 2XS5A 3HHLD 2HHXA 1HYSA 2EI5A 5KG5A 2LU2A 3MPDA 3D67A 2GFFA 1MLAA 2FJDB 3S8SA 2JEFA 1Y5NB 4CRZA 2DHXA 2KJWA 5FJ4A 1CZ5A 1YLEA 3QQ7A 4B02A 4IH7A 1HNWF 2CQDA 1TL4A 4PXBA 4I6YA 2PT0A 3L95X 3GQCA 2YNHA 3VR1A 2NREA 1HW8A 4B9MA 3E3XA 4RNNA 1WEYA 5KFYA 4R5PA 5EN1A 2AEMA 2XZTB 1TVRA 4URGA 3WX4A 2C3PA 3MM6B 4PZVA 4DPXA 1DQ9A 1C2PA 3X2IA 5HMZA 5ETOA 2FGCA 4RNMA 3WIUA 4X4VA 1R6VA 3MMJA 3CC7S 5HI7A 4DV4J 1V6HA 4PG4A 4YDDB 2YNGA 2Z4PA 1T3NA 3D1HA 1P1LA 5DQGA 2JEGA 1RAHB 3N6LA 3UQSA 1RWKB 5DDQC 4B3MJ 4LF7F 4IRKA 2R7SA 4I67A 2NXCA 3G86A 4J9KA 1QSSA 1MMDA 2C2MB 2YKMB 1E60A 1NNDA 2YWKA 2ZH6A 1J5OB 1E18A 4GRSA 5DDRC 1VBYA 1SKSA 4WWSA 1NB7A 1TFYA 1U2CA 2O01C 2JHEA 2XMTA 2G2YA 1G8JA 3LO3A 1VRTA 4C4WA 2KM8B 4URSA 3CDAA 4JBCA 1IR0A 2VFUA 4KO0B 4QWCA 1LWEA 1RT6A 2PMZA 2KVQE 3BO2A 5KFRA 1X9WA 4MFBA 3D1OA 1XNQJ 1JB0C 3GIMA 2XGPA 3R1HA 1KLMB 2GIQA 5KFDA 5HROB 5HVGA 4NXMF 1RXOB 4TLRA 3UNYA 4A46A 3CJ2A 2X3GA 3IA0A 1XNRJ 3G87A 3GIKA 2GMLA 2KRRA 3TA2A 3E8OA 1OWXA 1TL1B 2HBRB 3QO9A 4MMOA 3MM7A 2IJFA 3M6XA 2CPIA 4IDKA 2IV2X 4CH1A 3CO9A 2ZH4A 1HBMB 2PD1A 4EFAC 2KXNB 2CZ9A 4P9SA 4K4TA 2QE5A 3QAUA 1EX8A 1WACA 2BJDA 3QMQA 4KGKA 2ZBQA 4CLTA 1FKAF 2FLNA 3T9NA 5HMWA 1OSCA 3FMWA 2HGMA 4JS7A 1Z4UA 3EJMA 3HO1A 4X64F 3BGRA 2RJZA 4ZVUB 4NEZA 1UPMB 5F0WA 4U96A 5SZTA 3QIPB 4PABA 2BQRA 5KTQA 2OH2A 4M94A 2J0SD 5J1EA 3HFZB 2Y1JA 4OIXA 1Y1VA 5GM9A 1LWFB 1FRHA 3NP5A 4ELTA 1X4DA 1FJGF 4O0IA 1RAGB 4DCJB 1CQNA 4DQSA 5HROA 1BHNA 2VBZA 1FKPB 3OTBA 3D54A 4QWDA 2VA3A 4Q0BB 2B3TB 4Z7YA 4DZDA 1LWEB 1RT6B 3NGDA 4B3TF 4LQ3A 3D30A 1CJKB 1SPBP 2V5HG 1FK9A 3VGSA 1C4AA 2AYMA 2W2PP 5I4MA 3TZYA 2OMLA 5D4NA 3IO1A 4EU0A 2CRLA 1YJWS 1MSWD 3CZBA 3NBPA 2EW9A 2XQCA 3NS6A 1HD0A 1U2FA 4ZKAA 3KLGB 1S48A 2AJ4A 2HZAA 2AHOB 2YKMA 4FYYB 2DJWA 3MURP 4ZLNA 5AXKA 1Y00A 3ZNJ1 4E2FB 2LECA 2BDPA 1FVSA 3FRZA 2PC6A 3IM9A 3TW0A 1S6UA 1R27A 4KHPF 3GSDA 3GR1A 4KPYA 1KQGB 1RTHB 2JA6A 2KXHA 2GC8A 2ZNZA 3KDOA 2DIUA 3KUEA 4KB7A 3C16A 1PQHA 2CAJA 3EZUA 4IG3A 5LT5A 2ZNYA 3CMQA 3OD2A 1R3NA 1DRZA 1B7FA 1WNEA 3PEHA 2QL7B 2DYAA 3GYXB 3EWGA 1EJ7L 4DDFA 2C28A 1NHKL 3IR5A 1VHIA 2ZFHA 3SFUA 1TVRB 2IRXA 2VF3A 4QYRA 1S97A 2UXDF 1YTYA 4R5PB 2OTLS 1RHMB 3MEKA 4I64A 1H0HA 1B0TA 1EETA 3FSXA 2MLXA 3HKZA 2QIFA 5IT4A 4JI3J 1CPZA 3RJMB 3IBCB 4C2MA 4YP3A 1O0PA 3TOQA 1YGYA 4IR1A 2LEBA 3MOJB 2WSEC 1FNXH 4Q8EA 4IKAA 4CLFA 2BM0A 1IQZA 2LQJA 2XMJA 2LQBA 1RT5A 5A6WA 3TYTA 4AQYF 3FRYA 4IUFA 3DU5A 2DK2A 4DUZJ 1B4SA 4KBIA 1WC3A 2E9ZA 3P45B 4NA3A 4AL7A 2VODA 1IKYB 1Q5VA 2RNEA 3TUIC 2F40A 5LJ3Y 4USIA 4ZVTB 2KU7A 5DM6Q 2IY5B 1FKOA 3NGUA 1GTEA 5ETNA 4KGVB 1TUVA 2K1RB 2I5JA 1S0VA 4KO8A 4LIWA 3T6JA 5DQIA 4U7UD 3FBBA 1K44A 1R8AA 2HNYB 4QIWD 1AT1B 4LSLB 4ECQA 5KFHA 2C3YA 3CJSA 2XYGB 1BUXA 2EKYA 3Q83A 4ZLPA 2B8PA 3DU6A 2A6ED 1N6QB 1SJRA 4KPCA 3MUVP 2XY7A 2ADBA 5L39A 1TR0A 4M5LA 5GLYA 3O5TB 2IFXA 3X2LA 1PYQA 1U02A 5ETQA 5RUBA 3OVBA 5GAEU 4FF2A 1DJ0A 2I6WA 5F8IA 2XG8A 1SC4B 4QIWA 2GIRA 5FTMA 4OX7A 3EGVA 2JIRA 1D8ZA 4G1IA 4QPXA 4OJ1A 1H72C 1Z1ZA 2KDOA 2KYXA 4O23A 4C9DA 4J37A 2ACYA 9ATCB 3MR7A 1U7LA 2LCWA 3C6UB 4X65F 2FJXA 2GVDB 4M63A 5J2MB 3KK1A 3FFIA 2XMKA 3BR9A 4K4WA 3NG8A 2A6HD 4JYAJ 3M9MB 4ZPVR 2X3DA 3ONQA 1Q16B 5EX0A 2E44A 3CF2A 2EFQA 3CD6S 3AD7C 4ANEA 1FDAA 1TUGB 2BKPA 4HR2A 4CS0A 1H2VZ 2IA0A 1T7PA 1FWLA 1SL0A 1KD1T 1VC5A 1FTCA 2OMOA 1RGVA 2P2CB 3ZO7A 3MEEA 1CULB 3GFYA 1U4BA 1OIAA 4CNZA 4ZPBA 3MUMP 3W8GA 4DS5A 1VBZA 1TKXA 4WP3A 2AU0A 2B5JA 4FYWB 5A0YA 5CQGA 1VQLS 3KK3B 4L73A 2V68A 2IHR1 3C6UA 3GCWP 1NSPA 2A18A 2DXFA 3L7PA 5A8RA 1R89A 3VCDA 3QGHA 4KHMA 2Z30B 2HZVA 3PYEA 2J0XA 1IM6A 3LP1B 2OSQA 2W01A 5J1NA 5E33A 5FIIA 1Q7YT 1XNRF 2BM1A 1FD8A 3FBCA 4M5NA 5GAGU 1BGXT 5KOWA 4NLGA 4J9UE 4TU7A 5J2QA 1UA1A 2CKWA 2RQMA 1OY8A 3UNGC 4DR2J 5C18A 3GTLA 4RUCA 2ATLA 2J9DE 4FYXB 3IM8A 3U1NA 3ZTQA 4CQ1A 2FJWA 5HMYA 1AUDA 2DVIA 2I5JB 3AQOA 1Q53A 2MQNA 1T9VA 5KG6A 2M4MA 1ZZNA 1FWKA 1SIWA 2HVDA 4O3QA 1AFJA 2IA6A 4NCBA 4KKOA 4UUXA 1IBMF 3PYDA 4X64J 1S0NA 2HPUA 2GO9A 4OI6A 3R2DJ 4AZDA 1QTNB 4OYXA 2DNGA 3TJ8A 4RBVA 1DTQA 3EGZA 1S9GB 2IDLA 2BZ2A 5KFTA 1A7GE 2RDDA 4ZA1A 4B3OB 3A8JA 3NAHA 2FPHX 4RKUC 1S0MA 3X2OA 3RBZA 1UAWA 4KE5A 3D7SB 2XNRA 1CS4A 3DOLA 3K2YA 5HBMB 1YDLA 4IOCQ 2FVSA 4UZCA 5KFAA 3TEGA 1X9SA 2V2ZA 2DCLA 1S9EA 3H2LA 3W8PA 5A8KB 4CRYG 3M05A 2RAQA 2VQFF 1VQ4S 4FERA 2F7VA 3D6FB 4B3RF 3A8EA 3DLGA 1VLOA 2WB1A 1XBWA 4A8WA 2EFOA 4DBQA 5IQ6A 2RQCA 2I8EA 2DR5A 4Y0FA 1NKEA 4PWDA 4LSNA 3G8QA 2H5JB 3CIZA 2XEXA 5KFCA 2KO1A 4HH1A 3KKFA 3VZIA 3KUHA 3LUYA 1QJHA 1H73A 2MLYA 2NUHA 1Y9OA 2QX0A 2JFKA 3D0HE 4G1PA 4OYMA 4EWTA 2PI8A 2V45A 3HMJG 1FI4A 3ILLA 5EPPA 3PY8A 2YX4A 4I6AA 4RW7A 4O4GB 4DL3A 5LMNJ 1VCTA 3MUTP 4WP9A 1RT1A 2PJHB 2VUMA 2HGLA 1DMRA 2DRDA 2GIFA 2YWWA 2C42A 1MROB 4NPOA 5K8NA 5L1LA 2HVEA 4DLGA 4ECYA 1X0FA 4F3MA 1MNEA 1RT2A 2AGPA 4WFNQ 4ILLA 3C15B 2P6SA 3KLFA 2PE8A 2BVZA 4HT5A 3UN3A 1KHVA 3QGPA 4ZVFA 1DAXA 1YZ7A 1RQ0A 3CWJA 1S6QA 3OL8A 2E1AA 3V6DB 3RAXA 2BYCA 3VHQA 2MKIA 1YJ7A 3FEXB 2BBEA 3N9UC 4ZCMA 1FK9B 4E8UA 2MHNA 3SZ2A 1YITS 1WF1A 3PJXA 2JVOA 2MLZA 2YKQA 2LQ8A 3I9ZA 3M8SA 4Q0BA 1Y1WA 2EK6A 5ETPA 3GSIA 3OHBA 4KHPJ 1UW4A 4LF9J 1RTDA 1KRPA 2VU5A 3H2VE 4I2PA 3F41A 3VAJA 3RR8A 2OTJS 1U1OA 2EC0A 4DUZF 2ALYB 5KG2A 3QIPA 1JLQA 1RA7A 2W4CA 3SDEB 4ECRA 1K83A 2G0IA 2A6OA 1S9FA 1UKUA 2HYIB 3PKYA 5LSRA 4UY8T 1NH8A 2FC9A 4OHWA 3G8TA 1B3TA 1NHUA 1RA6A 4RWWA 2I9SA 4LRAA 1N0VC 4KFBA 1B7YB 1K47A 3C66A 3A8IA 2V8VA 3UR3C 3OSNA 4A8QA 1YZ6A 2Z2ZA 4D3HA 2GA7A 3HXMA 4LF8J 1IXKA 1RCOB 3QWPA 1OGYA 1DQ8A 2Y0BB 4JI0J 3IFEA 4PUOB 2OPSA 1QM9A 3V6HA 1I6JA 1VBXA 1Q4RA 3QT6A 3M8PA 3LGMA 1DZ5A 3NWGA 3X2HA 3CJKB 2AZ3A 4U95A 2F4VJ 2B4OA 2EC2A 4ZIWA 2XCAA 1UZDA 1SKUB 2BH0A 1H7XA 3MPYA 4K4ZA 2ZBIA 1P9YA 2RU9A 4KT0C 4NLTA 4HI2A 1NSQA 5IM0A 1UJ5A 5CCMA 4U6PA 2K2PA 3PW2A 4PG8A 3D2WA 4MIWA 4ID5A 4GA6A 4ZCIA 3HD2A 3OFGA 3EPGA 2ZH2A 4QWEA 3MTJA 5CABA 4NLRA 4P52A 4UUWA 2MKHA 3TVYA 2R7XA 4CO0A 5D4PA 2QC3A 2HVIA 4MK8A 3BGFA 4U7UK 1HI0P 3TVZA 2W2OP 1SV5A 3M32A 2L9NA 1T03B 3W62A 2QSFA 4FDFA 3ZTPA 3OFHA 2XTJP 2OUGA 4P6QA 4DHVA 1WOPA 3G6ES 2XMAA 4N8NA 3K17A 3Q8RB 3FGVA 4W90B 1VFJA 4E0DA 1VRUA 2E2HA 2IJRA 2OPSB 4ECSA 3PFEA 4IFVB 1OJ4A 2F9JA 2HQDA 2K8GA 4OHZA 4CWBA 1LV5A 2PO4A 3MM9B 2XYPB 3RAQA 4DL4A 2UUWA 3PCOB 5L38A 5AJ3J 3J7A1 1VJWA 1Y5LB 5IZHA 4JV5F 4XIUA 1PGZA 4KFBB 3KNAA 1MMLA 3MGJA 1ZM9A 3I0SB 3CC4S 1U6ZA 3J80Y 2BJ1A 1W25A 2MY8A 3KHLA 4F4ZA 3SBMA 1U8WA 2QA1A 4DF4A 1UFKA 2A0FB 3OUYB 1N5SA 1MN7A 3PDNA 3T1AA 1RU1A 5CZXA 3V81A 5F8MA 1BY9A 3SSQA 3OW2R 4P71A 4F4AA 2DGXA 1FTRA 3TR5A 2B4UA 2V67A 3VAIA 2QFJA 4RU9A 3D6MB 1IBMJ 3ISNC 2VV5A 3ENWA 3HU1A 3ISZA 1UWAA 5U47A 3RW6A 5KG7A 1IBCB 2FJAB 1BQNA 4F8RA 1PAEX 1SKRA 4O44A 1X60A 3DC2A 2LXFA 4C8YA 3PACA 4NMXA 4NCAA 5K5MA 3HZEA 3T5KA 2CQIA 1N5YB 1HNZF 2V3VA 2L48A 5HP1B 1U48A 2JA7A 2DB1A 4FXDA 1GQEA 3UDEA 4DSIA 2R9LA 2IM2A 5LM7E 5KFEA 4LMZA 1X8DA 3CJ8A 3CSKA 3MCSA 2J8SA 3P5TL 3FK4A 4GO7X 4YN3B 2DITA 5K20B 5KT2A 2UVRA 2VKRA 3VQTA 1I94F 1JLBA 5K14B 2VDIA 3QLHB 4LF5J 3GTOA 1CJUA 3F56A 2R2RA 3D6HB 4X84A 2GVZB 4EK2A 4ZHRA 3CF5Q 4DR3J 3M2UA 3MI7X 3QC8A 3DRSA 3AQPA 2BE7D 4QQBA 4C0HA 4RW7B 2EWHA 3CJ4A 3JYTA 4ZVPB 1KFSA 2CG8A 2R7ZA 3A1YG 2CA9A 1TWCA 3HU3A 2DHSA 1QDUB 2FHJA 1JJ2R 1F6TA 3L7UA 5KAKA 3HDSA 3H98A 4RX6A 1Z2LA 2NS1B 2J9EA 5LMNF 1WLFA 2JIOA 2GNKA 2JZ5A 3FBFA 4L3NA 3H20A 4X62J 4FPRA 4OLOA 2F9DA 3MECA 5HMXA 3G9CA 3HVTB 1JJHA 3CCLS 4CO3A 3PX0A 4IQXA 4DV7J 2MZSA 1EZZB 2M88A 4IO1A 1KQSR 3TM7B 3HVAA 3ZZOA 2XY6A 2WHOA 4LFAF 2VQEJ 2Y9HA 1IN0A 1Y11A 3VVUA 2LA4A 2YY3A 3TQEA 4B3OA 3D6TB 5D0GA 2M70A 3R2CJ 4B08A 3JB9k 4ZPWR 3IBFB 1YJNS 1HWIA
chains in the Genus database with same CATH topology
1RISA 1X4CA 1ZM3A 2VA2A 3DRXA 1AROP 4ZOSA 2HNZA 3UFCX 4KKOB 4DV4F 3BJYA 2FJBB 2VZ9A 2VONA 1SIWB 4I1TA 2DGOA 2ZD1A 4C8KA 2N3LA 3QLHA 1KR4A 2OD6A 2DMRA 4FS2A 3ZZUA 2HWIA 2BQ3A 3DRYA 2AGOA 4ZVHA 3I6PA 5E41A 2JL9A 5F3TA 1SJ1A 4YR2A 1VQ6S 3HHNB 1M5VC 4N76A 3VF0B 2FLOA 5J2QB 2HMIA 2OFGX 3I0RA 1N5YA 2RILA 2GHVC 4C7QA 2HRUA 4J9OA 2YH1A 4CT9A 4Q8FA 4O44B 2XLIA 2DR8A 2V94A 4JI0F 2WK4A 4O4RA 4R25A 3K5MA 1RT3A 3CPWR 3TANA 4ZDNA 5IWAF 3KK3A 1LQ9A 3M30B 2F4VF 2GCFA 1B64A 4B9TA 2K3IA 3PJWA 3V5RA 1BWEA 4OZ1A 1C1CB 4YB5A 3V2UC 5AE2A 4WE1B 4UQGA 2MB0B 4DN0A 1LW2B 2B4VA 2DNMA 3LF0A 1FRXA 3MPVA 1O51A 1QAIA 4B9VA 4X4UA 4ED7A 5FTJA 1KTQA 3SCLE 3HVRA 4OZLA 3CCQS 3RB3A 5D3GB 2J5AA 1YJTA 2J7KA 4C11B 4JUZA 3K5LA 2DO4A 2P9GA 3D28A 4IFVA 1S1UB 3Q8PB 1NK0A 4QR0A 4DV6F 3GG1A 4NYOA 2DNZA 5KFSA 4DF8A 1VQ5S 3ETOA 2J6UA 3B4MA 1MMNA 3R5DA 1Y5IB 3BDPA 4EZ9A 4QPTA 3IC1A 3BR8A 1N5VA 2W9CB 5KT4A 1HNXF 4NCGA 4ZPCA 4PRFA 3MDFA 4X4QA 4NZ0A 1SJFA 2J0WA 3SCJE 2ADCA 2WB4A 2VFTA 5I3PA 3Q8SB 3OTEA 4AXIA 3L7OA 1ZOTA 2BABA 2FHKA 3LWLA 2UU9F 4FNHA 1F9FA 2DNKA 3OV7A 3TUZC 5JVHQ 2NQPA 3CEDA 1UP1A 5IM0B 1TAUA 3MPWA 2Q43A 1YJVA 2ZH1A 2ZUGA 2G6GA 4I4BA 1FXDA 2C2DA 5KFFA 4HYKA 3N28A 3CMAS 2AYBA 4NYZA 1WG4A 1YJ9S 5EWGA 2I2YA 4K5RA 4DQRA 3M8PB 2FD2A 3JSMA 2HLTA 1RT5B 1P27B 1UVIA 3HJFA 3O5AA 2EG2A 4PUOA 1DMSA 3OUGA 2EFVA 2QT7A 2L41A 5EHHA 2ZC4A 2PNWA 2I0XA 3LW5C 4DUYF 4TYAA 4YOEA 3OSPA 3U1LA 1VC0A 1EETB 1H0HB 2J0QD 2N82B 4F4YA 3VWSA 1S49A 1FJGF 1X0PA 3N01A 3WZ0A 4ES2A 4C8ZA 4B9LA 3CCZA 1U2RA 3GFHA 4J9PA 2JJ4D 4AL5A 3O8WA 1T8EA 2MHEA 1ZYRD 1HW9A 4K4UA 4KV8A 1NK7A 3NL0A 2G1DA 3LP0A 2ZE2B 1KQGA 1RTHA 2A2CA 3O6QA 1HD1A 1IKWB 2LXIA 3MTKA 2WRMA 5KFIA 1SJ4P 2QMWA 4LF4F 3SQGB 3VZHA 2YX1A 5L9NA 2OPPA 4B17A 2POKA 1HNIB 2B4PA 3KHHA 1NHVA 4FVMA 1CC7A 1S6QB 5K8OA 1D0EA 2IVFB 4CTAA 1R0AB 5F9NA 2DNOA 2UZAA 2UUCF 2YU9A 3JSBA 2VQEF 2ASDA 1SQEA 2XMMA 2B56A 4F67A 5F8GA 1XWLA 4PG7A 1JXLA 3DMRA 1HMVA 4J9SA 3CUNA 1VQ9S 4CNYA 4LJMA 5KG3A 2M8DB 1V3ZA 1FEEA 2DNYA 1BQNB 1UWBA 2DTJA 3AAWB 4IH5A 5J1EB 3PR4A 4A8FA 1PYUB 1UL3A 2G0CA 3LP2B 3MR5A 1U1KA 2KFZA 4IRCA 3SCKE 1WHVA 1FVQA 2OPQA 2GW8A 1DFDA 4I7FB 1Q81T 5KT7A 1R31A 4QU7A 4B9SA 5B0EA 4H4MB 1FXRA 2CQGA 2JX2A 5J2PB 1H98A 1TQLA 2OSRA 3TP2A 4YMEA 1E5VA 2ZDPA 3SI8A 1S9EB 4AFFA 4L6V3 4QIGA 2E7ZA 1BD6A 2IYIA 4R0JA 4DR5F 1S0OA 4IDKB 3RZAA 3BQ0A 3QGIA 3G6VA 1X4FA 4YFUA 3RYLA 4DS4A 2UXCF 5FTNA 1O5JA 1SUQB 4WU2A 1Q8LA 4JI8F 3SFGA 1KLMA 3DN9A 4XK8C 4DR1F 1QUPA 2QRRA 4CI0B 1BQMB 4KR0B 1N5TA 1QY7A 2DGSA 1U49A 3F44A 1HBUB 2NLWA 3VAFA 3QJJA 2Y0SD 4Y3CA 1VRTB 4Y34A 4A8MP 5KOXA 1JIHA 3C3LA 4BC7A 3DLLQ 1J5OA 1I50A 1Q78A 2O66A 3HHEA 4DEZA 3VAHA 4ES3A 3DLEA 1K1QA 3R1LA 1FCAA 5H9EJ 5JVGQ 2YNGB 2RT3A 1PQFA 2B6AA 1TL3B 1ZAXA 1S4FA 1H2TZ 4NLOA 3KLIA 4W92B 3DOMA 2DIVA 4IH6A 4A8KA 5C25A 3EGNA 4ECXA 2J8AA 5CD4H 2HVHA 5IQQA 4QYZJ 1CLFA 4XDCA 2LMIA 3DLJA 2V4RA 1VS3A 4C97A 6FDRA 3EGZA 4ED5A 2UVWA 4DV1F 2MXYA 4F2RA 3GTPA 1YBAA 1ZBTA 2N7CA 3GYNA 1RWUA 1Q82T 1SL2A 4YY3F 1MW7A 1R9TA 4ZK7M 2HGNA 1CEZA 4RU2A 1VMBA 2EG1A 2WW8A 1LW0A 1S1XA 2KB2A 5KFOA 3PX4A 2D3UA 4TNOA 2EFPA 2OLWA 3FFIB 3KHRA 5E3QA 3IRXB 2R92A 3MM5A 4OL8A 2DGQA 5AE1A 2HZCA 2VPXA 2UP1A 3PV8A 4KIAA 4A48A 2VG5B 4Q5VA 1QE1A 4L72B 1JWWA 5F41A 5J1PA 1H38A 2JRSA 2KKHA 4BHQA 2H9ZA 3SMZA 2YNIA 2FVCA 2L9WA 1VGYA 2O5DA 4MYTA 4ED0A 2YKNA 3IGNA 1KTVA 3WBZA 1KQFB 1VIOA 5AXMA 3I82A 3G96A 4ED1A 1F5BA 3MR3A 3EZ5A 1VQKS 4QU6A 4C8OA 2CQHA 4ZVGA 3S7RA 2HRYA 5JXSA 1IKYA 1IKXA 3C8YA 2ROEA 3POTA 4BWMA 1XR6A 1GX5A 3IWLA 4GKJF 3NCPA 1T95A 3KJVA 4GC6A 7FDRA 1HA1A 1PPYA 3MMCA 4PQUB 4TY9A 4O4GA 1L3VA 3MM8B 2E5LF 1LW0B 1S1XB 4TYBA 5G0RB 4AE5A 1KOHA 4FBUA 4B3MF 2GAEA 3S1TA 5GAGI 2JEIA 3I56S 4N8OA 2R2SA 4PWDB 1Q1KA 3FQKA 1WTFA 1M5KC 3OR1A 4DL6A 3MD1A 3CCRS 3DLGB 1VQPS 2XI3A 1KEKA 4NLXA 2V4JB 4ZCLA 2PI4A 4KJIA 4UQTA 2V9WA 2CQ0A 2C3UA 2NSCA 1Q79A 2XY5A 3DOLB 2MSTA 1IW7D 1PC4A 4NMLA 2DGWA 3ML1A 4K59A 5C25B 2ZH2A 2OAUA 1YJUA 3EX7B 2PMHA 4BS2A 4Y2CA 3KLEA 1TL3A 2M5YA 2EPIA 5E3AA 2DPJA 2CPEA 1R27B 2YWHA 2QA4G 2NPIA 1N52B 2BE2B 3GV7B 5FTKA 4GMKA 2XZWA 4Z2XA 3HF5A 3J81Y 3DLKA 4MKBA 2KT2A 5HLFA 1E6YA 4DSFA 1E6YB 1M1KT 4X4NA 2ERRA 4MAKA 3PRDA 1W2IA 3Q0AA 1RDRA 4M5DA 2WAQD 1UVNA 4K4YA 2E2IA 3OXLA 2HQIA 2XMWA 1UHEA 3W2VB 4QW9A 2CQPA 1QAYA 4IRDA 3M8QA 2FJVA 4DL0C 5FDLB 2ZH8A 1MWZA 3S6EA 3CTRA 3VAGA 2OO4A 1ZYQA 2ZH3A 3MAQA 1L3TA 3GB0A 5C24A 3HI9A 5F0UA 1U1RA 1TWFA 2RH3A 1HPZB 5B09A 1GT8A 3T3FA 3BO3A 2GHWA 4GC7A 3IR6A 2YVSA 3DRRA 4AYBD 1MU2A 2DR9A 4RW6A 4N41A 1GAOA 4F3QA 5DGAA 2D1CA 2IM3A 3CCES 2LQ9A 1TWHA 1R8BA 3PW4A 1R43A 2W9BA 1KHWA 3FSYA 4EBDA 1JX4A 3MM7B 1N54B 2AV5A 2JIMA 4QIEA 1UWBB 2M52A 3MMCB 4WIIA 4PQUA 2ABYA 2CIMA 2G9OA 2XSFA 2V8HA 1HMVB 3KK1B 2CPZA 2FVRA 3Q24A 3T5LA 4KGMA 1X5OA 1EP4A 1ZETA 2WBRA 5DG8A 2UV8G 3VQSA 4LUBA 2RDJA 1IQTA 2JLGA 1NO8A 4CTAB 1V3SA 4O3SA 1X5SA 3IR7B 4C8NA 1KS2A 4X2BA 2V8DA 3OR2B 1TP7A 1J2VA 2OPPB 5DO2A 3M6UA 3SQGA 4R0EA 1WTBA 1NJXA 2IVMA 2FLPA 4C8YA 2VASA 1M5HA 4XO0A 3BGLA 2Y0SA 4DFPA 4LT6A 5CXTA 5C5JA 5DM7Q 3BSAA 2HS0A 2NPFA 1PT1A 2IC3A 4Y2MA 5DG9A 2GO8A 1JLAB 1LXJA 3J7YI 1LKZA 2QA2A 4V19X 2DRAA 2MZTA 3G71S 3R5AA 1CVJA 2NVXA 2XLKA 3MXHP 2B51A 5AXNA 4B3RF 1S1TA 3PZPA 1N4LA 1QLNA 3DRPA 3QPIA 2HHSA 5T5MD 1HNVB 2LQ5A 3RRKA 2NR0A 2V0NA 2ASYA 3TVKA 4K50A 5B0AA 2MQLA 3DYAA 2KYZA 4O3PA 3K57A 1X5TA 1U24A 1GXTA 4OX6A 4GO5X 2JVRA 3NMRA 2B9YA 3BN7A 3MEGB 4Q43A 2KM8C 1UVJA 3GV5B 3IN5A 4MJKA 2LU1A 2CPDA 1VQYA 2COLA 5B6CA 2N7YA 3IXQA 5A8WA 3KLHA 1URNA 4KODA 4EZ6A 3CT9A 2RDIA 1TKZA 2I38A 1JLGA 4JYAF 1JLAA 2IC3B 1ZTTA 2KZMA 5D4LA 5T7LB 2W8KA 1QCSA 4RW4A 2MY7A 1X4AA 4RZRA 3H0GA 3DHWC 2CJ9A 3TARA 5GAEI 4Y00A 1Y0HA 2B43A 4D3GA 1TWAA 3ISND 3ZZ0A 3KK2B 1JLFB 1QSLA 2HHVA 4U7CA 5KG1A 3OPKA 2ZH9A 2E7XA 3PIOQ 3C46A 1T02A 1H7WA 1S7HA 4O3NA 1NEEA 1EP4B 3I4PA 4Y28C 4X4OA 1SUQA 3PX6A 2P5VA 3OJSA 4WZQA 1N48A 2HHUA 3MMBA 4NA1A 5D8HB 5DYGA 4FF4A 1TFWA 2PJJA 3N6MA 2WOMB 1FEHA 3M6VA 2X1FA 4QWAA 2W4DA 2X1BA 3BGRB 4DR2F 3I31A 3N5BA 3H5YA 3OFFA 4WE1A 4CIOA 1GXLA 1QSYA 4PXEA 3H5SA 1YSJA 4BCAA 2AQ4A 2W7AA 1X9MA 5LJ5Y 1UVLA 4DFKA 4RW6B 4MK7A 2FB0A 3NCRA 4KLNA 3U1MA 3M6WA 3IR6B 1SH2A 2DR7A 1FE4A 2RVJA 4DPOA 3TQ1A 1HPZA 2KVIA 4CH7A 2E1RA 3HU2A 1S79A 2DISA 2VKZG 2YNFB 1YHQS 2V4QA 4HHJA 2RQ4A 3OFEA 2CQ3A 3KMSA 3BO4A 1AFIA 1F5AA 5FDLA 3SXLA 2R93A 5K8MA 1PT0A 2HMIB 1D9AA 4DG1A 4J9MA 3DFEA 1CSJA 2R8HA 1R0AA 4FYDA 2HFNA 1E6VB 1REVA 1R6YA 1Q7LB 1DLOB 4NLSA 3RB0A 3TAQA 2DNRA 2X1AA 4NX9A 3THVA 2BE2A 5GVQA 3H4DA 4JI7F 1EU1A 1FJEB 4RBTA 5KFKA 2R2TA 1PILA 5KFMA 4ZPTR 3WC2A 1NRKA 3UI3A 2C22A 2GQ2A 4KV8B 2HFOA 4ITSA 2G13A 3HX9A 2BV3A 2XS2A 2AJQA 4BBYA 2QV6A 1LWCB 1CR5A 2NVYA 1S6PA 4PPDA 2GGPB 3M2VA 5DYIA 1ZPVA 2JOQA 2YNHB 4Q45A 2V4JA 2OIHA 3AY0A 3LOUA 1CG2A 4J9RA 2AGQA 4WFXA 4BDPA 1FXLA 4QBUA 4K4SA 3JSRA 3OR1B 5LSOA 2XB2D 2OP5A 1WD6A 3UR0A 2V9KA 1R7IA 3RW7A 5EX3A 2ASLA 3EXCX 4NLPA 5LSLA 1PO6A 4M95A 4LF9F 3T5JA 2DD8S 3MM8A 2DH7A 4IG0A 1RTJB 1CQMA 3M2UB 3KJVB 4ECVA 3CXCR 2RRAA 4JV0A 2DH9A 2WB1D 1OQ3A 1TZ0A 4OJ3A 4CO5A 2NUUG 3K5NA 4TU9A 3BSNA 2HAIA 3BEGB 2HWTA 2EFGA 2HWHA 1A9NB 1FE0A 2KH9A 2J9CA 4RV0A 1Z2ZA 3RU0A 4LF8F 4CO2A 2E1CA 4NCGB 3AB4B 1Y4ZA 2BXJA 4PKDB 4DFMA 2VPZA 1JJ4A 5DETA 3NCQA 2IM1A 2E7WA 1QE1B