4NOHA

1.5 angstrom crystal structure of putative lipoprotein from bacillus anthracis.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
ATGIVMYGDETGVQQTMDQYKDKIESQNKFEAKLGTVNEKKVLIMNKTTAEKMVKENMLKKVVKEDVEPIKALPAISDEAGIVFAKEEQKDVVIDGKKMKYEGNVVIGDARKYTDMYAVVSDAEYAKISEPVKTIGLASFKENPKEKIFPDIKRGSKVEEAHMVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein, putative
publication title 1.5 Angstrom Crystal Structure of Putative Lipoprotein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Lipid binding protein
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17294 Lipoprotein_22 Uncharacterised lipoprotein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.60 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4nohA02
3.30.70.3060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nohA01
4NOHA
chains in the Genus database with same CATH superfamily
3P4UB 1N5YA 2X1BA 3BGRA 3ONQA 2BRKA 3NL0A 5GLYA 5E3QA 3G6XA 3PNIA 1KP6A 3F44A 4DSIA 1YK9A 1UFLA 1B0VA 3GIRA 2MQNA 3MMJA 2V8VA 3PDNA 4Q2LA 3T6JA 3AAWB 3M4XA 2Q66A 1M0SA 2ZITA 1TZ0A 3CO0P 3RUBL 2VF3A 5E5NA 3HFVA 2MKYA 3EGVA 3I96A 3VAKA 3M9OB 2OPQA 4DPTA 4P75A 2IC3A 2DGQA 3JSYA 3V4IB 3MPWA 2J6UA 2B56A 4ED2A 2CQ0A 4NCGA 4V19J 2XMTA 5GADI 2CQ4A 3D6MB 4NA1A 4LF5F 3FNNA 3A4TA 2DKOB 4OQJA 1VFJA 3WIVA 5LSRA 4IRDA 2LEBA 3VVTA 4DU7A 1IWAA 3OTBA 4RW8B 3LP2A 1G8JA 1FKPB 1RLCL 1KTQA 3EZ5A 2YU9A 1T94A 5SUHA 3CMES 1VQ9S 3UD3P 4FERA 3A8IA 4ZM7A 3A3NB 2WBRA 3CC4S 3W63A 4J5OA 4CO3A 4FNIA 2EPIA 4D3GA 1X9MA 1ZZNA 1Q8KA 5T7LA 1TU0B 1SIWA 4K5SA 3KOAA 1FX2A 1H5NA 3UR0A 4I2PB 2CJKA 4HDGA 4TYBA 1LQ9A 4K50A 5DETA 5JVHQ 3FVYA 1KS2A 3JB9k 4URGA 3EUNA 3IR6A 4EEYA 4F02A 4I1TA 2O66A 2MZQA 3CZBA 4I64A 4IFYA 4DG1B 4ECXA 3KLEA 2IA6A 4NOHA 3SQOP 3G8SA 2D41A 3BEGB 1ROFA 3PKYA 2Z56B 3M8QB 1SXLA 3DRXA 3BQ1A 1ZTWA 3W62A 2MZTA 3IBWA 4ZCLA 5A0YB 1EETA 4HKQA 1AZSA 3TEGA 2OPPB 3UDEA 4FVCA 4OIXA 1TL3B 1HHQA 2MQ8A 2CADA 3BO2A 2QGFB 2FYXA 2C28A 1VBKA 2KL8A 2KZMA 2E2IA 4R5PA 3OL8A 4U8VA 1DRZA 2B7CB 2IMOA 2ROEA 3M2VB 3H4BA 1RHRB 4OI3A 3TAPA 4FG4A 2YWFA 5K20B 2QZ8A 2CFXA 3IA0A 4OFZA 4UW2A 2ILYA 3OUYB 1M1KT 3M32A 1Y5IA 3OTOF 2YQ1A 3M8PA 5HROA 4A8WA 2VFVA 2QE5A 2FQQB 3MAAA 2GC8A 3PACA 2VQEJ 2FHJA 4N7TA 4ILMA 3FQKA 1OIAA 3VALA 5HMYA 4QU7A 3UDLA 3CJ5A 3MM6B 4KHPJ 2R7OA 1M5SA 3EVOA 2NZCA 1VC0A 2BW2A 2GIQA 8ATCB 1Y00A 5E33A 4MIWA 1KWMA 2PI8A 2J5AA 4J9KA 4EO6A 1WDTA 3R1HA 3H98A 4O3PA 1YBUA 2LQ9A 3MHYA 3JSRA 2AD9A 3DXBA 5B09A 2A6HD 1G4CA 2EG1A 3Q8RB 4JI6J 2OFHX 3X2MA 4NI2A 2Y1RI 1CC8A 1TKZA 4QR2A 2ASLA 3D28A 1TKDA 1OY8A 2XMMA 1H7WA 4BS2A 2UUWA 4M5DB 3HPOA 4FF1A 2NXCA 1SJFA 3HHLD 3QSYB 1R8HA 1R89A 3DLJA 1APSA 3KKFA 2O3DA 3H90A 3DOKB 1GXUA 1SH3A 1N5TA 4MKVA 1DLOB 1GXLA 2C3YA 1YIJS 2HHPA 3QMQA 2IM1A 2YTCA 3DOLB 3CJKB 3TZXA 3UN2A 4J91A 1CJUA 2IFXA 1U6FA 3KG1A 1X4HA 1JNZB 1VRQC 4NXNF 3TQEA 5F8NA 4YDDB 3WIUA 3A8KA 2Q1LA 3RW6A 1NK8A 1YI2S 4QYZJ 1VBXA 3K5OA 1HPZA 4A8SA 1UPPA 4DR7J 2MHEA 1LWCA 2L41A 2AJ0A 2BJ8A 1B99A 4L48A 3L95X 1TL5A 4X4PA 3NCQA 4WXWA 1A6LA 3IAS9 1YJ7A 2ZH1A 4GKJJ 2BKOA 4O4GB 2NQPA 4CH0S 2GVDA 1JLQB 3P5BP 3NCPA 1R31A 4P71A 4KSEB 1K1QA 3SFGA 5GM9A 3R2CJ 3EICA 2YXLA 4O23A 3D67A 2W4DA 3V5RA 2AJ2A 3TIWA 2J0WA 3DRYA 3D6TB 2MQOA 1CQNA 1O6XA 1WKKA 4OYMA 4JI1J 3HT3A 3MR2A 2KU7A 1QCSA 1KHWA 4J7CA 3CNQP 1B4SA 3O3LA 2SXLA 4TY8B 3HHLB 4N8NA 4OX6A 1XERA 1YJTA 3BO3A 4DDFA 2HGLA 3K5PA 2MKIA 4K59A 5F0WA 3B6BA 4J9QA 5DGAA 4L75A 3E01B 2ZE2A 2Z0GA 1TUGB 3MM8A 3S8SA 3OXLA 1TWAA 1NHUA 3A8EA 4RW7A 3RB3A 2A2CA 5KOXA 4TLQA 3GLJA 3DCAA 3DXSX 4ILLA 2HS0A 2CJYB 2QN6B 3PW2A 3QO9B 4O3RA 4KBIA 5L9NA 3OXGA 1LW0B 2XY5A 4FKXA 3G82A 2DIVA 5J2NB 3HJFA 1F0XA 1KFSA 1PJ6A 4URSA 2HWHA 2EFGA 3F73A 3KHGA 2VPWA 4RBVA 2K06A 2F1FA 1SQFA 4NASA 2JNJA 2JA6A 2IM2A 3MCMA 2VH7A 2AGOA 2OPRB 2BH0A 4OYIA 4YB7A 5FTJA 2FHMA 1JMTA 5HP1B 4ZVRB 2E9RX 1LXJA 3C6UB 2H65B 1N8RT 3AQOA 2JWNA 2YQ0A 3KJFB 4X64F 4UY85 1CS4B 2FDNA 5CYMB 1EARA 3ENAA 4B02A 2IMWP 4LF5J 4KO8A 1MSWD 2HZCA 4QCLA 1U7LA 4CO5A 2LP4A 2DHGA 3GYNA 2HK2A 2M5YA 4KKOB 4ZHRB 3Q22A 4MTPA 1S9FA 2CQHA 1NPKA 4CT8A 4WIIA 4KGXB 3C6TB 4K4ZA 5EWEA 3C3LA 1M5HA 3SYZA 1LWEB 1UVIA 1NRKA 3MUVP 1Q16B 5HJXA 1GX5A 4MKYA 1U6ZA 2X3GA 1RYSA 2AZ1A 1SV5A 5J1PA 4FFTA 3DM2A 4HI1A 1RHKB 4OZLA 4CWBA 1RT6A 4DV7F 2XZTB 1N5YB 2W7PA 3BGRB 4Q45A 2DPIA 2IM3A 1R0CB 4DZ6A 2UU9F 4Q8EA 1QAIA 1IKWA 2LQ8A 2OEJA 1L3SA 3RG6A 1MLAA 4LF1A 1S6PA 1WHVA 1NAQA 2HNDA 2X3DA 2F9JA 2AF6A 3CEDA 2COLA 5GAEU 4RUAA 2PD1A 2LCWA 1H74A 4C4WA 3RRHA 4QWAA 4KODA 2OPQB 5KFJA 3TZYA 1GMVA 2KJVA 2IC3B 5DGBA 4MKAA 3M05A 1IBMF 3OBIA 5GAHI 4NCGB 1L5UA 3HD2A 3PM9A 1G6BA 4I6AA 3H42A 3VF0B 2M2BA 2ZOMA 4GC7A 4LQ3A 1Q82T 3NEKA 4KO0A 3DDNA 1RJJA 1HWKA 3AJ2A 2ASYA 3LP2B 1K73T 3TARA 1UTAA 1WTFA 2BRLA 1VJQA 2M8HA 1N48A 1K47A 5CCMA 1HHTP 1P9YA 3D0IE 2MJNA 2FY8A 1CR5A 2JEIA 2CVIA 1HLWA 1SIWB 2CW0D 4IO9Q 2FHJD 2IYGA 1BY9A 4XAKA 3IR6B 2IHR1 1H0HA 3C8YA 4DHVA 2UUBF 2KYXA 5KFRA 4IFYB 4ZN1A 1H7XA 3CW2C 2HBYB 3KLEB 3CD5A 1EU1A 4ECTA 2PMHA 1SJ1A 4OZJA 3BGFA 2XO7A 1ZPWX 1HD1A 3CQZA 3CD0A 1NU4A 3ISND 3M8RA 1EETB 3RRKA 1AZSB 2FVSA 3PHEA 4HHUA 3X2IA 3WQPA 2Q3PA 2VZ9A 1FKAF 3CCLS 2DGVA 1X31C 2ZBQA 5FTMA 3OLBA 5ETPA 4R5PB 2W8KA 1OQ6A 4QPTA 4M5JA 4L73A 3Q8VA 1X9WA 3VAJA 3QT8A 2QG9B 1R9TA 3ILLA 1VQYA 5I4MA 4DFPA 2X1GA 3I31A 2V68A 3CUNA 4NXNJ 3VWSA 3UDCA 1FWPA 3NGSA 3I4HX 2JEFA 1JXVA 1S12A 3FRYA 4F4YA 3M32B 1N34F 1Y5IB 2HS4A 4ZVFA 1EP4A 3CC2S 1KR4A 3M8PB 5HROB 3OFFA 3T3FA 1F3VA 4FPIA 1PBAA 2ZZMA 1EX8A 3MAAB 2ALYB 1KEKA 2FLOA 4K4TA 1Q8IA 1H2UX 2GA7A 3TZZA 3PX0A 3CIZA 4NYZA 4YR3A 3TWZA 5MAOA 1XNQJ 2FLLA 4F8RA 4ES2A 2ZHBA 4DCPB 3QQ8A 5KFTA 4C3KA 4UZCA 3PXGa 1RAEB 3HDSA 2RQKA 2HHVA 1Q86T 2PI4A 4A8QA 2FTRA 5T14A 1CEZA 3H25A 2C2DA 2ROGA 2P8IA 2AKWB 2XS7A 1VCTA 4TYAA 4WJBA 4ETZA 3LALA 1LV5A 3JQJA 2G1HA 4F50A 4JI3J 4TLRA 4F2SA 3JYTA 2BZ2A 2ZBCA 3TA2A 4Q0BA 2W1BA 4RL1A 1ZM2A 1IN0A 1HI0P 4FVMA 4V19X 5A8RA 4ITSA 2D3O1 2V4RA 4AL6A 4O0NA 1SKUB 1T9TA 2DXDA 4NI2B 1F9FA 2ASDA 2YPYA 2LECA 1TKZB 5D8HB 2ZJPQ 4IR1A 4AT1B 2ZH9A 1JJHA 3SI8A 1WC2A 4NMLA 2XC9A 2FVPA 1E60A 4Z7YA 1S7HA 3PRBA 4DX8H 1UHDA 1NBEB 5IS2A 2DNMA 2OH2A 2BOPA 3SBMA 4KGVB 1B70B 2VOPA 3Q0AA 2EVZA 2BE2A 2VBXA 4B3RF 3UQSA 5IT9U 1CJUB 4HI2A 5F9NA 2G0IA 3PJWA 4N5SA 1F2HA 1HBUA 1HPZB 2HWTA 3G8TA 5JMNA 1LWCB 3VHQA 3M3GA 1S97A 3CO9A 4B3OA 2FHOB 5C18A 4QBUA 1T9VA 3BKUA 1DBDA 4RWWA 4QU6A 5K8PA 5J2QA 4OYBA 2GVDB 3Q2TC 1RT2A 4A8YA 1X4DA 3J81Y 2L9NA 2WSEC 4ATNA 5KFVA 1WG1A 3RGIA 3PYDA 2XHCA 3I9V9 1I50A 4N8OA 4RBUA 5D4LA 3FEYB 2G13A 3CJ4A 2CJ9A 1S77D 3C2PA 2W4CA 4A8FA 3PRVA 4DL4A 3H7HB 4ZA1A 3GG0A 1ZBTA 2CQPA 5K8MA 2I9SA 5E3CA 5DYGA 4CO2A 2WB1D 2V2KA 2M4MA 4UOCA 2R7VA 2R2SA 2GJFA 4I67A 3IC1A 2C3OA 2R3VA 1RACB 1SC4B 2VB6A 1MMNA 3GV8B 1QSSA 3KNGA 1PQEA 4HT5A 1OY6A 1QAJA 5HMZA 2LKZA 2ZE2B 4UOGA 3MM8B 2KDOA 4RW7B 1HYSA 2GGPA 1KOOA 5KG3A 3CCMS 4U95A 3HJVA 2ZDOA 3DRRA 4FBUA 2UU9J 4QW8A 3G82B 2B9WA 4A48A 2LU2A 2IVFB 2VPWB 1HW9A 2A18A 3H5SA 5U47A 2XMUA 2DBBA 2E5LJ 4FYVB 4M8LA 3THVA 3R3TA 3LH2S 2J0QD 2MGZA 2B4PA 3EPGA 4IQXA 2RSQA 5IV4A 3NKYA 1RT1A 3OFEA 4RNHA 2K7JA 3MCOA 4B9VA 2JEGA 5KT3A 3SCKE 3GJTB 3OHBA 3Q8SB 1TWGA 2VFUA 2Z2LA 2MEWA 2B8PA 5DO2A 2OD4A 1PT0A 3HVWA 2CXEA 1SQGA 4CZCA 1KHVA 1HHSA 2R8JA 3M8WA 2LXIA 1FRKA 3LGHA 4USKA 3ML1A 4UQGA 2DNZA 3I5CA 3LP0A 3LTOA 1E5VA 4W4MA 5E41A 1U4BA 4RKUC 5ETKA 1RT3A 3IWNC 2YX1A 1WD6A 3H20A 3DM2B 4K4WA 2YKQA 2BJ9A 3B78A 1OYEA 1RT6B 2JC0A 3GTYX 2LQ5A 3AA9A 2VU5A 2HHHJ 3MURP 1IJEB 3HU1A 3W5YA 3R27A 4CLSA 3SZ2A 1SL1A 1VQSA 2FJWA 1VS3A 4FP9A 3BN7A 1RT7A 3R7SB 2XMVA 5LSOA 4J9SA 1IKWB 2MKJA 4ZCMA 4FZVA 3ZTQA 1QVFR 1S6QA 1VRTA 3CJSA 1S6PB 2R7WA 2HNDB 3O1LA 1YRUA 3CCZA 2NUHA 3HSZA 3M9MB 2R7UA 2QSFA 3CDWA 1MN9A 4ZP9A 2ZEJA 3ZC4A 3U1LA 4M95A 3SUMA 3DKDA 3QGHA 3MEGA 2O5DA 4ICLA 3C46A 3I9ZA 2B4OA 4GKKF 4LSNA 4JV1A 2HYIB 3W66A 4KO0B 2C22A 3QT5A 2HRUA 4PG8A 2UV8G 1Q5VA 4RBTA 4WK3A 3EX7B 1N34J 3QJJA 2ZZNA 1M5OC 4AUKA 4RUHA 1IBLJ 4BLGA 4G1IA 2E5JA 3GONA 2Z2YB 1MMDA 2V2ZA 3QIPA 2HHSA 1V3RA 2B9EA 1VK3A 2PFFB 2FJBB 2B51A 4FKYA 4WZMA 2VICA 2LDIA 5IXUA 5LSLA 5K5MA 2XGQA 5G4DA 1H0HB 4DR2J 1KVIA 4WXOA 1RWVB 3K5LA 1UWBA 4YQWA 2RRAA 4U67Q 4C8MA 4I6WA 3TA0A 1HIYA 4ES1A 3CJ8A 3UCZP 1QM9A 1UEVA 3IBCB 4IYQA 1VMBA 3VZHA 1PBUA 2GQCA 2M7SA 4FBTA 4ZIWA 1T7PA 4KLNA 1HQUA 2DXEA 5CHCB 3UNYA 5HMXA 4YR0A 1JLAA 1E6YA 1RAOA 4QIVA 5A76A 1F9EB 3H59A 4OHYA 2WW4A 3PW0A 4DPWA 1QDNA 1N5QA 4DV2F 4LRCA 3LWLA 4BCAA 5L8RC 2JIOA 1HNVA 2MTLA 4LFCF 3MPYA 2QRRA 1ICEB 1LK7A 4C8NA 4YDXA 3Q89A 3DMRA 1OSCA 3EZOA 4ALZA 3FCWA 4X4UA 4LR7A 4F3OA 4G3IA 5A6WA 1EP4B 1N0UA 2BANA 3G2XA 4CO0A 1NHKL 2PJJA 4JV2A 1N56A 3DC2A 4OZ0A 3D6FB 1DMRA 5KFMA 3SSQA 3G87A 1VQ6S 1Y5NB 2LEAA 5E3RA 1KRPA 1JLGA 2N4CA 2PT0A 2DY1A 3FCVA 1DMSA 3PRDA 3BPSP 2DRAA 1PQFA 4NLWA 3UFCX 1CG2A 3UN3A 3N6NA 3B4MA 2BR0A 4OZ2A 4U7UK 1YX2A 3JYTB 2BE5D 4Q0BB 4LBIA 3PW7A 1RABB 2RIJA 3IN5A 3DLEA 5KG7A 4PZVA 1WELA 5IV3A 4FF4A 3X2PA 5A8RB 1IUJA 5C2GA 1RT4A 3JTPA 2ZM6F 1YQHA 4DEZA 3CD6S 2N4DA 1IR1A 3OR1A 4ZLLA 5FLXU 3OL7A 3BBFA 1J5EF 2DO4A 2I5JA 4NL5A 4DF4A 1TWCA 3WBZA 1U45A 4DPYA 4WFAQ 1GEHA 3HHEA 5F0UA 3F56A 3W60A 1M90T 1XQIA 2BE2B 4B9TA 2OPSA 2CJAA 1OA7A 1V5IB 4ID8A 4IG0A 2DHXA 3GP9A 3CMAS 1NJZA 1JLEA 2V67A 2P9EA 4W98A 3PY8A 2ZDPA 1HBUB 5LMUF 1IM4A 2VC1A 4UUXA 3IR7A 4J9UE 3R6GB 4B3OB 4NMXA 3OFHA 4OHVA 1XMOJ 2AE0X 2OLWA 4NLYA 2V8HA 1NZ8A 5GMDA 2RKIA 2CJXB 5J2QB 3CDBA 1WI6A 5F8HA 4F4AA 3A1YG 1RT2B 2V8GA 5FTNA 2Y1JA 3NRBA 3TVKA 4ED4A 1M1GA 4WWSA 2JOQA 1U8WA 2HZAA 1S10A 2W2OP 1VDHA 2NREA 5C5JA 4RZRA 4ZVTB 1RISA 3MR5A 4FXWA 4QOTA 1UA0A 1RAIB 5CABA 3ETMA 2RDDA 3EDQB 1WF1A 3NMAA 4XK8C 2XSJA 2OEKA 1DY3A 1R8CA 1IKVA 4W90B 5HK4A 1U1PA 4NLSA 4OX8A 4LR8A 1VQPS 2UVUA 3RBEA 1JLBA 1KVKA 1RWWB 5KFGA 1IVZA 3DHWC 3T1YJ 1NMEB 1S9GA 2IA0A 1HQEA 5D78A 3QGPA 3HHKA 1XNRJ 5LL6d 4M1KA 1QVGR 1HYSB 1K0VA 2GGPB 4LBPA 4F4ZA 2ZZTA 3D30A 4F36A 3NMRA 1B64A 4ZP8A 3NNAA 1RWXB 3DRRB 3TO8A 3OTDA 5BR8F 4LVNP 1FD8A 4LF9F 3HFZB 1MWQA 1KKHA 3QZ8A 5HMWA 2NAPA 4OYXA 5IT4A 2LQBA 2DTJA 3R9LA 2AT1B 1VR6A 2I2YA 2DPJA 5D77A 2B63A 4F26A 1NPRA 2CNOB 2MGZB 3HVRA 3MEDA 1RCXB 4EYHB 2DHAA 4ECVA 1NSPA 1RT1B 1PG5B 1C2PA 2C45A 3DN9A 2C2OB 2J0SD 2HRTA 1FFGB 4GKKJ 5KFPA 4P72A 3U7JA 1RWOB 2HRYA 2E29A 3DLKA 1BWEA 4WFZA 1SJRA 4QR1A 3G4SS 4JS7A 4F25A 4KGMA 1TWHA 5CD4A 2MZRA 1QTMA 1MNEA 4PABA 5KFZA 2UUAF 3NGTA 1RI7A 1FEEA 1XBWA 3TW0A 2UVRA 1N5SA 1HBMA 1FDNA 4B9SA 3U1NA 1ZM9A 5B7WA 3LP0B 5H4UA 1KQSR 2BUNA 1NEEA 2GX8A 2YQ3A 1RT3B 1A7GE 3PX4A 1NLKL 1UVJA 3WC2A 5GLXA 5HBMA 4Y0FA 5CD4H 4C9DA 3LQVA 4OZ5A 4ZK7M 1U2RA 1N54B 1UMJA 4IO1A 1R43A 3SV4A 1SQEA 4N41A 1RT7B 3FFIA 1AUDA 2XCPA 3PW4A 2K3KA 2XBPA 3JAMY 5LXRA 1S6QB 1VRTB 4L3KA 5LJ5Y 3FZBA 1JLFA 2NS1B 1ZM3A 3QIDA 3RW7A 4LF8F 2QLBB 1FERA 3I55S 4PUOA 1G2EA 3OVBA 1FESA 2HQIA 3KDOA 2YUJA 2ZBPA 3BF4A 3MEGB 1UA1A 4FPRA 1OS5A 1HMVA 4ICLB 2CWKA 2OSQA 5AJ3F 4XPCA 2GHPA 3ZZUA 4LF7F 4LFCJ 1Q4RA 3FCHA 2XMAA 2A1BA 4LSNB 4XDDA 1Q7LB 1CBKA 2A3JA 5J1NA 5F9LA 2D3ZA 3GTJA 3H4DA 4BBYA 1UP1A 1GX6A 1TFWA 2M9KA 3R1LA 2JLEA 3GIIA 4DR3F 1NKCA 2G1DA 4CLWA 2DH7A 4A8KA 2EC2A 2RH3A 3QIPB 2CRLA 5KFLA 2JIPA 3BPDA 2G9OA 1PILA 4YUDA 4TQRA 3S01A 4LQ9A 2GVZB 2V9WA 4B3SF 3P96A 1KDNA 1D8ZA 1VIXA 4KIAA 1K8AT 2ZHAA 1FRMA 1UWBB 4F0HA 2R7TA 3LANA 3FZ2A 4AONB 4OMFG 4NLVA 4I7FA 2UUCF 1S0VA 3IWLA 5KG1A 1ZZFA 1Y3JA 3JSMA 2UXBF 1NK5A 3P3DA 4ZVGA 2MLZA 4L76A 1HQUB 2ZM6J 3S1TA 2GZOA 4MK9A 1RTZA 2W8LA 2A6MA 2E1MC 1JLAB 1R6YA 1LOUA 1E6YB 2LMIA 2V4QA 2QYGA 2MQPA 4GVBA 1NSKL 3BH7B 3TOQA 4FN5A 3VV2B 2AIRB 2RRBA 4M5KA 2YH1A 1HNVB 2ACMA 3CE8A 4LF2A 2AGPA 1RWKB 5IC6B 2NVYA 1VQMS 1GK8A 4KDLA 4ZS6A 5FTLA 4AOKB 2D3UA 3BBBA 1IKYA 5J1EA 1UCNA 2W9CA 4WKYA 1GTEA 4AZDA 2BANB 4H4KC 5EWFA 2CQ1A 5LMUJ 4DR5J 4DL0C 2DR8A 1N32J 4WIQA 1NDCA 2G0CA 1WWHA 2V8DA 2NXEA 4Y00A 4F7VA 2GNKA 3D5MA 1NM2A 1JLGB 2CZVC 3MPVA 2K1RA 1D1UA 1ZAVA 4PYAA 4CM2A 2ATLA 5ETNA 1B7YB 4ILRA 1PGZA 3CF2A 1TL7A 2MPUA 3RU0A 2GIFA 1YNND 4P52A 5HQ8A 1RTIA 5D3GA 5DDQC 4FS2A 3DLEB 1VQLS 1NK4A 2QJ3A 4GMKA 2HIYA 5IWAF 3NWGA 4KQZA 4K4VA 1RT4B 4XIUA 3UD5A 4JI8F 5CAAA 4O3NA 3OR1B 3DGVA 2I5JB 3CSKA 1YJRA 2E1RA 2Z58B 2QA2A 1C0TA 3K59A 1Q8LA 3OFGA 2RILA 2Q6CA 1K83A 2H51B 1JNRB 3GMGA 4U96A 3EDRB 2M88A 2QX0A 2OPSB 2RJZA 4X4VA 1A9NB 2DGXA 2LYVA 1X5PA 1Y0HA 4IG0B 1DTTA 3MPUB 2C2EA 4C2MA 2Y8WA 1JLEB 2AW0A 3BKTA 2E7XA 2QFJA 4FXDA 4LF9J 5BYRA 4DS4A 1CQMA 1E61A 1T8EA 4DMRA 3CULA 1T9XA 3NNHA 3IR7B 1SKRA 1DFDA 2IV2X 5M2UA 3AXMA 1UKUA 1VHFA 3ENQA 3CCTA 4B08A 3PHTA 2RKIB 3H40A 4JCWA 4WTOB 1CZ4A 1DTQA 4USUA 3CTRA 2W7OA 5KAKA 2EFNA 5CZXA 3W5XA 1F9HA 4PKDB 1YLXA 3FSIA 2MY8A 2KFYA 3HU3A 2QMUB 1QSYA 1RT5A 4DZDA 2CPJA 3J80Y 3D1QA 2ZH2A 3N9UC 5EDWA 6AT1B 2MZJA 4AQYF 1HKAA 3KK3A 1VQOS 1NH8A 2OHDA 4C8KA 2CIMA 2XSJB 4ZJLA 4P73A 1LFPA 3O2IA 4QYRA 3BYPA 4WYWA 1IKVB 5KFNA 4NLDA 1OPIA 1BQNA 1WORA 2QSWA 4ZVSB 1JLBB 3W5ZA 3D1HA 4QJVA 3PO5A 2EXUA 1S9GB 2AYGA 3N6LA 1HQEB 1X4EA 2XZWA 2AEMA 4HR2A 3TNVA 1PJ5A 4OLOA 2IBOA 3VAGA 3VCDA 2AX1A 3AH6A 2HK3A 1NK0A 2GCFA 1FXDA 4PR6A 4ANDA 4FYWB 4ED3A 1NJIT 1X0PA 4ECWA 2VUMA 3QYYA 3DDKA 4J9LA 3NAHA 3OV7A 1X4GA 3GTMA 4IR9A 2CPXA 5EX0A 4JYAJ 7FD1A 1U2FA 4ETXA 4ERDA 3Q8QB 2D7SA 4KPCA 3QT6A 2UZAA 3E2EA 4DV6J 4C97A 1M1HA 4LF8J 3ET6A 1HFEL 5LMNF 3CDAA 3JSBA 3MEDB 4QIWD 3C19A 2NVXA 1S9EA 4IUFA 2I0XA 3BJYA 5AJ3J 4XDCA 2RS2A 2QYCA 2RB7A 4LF7J 3TAMA 4JI2F 2CNNB 2E1PA 1SVDA 4EK2A 2Q79A 2DGWA 2EK6A 3H5XA 3QBCA 3DLKB 3AOBA 3GFXA 5C42A 2WVCA 4HDHA 2DNPA 2K8GA 1S6OA 5IQQA 4CT9A 3BGLA 2IDEA 4WPAA 2CNKB 4DR3J 1GQEA 1GT8A 4BC7A 1HBMB 2DR5A 2AJQA 1TFYA 1WKLA 1YHQS 2OSRA 5ETQA 1UJ6A 3J7ZT 2NZ4A 1TQLA 5C25A 3UI3A 5H9FK 4B3SJ 2RE1A 2CPFA 1BD6A 1HNWF 1J2VA 2R7ZA 4WP8A 2GAHC 5HBMB 1PIEA 3HKZA 2KVIA 2V45A 2HQCA 2VBZA 4RUCA 2HNYA 3LO3A 1AROP 1FF2A 2UUCJ 4KH0B 4ECQA 2DNKA 1UEKA 3FFIB 4R25A 3P49B 2UXBJ 2GQQA 3DRSA 2ZBRA 4NCAA 3X2NA 1QLNA 4LT6A 3KLIA 2ZVIA 1DARA 1JLFB 1Q1KA 1C1CA 3LOUA 3EJMA 1SC6A 5I3PA 4A8XA 4F4WA 4B9NA 4PWUA 2ZJRQ 3EWGA 1B0TA 4PUOB 1SB6A 4ED8A 3WX4A 5LT5A 1S3SA 1RTDA 1RTJA 1HMVB 5KT5A 4ZOSA 1WKJA 3CCVS 2VPZA 4CDIA 2ZWOA 1SJQA 3GFHA 4BWMA 1SKSA 4OL8A 2P5VA 2Z57B 4M5MA 2XLJA 3X2GA 4ZP6A 3W1YC 3QPIA 5DDOC 4YB5A 5I3QA 3KG0A 5HQLA 3ZNUA 1HQ2A 1FK9A 3CPWR 2ADCA 4OJHA 3PR5B 4DCJB 3IXQA 1NKBA 3ZZYA 4C3LA 2JVRA 1S1UA 5HSPA 3HMJG 4LIRA 2LA6A 1VC3B 4KV8A 1J27A 2YKMA 2Y3YA 4U9RA 1XJWB 5F8GA 3MPDA 1V3SA 1RWUA 5DZ7A 1SJ4P 5H9EJ 3G86A 3QATA 3GSIA 2Y0SA 3G71S 3MTJA 3P8BB 4CRYG 2LU1A 4I7FB 2CJQA 3HXMA 1JX4A 4JI5F 3MMCA 4B9LA 3JSMB 2ENGA 1F6TA 1ZM4A 2I8EA 2KXHA 3QGGA 2Y0BB 2CVEA 2D69A 3RB0A 5FDLA 3P45B 1YRXA 1UVLA 3GIKA 4JI8J 2VBWA 2B4UA 5J2PA 1Z1ZA 2V9KA 2RVJA 3P6YC 1BWVA 4UTGA 3MCSA 4RV0A 3C14A 3PCOB 5GVQA 1YVFA 4GVBB 1BHNA 3SQGA 2AJ4A 4ANEA 5DJBA 3J81j 5B0DA 2B9XA 4KT0C 5EX3A 5D15A 2N7CA 2AJ1A 5BYSA 2W9AA 5HI7A 2N82B 4DSLA 3GJRB 2O1PA 1P6TA 2NCKL 1H3DA 1IKYB 2J9DA 4HEA9 2G2ZA 5J1EB 3IAM9 1FNOA 2W9CB 1BUXA 3MAQA 1FI4A 1U47A 2ZVSA 4I0WA 4JV5J 2CQDA 2BABA 1S72S 3FUYA 1T9WA 4OZNA 2VA3A 3QT7A 4C6AA 1Y11A 5FJ4A 2EG2A 3CCJS 4CLKA 1Y4ZA 5KT7A 2K1RB 1FJGF 4KY3A 5LM7E 3GU0A 1HWUA 3RTVA 4ZVHA 1FJEB 2GJIA 3OW2R 4OJ3A 4DX6A 4IDKA 2V0NA 1WNEA 1TL7B 3EXCX 3MCNA 1RTIB 3OT9A 5D3GB 3P5TL 4L74A 2WAQA 4AQYJ 3TJ8A 3PG9A 2GMLA 1TKXA 1N6QA 4EBCA 5T5MD 2HBQB 4FYXB 4JI0J 3L7OA 3UO0A 1K0TA 1F5CA 2VUGA 3HSDA 3VGSA 1U0SA 2EEOB 4A4JA 1K44A 3X2HA 4YHHF 5ETMA 2HFVA 1C0TB 4FF3A 4GO7X 3KJQB 2R7RA 3EGZA 3AFGA 4YY3F 4DX5A 2XI3A 2C2NA 4DN0A 1DTTB 4K0KJ 1UEUA 1RAAB 4X65F 4QWDA 2E5GA 2RT3A 3TUJC 5DLGA 2OTLS 3ILJA 4TQSA 2F8MA 2IM0A 2A10A 1R6VA 3MGJA 1TELA 4LF4F 1WSRA 3CMQA 3Q83A 4LIWA 5B6CA 1O51A 3FEZA 2A68D 2CPEA 2EC0A 2PFDA 3UCUP 1Z2ZA 5I42A 2JIQA 1WOPA 5LMNJ 1DTQB 3D2WA 4KHRA 1U49A 3AA8A 4C8YA 1UVKA 4USTA 3ITHA 3NP5A 5ETVA 5GAHU 4KFBA 4DV4F 3UR3C 4ENOA 1WTBA 4JI2J 1PKUA 3AHPA 3V4MA 1RT5B 3N28A 5IFMA 3B8HA 2PMZD 3TEHB 3HP6A 5AXMA 1RXOB 4P9SA 3KK3B 2MSSA 3Q2SC 2ZH3A 2JA5A 1TVRA 1UJ5A 2RDJA 4YS2A 2IDLA 3M2UA 2AP6A 1WJ9A 3R5BA 3US5A 1ZOTA 3CGIA 3TUIC 4DL5A 1YZ6A 2J7WA 1BQNB 3MEKA 2D9PA 2LXUA 3KHLA 4GVLA 4I68A 4WK1A 1P1TA 5CYQB 4DR1F 1M5PC 1MW7A 1SL2A 1I94F 4ECRA 1HNWJ 2CPIA 5IT0A 5ETRA 1CVJA 1N10A 1D0EA 3DOMA 4AL7A 1XK8A 2KO1A 3W61A 3SCJE 4DUTA 1NK6A 5JVGQ 4GA5A 2N3LA 4O44A 2FJXA 1Y9OA 5DQHA 1S76D 1YZ7A 1WF0A 2ZH6A 4QYZK 1PC5A 2KM8C 4K7QA 3NGDA 1OMSA 4WYLA 4CYUA 4LRAA 2F63A 5IZHA 3CVKA 3ET6B 3RR7A 3HKWA 2BKNA 1TKTA 2XMJA 1XEZA 1CJTA 4XPEA 3DLHA 2AX0A 4X4QA 3W9IA 1B3TA 1S9EB 4WFBQ 5K8NA 1FRHA 1W2IA 1N4LA 2XSFA 3TAMB 1UVNA 2JSXA 3HX9A 5L1JA 1N52B 3O5AA 5KOWA 1KLNA 4IFVA 1FJ7A 1RSCA 2HMIA 1PYSB 4HYKA 5C42B 2LLZA 3BDPA 2VFSA 1F1BB 1S6UA 2J7UA 5KFIA 3IGNA 1FRXA 2EFOA 5KG5A 4RW9B 3CXCR 4UOFA 4FNHA 5D4NA 1NK7A 2HVIA 2J6SA 3CCUS 4DSJA 4LFAF 1I3QA 5D0RA 4B17A 2DRDA 5C25B 3CJ3A 4MIBA 4CO4A 4ZVQB 3G6ES 4CM0A 4R0JA 3PV8A 1PO6A 3QJLA 2VBYA 2BA9A 4I4BA 2KG1A 1HNXF 5HJYA 5T41A 5KTQA 2HNYB 4NLGA 3KDNA 3OJSA 2X51A 3JQMA 4NZ0A 1VRUA 3IRXA 4JI5J 2BYCA 5IC4B 2I38A 1XR7A 3DRSB 4BC9A 1UZHA 2NPIA 5B0EA 1PYQA 4Y3CA 3KLIB 3LF0A 4ED5A 1C1CB 4P10A 3KUEA 2HNZA 4KGKA 3CCSS 1AFJA 4M63A 3HHLC 1N33F 3OXFA 1GXTA 4MYUA 1SL0A 3AT1B 3T19A 1C1BA 5AXNA 4OYWA 1RTDB 4DFMA 1RTJB 1DJ0A 2VPZB 4K8RA 3OPKA 2LXFA 3RZAA 1R0BG 5J2MA 4WZQA 1LWFA 2DISA 4J9RA 3C15A 1WEYA 4DPOA 3HM9A 1F3FA 2MJUA 3ZZZA 3KUHA 4LREA 4K4YA 3VAHA 3THTA 2AEFA 3T5LA 1FK9B 5DYIA 4FS1A 4HVZA 4HH1A 1GFWB 1RHQB 2H5EA 2J9DE 4ZLNA 3MXHP 2B3TB 2XULA 2FIUA 2BV3A 1ZPVA 1S1UB 2JX2A 4PWDA 3D3BJ 4FXVA 3DDIA 1FJGJ 1FWLA 3BS9A 4KV8B 2D3OR 1EKSA 1X60A 2YKMB 2JHEA 1T3OA 2CQBA 5KFHA 4LJMA 1WC6A 1M5KC 2VODA 2Z30B 1PAUB 2RU9A 4CH7A 2C2KB 3OQ2A 2QLWA 2KRBA 1RYRA 3R8YA 4DFJA 1YBAA 3MMCB 3N4WA 2F8EX 2H4WB 2ZKTA 4B9MA 3CDEA 5FDLB 1IR0A 1QUPA 2I1RA 3NWRA 1OPZA 1ZA1B 1BC6A 1RBLA 3T9ZA 3L7PA 5J2PB 1ITPA 5KFXA 2YBVA 2RHSB 3D0GE 4PG4A 3C14B 2XTJP 4OZ3A 1L3UA 1KQFA 2OUGA 4YHHJ 4DX7A 3SQGB 5L38A 4OYZA 2PEHA 4DV3F 4NRUA 5DS7A 2Y8YA 4MKBA 1X7VA 1CLFA 3E8OA 4DQQA 4DQIA 2AEJA 2B6AA 4PRFA 5A2QU 3K8VA 3DI6A 2RUGA 2HSEB 3QNWB 2ZHOA 2W01A 3N0VA 1FRIA 4A46A 1FEHA 1ZAXA 4D7ZB 4X65J 3UCGA 5EUHA 4HLBA 2MXYA 1FFSB 2DK2A 1KTVA 3QJPA 1Q53A 2AGQA 4IH7A 2M3DA 2V2QA 1SMYD 4LF4J 1VQ8S 3F41A 4OHZA 3FBBA 3QLHA 3MTKA 1VLYA 4LMZA 2HQGA 1HWIA 2ZFHA 2H1YA 3D54A 4U7UD 2KT2A 4M5HA 2K2PA 1WI8A 1Y4ZB 1RBOB 3GTGA 4UY8T 1UPMB 1R27A 1WHWA 3Q24A 1KD1T 2CKWA 3OTOJ 4IDKB 3CWJA 1IWGA 1U1KA 3BO4A 1KN6A 2JIMA 1REGX 2ATCB 2B0GA 5IT9Y 1BW4A 4USIA 2VPXB 1JJ4A 1SJ3P 1PAEX 4D3HA 1Q79A 4DPUA 5KFCA 1AT1B 4LUBA 3IWXA 2ZH8A 1TKXB 3K8WA 1HR0F 1N6QB 3MMAA 2B9YA 4Z7CA 4GC6A 1TMJA 1L3VA 3FBEA 4I69A 4UUWA 2Z4PA 1I1GA 4USMA 4KHMA 1SH2A 3QFWA 1AYEA 3GZ7A 3V6DA 4NLQA 4YR2A 3GYXB 5ITHA 2H9ZA 1S57A 2BJEA 1I94J 3O5TB 1WDDA 2EKYA 3BQ2A 2RRNA 4J9VA 2IJFA 1ZS6A 4H4MA 2IY5B 3UPFA 5E7OB 4DFKA 3BBCA 2NSBA 1JQGA 4ECUA 3CB4A 3BREA 1B0PA 4ZPVR 3D68A 2DNLA 4RW6A 3D7SB 2OMOA 3HK2A 2AQ4A 2VQEF 4ZPBA 3IGVA 4KTQA 4JB8B 3VTIA 2Q6BA 2BM0A 1V6HA 3B54A 3SIPB 1G1XA 4CIOA 1MG7A 2PA8D 2B4VA 5I42B 4DLGA 2P9GA 4ZPTR 2F4FA 4WFNQ 2KXNB 5H1SV 1L3KA 2E2HA 3HSJA 5KFSA 6FD1A 2HAIA 3AY0A 2C2MB 3NCRA 2RQ4A 2XNRA 2DR9A 1Q7YT 2HHXA 3LWMA 3ITHB 4YFUA 4KFBB 5EN1A 2HVHA 1YJWS 2V69A 1BQMA 2R2TA 1WC1A 3ZXWA 2WOMA 4P2MA 4HL9A 4UOHA 3GFYA 4ZPCA 2W4PA 1VK8A 5BXIA 2CQCA 4DF8A 2OGUA 1HD5A 4ED7A 1W25A 1TVRB 2MZSA 3E51A 2MMYA 3N01A 3KUGA 3M2UB 2HURA 3MAHA 5AXLA 4CLTA 4DS5A 2OKQA 2QL5B 2L9WA 3T1HF 1X0FA 2QMXA 4CLYA 2X7IA 3OR2A 5FTKA 2LFVA 5A6PA 3OHAA 1U24A 1KFDA 4A47A 1KQGA 2CJBA 4M5GA 1E32A 1EZZB 3DOMB 2HFSA 1C4AA 3OL6A 1X5SA 3D4JA 3FKIA 3MECA 1OA9A 3ELHA 1TMMA 2ILZA 3BSCA 4ZMMA 2WW8A 4O3QA 4O44B 5HO4A 2JLGA 2KQAA 4RNMA 2XZDB 3W65A 1OGYA 1FE4A 2BEFA 5AE3A 4LFBF 1NPPA 4CYUB 4GKJF 1SPBP 2OTJS 3FEXB 2FZCB 1QUVA 2R9LA 2M52A 2JFDA 1N33J 1TKTB 3HVAA 3GILA 5B08A 2MQLA 3H5YA 1CJTB 3NOGA 2HQ3A 2AYMA 4EU0A 4CH1A 4EYIB 5KG6A 4PAAA 4YB6A 5A8KA 3GFZA 2G5DA 4ZJOA 1NDKA 4HHHA 2OAUA 2JC1A 3ILOA 4IFVB 3JS9A 3CCWA 2HMIB 1S1WA 1FDBA 1VYAA 3T1AA 1CPZA 4OYOA 4ECYA 4PYDA 2B43A 4P7VA 3GE9A 3KMSA 2WZ1A 5EHHA 3IP0A 3F0NA 4X64J 1UZDA 1DZ5A 1HI8A 3PVXA 1MU2A 2K7KA 3K5MA 1RB0A 2ADBA 4C8ZA 1X5TA 2YH0A 2DNQA 3MR7A 2M8DB 5K8OA 1Q0NA 2R8IA 5K14A 2W9BA 4MK8A 3KLVA 1U48A 2WVBA 3DU5A 1VRUB 3IRXB 2G2OA 2GAEA 3FMBA 1BLUA 5HATA 2UVWA 5CA5A 4DSKA 1T03A 2E7ZA 1JB0C 3WHIA 1TP7A 2GHVC 3I82A 4O3OA 4PG6A 2CPHA 4DV7J 2JJ4D 1YITS 2DO0A 2HNZB 2D9OA 3EGWB 2W2PP 1VQ5S 4PEOA 1ZAWA 2GO8A 3SDEA 2CPDA 3OD2A 1HBNA 2PI5A 1C1BB 3I87A 4DV3J 3RJMB 1NK9A 4CTAA 1W2BR 1S0NA 3KHRA 4DL7A 3RB4A 2P6TA 3AD8C 5LXYA 2HIQA 4QZVB 5J2MB 1LWFB 1BE4A 3K2YA 2FJAB 4FF2A 5HLFA 1QAYA 3KNAA 3C15B 4OLPA 2V6AA 4DPXA 1MMLA 1WC0A 2HPUA 3DLLQ 1BXNA 3BB5A 3NBPA 1E6VA 4WFYA 2HHQA 2C2RA 5DDPC 3EE3A 3R2DJ 5HANA 3BSOA 2DITA 1AUSL 3MD1A 4CRJA 1U02A 4HHJA 2IVMA 2Y1IA 1IBMJ 5DG7A 2Y1LB 2HAFA 4Q44A 2YVSA 2VG6A 3GJQB 2I6WA 2NSCA 1TUVA 4DUYF 1TL4A 1XMQF 4PWDB 4HACA 3CJQA 1FFWB 5AE1A 3UDVA 3BSNA 2KFNA 2E5HA 2VA2A 2D74B 3M30A 3SFUA 1PPYA 2YNIA 3FGVA 4DN9A 1HBOA 1SUQA 3DYAA 3LP1A 1YG0A 4F2RA 4DV1F 2HFZA 1T95A 2V2VA 4LR9A 1TL1A 1RHMB 4O0IA 1R7RA 3MF5A 4C8LA 1N5VA 1AFIA 4CLLA 4O3SA 1RAHB 1UVMA 4BHQA 1PYUB 2YNHA 2UP1A 1HR0J 1GTHA 4DXLA 2DGSA 2UUBJ 4JI7F 1RUSA 5L46A 2VQFF 2YKNA 3OSPA 1ZETA 2E1AA 5F8JA 1KQFB 4AAYA 1F5BA 2QMWA 2BQUA 2CWXA 4RNFA 4QWBA 3PJ9A 1FNMA 3POTA 4Y2MA 3NGUA 3Q8YA 1IBKF 1NUEA 1WG4A 4NA2A 1QAXA 2GMJA 2B6AB 4QWEA 5DG9A 3DI6B 2BM1A 3AD9C 1NO8A 2JRSA 2VC0A 2DB1A 3MEEA 2UVVA 2V50A 3H2UB 2FLNA 2QO3A 3GCXP 1H73A 2NUUG 3QLHB 1GNKA 3KXDA 4CLFA 2XLKA 1WC5A 3RBZA 4RU2A 4ENGA 4Y28C 1S48A 4HH0A 5FLXY 5DM7Q 2CQGA 1D9AA 3A3PB 2J8SA 1EAYC 1R27B 2FC9A 4I56A 4F67A 4ID5A 1RHJB 2A6OA 2RQCA 3Q8UA 4G1PA 2GHWA 2ALZA 2PDAA 2KM8B 3OJUA 1YLEA 1KOHA 3GYGA 4NA3A 2ZC3A 2RD5C 1BQXA 5KG4A 3H5UA 2HBRB 2GVZA 2R4FA 3HULA 4WP3A 3KLFA 3MMAB 4ZCKA 3NAIA 4ELUA 1X4AA 5G0RA 4JP7A 2P6SA 3T1HJ 1E18A 2XYGB 2W24A 3UVJA 3LPYA 3NOCA 3V6DB 4MJKA 2ZC4A 5DLFA 4AXJA 5BJRA 1RQ0A 2B5JA 5DQGA 2NR0A 1U1LA 4Y2KA 2XI2A 1VQ7S 2J9CA 5B0BA 4HTIA 3PEJA 3DU6A 2XS5A 4IQMA 2FD2A 4H4MB 3FKBA 2PSZA 2IIHA 4ZN3A 2HLTA 3M9NB 2FC8A 5F8IA 4MIAA 3DRPA 4J9NA 2BJ1A 2XWYA 2VDIA 3WX8A 3ZZTA 1IM6A 4ELVA 2ZUAA 3CDUA 1RAGB 4USWA 4ZVUB 4CNYA 5E0OA 2MKKA 1JK9B 3ZZOA 2G6GA 4RW6B 1NB7A 4K4UA 1FVQA 1S49A 2V94A 2XWXA 4OI0A 3GPAA 2VHGA 2RNEA 1XNQF 4X4RA 7FDRA 3U02A 4LFBJ 5KFAA 2Z8QA 3AB2B 1T9YA 3NGRA 4B3RJ 4P6QA 2DNRA 3LGNA 1CJKA 3BH6B 2ABYA 3SULA 4A8OA 3EGNA 1KNZA 4DL6A 4OV6A 1BQMB 2O67A 4JI3F 4IH6A 2WOMB 3EMTA 1U0HB 4OV1A 3TZWA 1H38A 2J0XA 4GO5X 1D09B 4ES3A 3LAMA 4ER8A 1JXLA 3KMQA 1NXIA 4Y2AA 3HD1A 2CZ4A 4X4NA 1FJCA 2QV6A 3V6KA 2E1CA 4RR5A 1FWKA 1FVSA 1TK5A 1VC5A 3VGTA 2GW8A 4OI1A 1HA1A 3OR2B 1CC7A 2M70A 3PW5A 1KQGB 4JP8A 2XMKA 3R7NB 4J90A 4Y2IA 3R5GA 1S99A 2R8KA 4WBFA 4NRTA 2QLFB 4C11A 1QD1A 3MECB 3R5AA 4NX9A 9ATCB 1GAOA 3M6WA 2VV5A 2QIFA 4TY9A 2JVOA 2JL9A 2GIRA 4DSEA 3HFKA 4EI2A 3MZIA 2JZ5A 2VD3A 4WTYA 3TRGA 3V6JA 2BXJA 1HNIA 3PX6A 4IRCA 4DSFA 3ZZRA 2FJDB 3ZFVA 5HN0A 4CNZA 4KE5A 1UW9A 3QAEA 2EWHA 1TK8A 3V2UC 5A8KB 2WB1A 1YWXA 3ZTRA 4Q43A 1FRJA 4ZVOB 3AQPA 2KJWA 1RTHA 5C1BA 1N88A 1S1WB 1EJ7L 2FVRA 3W2WA 5L1LA 2XGPA 1SKWA 2CQ2A 3FSYA 5F3TA 1HARA 2DCLA 4KR0B 3LA0A 3M6UA 4Q5VA 4X84A 2KN4A 5E3AA 3G6VA 2WB4A 4DUYJ 2BQ3A 1XMQJ 1YDLA 1MU2B 2G0JA 2H54B 1WOSA 1RA6A 4MFBA 2WHOA 4NLOA 3K57A 2YPZA 2VOOA 1ZTTA 1WF2A 2IJNA 1FXRA 1FDDA 2X1AA 2CG8A 3RR8A 5K14B 1D9FA 2W9BB 2F9DA 4GRSA 1WOOA 4DV1J 2AYEA 1YJUA 4PXBA 3W3SA 2V4JA 1U6BA 2GFFA 5D4OA 2VPYA 2QTWA 2EKNA 4JV0A 1EIYB 4FG2A 2GO9A 1T03B 2E5LF 2CDQA 3ADAC 2QLXA 4JI7J 1RK8A 5D0GA 2VQFJ 3UD4P 1SIZA 3G8QA 4R8UA 2HWIA 5IM0A 2L9DA 1QTNB 3CJTA 2MHNA 5GMKa 1G3OA 4ZLPA 3SDEB 1YNJD 1HBNB 1FX4A 4DU8A 3M6VA 1NDPA 4OZ1A 2BJDA 5ADZA 4JUZA 2VONA 4CTAB 3IFEA 1IBKJ 1T0TV 4Y2CA 1YGYA 5LJ3Y 3KYLA 4MYTA 4S0MA 2U1AA 3CJ0A 5HLFB 4ZKAA 3QZ7A 1G7CB 3FRZA 1NH7A 1PQHA 4IH5A 3X2KA 4MK7A 4NZ7A 2FJEB 5HVFA 3NBPB 1E6VB 2WBMA 5T5ID 1TR0A 1ZH5A 3ZNJ1 1VBZA 5L1IA 1XMBA 2L08A 1S0MA 4NXMF 4YMEA 3MUTP 5T7LB 1AW8B 3PR4A 2EFPA 4NLXA 2QT7A 4AYBA 1P9QC 3ENWA 3K17A 2VG6B 4KH1B 1RU1A 1RZMA 5B0AA 4HACB 4QWCA 4TKTA 4AL5A 4OX9F 3TVZA 3DLBA 3MFIA 2IAJA 1VLOA 4CS0A 3R6LB 2HHHF 3M30B 3GR1A 2YNIB 1DQAA 4PQUA 5GLFA 3EXYA 1HBOB 1SUQB 3DYAB 2W7AA 3LP1B 1UW4A 4RX6A 3SV3A 2MYFA 4K4XA 1F2GA 3D0HE 3GJSB 4ZPAA 1TL1B 1S4FA 3W9HA 4NZ6A 2FHKA 3EZUA 3DLGA 3EVMA 3BYRA 4Q7AA 2YNHB 1RADB 2D1CA 1C0UA 3R7BB 3MFHA 1I3OB 3SCIE 2YKNB 2MZ1A 1LEOA 4A8MP 2R7SA 3BGOP 2XY6A 3ZZ0A 3R5DA 3GCWP 4H54A 1YJ9S 4N56A 1KSPA 3POTB 4N47A 4Y65A 3MOJB 3ENGA 2A69D 1H2TZ 2NXNA 2ZKUA 3CC7S 5C24A 3JQKA 1NZAA 4P2SA 2F7VA 3HO1A 2OELA 4Y6IA 2VIHA 3H2LA 1BGXT 2CQIA 4LSZB 1IBLF 4G65A 3C16A 1Y10A 3O8WA 1X8DA 5EPPA 5FIIA 3L4BC 3MEEB 2BJ3A 3N5BA 4YN3B 1GH8A 1W7WA 1Y7PA 4WP9A 4DV2J 1SBRA 1X4CA 2BE9B 2OI2A 1I5OB 1U1OA 1VQ4S 5DZ6A 3HZGA 3PFOA 1P1LA 4NEYA 4DR2F 2HHTA 1S1VA 1XR6A 1R3NA 3CD7A 2M0GB 2YWKA 4EO8A 4ID5B 2X1FA 4WU2A 2VG5A 6FDRA 4RNNA 2J7KA 4P7TA 1S59A 1KC8T 2HGMA 2HFOA 2MKHA 2V63A 4TU7A 3NLCA 1WC4A 2IVYA 2BE7D 3BM7A 1S1TA 3KLFB 3PIOQ 5LOQA 4P2XA 3HSGA 2KH9A 5G0RB 3ILIA 3KHHA 3VVUA 3UVJB 1FA0A 1PC4A 1KQKA 5KG2A 2B5JB 3I0SA 2KI8A 3NNCA 2ZH7A 3IBFB 3ZZPA 4TNOA 3FQLA 2DEJA 3NGKA 4F3QA 2ZD1A 2H5IB 3QRQA 4QW9A 3RRGA 4GA6A 3VQSA 3KLHA 2WONA 3ZTPA 2UUTA 4DR4F 2PNWA 3MM7A 1MWYA 3DRPB 3FBFA 2IYIA 2YWGA 4LSLA 1R8BA 5ETSA 5THWA 2ZH4A 1J5EJ 3GV5B 2KZZA 1I51B 4DBQA 1T05A 2H3EB 2FGOA 1EQMA 3TAQA 2BBEA 4IOBA 3S7RA 1LKZA 4R0EA 1I6JA 3KK2A 4E98A 7AT1B 1CJKB 2YWEA 3GB0A 2OD6A 5B0FA 2MSTA 3AODA 2POKA 4V1Ak 3E3XA 1WHXA 3W2VA 2DYAA 3AOAA 4IOAQ 1QY7A 1LWXA 4WE1A 5I3UA 1GMUA 1NJXA 4OJ1A 1KLMA 1CSJA 2LA4A 4EZ6A 1FTCA 2MKCA 2Z2MA 2L48A 2VG7A 1OSDA 2OO4A 2RUSA 5MLCV 4ANCA 2R42A 1FNXH 1F60B 1CJVA 2DH8A 1TWFA 1VIOA 2CA9A 3IR5A 1AA6A 3KWMA 3CCQS 2OIHA 1QJHA 2RAQA 5JJBA 2P2CB 3LPEA 1YKWA 2EI5A 2QL9B 3L9ZA 1FE0A 5CCLA 1HL6A 2YX4A 1PT1A 2WVFA 2Z2ZA 4C98A 3M2RA 3M8ZA 5JXSA 1TMOA 1O8BA 2WVEA 2CG4A 2JEJA 4TN2A 1ZYRD 4ZP7A 4YB1P 4OYPA 4YOEA 2VASA 5GAEI 4C11B 5D6GA 4FDFA 2DCUB 2DR7A 3WDOA 4UT4A 5AE2A 1EB0A 2R2RA 4CLPA 1RWMB 4DV5F 2DR6A 5KFOA 3U27A 2MB0B 1XMOF 1OWXA 5DQIA 4LF6F 2E9TA 1AA1B 1HNIB 3ZO7A 1OO0B 1O0PA 1ULRA 1TK0A 4FYYB 3ZTOA 3C66A 2JDJA 2G4BA 3PO4A 4EUVA 4LRDA 2ZJQQ 2AZ3A 3GQCA 3IM9A 1SC1B 3KJVA 3B82A 4DUZF 3KG4A 4J9OA 1U1QA 4PXCA 5BR8J 2W2MP 4CQ1A 4X2BA 3TX0A 4IG3A 3GTKA 4Q8FA 3BV8A 1RKJA 4QIGA 1RTHB 4IOCQ 4IRKA 3G9CA 1WHYA 3W2WB 1RHUB 4NXMJ 3IG1A 4LRFA 2HVEA 3O6QA 1PCAA 2XYHB 4RU9A 3T1YF 2MKSA 5IQ6A 2AHOB 3QRRA 2DRBA 2JH3A 2WTFA 1SV5B 4ZITA 1RCOB 3GTQA 2DNGA 3TJAA 2NYAA 4AYBD 2QFIA 2F65A 4X62F 5AXKA 3K58A 3DHXA 1XNRF 4OX9J 3HT0A 4MFBB 4MH8A 2ASJA 1RKIA 4F04B 3K89A 4U6PA 4O4RA 4PPZA 2HGNA 5D0HA 2NXJA 3D1OA 2HW3A 2MLXA 3QRPA 4C7QA 2EFVA 3TR5A 4F4XA 2UUAJ 3AJ1A 3MM5A 4X66F 1D9DA 4OI2A 2V4JB 4EBDA 2QLJB 3J81U 4AE5A 2VPYB 3W9JA 2XS2A 5ETTA 2OJ3A 2MQQA 1RLDA 3L3CA 2KI2A 4USVA 5CYQA 2N7YA 4N76A 3K0JA 3SUKA 4OJGA 4ZDNA 1L8FA 2DHHA 3OL9A 4ZVEA 4R8UB 5IM0B 2F4VF 2RS8A 1M5VC 3GTOA 2V3VA 4M94A 2P9CA 5E2QA 3DFEA 3MMBA 2XY7A 3GV7B 1VBYA 1CULA 3EVWA 4P74A 5CH7B 3HU2A 3BGUA 3THPA 5F3ZA 1RDRA 3QFHA 3SMZA 2NXUA 3QQ7A 1MROA 4YEAA 1S5ZA 3MR3A 3J7A1 3PYFA 2PO4A 3N79A 2O01C 4C48A 1F5AA 4RW4A 4WCEQ 2XO6A 4K5RA 3TVYA 2IAJB 4PWWA 1ZYQA 2R93A 1U8SA 2KFZA 4X4TA 2V8PA 4OI4A 4EMDA 4PQUB 1YRTA 2LDYA 1WSVA 2PEBA 3LW5C 5K9FA 4RW9A 2F5GA 3OLAA 2BX6A 3X2JA 1DQ9A 2BVZA 4TU8A 2RF2A 3IM8A 4AFFA 2ROPA 3DLGB 4NLRA 3SXLA 2UV8A 3WZ0A 3PYEA 3RAMA 4KDIA 1C0UB 2BJ7A 1JXEA 4HT7A 1FT8A 4ECZA 2YWWA 2ZNZA 4KGZB 5ETOA 5AT1B 2WK4A 3X3UA 4H4KA 4MT1A 3GSDA 4P2FA 2R7XA 4KB7A 2E7VA 5C2CA 3NS7B 5C24B 2CYYA 5HL7Q 4DR4J 3J7YU 2R8GA 3LGMA 2PIIA 1LNQA 1HW8A 3DGPA 5GMEA 5F8MA 1J5OA 3SEOA 1S0OA 3C16B 2E5IA 4NE9C 2IJRA 2RMLA 1VQKS 3TP2A 1SC3B 4JBCA 1RP5A 1JLCA 1XC9A 1VGYA 1SH0A 1UJ4A 3QC8A 1OJ4A 1TTHB 2DNHA 3K7RA 4J9MA 2XLIA 2G2YA 3BN4A 1S1VB 3GR0A 3J7AN 1Y5LB 4Q2MA 2WRMA 2FLPA 3NG8A 2H5JB 3X1LB 3KLGA 3NS5A 4PXDA 2JA7A 2VG5B 2DJWA 3IO1A 2H48B 4C0HA 4G1QA 1IJFB 4MMOA 3QWPA 1N36F 3TA1A 5H9EK 1RAFB 4RLEA 2HVZA 4M5IA 1HNZF 1U1NA 2DMRA 3CCES 3HVTA 4K2XA 2CQ3A 3UWTA 2KT5A 2ZOGA 3EYZA 1OQ3A 3Q23A 4DQRA 1S1TB 1LK5A 4WU3A 5HAOA 1Q78A 3W64A 3GG1A 1LW2A 2CDRB 2FJVA 3L09A 4TVAB 2R2UA 2NLWA 4DMZA 3SCLE 4X4SA 3ICLA 3I0SB 1NSAA 4DLEA 4KJIA 2ACYA 2PA3A 2WSCC 2ZD1B 3JTNA 3UNGC 4QQBA 5EWGA 3KLHB 2WONB 2DGTA 3HLUA 1S4EA 3MM7B 4JI4F 5IWAJ 4NPOA 3N6MA 4I6YA 5KFUA 1P8GA 1MN7A 3QGIA 3X2OA 2DGUA 1Y1WA 5L9XA 1XTZA 4LSLB 3AB4B 4DR5F 3OSNA 3BZQA 2JLFA 3M8SA 5CQGA 1N32F 4DV5J 3V81A 4RJVA 1R0AA 5D0EA 1T05B 3HF5A 1NJYA 2F40A 4LF6J 1DHMA 4ELTA 3RAXA 3IS9A 1RWPB 3M1VA 5M2RA 3KK2B 2VKZG 3EM1A 1S7IA 1EHWA 3BKFA 4LVOP 4UQTA 3VAFA 3SSRA 3D6HB 2HS3A 1RWNB 4RWXA 4LRBA 4DL2A 5A8WA 3CT9A 1NHVA 2R7QA 3W2VB 4DUZJ 1WG5A 4DL3A 5GAGU 2JIRA 4WE1B 5I3UB 1VI7A 3D9BA 4AD6A 2FPHX 1X9SA 2PJHB 2KYZA 1KLMB 4E2FB 2HEKA 4ZLJA 2VG7B 1REVA 2HLUA 4M5NA 1PYTA 1URNA 2KRRA 2HVDA 2C3MA 1CJVB 5D4PA 3QAUA 5KT6A 3TUPA 1RU2A 3IR5B 4USJC 1UETA 2YNFA 4KAIA 3T9NA 2FB0A 4CP5A 3CCRS 5CYJA 3X2LA 5RUBA 4DV0F 5CZVA 2C1EB 4NYPA 4X62J 5M2PA 3TJ9A 1GMWA 2BMBA 3M2RB 2XEXA 2VPXA 3UN5A 2GS8A 4X4OA 4OYAA 2DEIA 4OHXA 4KC5A 2CPZA 2CZ9A 2VL1A 4X66J 3PTWA 3PLXB 4Z37A 1T9UA 1R8PA 5DRKA 2WVDA 1IW7D 1LXNA 3ENVA 2VDHA 4NYOA 2E9ZA 1KVJA 2HKEA 2YY3A 2V34A 2E7WA 3PIPQ 2BKPA 3M7VA 2F4VJ 1WC3A 2IPOB 4URQU 1ZC1A 3TX8A 3A3OB 2FVCA 3MD3A 3GIMA 1QE1A 2AU0A 2DY9A 1YTYA 2KG0A 3KTQA 2EK1A 2YWHA 3A13A 3KJVB 3OTEA 2OMLA 1FKOA 1UFWA 3SUJA 3FK4A 4EFAC 4IG3B 1SI9A 3PFEA 1X4FA 2LVWA 4LBHA 1HWJA 1R8AA 1X5OA 2EBGA 2A0FB 4L3NA 1JKHA 3I32A 4NLPA 2YKPA 2KHCA 4DCOB 2DXFA 3MM9A 2C3PA 4EZ9A 3PJXA 3IG1B 5F41A 1WEXA 3KK1A 2W2QP 2LQJA 4ED6A 2OEMA 2VJUA 4H4OA 4CO1A 2DNNA 2PC6A 2N3OA 3CIMA 1ELOA 2ZH5A 1TAUA 3T5JA 3KJNB 2PICA 3MM5B 5KG0A 2RU3A 3BSAA 3I5AA 4C8OA 2YNGA 2J9EA 4JYAF 2CPYA 4EWTA 2AWZA 5KT4A 4MAKA 4QR0A 2IBKA 2J76E 4DV6F 2L3MA 2BQRA 1OY9A 1IKXA 2V5HG 4QIWA 4JJOA 2CUYA 2J8AA 3J7YI 2MDAA 1K9MT 4CRZA 2Y9HA 3FJ2A 2ZOFA 4UZBA 3HKZD 4ED1A 2K3IA 1V3ZA 3MMBB 3T5KA 1L3TA 1UFKA 1CULB 2QL7B 2H4YB 2VJVA 3FDSA 1DAXA 2HQFA 2GV1A 2MY7A 3W7BA 5L1KA 1H72C 1Q8BA 2GJ2A 3H2VE 3LAKA 1Z2LA 3QWUA 2DT9A 1FDOA 4M5LA 4DR6F 1MROB 1T02A 5KFDA 4E8UA 1EKRA 3BQ0A 2IRXA 2RQMA 3I4PA 4RW4B 3ULHA 3AOCA 2XM3A 1JIHA 2HQDA 3RBXA 1S1XA 1BW3A 3I0RA 1V9OA 1NKEA 1TV6A 1R7IA 3R97A 3AJDA 1TUWA 2FZGB 2KB2A 4I2QA 2LEPA 1N36J 2BW7A 3DMJA 3VR1A 3VAIA 4DOZA 5A2QY 1HNZJ 3HZEA 1UL3A 4TU9A 4DQPA 2RF2B 3D66A 2NPFA 1FXLA 4WKRA 3CJ2A 5KFWA 4HTJA 3D3CJ 2DD8S 4U7CA 3Q86A 1UAWA 4F4KA 1IR2A 4ECSA 2XQCA 3R5JB 4RPFA 1IQTA 4PPDA 3FBCA 3I56S 1QSLA 5KFYA 1K1SA 4KPYA 4DQSA 2Y0SD 4XO0A 3RYLA 2YKAA 5KFFA 4JI4J 2GQ2A 4DWIA 4ZPWR 1NSQA 2E44A 4AXIA 2GMHA 3OUGA 3DGPB 5ETLA 2UXCF 2HFNA 4Z2XA 1J5OB 4K2JA 2RDIA 4PXEA 3V4IA 1W26A 1FD2A 4YP3A 4FYDA 2QA4S 4B3TF 1VQNS 1JLCB 2UXDF 2PGCA 5GAGI 1UHEA 3QQCD 3VGUA 1P27B 4B9UA 1URRA 2YX7A 4RW8A 1U09A 2AJFE 1DURA 3JAMU 3KLGB 3I6PA 1FKPA 2VFTA 5HVHA 4RUBA 1JWWA 2HG4A 1PJ7A 3FC9A 4JP6A 1U1RA 2XB2D 1NNDA 1X4BA 5KT2A 4G1QB 4QIFA 2OFGX 2IRYA 4USHA 4I2PA 3A8JA 4PCQA 3H8YA 3O44A 2WSFC 4NLUA 1RAJA 4RO0A 2ERRA 3HVTB 3UW1A 4ZIVA 4L6V3 3ETOA 3EPIA 4WF9Q 3OTCA 1FDAA 4B3MF 2HZVA 3RAQA 1U26A 2O5JD 4OI6A 1VHIA 4DG1A 4PQAA 1VISA 3GTPA 1FCAA 2F8HA 2HHUA 1LW2B 2KXFA 4NLTA 1A0OB 4K4SA 1NB2A 1RGVA 4DI6A 4DV0J 4BDPA 2BACA 2JFKA 5KFEA 4ZJQA 1YJNS 3V6HA 3TANA 3M8QA 4W92B 2PN6A 1TAQA 3I5BA 2U2FA 3JXOA 2B7BB 1YJVA 5IOLA 5E3PA 3S6EA 2EFQA 1VJWA 2YKOA 4BWJA 1GMWD 2J6TA 5A0YA 5EGYA 5DDRC 1RA7A 5SZTA 3TUZC 2OPPA 2WAQD 1TL3A 5B0GA 5KFQA 1FDIA 3UE2A 2KT3A 3TI0A 2E66A 4NWBA 4C3MA 4JV5F 3HCXA 5L39A 2HCZX 1Q5YA 3V81B 1R0AB 3PEHA 9RUBA 2BDPA 3M2VA 3ZTSA 2DHSA 3T41A 2ZBIA 3IMQJ 1HWLA 4QIEA 2EBEA 3HHDA 2XG8A 1IBCB 3IS9B 3M1VB 2CAJA 3T6BA 1U1MA 4YY3J 3BR8A 3OUYA 1HD0A 2Q43A 2ZUGA 2QA4G 5FD1A 3Q8PB 1FO1A 5A8WB 5GADU 1S79A 1MWZA 1KONA 1SFOA 1WEZA 2R92A 2DNOA 1ZA2B 1Z4UA 3VQTA 2XHWA 1Q81T 4E0DA 2XMWA 1WACA 1AXQA 3MM6A 5F8LA 1REVB 3DNCA 1PYOB 2XYPB 2KTQA 3RB6A 3J7Z5 1FHTA 4XTTA 3NXZA 4F0KA 4JI0F 4IKAA 4C0BA 1D3WA 5KFBA 2YNFB 2EW9A 1VC6A 4F0MA 2XCAA 3VZIA 2MQMA 4DV4J 3PZPA 2R8HA 1Y1VA 4OHWA 3B4DA 3ISZA 1H6KX 1EQ0A 2KHDA 2F3JA 2PMWA 3T5HA 4QPXA 2C2ZB 4K0KF 3TYTA 1UWAA 1XIQA 3QSIA 2EEYA 3OVAA 2QC3A 2OP5A 4M5DA 4C0OC 2KVQE 1AB8A 1YBTA 3DOKA 3MI7X 4CLZA 4EGLA 1DLOA 2DNYA 3LUYA 4DR1J 2ZNYA 1YSJA 3GWCA 5DM6Q 3CF5Q 4F3MA 2HHWA 3DOLA 3CJKA 2W25A 3R5CA 1DQ8A 1XN9A 3MR6A 2W2NP 3G96A 1QE1B 1N0VC 3IRWP 2HFUA 1QDUB 4RNOA 2PMZA 1O5JA 5CXTA 3GIJA 4PG7A 1FKOB 2IRUA 3AD7C 4PG5A 4J9PA 3MUMP 2NYIA 5DG8A 1CZ5A 3MDFA 4KRWA 8AT1B 1H2VZ 3M6XA 4NCBA 4KHPF 1XWLA 2AV5A 4O4GA 2FY1A 4CI0B 3OVSA 2XNQA 1JLQA 2VFRA 1JKHB 4TXSA 2RHQB 2FUG9 4DR6J 4J37A 1RE1B 3MM9B 3FMWA 3WC0A 1KBRA 1WLFA 3H0GA 2ZWPA 3KK1B 4KYZA 4UF4A 3VGVA 5HQMA 1JJCB 3VAMA 2BOAA 1U0HA 4JI6F 1BMQB 4H4OB 3PKMA 4Y34A 2FVQA 3NY0A 1V5VA 3L7UA 2C3UA 2AYBA 1FRLA 4OX7A 2MLYA 1Q95G 4TY8A 4WFXA 3HHLA 1NJWA 5B0CA 2A6ED 5H9FJ 1JJ2R 2GAGC 2FZKB 1LFWA 2CNLB 4JOUA 1U25A 2YNGB 3MOZA 4LFAJ 3E01A 1U2CA 4U8YA 5BYQA 3SSSA 1T11A 1FTRA 2FGCA 2C42A 3TM7B 1D8YA 1IKXB 3BR9A 4ZVPB 4NEZA 3J80U 2HBZB 4CCHA 4EBEA 3QO9A 1HNXJ 3HI9A 3H0PA 1LW0A 5J2NA 3CJRA 1PSDA 1H98A 3ISNC 4DR7F 3KFWX 1ACMB 1IXKA 3W8PA 2DH9A 2OPRA 1IQZA 1VOMA 5KFKA 2UXCJ 1C4CA 5HP1A 4N77A 2APOA 1SCJB 2DVIA 3C6UA 3JTOA 1HI1A 3GTLA 3TQ1A 4ED0A 3M8YA 2QEXS 4B3TJ 1CS4A 3N5FA 5CYMA 2UXDJ 3BDEA 3MWBA 3RBDA 1NDLA 4CLUA 1Y3KA 5C7PA 3QWZA 1WCMA 2KKHA 3HHNB 1S1XB 2DIUA 2WCXA 2AMCB 3I0RB 2QA1A 2VKRA 4JI1F 1TV6B 4KKOA 1RBAA 5HVGA 4ZHRA 3G6YA 2PE8A 1G8KA 1B7FA 2B8QA 4ZPDA 1OYDA 1XR5A 4ZCIA 1NCLA 4I2QB 4G6VB 3C6TA 3FSXA 3AXKA 5JUMA 3W8GA 2A2DA 1LWEA 3DMJB 4L72B 3A12A 1Q16A 4DJBA 1AW0A 1T3NA 3K5NA 2DGOA 2NYHA 3NS6A 3PYGA 1WUUA 4B3MJ 8RUCA 4AVRA 3U1MA
chains in the Genus database with same CATH topology
2DH8A 4ID8A 3HM9A 1N5YA 1TWFA 1VIOA 4IG0A 2X1BA 3BGRA 2MJUA 3ONQA 3IR5A 2DHXA 3ZZZA 2BRKA 1AA6A 3KWMA 3CMAS 3CCQS 3NL0A 4K4YA 1QJHA 2OIHA 3VAHA 1NJZA 1JLEA 5E3QA 3THTA 3G6XA 3T5LA 3PNIA 1FK9B 2P9EA 5JJBA 3PY8A 5DYIA 3F44A 4FS1A 2ZDPA 4HVZA 4HH1A 4DSIA 1HBUB 1UFLA 1B0VA 2EI5A 2H5EA 2J9DE 5LMUF 3MXHP 2MQNA 2B3TB 2XULA 1IM4A 1FE0A 2FIUA 2VC1A 4UUXA 5CCLA 3IR7A 1HL6A 2YX4A 3MMJA 1PT1A 2BV3A 2V8VA 1ZPVA 4B3OB 3PDNA 4Q2LA 1S1UB 3T6JA 2JX2A 4C98A 4PWDA 3AAWB 3M2RA 4FXVA 5JXSA 1TMOA 3OFHA 4OHVA 3M4XA 1O8BA 2AE0X 2Q66A 2OLWA 1M0SA 2CG4A 1TZ0A 2V8HA 2ZITA 3BS9A 4KV8B 4NLYA 4TN2A 2D3OR 2JEJA 1ZYRD 4ZP7A 2YKMB 5E5NA 2RKIA 4YB1P 2JHEA 4YOEA 2VASA 5J2QB 3CDBA 5GAEI 1WI6A 4C11B 5F8HA 3I96A 3VAKA 5D6GA 3A1YG 3M9OB 1T3OA 2OPQA 1RT2B 2CQBA 2V8GA 5KFHA 4LJMA 5FTNA 2Y1JA 1M5KC 2IC3A 2VODA 3NRBA 2DGQA 2DCUB 2RU9A 4CH7A 2DR7A 3TVKA 3WDOA 3JSYA 5AE2A 3V4IB 3OQ2A 2QLWA 3MPWA 2R2RA 2B56A 4ED2A 2CQ0A 4NCGA 2J6UA 2JOQA 2KRBA 4V19J 2XMTA 1RYRA 5GADI 4DFJA 1YBAA 1S10A 4DV5F 2CQ4A 2NREA 3MMCB 3N4WA 4NA1A 2F8EX 4LF5F 3FNNA 2ZKTA 5KFOA 4B9MA 3U27A 3CDEA 5C5JA 2MB0B 4RZRA 1XMOF 1OWXA 4OQJA 5DQIA 1RISA 1VFJA 5LSRA 4IRDA 4LF6F 3MR5A 2LEBA 2E9TA 5FDLB 1IR0A 1QUPA 1HNIB 4FXWA 4QOTA 2I1RA 1UA0A 1OO0B 3OTBA 1O0PA 4RW8B 1OPZA 3LP2A 1ULRA 1TK0A 1BC6A 1G8JA 3T9ZA 1FKPB 1WF1A 3C66A 2JDJA 3L7PA 5J2PB 2G4BA 3NMAA 4XK8C 2XSJA 5KFXA 1KTQA 3EZ5A 3PO4A 2YU9A 1T94A 3D0GE 4PG4A 5SUHA 4EUVA 3CMES 1VQ9S 2ZJQQ 3UD3P 1R8CA 1L3UA 1IKVA 3GQCA 1KQFA 2WBRA 4W90B 3CC4S 1U1PA 4J5OA 4CO3A 3KJVA 4NLSA 4FNIA 3B82A 4OX8A 2EPIA 4D3GA 1VQPS 2UVUA 3SQGB 1ZZNA 3RBEA 1X9MA 1JLBA 5T7LA 4DUZF 1SIWA 3KG4A 5KFGA 3DHWC 4K5SA 3KOAA 5L38A 4J9OA 1H5NA 3UR0A 4PXCA 1U1QA 2PEHA 4I2PB 4DV3F 2CJKA 4HDGA 4CQ1A 1S9GA 4TYBA 1LQ9A 4X2BA 2IA0A 1HQEA 4IG3A 4NRUA 5DS7A 4K50A 4MKBA 1X7VA 3GTKA 5DETA 3E8OA 5JVHQ 3FVYA 4DQQA 4Q8FA 1CLFA 1KS2A 5D78A 3JB9k 4URGA 1RKJA 3EUNA 4QIGA 3IR6A 4EEYA 3QGPA 4DQIA 3HHKA 2B6AA 4F02A 1RTHB 4PRFA 4IOCQ 4IRKA 3K8VA 3DI6A 2RUGA 4I1TA 3G9CA 1WHYA 2ZHOA 3W2WB 5LL6d 4M1KA 1QVGR 2O66A 1HYSB 1K0VA 2GGPB 2MZQA 3CZBA 3N0VA 4I64A 1FRIA 4IFYA 4F4ZA 4DG1B 4A46A 1FEHA 1ZAXA 4D7ZB 3UCGA 4ECXA 5EUHA 4HLBA 2MXYA 3NMRA 3KLEA 1B64A 2DK2A 4ZP8A 1KTVA 2IA6A 3NNAA 4NOHA 3DRRB 3QJPA 3TO8A 1Q53A 2AGQA 3IG1A 4IH7A 3O6QA 3G8SA 2D41A 4RU9A 2M3DA 3T1YF 3OTDA 3BEGB 1ROFA 2MKSA 5IQ6A 3PKYA 5BR8F 4LVNP 1SMYD 2DRBA 3M8QB 2JH3A 3F41A 1VQ8S 1FD8A 4OHZA 4LF9F 2WTFA 3QLHA 1SV5B 1SXLA 3MTKA 3GTQA 2DNGA 1VLYA 4LMZA 2NYAA 4AYBD 3DRXA 1HWIA 2ZFHA 3BQ1A 3D54A 4X62F 3QZ8A 1ZTWA 2KT2A 2K2PA 5AXKA 3J81Y 1WI8A 3DHXA 3K58A 2MZTA 5HMWA 1XNRF 2NAPA 5IT4A 3IBWA 4MFBB 4MH8A 4ZCLA 2LQBA 2ASJA 1Y4ZB 2DTJA 5A0YB 1EETA 1RKIA 4HKQA 3GTGA 2I2YA 4UY8T 2OPPB 2DPJA 5D77A 4U6PA 2B63A 4FVCA 4OIXA 1TL3B 4O4RA 4PPZA 1R27A 1WHWA 2HGNA 3D1OA 2HW3A 4F26A 3Q24A 2MGZB 3HVRA 1KD1T 2CKWA 3BO2A 3MEDA 4C7QA 2EFVA 2C28A 3TR5A 4EYHB 4F4XA 2DHAA 4IDKB 3AJ1A 4ECVA 1RT1B 3MM5A 4X66F 3CWJA 1U1KA 2KZMA 1D9DA 2E2IA 3BO4A 4OI2A 2V4JB 1KN6A 1C2PA 4EBDA 2C45A 3DN9A 2JIMA 4R5PA 4AE5A 2VPYB 3OL8A 2J0SD 2XS2A 1DRZA 2OJ3A 2B7CB 2MQQA 2IMOA 2B0GA 2ROEA 5IT9Y 3M2VB 3H4BA 3L3CA 4OI3A 3TAPA 2KI2A 4USIA 5CYQA 2N7YA 5KFPA 2VPXB 1JJ4A 3U7JA 2HRYA 4N76A 3K0JA 2E29A 1SJ3P 2YWFA 4D3HA 1Q79A 2QZ8A 3DLKA 5KFCA 1BWEA 4WFZA 2CFXA 1SJRA 4QR1A 4OJGA 4ZDNA 4LUBA 3G4SS 3IA0A 3IWXA 2ZH8A 4OFZA 1TKXB 4UW2A 3K8WA 1HR0F 4ZVEA 2ILYA 4R8UB 5IM0B 1N6QB 3OL9A 4F25A 4KGMA 3MMAA 3OUYB 2B9YA 1TWHA 2F4VF 2MZRA 4GC6A 1QTMA 1M1KT 1MNEA 2RS8A 1L3VA 3M32A 1M5VC 4I69A 1Y5IA 4UUWA 2Z4PA 5KFZA 3OTOF 2UUAF 1I1GA 1FEEA 1RI7A 1XBWA 3M8PA 4KHMA 1SH2A 3TW0A 5HROA 4A8WA 2VFVA 3GTOA 2V3VA 4M94A 2QE5A 2UVRA 1N5SA 1HBMA 3GZ7A 3V6DA 4NLQA 1FDNA 2GC8A 4B9SA 3U1NA 3PACA 1ZM9A 2P9CA 4YR2A 5B7WA 3GYXB 5E2QA 2FHJA 3DFEA 3LP0B 5ITHA 4ILMA 3MMBA 3FQKA 2H9ZA 2BJEA 3O5TB 1KQSR 2EKYA 2BUNA 2XY7A 1OIAA 3GV7B 3VALA 1VBYA 1NEEA 3BQ2A 2GX8A 5HMYA 4QU7A 2YQ3A 1RT3B 2RRNA 3UDLA 3CJ5A 3MM6B 1A7GE 3PX4A 2IJFA 2R7OA 4H4MA 1M5SA 1UVJA 3WC2A 5HBMA 4Y0FA 5CD4H 3UPFA 5E7OB 4DFKA 1VC0A 2NSBA 5CH7B 2BW2A 4C9DA 2GIQA 4ECUA 3LQVA 4OZ5A 1Y00A 3HU2A 3CB4A 4ZK7M 1U2RA 1N54B 1UMJA 3BGUA 4IO1A 4MIWA 3BREA 5E33A 3THPA 5F3ZA 1RDRA 2PI8A 1R43A 1B0PA 2J5AA 3SMZA 4J9KA 2NXUA 3SV4A 1SQEA 4ZPVR 4EO6A 3R1HA 3QQ7A 3H98A 4N41A 2DNLA 1MROA 4RW6A 4O3PA 4YEAA 1RT7B 2LQ9A 3FFIA 2OMOA 3HK2A 3MHYA 1AUDA 2AQ4A 3JSRA 2XCPA 3MR3A 2VQEF 2AD9A 3J7A1 3DXBA 3PW4A 2K3KA 5B09A 2A6HD 2PO4A 3N79A 4ZPBA 2O01C 3IGVA 2XBPA 4KTQA 3VTIA 2EG1A 3JAMY 2Q6BA 5LXRA 1F5AA 3Q8RB 2BM0A 4RW4A 1V6HA 1S6QB 1VRTB 2OFHX 1G1XA 4CIOA 5LJ5Y 4WCEQ 3FZBA 2PA8D 1JLFA 4K5RA 2B4VA 2NS1B 1ZM3A 3TVYA 5I42B 2IAJB 2P9GA 3QIDA 4DLGA 4ZPTR 3RW7A 2Y1RI 2R93A 1U8SA 1ZYQA 4WFNQ 2KFZA 4X4TA 1CC8A 2KXNB 1TKZA 4QR2A 5H1SV 1L3KA 2ASLA 4LF8F 2E2HA 3D28A 1TKDA 4OI4A 5KFSA 2XMMA 6FD1A 2HAIA 1FERA 3AY0A 4PQUB 3I55S 1YRTA 3NCRA 4PUOA 2RQ4A 2LDYA 2DR9A 2XNRA 1Q7YT 2HHXA 1H7WA 1G2EA 3LWMA 3OVBA 4BS2A 3ITHB 3LW5C 2UUWA 5K9FA 4YFUA 1FESA 4M5DB 3HPOA 4FF1A 2HQIA 4KFBB 4RW9A 1SJFA 5EN1A 2HVHA 3HHLD 2YUJA 1YJWS 3BF4A 3MEGB 1R8HA 1UA1A 4FPRA 3OLAA 1OS5A 1BQMA 1HMVA 1R89A 4ICLB 3DLJA 2R2TA 3KKFA 1APSA 2O3DA 2OSQA 3DOKB 2WOMA 1DQ9A 5AJ3F 1GXUA 1SH3A 1N5TA 2BVZA 4HL9A 4XPCA 1DLOB 2GHPA 3ZZUA 4TU8A 2RF2A 4LF7F 3GFYA 1GXLA 2C3YA 4ZPCA 1YIJS 2HHPA 4AFFA 1Q4RA 2ROPA 2W4PA 3FCHA 3QMQA 2IM1A 2A1BA 3DLGB 4LSNB 2YTCA 4NLRA 3SXLA 2UV8A 1VK8A 3DOLB 4XDDA 1Q7LB 3CJKB 2CQCA 3WZ0A 3RAMA 4KDIA 4DF8A 4ED7A 1C0UB 2A3JA 1JXEA 4HT7A 5J1NA 5F9LA 1W25A 2D3ZA 3GTJA 1FT8A 2IFXA 3H4DA 1TVRB 2MZSA 1U6FA 4BBYA 3KG1A 4ECZA 3E51A 2ZNZA 1X4HA 3Q2TC 1JNZB 2MMYA 4NXNF 3N01A 1UP1A 1GX6A 3M2UB 2M9KA 3R1LA 1TFWA 2JLEA 3GIIA 5F8NA 3MAHA 4YDDB 5AXLA 4DS5A 4DR3F 2OKQA 1NKCA 2L9WA 2Q1LA 2WK4A 2G1DA 1NK8A 1YI2S 3RW6A 4QYZJ 1VBXA 3T1HF 2DH7A 3X3UA 4H4KA 4A8KA 2RH3A 3K5OA 3QIPB 1HPZA 4A8SA 1X0FA 2QMXA 3GSDA 2MHEA 2CRLA 2R7XA 5KFLA 1LWCA 3OR2A 2JIPA 5FTKA 4KB7A 2G9OA 5A6PA 2L41A 1PILA 4YUDA 2AJ0A 1U24A 1KFDA 4A47A 3OHAA 1KQGA 2CJBA 4TQRA 3S01A 5C24B 4LQ9A 2CYYA 3L95X 5HL7Q 2V9WA 1E32A 1TL5A 4B3SF 3P96A 4X4PA 3NCQA 3J7YU 1D8ZA 4WXWA 1A6LA 3IAS9 2R8GA 3LGMA 2PIIA 2ZH1A 1VIXA 2NQPA 4O4GB 4CH0S 1C4AA 4KIAA 3OL6A 1JLQB 1X5SA 1K8AT 3NCPA 2ZHAA 1FRMA 3FKIA 1HW8A 1R31A 1UWBB 3MECA 4KSEB 1K1QA 3DGPA 3SFGA 5F8MA 1J5OA 2R7TA 3SEOA 1S0OA 2ILZA 3LANA 3BSCA 4O23A 2E5IA 4ZMMA 3FZ2A 4AONB 2W4DA 4OMFG 3V5RA 2WW8A 4NLVA 4O3QA 2RMLA 4I7FA 1VQKS 4O44B 2UUCF 5HO4A 3TIWA 2J0WA 3TP2A 1S0VA 3DRYA 4JBCA 3IWLA 1RP5A 1JLCA 1XC9A 1VGYA 1SH0A 5KG1A 2JLGA 1UJ4A 1ZZFA 1Y3JA 2MQOA 3JSMA 1CQNA 2UXBF 1NK5A 4RNMA 3P3DA 3QC8A 1OGYA 2DNHA 1FE4A 3K7RA 4J9MA 2XLIA 4ZVGA 5AE3A 3BN4A 4LFBF 1S1VB 3GR0A 1Y5LB 3HT3A 4GKJF 4Q2MA 2WRMA 2FLPA 1HQUB 3FEXB 3NG8A 2OTJS 3MR2A 2KU7A 1QUVA 3X1LB 3KLGA 1QCSA 3S1TA 2R9LA 2M52A 4MK9A 2JFDA 2W8LA 2E1MC 1KHWA 1JLAB 1R6YA 1TKTB 1LOUA 3HVAA 3O3LA 5B08A 3GILA 2MQLA 1E6YB 2LMIA 3H5YA 2V4QA 2SXLA 4TY8B 3HHLB 3NS5A 4PXDA 2MQPA 2JA7A 2HQ3A 2AYMA 4N8NA 4EU0A 4OX6A 4CH1A 1XERA 2VG5B 2DJWA 4EYIB 3IO1A 4C0HA 1YJTA 5KG6A 4G1QA 1IJFB 4MMOA 3BO3A 4DDFA 2HGLA 3K5PA 4YB6A 4FN5A 3TOQA 2MKIA 3QWPA 4K59A 5F0WA 5A8KA 3GFZA 1N36F 3TA1A 4J9QA 5DGAA 2G5DA 2RRBA 4RLEA 2HVZA 1HNZF 1U1NA 2DMRA 3CCES 3E01B