4NOHA

1.5 angstrom crystal structure of putative lipoprotein from bacillus anthracis.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
ATGIVMYGDETGVQQTMDQYKDKIESQNKFEAKLGTVNEKKVLIMNKTTAEKMVKENMLKKVVKEDVEPIKALPAISDEAGIVFAKEEQKDVVIDGKKMKYEGNVVIGDARKYTDMYAVVSDAEYAKISEPVKTIGLASFKENPKEKIFPDIKRGSKVEEAHMVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein, putative
publication title 1.5 Angstrom Crystal Structure of Putative Lipoprotein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Lipid binding protein
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17294 Lipoprotein_22 Uncharacterised lipoprotein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.60 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4nohA02
3.30.70.3060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nohA01
4NOHA
chains in the Genus database with same CATH superfamily
4ENOA 2HGNA 2D74B 2BKPA 1L3SA 1JJCB 1YG0A 2JDJA 2BRKA 5ETMA 1VHFA 2XYPB 1VQ8S 3DYAA 1XMOF 4O0IA 4DQSA 1N34J 3G9CA 3HT0A 4N77A 1U02A 4NLSA 4P52A 3MOJB 2QE5A 4XDDA 2AQ4A 3SUMA 1FDAA 3LF0A 2BZ2A 1HQ2A 1VC6A 1PQEA 2V2VA 2F40A 1VQ9S 3GJSB 3CC4S 2IHR1 4KKOA 3TUPA 1V9OA 1S9EB 3SSRA 3OTEA 4QR0A 3RBXA 5KG3A 3RRGA 4FXDA 1Z1ZA 1T9YA 2B4UA 5DO2A 1ZA1B 2OEJA 2GO8A 4LJMA 4QIVA 3IBWA 2HZAA 2AF6A 4DV4F 2K8GA 2XG8A 4DL2A 3VWSA 5J2NA 3GSDA 3PIOQ 3FSIA 1FX4A 2XTJP 3SQGA 2D41A 2F4VF 5FTLA 2YNFA 3W60A 3G8TA 2CFXA 4H4OB 1EQMA 5K14B 4ID8A 4MK9A 1HNZF 4AONB 5C24B 2XMMA 1FRXA 3H0GA 2BW7A 1IBKF 1TUGB 3CO9A 3QBCA 1SJ1A 1EKSA 4DPOA 2P5VA 3ETMA 3R5JB 1CVJA 4IRCA 1S1TA 1NJWA 1Q86T 2KYZA 1VYAA 1XNRF 2KI2A 5A8KA 3KG0A 3OHBA 1WG4A 2PICA 4A8FA 4C8YA 4B3MJ 3N5BA 1JQGA 2DNGA 2HHSA 2CZVC 3EZOA 2KFNA 1PIEA 2HHQA 1TV6B 3CQZA 3W8GA 1T9XA 1SKRA 1ELOA 2HRYA 1RKIA 5D3GA 2FTRA 4BC7A 1BMQB 5F9NA 4QW9A 3R7NB 4AQYJ 4NLDA 5HAOA 1OSDA 4UT4A 3SBMA 2G0CA 4YHHJ 4ED6A 1H72C 2MQNA 3MTJA 4OYOA 2HQIA 1DTTB 3W2WA 3Q86A 1LWCA 4JI8J 1SQEA 5JMNA 4KFBA 5DQIA 2HK3A 2ZHBA 2EK1A 3JTPA 4UF4A 3RJMB 2XLIA 1NHUA 2W9BB 3DLEA 3IS9A 1S1XB 2AX1A 2R8IA 4W4MA 2GJ2A 4LQ3A 4NX9A 2HBZB 4JI3F 2VV5A 1FRHA 5CCMA 3AY0A 4DI6A 4DUTA 4F4WA 1JB0C 1ZM4A 2YQ1A 4X4TA 1HWLA 2HFSA 3QPIA 1TL5A 4M5HA 1U1RA 1A0OB 2CQPA 3OVAA 1S1VB 5CABA 2IC3A 2UVUA 1YLEA 3MAQA 4PAAA 3HFZB 3TVKA 4TY9A 3I31A 2NSCA 4OI2A 1XERA 4DG1A 3NS5A 3O44A 3RR7A 2M2BA 1FXDA 4IO1A 3C6TB 3Q8UA 5ETVA 2RKIA 2XY6A 1GXLA 3M9NB 4ID5B 1LFPA 3FEXB 4YMEA 2EKYA 4M5NA 3MR6A 4OLOA 1NPKA 5DDRC 4BLGA 1S1UA 2I2YA 2VQEF 1SPBP 4RW9A 5CYQA 4KRWA 3ZZRA 3TZZA 1HNVA 3GONA 9RUBA 4MKAA 1FJCA 2Z4PA 2HGMA 4RUBA 4TLQA 4K5RA 4I56A 1YBTA 3NMRA 3BDEA 1UPPA 4CO5A 4ED8A 3HSDA 3GCWP 3C15B 1CZ5A 2U1AA 5HATA 1RWNB 1H74A 4B3TF 4FG2A 3R97A 1QE1A 3TVYA 1C1BB 1U8SA 4JI7F 3CJQA 4F0HA 3B6BA 4PQAA 4AD6A 1C0UA 3PR4A 4U96A 2KVIA 4LQ9A 3SCIE 2DVIA 1U8WA 1YNND 3BGRB 1PJ5A 1S59A 2QIFA 5L1LA 2RQ4A 3T5JA 1DARA 4CO3A 1H38A 2E66A 4XIUA 2C2RA 2BE2A 4RU9A 2HMIB 3CJ2A 2CPYA 1YLXA 3AQOA 3H5XA 4DV2J 2HS3A 3ICLA 4O3PA 2MB0B 3ET6B 2IM1A 4UOGA 4QZVB 2MDAA 3FQLA 1IBCB 3FQKA 3Q83A 3JB9k 2G9OA 3AXKA 3P49B 3K89A 1RWVB 3SSQA 4OJ1A 3D6MB 3ZZ0A 2DGXA 4FZVA 1NCLA 4GKJJ 3HXMA 2YX7A 4D3GA 2HVHA 1HBOA 4LSZB 4P10A 4X4SA 2G4BA 2PMZD 3AXMA 2ZKUA 3OXGA 5GLXA 2R3VA 2UVRA 1YSJA 5DYGA 3BGLA 3MR7A 3FBCA 4UQGA 2PO4A 1WHVA 1MWYA 5M2PA 1RTHB 3K8VA 1HBMA 2VPZA 2IJRA 4QWBA 2RAQA 2MQQA 5J2PA 2ILZA 4K4UA 4E0DA 2KTQA 5GAEU 5KFGA 4NLTA 4O3QA 1XN9A 2HGLA 2VPXB 3C66A 2OPPA 4I69A 4PXEA 1RT4A 4ECUA 1RAIB 2HQFA 3GV8B 3G71S 2HZCA 3IR6A 3KLHB 1K0VA 1CC7A 2QSFA 3HSJA 3HU3A 3R2DJ 2DNOA 5CH7B 3U1LA 3PKYA 5IT0A 1DRZA 3JSYA 5THWA 3VF0B 3TZYA 2FC8A 2XBPA 3MCNA 5KFNA 1DFDA 2KL8A 4MKYA 2DIVA 2NUHA 1FK9A 1IBLJ 4FXWA 1UPMB 4DLGA 3OUGA 3OTBA 3M8QB 2C28A 2FVPA 4KGKA 1HYSB 2B7CB 1UVMA 1VRQC 1WEYA 2Y0SD 5E7OB 2BM0A 4U7UD 1V6HA 4P72A 5BR8J 2WVDA 1TFWA 2C3OA 1RTDA 2UXDF 1DBDA 2C2NA 4O4RA 2MJNA 3NGRA 3MMAA 4J9VA 5LMNF 2HS0A 5GLYA 2N4DA 3MMBA 3M2VA 3VAJA 4IUFA 2R7UA 3W7BA 2DGUA 2FD2A 4HHUA 2DT9A 4IG0B 4MK7A 5HMZA 1R43A 3JQMA 1SL0A 2ZITA 2AGQA 3V4IA 4JI2J 1DJ0A 4DV0J 1H0HA 2ZD1A 5KFDA 4GKKF 4AE5A 3FFIA 4IR1A 1LWEB 4QJVA 5HJYA 1WKKA 2B7BB 3JSRA 1IBMF 1LOUA 1UW4A 2L9NA 3EVMA 3DI6B 2R92A 1H6KX 3ILOA 4P6QA 5E2QA 4KV8B 2HFOA 3LGMA 2P6SA 1X4BA 2UUAJ 5K8PA 3D6HB 2XQCA 1BQNB 4LRBA 1RWKB 2LQ9A 3EDQB 2FJXA 1OO0B 2IJNA 5EUHA 5ADZA 2K2PA 4CI0B 5HROA 1NNDA 2HZVA 2DH8A 4WK1A 1S6UA 1QSYA 4X64F 4NCBA 1AFIA 2CDRB 4OZJA 1LW0A 2V34A 1HBNB 5DM6Q 4B08A 3PZPA 3M2UA 4RWWA 2POKA 4KO8A 5J2QB 4QIFA 4DR2F 3I4PA 3CMAS 1SUQA 2MQMA 1FA0A 2R8KA 1VHIA 2BOAA 5B6CA 1HL6A 2V5HG 2YKQA 3UFCX 1RT3B 1JIHA 3IBFB 2AGPA 2DR9A 1UCNA 3VV2B 2PI5A 1QSLA 2JIPA 5J1EB 3G4SS 4OYWA 2HW3A 4RNOA 3IRWP 3M8RA 1QVFR 1KC8T 1Y00A 1Q78A 1WLFA 1IKVA 2FVSA 4F0MA 3E3XA 4C97A 4NL5A 2RS2A 2R7OA 1WKLA 4F3OA 1TK0A 2OEKA 3I87A 1S9GA 3DC2A 4ZLNA 1JLQA 1LK5A 2V94A 1T03B 3CWJA 1MSWD 3L4BC 4ZPVR 5EWGA 5HJXA 1RADB 3HHLA 3D7SB 5M2RA 4RW6B 3PW2A 2V9KA 2L3MA 1ZA2B 3TX0A 1SH0A 1HNXJ 1VQKS 3CJTA 5FTKA 3HD2A 1GX5A 1N0VC 3CJ8A 2HBRB 3IR7A 4NEYA 4PZVA 3CCJS 1PAUB 3DLKA 1UWAA 2R8GA 5DS7A 3QRRA 2R7ZA 5L9NA 4DL7A 2CWXA 2W9AA 4NLPA 2O01C 1L8FA 1S49A 1YX2A 4OV6A 3KK2B 3RGIA 1SH3A 3IWNC 3R7SB 5ETLA 4I2PA 4YP3A 1N48A 4M95A 2HVZA 4I1TA 4AAYA 5J1NA 2KN4A 2J6TA 1CG2A 4DV5J 4J9RA 4CTAB 1M5HA 5FDLA 3SDEA 4DR3J 3AB2B 2KHCA 2AEMA 4PPDA 1L5UA 4HKQA 1M5VC 3BDPA 3I9V9 2HYIB 3X1LB 3PW4A 2JRSA 4OYBA 1N34F 2VFUA 1A7GE 2B8QA 2P6TA 2GFFA 1NK9A 1BE4A 3KUGA 4CRZA 4ZVEA 5B09A 2YBVA 4LR8A 2YNGA 1EP4A 5LT5A 5BJRA 2A6HD 1VDHA 1RTIB 4PKDB 1FJGF 4A47A 1IKYA 1SIWB 4MYUA 2R4FA 3MPUB 2DIUA 1NDLA 1TL3B 2DEIA 1V5VA 4ECTA 2NXEA 3HKZD 4FF1A 4HACA 3MMCA 3KMQA 3UCGA 4UOHA 3ZTPA 2XI2A 4F3MA 4KO0A 2KG0A 1PSDA 1AYEA 2FJDB 3H0PA 4UY85 3GZ7A 3BYRA 3O2IA 3GP9A 4UQTA 2IRXA 2CAJA 3PYEA 1LXJA 3RW6A 3KLGA 2QLJB 2XULA 2WB1D 2DR6A 5L1IA 4PXDA 2VFVA 2BV3A 3R1LA 3AJ1A 1MMDA 1U1KA 1PC5A 1TUVA 1DQ9A 4R0JA 2B51A 3DRRB 3I56S 4G1PA 4B3MF 2Z57B 2XMVA 1K8AT 2GS8A 2RJZA 1GX6A 3PM9A 4ECRA 2LDYA 5HQLA 2VBXA 1PAEX 4FBTA 2JVOA 4TKTA 1RLDA 2V69A 1UETA 3CEDA 1Y7PA 4Y2MA 3A12A 3H2UB 2DNYA 3CPWR 4KGMA 1N6QB 4FNHA 1G8JA 2OSRA 1FTRA 2ZBQA 4AQYF 3DM2A 4B9LA 2BVZA 3OD2A 2DPJA 4YHHF 2VZ9A 3RB0A 1FXLA 2E7XA 1D9FA 4OZNA 4K50A 3TUZC 2FVCA 2H9ZA 2EG1A 4PG6A 3SIPB 2RF2B 4FF2A 5EX3A 4X4NA 1FE4A 4JI8F 4WFYA 1MG7A 2LXFA 2LCWA 3BV8A 2GIFA 3CCQS 1U09A 4X4UA 2ZE2B 4AZDA 2KQAA 4AYBA 3MWBA 1N5VA 5IV4A 1Q16A 1WC4A 2CPHA 2LEAA 1KQGB 3OUYB 1TL7B 3OTCA 4WP9A 3UVJB 1NXIA 5GAHU 1XQIA 1O0PA 1IM6A 5HP1A 4BC9A 2AGOA 4CLKA 3HJFA 1S0OA 2R9LA 4CNZA 1OS5A 4KDLA 3PRVA 5F3ZA 4M8LA 1S6PB 5D4LA 2C2DA 4JCWA 4L48A 2K7JA 4KQZA 3KLEA 1HQUB 2E7WA 4C0BA 4LRCA 5CA5A 3Q8VA 3TZWA 3M32A 3NNHA 2KVQE 1UVLA 3MM7B 5IFMA 2YWKA 4QPTA 4RNMA 1XR6A 3X3UA 3MEGB 1S7HA 4YB6A 1X4FA 4NXNJ 1RAEB 4GC7A 2LP4A 2CQCA 3C16A 3BSAA 3JTOA 2FPHX 4NWBA 5T7LA 1TKTA 2VICA 3QO9B 1VC3B 5J2MA 2QYCA 2AU0A 5LSRA 1KVIA 3RW7A 3VAMA 4DCOB 3EUNA 1VRUB 4F4XA 3QGHA 1J2VA 3I96A 4J9NA 3L3CA 4ECVA 4YQWA 1FFSB 2ZH9A 3MM9A 1U2FA 3CCVS 3MEDA 5D4OA 3N9UC 2P2CB 1TWGA 2K1RA 4URGA 1YZ6A 3R9LA 1NB7A 2BUNA 2FHJA 5KFYA 4USHA 4IG3A 1HHTP 2KO1A 4FP9A 3AJDA 2OKQA 3DLBA 1GK8A 5I42A 5KT5A 1S1WA 2M5YA 2EKNA 2JOQA 4WKRA 3G82A 3OLAA 2I8EA 1YZ7A 3CIMA 2VA2A 3CXCR 4X4QA 4RNHA 2KRBA 4G6VB 1TKZB 1CQNA 3PJ9A 3KDOA 1KVKA 3NOCA 4DLEA 1S48A 2Y1LB 5KFQA 2EFOA 4EU0A 1IWGA 1RXOB 1UVJA 4DU8A 4DV2F 3DN9A 1HBUA 2XMTA 2V4JB 1SV5B 2J7UA 2ILYA 1EX8A 2KT5A 1NZAA 1UHDA 5KFIA 2MKHA 2VB6A 1F1BB 4KH0B 1D9AA 4R0EA 4GKJF 4LFAJ 1HMVB 1NKEA 2RQKA 3VGTA 2MZJA 4WP3A 2GGPB 2CNLB 5HMWA 5E33A 3M30B 3G6XA 3KFWX 1RTJA 4FS1A 1W2IA 1TKDA 2DITA 3D30A 1D3WA 4I7FB 5JJBA 3KTQA 5IXUA 1VQOS 2R2SA 1QUPA 2WSFC 3MI7X 2J6SA 4ES1A 4M63A 2FB0A 4QIWD 1JKHB 4CP5A 2VPWB 4OX6A 5IM0A 1NPPA 4KH1B 2QLXA 1T05A 3Q2TC 2RB7A 2FJBB 2LU2A 3KLIA 2MZ1A 3P5BP 1X4EA 4WXOA 3N6MA 5GAEI 4H4MA 3PYFA 1LXNA 1HNIB 2AWZA 2L08A 2RRBA 5A0YA 1BXNA 3UR0A 3MF5A 1ZPWX 4C3KA 4B02A 2DNRA 1DLOA 2E5GA 1IBLF 1BLUA 2A69D 1HWKA 1S6QB 1R0AB 4KB7A 2R7RA 3W8PA 3VAGA 3TI0A 3L7PA 2AJ0A 4RNFA 3U27A 2CPEA 4U6PA 4DSEA 1QDUB 1Y3JA 2XC9A 1REGX 3OVSA 2HFUA 4FFTA 4ZLLA 2Q43A 5BR8F 2W4DA 3BREA 1KVJA 1KLMA 1RA6A 2BBEA 2VG7A 1BWEA 2QMXA 5FJ4A 2ZDOA 3QQ8A 2VC0A 1W2BR 1FKAF 2WONA 3I4HX 3BSCA 3HCXA 5AJ3J 4U95A 1ZM3A 3HHLC 1QVGR 1F2GA 1ZC1A 2F8EX 5A8RB 4X2BA 4N41A 2YKAA 4JI2F 4O44B 2IJFA 2XZDB 3OR1A 2DO4A 3G6YA 1Q4RA 4FYXB 3FMBA 1S12A 5B0GA 1NJZA 3G8SA 1UVKA 2BRLA 5D15A 2VBYA 2MZTA 3OFGA 4TYAA 2H54B 3IMQJ 3BPSP 1I94J 4J9UE 1T3OA 2MY8A 3GLJA 3SQOP 2ZH3A 4C3MA 2WAQD 1U6BA 5JUMA 4JUZA 4RW8A 2UUAF 2VC1A 5AT1B 3HF5A 2X51A 1TMOA 3DNCA 2HQ3A 3OW2R 5DQGA 4QWEA 2CNKB 3M8PB 1LWXA 3W62A 5B0EA 3PX6A 4IFVA 1N33J 1UHEA 4CH1A 3D1OA 3GG0A 4YOEA 4ECZA 1I51B 4WTYA 4FERA 2DISA 4U8YA 2MHEA 4PQUB 2PIIA 2IVMA 3MPYA 4QOTA 1QTNB 1S6OA 4NYZA 4IH6A 4PUOB 3QWZA 1S76D 3K7RA 2W2OP 4AT1B 2EFNA 3GTMA 1WTBA 1XEZA 4OZ0A 4ZPBA 3D2WA 3GWCA 1RHRB 1FRJA 3QT5A 1PYSB 4EGLA 4DX8H 5IWAJ 2DGQA 3CVKA 2ZKTA 2F1FA 4UOFA 1X9WA 2WZ1A 3DLLQ 1OA9A 2YH1A 3W63A 5B0BA 1RACB 4USJC 1U6ZA 4BDPA 3W9JA 4ILMA 3H2VE 1QLNA 2KU7A 1VFJA 3M9MB 5HI7A 3QMQA 5C1BA 2Y1JA 4X65J 3QZ8A 4NXMF 4P7TA 3JTNA 3TYTA 2JLFA 2ASJA 2IY5B 1D09B 2UV8G 4FXVA 5FTMA 3M1VA 3ZO7A 2QGFB 2XM3A 1P9YA 3A4TA 1BW4A 4RNNA 5L39A 1UL3A 4ILRA 2CJKA 1CULB 3HP6A 2ADCA 3HVRA 1AA6A 1UFWA 4LSNA 2PA3A 1RUSA 1WELA 4DPWA 4YDXA 2E9RX 2O3DA 1SJFA 1HNXF 2F4FA 2BKOA 2VPYA 2K06A 3I0RA 3PY8A 2IV2X 1G1XA 1C4AA 1P6TA 2BR0A 3VCDA 3NOGA 2NVXA 2CG4A 1MROB 1M0SA 4ALZA 2EG2A 3PRBA 1Q79A 1F5AA 4HT7A 5LL6d 4A8OA 1XJWB 4PWDA 5F8HA 2OPSA 2ADBA 2QJ3A 4JB8B 5KG0A 4DV5F 4K7QA 1RWPB 2DD8S 4DR3F 3VTIA 1O6XA 2FGCA 3DGVA 1QJHA 3PW5A 1U2RA 4ED5A 1T94A 3SSSA 3CCZA 4LBIA 2FJWA 4K2JA 2MQPA 1GEHA 2ERRA 3UN5A 4K59A 2LLZA 3OTDA 2A18A 1X4CA 2B8PA 1VQNS 2O67A 2ALYB 1RT6A 2ZVSA 4O4GA 2RQMA 4ZPWR 1H7XA 3UW1A 2KM8C 4FDFA 4DQIA 2RU3A 4EYHB 5GMDA 3EWGA 2GQ2A 4OX8A 3PRDA 4TY8A 2WCXA 2B9WA 1UVNA 4E8UA 3PHTA 1UZHA 1SJRA 3CDWA 3V81A 1WHXA 4M1KA 4DQRA 1NK0A 2CADA 3BKTA 2JFDA 3E51A 4YR3A 4LF5J 4F7VA 5B0DA 4CM0A 1U25A 1FDIA 3RBDA 4F2RA 4KKOB 5T5ID 1WOPA 1G4CA 5AXNA 2QLWA 3CW2C 2B63A 2HQDA 2DNMA 1OQ6A 3X2NA 4G1QA 4ANEA 1FWKA 3V4MA 1FD8A 2QA2A 5J2NB 1Y5LB 3POTA 4K5SA 3SQGB 5A8WA 5L1KA 2YNFB 3QLHA 1Q8LA 1PQFA 2CWKA 2ZUGA 1UTAA 2ATLA 5CZVA 3N79A 4NYOA 2IRUA 4A8WA 1WOOA 3DXBA 1KWMA 3MM8A 2IM0A 1SIZA 1PT1A 2YH0A 3WHIA 3TA0A 1E5VA 2HRTA 3R2CJ 2J9CA 2CNNB 2RHQB 2A68D 4I6WA 2LA4A 1S1TB 3WIVA 4F02A 5A8KB 1NSKL 4YN3B 1HD5A 4O3RA 5E3AA 2XMKA 2MKYA 2MKKA 1WC6A 5AE1A 2PI4A 3HT3A 4QU7A 1RU1A 1T0TV 5FD1A 4FS2A 4TNOA 4WE1A 4F0KA 2DHSA 5D3GB 3LPEA 5HVHA 1GNKA 3H59A 2UXBJ 1FRLA 1IJFB 1NJXA 3WC0A 4DUYJ 3J7Z5 1Y5NB 4A4JA 3W2WB 3D6FB 3MM5A 3TA1A 4UZBA 3D4JA 1LWCB 4C8LA 1VJWA 2KYXA 4DR4J 4KFBB 3F44A 4Y28C 2DRAA 3ZC4A 2IYIA 2KG1A 4D7ZB 3BS9A 2CQ3A 3DLEB 3IS9B 4OHXA 4Y3CA 5L1JA 1FESA 2BA9A 1W7WA 4CT8A 4WXWA 2PT0A 2DGVA 3LGNA 4L6V3 4L72B 4LR7A 5GAHI 1LKZA 3OXLA 4CS0A 4NLVA 4DL3A 4XO0A 4C8ZA 2MSTA 1C2PA 2CJ9A 5E5NA 4F4AA 5BYRA 2ASYA 4DV1J 4EZ9A 4NXNF 2B6AA 3GJTB 3WQPA 3A8EA 4F26A 1ZM9A 1YJUA 2IC3B 3J80Y 3W1YC 3B82A 4LF2A 4FG4A 3ZZUA 1SJQA 1WJ9A 1P1TA 4HHJA 1KBRA 5KG7A 1AW8B 1FCAA 4DG1B 3J7A1 2MEWA 4CIOA 3TR5A 2VFSA 2Y1RI 4ZHRA 2RKIB 4DMZA 1L3KA 4ZP7A 3K2YA 4B9VA 4TU7A 5ETKA 2HAIA 3NMAA 5L9XA 1C4CA 1S1UB 4HH1A 1H5NA 1R27A 2G2ZA 2VH7A 2YKMA 4RW9B 5CYQB 2Z2ZA 1HI1A 2CKWA 3FBFA 1HNVB 2LQBA 1LFWA 1B7FA 1RABB 3FRZA 4HTIA 4CYUA 2GC8A 2HNDA 3KG4A 1OWXA 2F7VA 1X4HA 3O5TB 3M8YA 2OSQA 2DNKA 3CZBA 4HI1A 3S7RA 4DF8A 4F36A 3S1TA 1QE1B 4B9NA 3NRBA 4CCHA 4J9OA 4K4VA 1VQLS 3BB5A 1C0UB 4ZVHA 3BR8A 5KT6A 2ZBCA 1U47A 1R8HA 1TR0A 4JOUA 4HH0A 4RW7A 4EK2A 1R8AA 2MZRA 2XO6A 3OFEA 4MMOA 4DWIA 1LW2A 2ASDA 4ITSA 3IBCB 2JSXA 4LFAF 4CQ1A 3AT1B 1JNZB 2KH9A 4OJ3A 1KN6A 4ELTA 3IP0A 2PMZA 4CO2A 5LMUJ 3TANA 1ZETA 3CCWA 4NMLA 1IQTA 2HS4A 4LVNP 4ZVGA 3D0IE 1RT7A 3VVUA 2BJ3A 1CPZA 3EDRB 4C0OC 2CQ2A 1CSJA 2IVFB 3ISND 4Q2LA 3GCXP 3EE3A 1HBOB 2H3EB 2GAHC 4QWDA 2HHWA 4G1IA 1HFEL 4C6AA 1U1LA 3QGIA 2IBKA 3D3BJ 1OY6A 2CQIA 1N5QA 4B9MA 3K17A 3VVTA 4XPCA 2FJAB 4J37A 3TW0A 2W4CA 1TWHA 3CJ3A 2YNIA 2M0GB 1HBMB 3MDFA 2VPZB 3DOLA 3QYYA 1OGYA 3T41A 2QSWA 5J2PB 3VALA 3QRPA 2XGQA 5T5MD 3QAEA 3FGVA 3AFGA 3GIKA 1NM2A 2WBRA 2NPFA 3OVBA 3CD7A 3MAHA 4F4ZA 3DKDA 2W24A 2JJ4D 2RDIA 3IR6B 1B4SA 2QEXS 2XMAA 4LF7J 3J81U 2ZOMA 2P9EA 1P27B 1PG5B 3GTQA 1YJTA 3KG1A 1SVDA 3HZGA 2J0XA 1R31A 4KT0C 2Y0SA 3UE2A 1FKPB 2V2QA 5K14A 5EDWA 2XO7A 2AJ4A 3J81Y 1FK9B 5L46A 4AXJA 3FSXA 1KFDA 1MMNA 2CVIA 3G6VA 4N76A 1JXEA 3H4DA 1FWLA 5CD4A 3AD7C 2AJFE 5C18A 1D8ZA 2XCAA 1GTHA 2SXLA 4KE5A 1YKWA 2QG9B 4Q43A 3KHGA 1VQ6S 4USMA 5K8NA 3IGNA 5AJ3F 4C2MA 4RJVA 4AFFA 2KXNB 1RTDB 3FUYA 3WX4A 1HW8A 4NLXA 1DMSA 2DTJA 4LF6J 5KOXA 3MMAB 2YKPA 2JC0A 1U6FA 4N47A 3MR5A 1IKXA 5KT7A 1PKUA 1NHKL 2AV5A 3F73A 3MMBB 3M2VB 2GMHA 1RWWB 3R8YA 2RMLA 2FUG9 1MLAA 2OGUA 2ZJPQ 4DSJA 4LFBJ 1SFOA 4OMFG 3TUIC 3V4IB 5U47A 1H0HB 3RRKA 5LSOA 1I94F 3BBBA 2ZD1B 3UDVA 4EO6A 2QRRA 3PX4A 1Y1VA 4L75A 2CXEA 2KFYA 2BYCA 3FFIB 5HLFA 1RKJA 2DNNA 3HU2A 5D0GA 2ROEA 2J76E 4ED2A 1N33F 3WIUA 2AEJA 5DDOC 1MMLA 2B3TB 3AHPA 3MR2A 3X2HA 5HMYA 2M9KA 3LP2A 1QAXA 1PC4A 5K8OA 1VRTA 1OY9A 1N54B 4DJBA 2WW4A 1BGXT 2BANA 2W4PA 5KT3A 5KFRA 2A2CA 3DMRA 2COLA 4USTA 4J9MA 5HROB 1VGYA 2F3JA 5IWAF 4LUBA 1ITPA 1Y3KA 3UD3P 3D67A 3GQCA 3FCWA 3VR1A 1LW0B 3FZBA 2HPUA 4MIAA 8RUCA 3M2UB 3KKFA 3K8WA 3U1NA 2W8LA 2W2PP 1V3RA 1N56A 1RWXB 5DGAA 1OJ4A 1U1NA 3AOBA 5ETTA 3IM9A 1EIYB 4X65F 1SUQB 4RBUA 4J7CA 1HPZA 5M2UA 4ED0A 4Y2AA 4OI3A 1BQMA 1XMQJ 2VDIA 5DQHA 4ZCIA 3R3TA 1B70B 1UJ6A 3DU6A 7AT1B 4CZCA 2MKIA 3DU5A 4DPXA 3CDEA 2VDHA 5I4MA 3QATA 1BC6A 5BYQA 2DYAA 1V3ZA 2CQDA 1RHKB 3QT7A 3TUJC 4N8OA 2CQ1A 2ZDPA 4PG7A 3TP2A 3N01A 1IKVB 1NSAA 3ENQA 4TN2A 1S3SA 1YVFA 3F0NA 4F25A 2C2KB 1S9GB 1JLQB 3AOCA 3N0VA 4OHYA 3VZIA 1SQFA 2W2MP 2WOMA 3GTKA 1BD6A 3MTKA 3G86A 3NS7B 3QFHA 2D7SA 3HHLB 2YWEA 1N5SA 4J9LA 1UA0A 5F8JA 3QJJA 4U8VA 2V67A 2J7KA 3JS9A 2O66A 3PEHA 5LXRA 2K3IA 7FDRA 2DGWA 3IR7B 3MD3A 3KLFA 2HMIA 2AYGA 1IUJA 4OHWA 2XB2D 4MK8A 3DLKB 2JH3A 3K0JA 4I2QA 2PA8D 3ZNUA 1NPRA 3PTWA 1SKWA 1AXQA 3L9ZA 3ZTQA 2W25A 3HHNB 4I2PB 3GIMA 3RUBL 5B0CA 4ZS6A 2BM1A 2HHVA 4ZN1A 4KPYA 3J7ZT 3OL9A 5FDLB 3SDEB 4ZVPB 5FTNA 3BN4A 4DS4A 4RBVA 1FX2A 2RNEA 5IT9Y 2HURA 3BSNA 3I32A 2AHOB 3BGUA 5AE3A 2H5JB 1EAYC 3LA0A 3QIPA 3HVTA 3MAAA 2NXCA 4S0MA 5EPPA 3A1YG 5C25A 3GFZA 3SYZA 1PJ6A 4FN5A 2OPQA 3HKZA 3ULHA 5K20B 1EP4B 4LF5F 2VA3A 1F5BA 1B3TA 3QRQA 3MUTP 3W5XA 3KUEA 3MCSA 3H42A 2MYFA 1IKYB 1DZ5A 3THPA 3SI8A 4PG4A 1FDDA 2CQHA 3EJMA 5FLXY 1LEOA 4TXSA 4ETZA 1NJYA 1JK9B 2L9WA 3IO1A 4P7VA 4HR2A 3THVA 4HACB 3MMCB 3U7JA 2B5JA 1XR5A 2LQ5A 2BQ3A 4FF3A 1RLCL 1RAOA 3Q8PB 1I6JA 1Y1WA 1LNQA 1YQHA 4AOKB 3D3CJ 3TWZA 4QR1A 1WSRA 4C8KA 3OSNA 1PILA 1DMRA 2OIHA 3FVYA 3IRXA 2HHHJ 4EBEA 1HWUA 5D4PA 4HLBA 5IOLA 1N10A 2CQBA 1NDKA 1AB8A 4YY3J 3A8KA 3GSIA 2AIRB 4FYDA 2H65B 5AE2A 3V6DA 4P2MA 3SCJE 1S77D 1D8YA 4RWXA 4A8QA 1S79A 1TZ0A 2JC1A 1PQHA 4J90A 4U67Q 1XC9A 4KHRA 3DLGA 1RAGB 4W92B 2CQ4A 2N3LA 3PXGa 2GV1A 3DM2B 3CO0P 4DL0C 1FO1A 3NAHA 3OFHA 2UXBF 1N52B 5DRKA 4DUYF 4HDGA 2Q79A 3CCSS 4E98A 3DMJA 4Q0BA 5HSPA 5DM7Q 3E8OA 2ZJRQ 4DR4F 4J9SA 2EK6A 2E1PA 3GPAA 1X4GA 1OMSA 2OI2A 2E44A 3NCRA 4JJOA 5MLCV 5G4DA 2Z2LA 4R5PA 3B54A 2D9OA 1Q16B 3HKWA 1TL1A 5HVFA 1XMBA 2ZOFA 2L9DA 2DY1A 1QAYA 5HP1B 3NXZA 5HN0A 1SI9A 3HD1A 2KM8B 2C45A 3FEZA 2RDDA 3C8YA 1TL4A 2MLZA 4DV1F 3TVZA 4H4KC 1JLAA 2N4CA 3KLEB 3S6EA 5DDQC 4GA5A 5E3CA 2VBZA 3BJYA 2LXIA 4ECXA 2Y8YA 3M32B 4LSLA 1JLEB 1FKOA 2C2ZB 5JVGQ 3NBPA 2KKHA 4YR0A 1HI8A 3Q8YA 1TP7A 3I55S 1Q8BA 3UNGC 3C16B 2JVRA 1K1SA 2Q6CA 5T7LB 1TKTB 1DY3A 5J2MB 5ETOA 4JI6J 4DPTA 2AJ1A 4URQU 2GHPA 4I64A 1WEXA 2ZNYA 2EBGA 2CJXB 3T1AA 2XMJA 3MM9B 3MEDB 2HSEB 3GMGA 2F63A 2K1RB 2DJWA 3BH6B 2IIHA 3MFIA 4USKA 1N36J 1O51A 4DZDA 4IG3B 4J9KA 3GYGA 4EEYA 2MSSA 4NASA 1YITS 5I42B 3BQ1A 1YJ9S 2CPDA 1S1WB 3G87A 3B4DA 1JLCA 2MQ8A 4C7QA 2NXJA 4K0KJ 3G82B 3M8WA 1AUDA 1I3OB 3AD8C 2MXYA 1DTQA 1RT2A 2DGTA 4OYZA 5SZTA 2OJ3A 2V2KA 4A48A 4KHPF 2F8HA 9ATCB 3MUMP 3HI9A 4OZLA 2BDPA 3IG1A 1RA7A 4GMKA 1HBUB 5LMUF 1H2UX 4ZVOB 2HRUA 1FNXH 2WW8A 4ECYA 1C1CA 1LWFA 4P71A 3FEYB 3JAMU 2AKWB 1EU1A 3ENGA 2LQ8A 3NWRA 2MQOA 2I38A 1YJ7A 1MWZA 3DGPA 1D0EA 4ES2A 4G65A 1JX4A 2D1CA 1R0BG 2RVJA 2NZCA 2XMWA 2E2HA 2YPYA 2R7XA 2JEGA 4ZPAA 2WTFA 1RTJB 3K5MA 2ZH1A 4QIWA 3LQVA 3VAIA 1RHUB 1JLFA 1S97A 5F8GA 4FF4A 1PYUB 1ZAWA 5D78A 5JVHQ 2XSJA 4NZ0A 5H9FK 3UDEA 4CRJA 1RYRA 2R7TA 2D3OR 2FZGB 3GU0A 1GFWB 4KBIA 1XMOJ 4KTQA 4IH7A 4Y65A 5IM0B 1Z4UA 4FYYB 1T05B 3LTOA 3T5HA 3KLIB 2KHDA 4OJGA 4LF7F 4QYZK 2VL1A 3AA9A 3J7AN 4MJKA 4H4MB 1UA1A 5A0YB 2HWTA 5KFUA 1DQ8A 1B0TA 5KFOA 3IR5A 4K4YA 3D28A 2NZ4A 3WBZA 1XWLA 4Z2XA 1WG5A 1AZSA 1H2TZ 3HJVA 4D3HA 1DLOB 4USWA 3FMWA 3A13A 1RWMB 5I3PA 3U02A 2DO0A 1K9MT 3KK3A 1GTEA 3LP0A 3BO3A 2MY7A 4IDKB 2FIUA 3DFEA 4QYRA 4GC6A 3PV8A 3AJ2A 1TAUA 2ROGA 2V50A 4JBCA 4ZKAA 3R1HA 4ICLA 3L09A 4MFBB 4N7TA 2ZEJA 1GMWD 1KLMB 2W2QP 1R89A 2VG7B 1RAFB 1S57A 1HHSA 3A3NB 4LF6F 3A3OB 3UD5A 1P8GA 2VG5A 3CDUA 4J5OA 4Z7CA 3W66A 4M5MA 2WONB 1VC0A 2NPIA 4B9SA 1DHMA 2R7SA 3QC8A 2EFGA 3D0GE 1N88A 4U7UK 1HLWA 4ZOSA 4LFBF 4LIRA 1XK8A 4DS5A 3CIZA 1KQSR 3RR8A 2XSFA 3OR1B 4DSIA 1U7LA 1K83A 1M1KT 3PKMA 1SMYD 3W61A 4LREA 3DRPA 3PYDA 4G3IA 4CM2A 3CTRA 2RH3A 3UDCA 4OZ5A 4GVBB 3P45B 2DH9A 2Q66A 1XTZA 5B08A 2CA9A 5E3QA 1QY7A 2FJVA 2R93A 1WC3A 3W2VA 3KMSA 1KEKA 4RW8B 1HHQA 4MKBA 4O23A 1N5TA 1SB6A 3OJSA 3D0HE 4TQSA 3CF2A 1OA7A 4IFVB 2OFHX 4Y2CA 2J8SA 2EI5A 1VLYA 2BJ7A 1SL2A 5KFHA 2ZZNA 3PR5B 4RV0A 1EKRA 2HWHA 3JYTA 4B3SJ 4TU9A 4YEAA 2ZH6A 4Y6IA 2BABA 3DLHA 3E01A 3P3DA 2JIRA 1U0HA 1Y4ZA 4C98A 3L7UA 2HFVA 4U9RA 4DDFA 3QO9A 3HVAA 4M5JA 3VGSA 3RU0A 1XMQF 3M6XA 5K9FA 2ATCB 1RJJA 2CJYB 4QR2A 3NP5A 3CMES 1OYEA 3MXHP 2C2OB 1RAJA 1NHVA 2JIOA 4Q5VA 5D77A 4JP8A 1KQFA 3N4WA 3W64A 3M1VB 2MGZA 1X5SA 5DG8A 4AVRA 1UWBA 3BQ2A 3PJWA 5DZ7A 3AD9C 4DF4A 3IWLA 4JV1A 3I5CA 4LSNB 1G2EA 4MAKA 2G0IA 2FQQB 5KG5A 2DNPA 3TQEA 4JI0J 1UEKA 3J81j 2LQJA 3X2KA 2VPYB 4FKYA 3I0RB 4P2SA 4ZP6A 3SUKA 4F2SA 1LV5A 3GIJA 1NSQA 1E6VA 2GW8A 2KXFA 2HFNA 5F41A 1TQLA 2EPIA 2GA7A 4ZK7M 3KHLA 1VOMA 3D54A 3BEGB 2OUGA 2OLWA 3ENAA 4XTTA 1TMMA 2DMRA 4PWDB 5DETA 2V68A 3BN7A 5KG2A 2F9JA 2OMOA 4F04B 2JIQA 1BWVA 5ETRA 4DSFA 2OPSB 2C42A 2J8AA 3PVXA 4MH8A 4OJHA 2J0WA 4QBUA 1ZOTA 2GVDA 2ZH2A 4WYLA 4O3NA 2Y9HA 3G8QA 3VGUA 1NK8A 3C6UA 1B64A 2H4WB 3OTOJ 2RE1A 1T3NA 1RT5A 4LT6A 2VIHA 2CQGA 1CLFA 1Y5IA 5DJBA 2E5HA 4TVAB 2X3DA 1RT6B 4O4GB 2QZ8A 4ES3A 5KFSA 3QGPA 4KAIA 3FDSA 4TY8B 4DFKA 3AOAA 2KT2A 3V81B 3DRXA 1WHWA 3G6ES 2UUBJ 1NK5A 1GT8A 3HSZA 1IKWA 2UUWA 4HT5A 2H48B 5DG7A 3NEKA 4WTOB 2ENGA 3RZAA 3EICA 5EWEA 4EMDA 4DQPA 2RQCA 1ACMB 5L8RC 5KTQA 3ZZZA 3DCAA 4FYVB 4ETXA 4RUAA 3TX8A 1DURA 4G1QB 4KDIA 4WIIA 3L7OA 4MTPA 3ZZTA 2F5GA 3T3FA 1WI6A 2WVBA 1Y11A 3POTB 2E1RA 5A8WB 1R0AA 4CH0S 1Q53A 3QLHB 2JLGA 5A2QU 4ANCA 3HU1A 2HHHF 3DRSA 3LAMA 3THTA 1JLBA 2NXUA 4RUCA 3MM8B 1QM9A 4TQRA 1FD2A 4A8MP 4YY3F 2PSZA 1EJ7L 3ZZYA 4WK3A 2AX0A 3CMQA 5KFFA 2ZH5A 4YB5A 3H8YA 1RHJB 3U1MA 1KTVA 2HIYA 1TTHB 3GJRB 2JNJA 5LJ5Y 1HW9A 4K8RA 4ZP8A 4QU6A 3QT8A 1RI7A 1YK9A 3W9IA 5H9FJ 3CJ0A 4WE1B 3T19A 1TK5A 2ZFHA 1WORA 4Q44A 5KG4A 2FDNA 2UVVA 1PBUA 2CPZA 5FTJA 2G1DA 3W65A 3FSYA 5CQGA 2JZ5A 5DLGA 1YRUA 2LA6A 2DGOA 4K4XA 4P2XA 4QYZJ 2H5IB 3MM5B 2XHWA 3HHEA 3HHKA 2ZM6J 4FYWB 1N32J 3LANA 2N82B 4DX7A 4M5IA 3IM8A 2B9XA 4A8KA 2CPXA 1J5OA 3R5AA 3DOKA 1Y9OA 2W1BA 4K4WA 1VS3A 2ZH8A 3GJQB 2I9SA 1SC3B 4URSA 2KDOA 2O5DA 3P4UB 4KODA 3BF4A 2LFVA 5EHHA 2PMHA 1PJ7A 2EBEA 3EM1A 3CCES 3X2OA 3H5UA 4PG5A 1FNMA 3I82A 3T9NA 3PW7A 4Q7AA 2B6AB 3EYZA 5BYSA 2DPIA 1H98A 2R7VA 3M2RA 4PUOA 4JV2A 4B3OA 4ZVTB 3DLJA 1KP6A 3BH7B 4JI6F 2ABYA 4WFBQ 1J5EJ 3IGVA 1YJWS 2FLLA 4ZHRB 4IRDA 2IM3A 1WC5A 2DR5A 1F9HA 2JA6A 3O1LA 1JNRB 1FFGB 1N5YA 3LW5C 1U1MA 3KWMA 3T5LA 2IMOA 3JQJA 3VAKA 3R7BB 1R27B 3PEJA 2YKMB 3UCZP 1N36F 2VODA 3TA2A 1NO8A 1CR5A 3PACA 3FK4A 2B4PA 2ZUAA 5KFTA 2FLOA 2ZHAA 4ELVA 3MM6A 2V8DA 3Q89A 2YU9A 4CYUB 2L48A 2HNDB 4CLWA 2C3PA 2EEYA 3VQTA 4K0KF 3PNIA 4OYIA 5J1PA 2NR0A 4TLRA 2V45A 1T02A 3N6NA 3Q0AA 3DDIA 1VJQA 2BJ8A 4CO1A 2RRAA 1X5PA 1Q8KA 5AXKA 3J7YU 4AXIA 5D0EA 4RW7B 5IC4B 5F9LA 2UVWA 4Q8EA 4IOCQ 1O8BA 2H5EA 3EGNA 5GMEA 2YY3A 2VOPA 3ZFVA 3KNAA 1IVZA 1TKXA 3LP1A 1LW2B 3TQ1A 3GTJA 2FLNA 5KT4A 5E41A 4NEZA 2CJAA 4PYAA 4RKUC 2XGPA 4DBQA 1ZBTA 2C22A 3D9BA 3EVWA 2W7AA 3OL8A 1H3DA 4GO7X 1RT7B 3E2EA 4CO0A 2AYBA 4KGXB 2F9DA 3ZZOA 2LVWA 5KFJA 1KSPA 1U0SA 1X4DA 2OTLS 3EPIA 3K5NA 4OZ1A 1ROFA 1YBUA 1NLKL 2O1PA 2B56A 4OQJA 3ENVA 4CLZA 4FBUA 2FY1A 4RW4A 1RAAB 2YNIB 1MU2A 4ZVRB 4ZVUB 2Q3PA 1UFLA 1E18A 3DOLB 3GV7B 2D3UA 1X5TA 2B43A 4FNIA 1AA1B 1YDLA 4I67A 1CJUA 1FJGJ 5KFZA 5KFVA 1D1UA 2WHOA 4ZPDA 2ZWOA 2M8DB 1CJKA 5KG1A 3B8HA 1RT1A 4X62J 3VQSA 4OI1A 4RBTA 4R8UA 5ETPA 5EN1A 3IC1A 2R2RA 3FC9A 4NE9C 4LBHA 5KT2A 4V1Ak 4NZ7A 5A6WA 4EBDA 1FI4A 2V8HA 4DFMA 4OYPA 1GMVA 4PEOA 2RUGA 3JQKA 3BM7A 3ISZA 3SCLE 3BYPA 2XLJA 1WI8A 2I6WA 4NI2A 3OR2A 2BXJA 3C14A 4F50A 3QT6A 4IQMA 2ZC3A 4JV0A 3CNQP 2VHGA 1PCAA 3G2XA 1RE1B 1O5JA 2GMLA 2V6AA 3OBIA 2PJHB 4MT1A 3I5AA 3X2PA 5C5JA 2P9GA 1Q7LB 3GE9A 2V9WA 2DNHA 4M5GA 1GH8A 1KR4A 2P8IA 2A6MA 2LECA 5E3RA 1IKXB 2HWIA 4ZLPA 1YRXA 4NCGA 1I50A 5GVQA 3TAMA 3CDAA 5HL7Q 1URRA 2NQPA 2F65A 2E1CA 2EFQA 1ZYRD 5HQ8A 3KJVA 4KHMA 3FNNA 2HNYA 1JLGA 3EGVA 3ZXWA 4RUHA 3MOZA 4MIBA 3NNAA 2PD1A 1U24A 4HDHA 4NZ6A 3SZ2A 4WU2A 5HLFB 2DR8A 3P6YC 5K8MA 5I3UA 2IDLA 1WNEA 2ZHOA 4PG8A 3KK1A 3OSPA 1KKHA 1VBZA 2FVRA 1SJ4P 4USVA 4NLGA 3W3SA 2IAJA 2G1HA 3LP2B 1VRTB 2HVDA 3NWGA 4B3SF 5DGBA 1DQAA 2BANB 3SCKE 2X1FA 5KFAA 1S10A 2NVYA 1S99A 2H4YB 3EX7B 1U45A 1E6YB 3GTGA 1K47A 4KIAA 2K3KA 5EGYA 3X2LA 2XWYA 1B0VA 4X4PA 2AJQA 3HLUA 1R7IA 4OI6A 1CBKA 3CSKA 4LFCJ 1NDPA 2QA1A 3NG8A 2FHOB 1VQMS 4WF9Q 2X1BA 1HPZB 3HPOA 4WJBA 3O3LA 1BQMB 5IT4A 4BWMA 1EETA 5HK4A 3GIRA 2BQUA 3K59A 3FZ2A 5A76A 4Q2MA 2JFKA 4UTGA 3K5LA 1F6TA 3KUHA 4LRDA 1F2HA 4E2FB 1M1GA 4LF4J 1FDNA 1RBOB 3BKUA 1TWFA 8ATCB 4IFYB 3D68A 4JI0F 2VG6A 1MWQA 1UJ4A 3ONQA 2WVFA 4M5DA 2MLXA 1RGVA 4HVZA 3TAQA 1S9FA 4Y2KA 2WOMB 4ZMMA 3GILA 5DYIA 1AROP 2DB1A 2IA0A 4DV0F 4C4WA 2KJVA 2KT3A 2NCKL 1HWJA 1UEUA 2LKZA 5K5MA 3GTOA 3OL6A 3KLFB 3ZTSA 1P9QC 2BE9B 1B99A 2R7QA 4JI5J 1HWIA 3I5BA 2YWGA 4KY3A 3OHAA 4DUZJ 2FZKB 5C2GA 3M9OB 4P2FA 1U2CA 4NOHA 4I2QB 2EC0A 2UP1A 4OIXA 2B4OA 3B78A 1RP5A 1HI0P 3OTOF 2DRDA 2ROPA 3JSMA 3HK2A 6FDRA 2E9ZA 2B9YA 3D6TB 2QYGA 3CJKA 3CE8A 2J6UA 4O3SA 2HEKA 3RB3A 5C42A 4C8OA 2CIMA 4A8YA 2NSBA 1U1QA 1HKAA 3ILJA 3QIPB 3HVTB 3MAAB 4HYKA 4QW8A 3EZ5A 1Q1KA 5C25B 2UUBF 2D69A 3VGVA 3BPDA 2QC3A 2OPQB 2J9DE 1SH2A 3FKBA 4DSKA 2B9EA 3SFUA 5CYMA 3RB4A 3VZHA 2W8KA 1Q7YT 1SKSA 3DOMA 2VU5A 4F4YA 2M70A 3X2GA 2O5JD 2RS8A 4X4OA 3EXCX 3H5YA 1BW3A 2EFPA 2HBQB 3RRHA 2YKNA 1VK8A 2ZJQQ 5CZXA 3TNVA 1X9MA 2B5JB 4DR6J 3HHDA 3VAHA 2R8HA 1TVRA 2X7IA 4DL5A 2BMBA 1GMUA 4UY8T 1FKPA 1S5ZA 5LXYA 3T1YJ 3I0SA 3QJPA 1FFWB 3MUVP 1QAJA 1HQEA 5MAOA 4QQBA 2ZZTA 4HTJA 2CVEA 3IRXB 3NL0A 4C11A 1TELA 2I5JA 2IDEA 1G3OA 4OX9J 1KD1T 4AL7A 4KYZA 3Q8SB 1XNQJ 1WF2A 2M3DA 3I9ZA 3GTYX 2HAFA 3V6DB 4CLYA 3QQ7A 2V3VA 3GTPA 1X4AA 1U48A 1WDTA 1PPYA 3DLGB 5FIIA 1MNEA 1TU0B 3MD1A 4DV3J 1AT1B 3CGIA 2A0FB 5HVGA 3Q8RB 4DL4A 1YJRA 3HZEA 5KFPA 2J9EA 1NB2A 2HNZB 3GG1A 1F5CA 3FCVA 1ZZFA 1ZS6A 3ISNC 5KFKA 3DMJB 4Q0BB 5F8NA 2ZM6F 1N32F 3QGGA 1RWUA 5IZHA 4YB1P 2V0NA 2J0QD 1PBAA 3Q24A 1CZ4A 2C1EB 2FC9A 2E5LJ 3BGFA 4RU2A 4M5LA 4R5PB 4WBFA 5D6GA 5E3PA 3A8JA 4EFAC 5HBMA 2X3GA 3OXFA 1S0VA 4ZJQA 1TL1B 5IS2A 5KFMA 3DYAB 4I4BA 1YGYA 1KONA 2IVYA 4NA1A 2J0SD 4RO0A 1JLAB 3CCTA 2QT7A 1FT8A 3MR3A 4Y34A 1RYSA 1BHNA 4TU8A 4YS2A 2WK4A 3NAIA 4HHHA 1TAQA 3SEOA 3OQ2A 4LSLB 1J5EF 1FKOB 4JV5J 1BY9A 3NBPB 2RHSB 1VQ4S 2AJ2A 2NREA 3WC2A 1OYDA 1YJNS 1CJVA 2M52A 1VISA 3DDKA 3LAKA 3LOUA 2OEMA 2YQ3A 3TJ8A 4WFAQ 4NMXA 1QSSA 2UUTA 1TFYA 3PJXA 3CF5Q 4Q45A 3TEGA 4CNYA 2GVZA 3QFWA 1M5KC 7FD1A 2NS1B 2ZBRA 2MZQA 3MEEA 3CJSA 2W7OA 5T41A 2FY8A 2XNQA 2KXHA 4NXMJ 1CQMA 2X1AA 4DR1J 1RTZA 3MCOA 4WWSA 1VQ5S 3RTVA 4LRAA 1K44A 4Y00A 5CAAA 1JLCB 4I0WA 1REVA 2CDQA 3ETOA 1S0NA 4NCAA 5HQMA 1DTQB 1RT2B 3EPGA 4OFZA 2RIJA 1KS2A 1MW7A 3UI3A 2UZAA 2EEOB 2QLBB 1Q0NA 3J7YI 1CJTA 3IG1B 2VOOA 3LUYA 1AUSL 1RISA 3RAMA 4ER8A 1NH7A 1F60B 1R9TA 4QIGA 5B0AA 1C1CB 1LWFB 3V6HA 4IR9A 1IM4A 3PYGA 1CS4A 5LM7E 4LMZA 3ENWA 2W9CA 2QN6B 2H51B 1OSCA 1WHYA 2FHKA 1XIQA 2HVEA 3TARA 5E0OA 2LEBA 2VD3A 1IWAA 2E7ZA 3BBFA 3DGPB 3NLCA 3GFXA 5F8LA 4NLYA 1WTFA 2XYGB 1R7RA 4YFUA 3S01A 5HMXA 4W98A 3QAUA 5KFWA 1M5OC 1CC8A 2UXCJ 4IOBA 4NYPA 1JLFB 2HQGA 1NH8A 1T7PA 4JP6A 2XSJB 1YI2S 2HHPA 3FRYA 1EZZB 2G2OA 1SCJB 2QMUB 2RT3A 1RCXB 3ZTRA 1F3VA 4YDDB 1WWHA 2XWXA 2CJBA 3QSYB 4EYIB 2CZ4A 5GMKa 5D0RA 5T14A 4CDIA 3MURP 2OPRA 2YPZA 5CCLA 5IQ6A 3MECA 2YKOA 1SQGA 3X2MA 5B0FA 1C0TA 3LGHA 2V4QA 1NEEA 2L41A 1WUUA 4X62F 1SC6A 2VJVA 4LF8J 2MHNA 2UUCJ 4J91A 3ZZPA 3CC7S 3EZUA 3RBEA 2PC6A 1FJ7A 3UR3C 5IV3A 4LF9J 1URNA 4CRYG 3ITHA 4CT9A 3IR5B 2YX4A 1IN0A 4IO9Q 5G0RA 4AL5A 2YNHA 1AZSB 4JYAJ 2KJWA 2XS5A 4ZIWA 1GMWA 4ED1A 5LSLA 2NAPA 2QA4S 4CLUA 3HFVA 4WPAA 4EO8A 3KHHA 2UV8A 1D9DA 3KK3B 3LP0B 3WX8A 3EGZA 1WF1A 2LDIA 4CLTA 2ALZA 2NYIA 4DU7A 1SXLA 4RPFA 3R6LB 2BKNA 3NCQA 2UU9J 4NPOA 1Q5YA 4PYDA 5L38A 4ICLB 2PNWA 2E2IA 4QPXA 1T8EA 3ELHA 1TK8A 1H2VZ 2GCFA 2VG5B 4OYAA 4WFNQ 3K5OA 4MIWA 2D3ZA 2BE2B 3NCPA 1NK7A 3O8WA 2G5DA 1GXTA 4UUWA 2BEFA 1XR7A 2NLWA 4Y2IA 4KGVB 4DHVA 2MTLA 4ZCMA 3DRPB 3R5CA 4QCLA 1RQ0A 4LR9A 1PGZA 4OHVA 4XPEA 4DMRA 5SUHA 1U26A 4KPCA 2VFRA 2PE8A 3MFHA 1WC1A 5CD4H 2H1YA 4OHZA 2AEFA 3CUNA 3SMZA 4H4KA 4DV7J 3UD4P 1U1OA 3BKFA 2N7CA 2MMYA 4BWJA 4I68A 4A8XA 4DX5A 1MN9A 3ADAC 3W2VB 2V63A 1SC4B 2G6GA 2RU9A 1R3NA 3R6GB 2G13A 1FTCA 1CEZA 1X7VA 2LXUA 2MZSA 3K58A 1RHMB 3R5GA 3GR1A 2R7WA 4C0HA 2OPPB 1U4BA 1VIXA 2RSQA 4ATNA 4QWCA 1MN7A 1RT4B 2HHXA 4ZM7A 1S9EA 3N6LA 2YWFA 2QA4G 4BS2A 3JYTB 1JLEA 3EXYA 3R5BA 2J9DA 1SJ3P 1JXLA 3DHWC 3E01B 4LFCF 1T95A 1U0HB 1Y4ZB 3P5TL 2YWWA 2CQ0A 4IOAQ 2VJUA 4HI2A 3T1HJ 4PXBA 3UCUP 1R8PA 2IPOB 2ZNZA 1ZTTA 4H4OA 4WYWA 4DSLA 1R0CB 1YHQS 5C7PA 1IXKA 1NBEB 2QL7B 5C24A 1FEEA 1KFSA 3CJRA 2GIQA 3CCUS 4OI4A 3HFKA 1BUXA 4LF4F 1H7WA 1JXVA 3NGSA 3ILIA 1KQFB 4DV6J 3V6JA 1X0PA 4ELUA 2MGZB 1UWBB 4PPZA 2A10A 4UUXA 1G7CB 3D1QA 1TV6A 3DDNA 4QIEA 2EW9A 1NDCA 4JS7A 5KFLA 3PDNA 4WKYA 2JA5A 2XS2A 3CT9A 3CDBA 1FRKA 1VBKA 4CO4A 4JI5F 1E6VB 4DUZF 4PWWA 2Z0GA 2JL9A 3TIWA 1DTTA 1B7YB 2PGCA 1KQKA 2F8MA 1Q5VA 3M4XA 3UO0A 1IR2A 3M6VA 4F8RA 2DH7A 4Z37A 4DOZA 5EX0A 4KJIA 1X31C 2HIQA 2W9BA 2ZH4A 2GVDB 1S1XA 2Y1IA 1I3QA 3UNYA 1W25A 2VKRA 2AP6A 3JSBA 4LIWA 1YRTA 1NZ8A 3C6UB 3GFHA 4GO5X 1RT5B 3SFGA 4NA3A 3N28A 4F3QA 3R5DA 1Y5IB 2DK2A 1S1VA 1VCTA 2BX6A 3FJ2A 3AQPA 5H4UA 1QCSA 1J27A 2EC2A 2A3JA 2DY9A 3C6TA 3MHYA 1LK7A 2YX1A 3NGTA 4L76A 4ID5A 1ZAXA 1Z2LA 3H20A 2DNLA 1NSPA 1IKWB 3PX0A 3PW0A 1S72S 1YBAA 1VBXA 2KI8A 4DR6F 2ZWPA 4JI4J 1WD6A 2GHWA 3T6JA 4P75A 3BQ0A 1XBWA 3RB6A 4WP8A 3HULA 3KHRA 2FVQA 3LWLA 3T1YF 4K4ZA 2XS7A 1V5IB 4USIA 2ACYA 3X2JA 2HBYB 3PHEA 3NS6A 3K5PA 3C15A 1HNWJ 2E9TA 4CLLA 3DRSB 2IRYA 1JLBB 4J9QA 3M7VA 4IDKA 4OX9F 1IW7D 2W7PA 1C1BA 4ZVQB 2JEIA 2DNZA 2ACMA 1XNQF 3CD5A 4ZDNA 2CW0D 3QWUA 2GAEA 4MFBA 3ZNJ1 2C3YA 3TJ9A 3BGRA 1RDRA 1YJVA 4EWTA 4DV3F 1K1QA 4ZVSB 1UKUA 2XLKA 4KGZB 4N5SA 4BBYA 3T9ZA 4ZN3A 4N56A 3F41A 4B3RJ 3ET6A 4ZJLA 5BXIA 2W01A 1A9NB 1WOSA 2KZMA 3D5MA 4B17A 2CJQA 4ZITA 3NGKA 2E5LF 2CPIA 5H9EK 1DAXA 1AFJA 3UQSA 1RCOB 4ECWA 4I6YA 3HDSA 1YIJS 2CUYA 3M05A 4IYQA 3EMTA 4GVBA 3BR9A 2C2EA 3EGWB 2PI8A 1J5OB 3DOKB 6AT1B 2M7SA 4ZPTR 3MZIA 2G2YA 1RTHA 2J5AA 4X66J 3IXQA 2A2DA 2WBMA 1R8CA 2YNGB 1NK6A 1TWAA 3C46A 6FD1A 4ZVFA 2DRBA 2QX0A 3V5RA 5DZ6A 2GJIA 3ML1A 3GTLA 2GQCA 4FPRA 2OMLA 4JV5F 2VPXA 1RBLA 1PYQA 3M3GA 4W90B 3T5KA 2M8HA 1R6VA 2N7YA 2U2FA 4IRKA 3M2RB 1A6LA 2IM2A 4R25A 2WB1A 1KDNA 4NLWA 3TJAA 3KLHA 1EB0A 4B3OB 2Y0BB 5EWFA 2EFVA 3TM7B 2VBWA 2OTJS 4KO0B 2DHAA 2QLFB 2VF3A 3DXSX 3US5A 1KHVA 4TYBA 1JJ2R 1N5YB 1JJ4A 2IBOA 1KHWA 2JEFA 2Z2MA 1V3SA 3KLGB 2DBBA 5KOWA 4LRFA 2GMJA 2WVEA 1Y0HA 2CPJA 2ZVIA 3M8QA 2K7KA 1ZPVA 2M4MA 4DR1F 4JI1J 4I6AA 3IA0A 1HYSA 5KFCA 3MM6B 3TO8A 1X9SA 1VR6A 2Z8QA 1YWXA 3M6UA 2Z30B 2BJ9A 1M5SA 2RD5C 2BACA 4ILLA 2OAUA 2JIMA 3TAPA 1FVQA 2I1RA 1UZDA 4PR6A 1NAQA 1HA1A 5RUBA 1VBYA 5C2CA 3MPWA 1S7IA 1G6BA 3P8BB 3TRGA 4IG0A 3OV7A 3RG6A 4EUVA 2PEBA 1TKXB 4ZLJA 1KLNA 3X2IA 2BJ1A 3LP1B 2WB4A 3O6QA 2GX8A 4Y0FA 3CCLS 4OZ3A 1WKJA 2QL9B 5AXMA 1LWEA 1KOHA 4KSEB 2XNRA 3FCHA 4GRSA 3DI6A 4DR5J 2UXCF 4V19X 4KV8A 4KC5A 4C9DA 2AYMA 5KFEA 2LYVA 1HR0J 5LJ3Y 2XYHB 2VFTA 2MQLA 1BQNA 4MYTA 2XZWA 2MLYA 4X4VA 3ILLA 4DQQA 3D66A 2R2TA 4Q8FA 4JP7A 2CRLA 5F3TA 2E1AA 4ERDA 2XI3A 2AT1B 1OPIA 2YVSA 2V2ZA 2BOPA 4RW4B 2DEJA 1UEVA 1MU2B 4ENGA 2CNOB 1HBNA 1SKUB 8AT1B 4LF8F 3MCMA 2UUCF 1WG1A 2CPFA 3HVWA 5ETNA 2D3O1 5J2QA 2JEJA 4LF9F 2AE0X 1CJUB 1U1PA 2EWHA 2GIRA 2MPUA 4JYAF 5HANA 5GADU 1CJKB 1RT3A 1RT1B 3RAXA 3LH2S 5ITHA 3UN2A 5J1EA 4R8UB 2QFJA 3SULA 4DR7J 4ZCLA 3NKYA 1UP1A 2C2MB 3AAWB 2ZBPA 1ZTWA 4P9SA 4OX7A 4CWBA 1N4LA 1F3FA 2UU9F 1QTMA 3NGUA 3IWXA 4A46A 4ED7A 1F0XA 4NI2B 2E29A 3OR2B 2ASLA 1T03A 2QL5B 4FVMA 4DN9A 1SL1A 5GAGU 2LU1A 1H73A 3ZTOA 4OYMA 3C14B 2APOA 1W26A 1TMJA 3CCMS 4RW6A 1Q82T 1ULRA 1TWCA 1UJ5A 2OH2A 1HD1A 1B0PA 3HO1A 3GV5B 1GAOA 4PRFA 3BGOP 2AMCB 1VMBA 1APSA 3F56A 5F0UA 2VQFJ 3KK2A 1RWOB 3HHLD 2ZZMA 4NCGB 5JXSA 3TAMB 1G8KA 2EVZA 3M8SA 4CLPA 4PABA 3LO3A 4FPIA 4CTAA 2XY7A 4GA6A 3LWMA 2PJJA 3KJVB 4DV7F 2YTCA 2HNYB 2N3OA 1EQ0A 1JLGB 3O5AA 3JAMY 3Q8QB 4H54A 3WZ0A 2NYAA 2I0XA 2QTWA 3MEKA 2GNKA 3KLVA 4YR2A 4RR5A 3KYLA 5I3UB 2NYHA 2HQCA 3KK1B 1NMEB 2DXEA 4ECSA 2IA6A 3RBZA 2A1BA 3J80U 2RRNA 4XDCA 4L3NA 5CHCB 2IAJB 2HHUA 1RTIA 1L3TA 1SIWA 2Z58B 1JJHA 4M94A 2XMUA 1X60A 1TL3A 5B7WA 2WSEC 1SC1B 4C48A 1N8RT 3H5SA 1VQ7S 3T1HF 1EHWA 2JLEA 4PWUA 4DN0A 4EZ6A 1FF2A 5KFXA 4XK8C 3RYLA 1NU4A 4WCEQ 3QIDA 4DV4J 1KNZA 2V4RA 3CC2S 1S4FA 4UOCA 5IQQA 4L3KA 1UAWA 1FJEB 2ZH7A 1FWPA 1GXUA 1RBAA 4K2XA 2OD4A 2F4VJ 4IQXA 3R27A 2DHHA 3CB4A 1F9FA 4DV6F 2JX2A 1EETB 5D8HB 3DRRA 1NK4A 1HNZJ 5H9EJ 2A6OA 1IBKJ 4WIQA 3H7HB 1Y10A 4AL6A 4IKAA 2OELA 3WDOA 5F8MA 2HHTA 5KG6A 2Z2YB 3HSGA 2YXLA 4NRUA 3QQCD 2V8VA 2VASA 2LEPA 2CG8A 1M90T 1XNRJ 1IQZA 1VI7A 1N6QA 3HX9A 4F67A 2CYYA 2VG6B 1YTYA 4M5DB 3SV3A 3CCRS 2DHGA 1OQ3A 1S4EA 3JXOA 2BJDA 3SXLA 2DCLA 3D1HA 3IFEA 2R2UA 3DRYA 2WVCA 2RF2A 2HLTA 2PFFB 2WAQA 1WDDA 4LBPA 4XAKA 3CULA 4KHPJ 3BZQA 2P9CA 2PN6A 1FVSA 3C19A 2ZE2A 4RL1A 2A6ED 3NGDA 2RILA 1JWWA 2VUMA 5DLFA 2AW0A 3GFYA 3SUJA 1KQGA 3OUYA 3KXDA 1TL7A 4BHQA 3QZ7A 4P74A 4DXLA 3UVJA 4NLUA 3Q22A 2VKZG 1NUEA 1NJIT 3JSMB 3RAQA 3HMJG 1EARA 3K57A 1UMJA 3VAFA 2X1GA 4LVOP 1ZAVA 3CJKB 1S6PA 1HQUA 5C42B 1WC0A 4AYBD 3TZXA 4AUKA 4KLNA 4JI3J 2V8GA 1P1LA 3MMJA 1ZM2A 2OFGX 3MM7A 3BO2A 1NKCA 3QSIA 4ZA1A 3PCOB 3H98A 3GB0A 5IC6B 2RDJA 3MEGA 2FHMA 3KNGA 1VIOA 1IJEB 5CYMB 2AZ1A 1LQ9A 3S8SA 4GVLA 3KDNA 2FJEB 4PXCA 3H25A 3DOMB 2XZTB 1S0MA 5I3QA 2CZ9A 2HG4A 4JI4F 4OYXA 1VRUA 4OV1A 2YKNB 2WSCC 3PFOA 1ZH5A 2YUJA 2Y3YA 1FEHA 1L3UA 1GQEA 2VQEJ 1HNWF 2C3UA 1FDOA 1UFKA 1TVRB 2YQ0A 4A8SA 3L95X 4WU3A 1E61A 2BE7D 1AW0A 3PG9A 2GZOA 5AXLA 2JA7A 1N0UA 4IH5A 2OHDA 3IAM9 2KB2A 1QUVA 3I0SB 2DNQA 2OD6A 4HEA9 3H2LA 3NY0A 1HQEB 5F8IA 4WFZA 3UPFA 1FNOA 2BJEA 2FLPA 5ETSA 3KJQB 4C11B 1FHTA 1QD1A 3P96A 4B3TJ 2I5JB 2FYXA 1TKZA 2MKSA 3AA8A 3TEHB 2XY5A 2FHJD 1L3VA 1RHQB 4JI7J 1PYOB 4L74A 1VC5A 4DPUA 4YUDA 4DFPA 2DXFA 4RLEA 2MKCA 2V4JA 4FVCA 4B3RF 3PFEA 1SV5A 3CD0A 2MKJA 4QWAA 3KOAA 2HCZX 2FGOA 1OY8A 1K0TA 2ZOGA 1KOOA 1RB0A 3PIPQ 2V8PA 1F9EB 3EVOA 4ZIVA 2BW2A 2YWHA 3A8IA 3KJFB 1FDBA 1HMVA 2JWNA 4PCQA 1E60A 5D0HA 3BO4A 2GGPA 1WC2A 2E7VA 4OL8A 1RZMA 3M30A 2XEXA 3GYXB 2GAGC 2BH0A 1ICEB 4NLQA 4I7FA 1IR0A 1YNJD 1VQSA 2HKEA 1T9WA 1WSVA 1OPZA 2PEHA 5HBMB 4X66F 2KZZA 1E32A 1WCMA 3IN5A 1HD0A 4L73A 4DCJB 1TUWA 4NRTA 4WZMA 2E5IA 2AYEA 2PDAA 4ED3A 1I1GA 2AD9A 4K4TA 3GIIA 2DXDA 1JKHA 2E5JA 2VPWA 3W9HA 1RAHB 1ZZNA 3AODA 1X8DA 1PT0A 2ZBIA 2QFIA 5KFBA 2XHCA 4O0NA 3PLXB 2HVIA 3MGJA 2GO9A 2DGSA 1SBRA 4CLFA 4C8MA 2B0GA 3C2PA 1ZYQA 4F4KA 2HFZA 1HNIA 2B4VA 3LALA 1T9UA 4ZCKA 1E6YA 4NA2A 2J7WA 4ZJOA 4B9TA 4ANDA 4B9UA 3QWPA 2JHEA 1CJVB 2PFDA 4Z7YA 3CJ5A 2GHVC 1HIYA 1S6QA 5HO4A 3CD6S 3UWTA 3QJLA 3NNCA 2FZCB 5CYJA 4JI1F 5LOQA 4M5KA 2EXUA 1IR1A 2GVZB 5DG9A 2GJFA 2KRRA 3MEEB 3I6PA 4DCPB 4OLPA 4MKVA 5A2QY 5CXTA 1Q8IA 4U7CA 1M1HA 4YB7A 4FKXA 4NLOA 4RZRA 2DCUB 4ECQA 1Z2ZA 1VK3A 1PYTA 1UVIA 4USUA 2XCPA 3KJNB 2R8JA 4IFYA 2LMIA 3IAS9 3OT9A 1REVB 1QAIA 1JMTA 1KRPA 1OIAA 1WF0A 2OO4A 5D4NA 1KTQA 3FBBA 1T9VA 5A8RA 2UXDJ 4DX6A 3OL7A 1VQYA 4O44A 2M88A 3OJUA 5LMNJ 4ED4A 5ETQA 3G96A 1CJTB 4CH7A 3AH6A 4KR0B 1WEZA 3QNWB 2BQRA 4BCAA 3OLBA 3TOQA 1NKBA 3PO5A 1T9TA 4EI2A 2DR7A 4C8NA 2Q6BA 1CS4B 5H1SV 3HM9A 3PO4A 1U49A 2W9CB 5IT9U 4ZP9A 4DR5F 2NXNA 1T11A 1NRKA 1FRIA 2QO3A 1M5PC 2C3MA 1FE0A 4GKKJ 4RX6A 1HR0F 1RU2A 4OI0A 1R6YA 3MPDA 4HL9A 4C3LA 3M8PA 1IBMJ 3N5FA 4X4RA 2DHXA 4V19J 4P73A 2BE5D 4X84A 2DKOB 5F0WA 4PQUA 2KFZA 3BSOA 5A6PA 1R8BA 4EBCA 2Z56B 1FERA 5FLXU 3M8ZA 3B4MA 3OFFA 4UZCA 4WZQA 4CLSA 2OPRB 5GLFA 3H90A 3MECB 4X64J 1Q95G 2QMWA 1C0TB 2MJUA 3H4BA 3Q2SC 1VQPS 3W5YA 1RK8A 4NLRA 4ZPCA 2QV6A 4WFXA 2VONA 4DR7F 2AZ3A 3T6BA 3MPVA 3ITHB 4DR2J 5G0RB 2YNHB 3FBEA 2RUSA 5GADI 1QDNA 1UW9A 1BQXA 3GYNA 3DHXA 1FXRA 4LF1A 1CULA 2ZC4A 3M6WA 1PO6A 2NUUG 3VHQA 3CJ4A 1HARA 3AB4B 2IFXA 4OZ2A 2D9PA 2VUGA 2PMWA 2Q1LA 3UDLA 5GM9A 5DDPC 4N8NA 2HK2A 5KAKA 3FKIA 5GAGI 4DEZA 2WRMA 4DZ6A 2HLUA 2E1MC 2OP5A 1MROA 3OPKA 1FRMA 4O3OA 2R42A 2VQFF 3V6KA 4K4SA 3Q23A 2GQQA 2W2NP 1RSCA 1X5OA 3LPYA 1Q81T 1I5OB 2G0JA 3SV4A 1WACA 3GR0A 2HNZA 3V2UC 1X0FA 2IYGA 4DL6A 2IMWP 4DFJA 3BBCA 3UN3A 3W5ZA 4DPYA 4J9PA 2Y8WA 3H40A 4UW2A 1K73T 3A3PB 1VLOA 3C3LA
chains in the Genus database with same CATH topology
2J9DA 2CG4A 1SJ3P 2HGNA 1MROB 2D74B 1M0SA 1L3SA 4ALZA 1JXLA 1KQFA 3DHWC 3N4WA 2EG2A 1YG0A 2JDJA 3PRBA 1Q79A 2BRKA 1F5AA 3E01B 4HT7A 5LL6d 4A8OA 4LFCF 1VHFA 3M1VB 4PWDA 2MGZA 1X5SA 5DG8A 1VQ8S 1T95A 3P5TL 1UWBA 1Y4ZB 2CQ0A 3DYAA 4IOAQ 3BQ2A 1XMOF 3PJWA 4O0IA 5F8HA 4DQSA 4HI2A 3G9CA 2OPSA 4PXBA 4N77A 3UCUP 4DF4A 2ADBA 5KG0A 1R8PA 4DV5F 3IWLA 4NLSA 4JV1A 3I5CA 2ZNZA 4LSNB 3MOJB 1G2EA 4MAKA 2QE5A 4XDDA 2AQ4A 1ZTTA 2DD8S 4H4OA 1FDAA 4WYWA 4DR3F 5KG5A 3VTIA 4DSLA 2DNPA 2FGCA 1YHQS 3LF0A 1IXKA 2BZ2A 5C24A 1QJHA 1VC6A 1FEEA 3PW5A 1PQEA 2LQJA 1U2RA 2VPYB 4ED5A 1T94A 3I0RB 4P2SA 1KFSA 2F40A 3SSSA 3CCZA 4ZP6A 1VQ9S 2FJWA 3CC4S 2MQPA 2IHR1 4KKOA 4F2SA 2GIQA 3CCUS 1V9OA 1LV5A 3GIJA 2ERRA 1S9EB 4OI4A 3HFKA 1E6VA 4K59A 3SSRA 3OTEA 4QR0A 2LLZA 2GW8A 2KXFA 4LF4F 3OTDA 1H7WA 5KG3A 3RRGA 2HFNA 5F41A 4FXDA 1Z1ZA 1TQLA 2A18A 2B4UA 2EPIA 2GA7A 1X4CA 5DO2A 4ZK7M 2GO8A 3KHLA 1VQNS 1KQFB 4LJMA 1VOMA 3V6JA 2O67A 3D54A 3BEGB 4QIVA 3IBWA 1RT6A 2ZVSA 1X0PA 2AF6A 2K8GA 2OLWA 2RQMA 2XG8A 4O4GA 4DV4F 4ELUA 2DMRA 4PWDB 4DL2A 2MGZB 4ZPWR 5DETA 1H7XA 3UW1A 3VWSA 1UWBB 2KM8C 3BN7A 5J2NA 5KG2A 2F9JA 2OMOA 4DQIA 4PPZA 2RU3A 2JIQA 4EYHB 2GQ2A 2A10A 4OX8A 3PRDA 4DSFA 2OPSB 3GSDA 3PIOQ 4UUXA 3FSIA 2C42A 1G7CB 2J8AA 3SQGA 2D41A 4TY8A 2WCXA 2B9WA 4MH8A 3PVXA 2F4VF 1UVNA 5FTLA 2YNFA 4E8UA 3D1QA 4OJHA 1TV6A 1SJRA 3G8TA 2CFXA 2J0WA 3CDWA 4H4OB 3V81A 1WHXA 3DDNA 4QIEA 2EW9A 4QBUA 4M1KA 1ZOTA 5K14B 2ZH2A 4DQRA 4ID8A 1NK0A 4WYLA 4O3NA 4MK9A 5KFLA 1HNZF 3PDNA 4AONB 2JFDA 3E51A 5C24B 4WKYA 2JA5A 3G8QA 2XMMA 4YR3A 1NK8A 1FRXA 3C6UA 1B64A 3H0GA 2XS2A 3CT9A 5B0DA 1IBKF 1U25A 1FDIA 3CDBA 2RE1A 1T3NA 3RBDA 4F2RA 1FRKA 4KKOB 1RT5A 5T5ID 4CO4A 3CO9A 4LT6A 4JI5F 1SJ1A 1E6VB 4DPOA 2P5VA 1CVJA 4DUZF 4IRCA 1S1TA 5AXNA 2CQGA 1NJWA 2Z0GA 2JL9A 1Q86T 1CLFA 2QLWA 3TIWA 2KYZA 1DTTA 1XNRF 2B63A 1Y5IA 5DJBA 2DNMA 2E5HA 2KI2A 5A8KA 1OQ6A 3KG0A 1RT6B 4O4GB 2QZ8A 4G1QA 2PGCA 1KQKA 4ES3A 3OHBA 3V4MA 1WG4A 2F8MA 1FD8A 3M4XA 5KFSA 2QA2A 3QGPA 2PICA 5J2NB 4A8FA 4C8YA 3N5BA 4KAIA 1Y5LB 3POTA 4K5SA 3FDSA 2DNGA 2HHSA 3M6VA 2CZVC 2KFNA 3SQGB 5A8WA 5L1KA 2HHQA 4TY8B 4DFKA 2YNFB 3QLHA 4F8RA 1Q8LA 1PQFA 2DH7A 2ZUGA 1TV6B 3CQZA 4Z37A 4DOZA 2KT2A 3V81B 3DRXA 1WHWA 5EX0A 3G6ES 1SKRA 2HIQA 5CZVA 2ATLA 4KJIA 3N79A 2W9BA 1ELOA 2ZH4A 2HRYA 1RKIA 4NYOA 1S1XA 2Y1IA 1I3QA 2FTRA 1GT8A 4BC7A 1NK5A 5D3GA 2IRUA 5F9NA 1W25A 4QW9A 4A8WA 3DXBA 2VKRA 2AP6A 3MM8A 2IM0A 1IKWA 1SIZA 3JSBA 4LIWA 1YRTA 1PT1A 2UUWA 3C6UB 2YH0A 3TA0A 4HT5A 3GFHA 4NLDA 1OSDA 5DG7A 1E5VA 4GO5X 1RT5B 2G0CA 3RZAA 2J9CA 4ED6A 5EWEA 2MQNA 4DQPA 3MTJA 2A68D 2RQCA 3SFGA 4NA3A 2HQIA 4I6WA 2LA4A 1S1TB 3N28A 5L8RC 4F3QA 5KTQA 3R5DA 1DTTB 3W2WA 3ZZZA 4F02A 1Y5IB 3DCAA 5A8KB 4ETXA 2DK2A 4RUAA 3TX8A 1DURA 4G1QB 4KDIA 4WIIA 1LWCA 3L7OA 1S1VA 4MTPA 1SQEA 4O3RA 5E3AA 3ZZTA 3T3FA 2XMKA 1WI6A 4KFBA 2MKKA 3POTB 3FJ2A 3AQPA 5DQIA 2E1RA 5AE1A 2PI4A 3HT3A 1QCSA 5A8WB 1R0AA 4CH0S 2ZHBA 4QU7A 2EK1A 1Q53A 3QLHB 3JTPA 5FD1A 2JLGA 4FS2A 4TNOA 2XLIA 4WE1A 3HU1A 2A3JA 1NHUA 2HHHF 3C6TA 2DHSA 2W9BB 3DRSA 3DLEA 3IS9A 1S1XB 3LAMA 1LK7A 2AX1A 3MHYA 3THTA 5D3GB 2YX1A 2R8IA 1JLBA 2GJ2A 2NXUA 4RUCA 4LQ3A 4ID5A 1ZAXA 1Z2LA 3H20A 3MM8B 4NX9A 2DNLA 1IKWB 1GNKA 3PX0A 1QM9A 4TQRA 1YBAA 3PW0A 1S72S 1VBXA 4JI3F 1FD2A 2KI8A 4A8MP 2VV5A 4YY3F 2PSZA 3H59A 1FRHA 4DR6F 3ZZYA 4WK3A 2AX0A 1FRLA 5CCMA 3AY0A 4F4WA 5KFFA 1JB0C 1ZM4A 2ZH5A 4X4TA 1HWLA 1WD6A 1IJFB 2GHWA 3QPIA 3T6JA 3WC0A 1NJXA 4YB5A 3J7Z5 1Y5NB 3H8YA 3U1MA 1TL5A 4A4JA 1KTVA 3W2WB 3BQ0A 3MM5A 1XBWA 1U1RA 3TA1A 3RB6A 3KHRA 2CQPA 3OVAA 2FVQA 3LWLA 3T1YF 1LWCB 4K4ZA 1S1VB 4C8LA 2IC3A 2XS7A 2UVUA 4USIA 2ACYA 1YLEA 3MAQA 1VJWA 1HW9A 2KYXA 5LJ5Y 4KFBB 3PHEA 3NS6A 4ZP8A 4QU6A 3TVKA 4TY9A 3I31A 2NSCA 3F44A 4OI2A 1RI7A 1XERA 4Y28C 4DG1A 3NS5A 5H9FJ 3K5PA 3O44A 3CJ0A 2DRAA 3ZC4A 2E9TA 3RR7A 2IYIA 2M2BA 4WE1B 3T19A 1FXDA 1TK5A 4IO1A 2ZFHA 3C6TB 4D7ZB 2KG1A 3BS9A 2CQ3A 3DLEB 2RKIA 3DRSB 2IRYA 3IS9B 4OHXA 4Y3CA 2FDNA 5KG4A 4Q44A 5L1JA 2XY6A 2UVVA 1FESA 1JLBB 1GXLA 3M9NB 4J9QA 4ID5B 4IDKA 1LFPA 2BA9A 2CPZA 3FEXB 4YMEA 2EKYA 4WXWA 4OX9F 1IW7D 2PT0A 4CT8A 5FTJA 2W7PA 2DGVA 3MR6A 1C1BA 3LGNA 2G1DA 2DNZA 4OLOA 2JEIA 4L6V3 4L72B 5GAHI 1LKZA 1XNQF 5DDRC 3FSYA 5CQGA 3CD5A 3OXLA 1S1UA 2JZ5A 4ZDNA 2I2YA 4CS0A 2VQEF 2CW0D 4NLVA 4DL3A 5DLGA 3QWUA 4XO0A 4C8ZA 2GAEA 4MFBA 4RW9A 2MSTA 2C3YA 1C2PA 5CYQA 2CJ9A 4KRWA 3ZZRA 5E5NA 1YRUA 5BYRA 2ASYA 2LA6A 1HNVA 2DGOA 4EZ9A 3BGRA 4NXNF 4K4XA 2B6AA 4QYZJ 1RDRA 4MKAA 3MM5B 2XHWA 3HHEA 3HHKA 3A8EA 1FJCA 2Z4PA 2HGMA 4TLQA 4F26A 1ZM9A 4K5RA 1YJUA 1YJVA 4I56A 4EWTA 2IC3B 3LANA 3J80Y 4DV3F 2N82B 1K1QA 3BDEA 3B82A 3NMRA 1UKUA 3ZZUA 1SJQA 4CO5A 4ED8A 1P1TA 2XLKA 4HHJA 2B9XA 4A8KA 5KG7A 1AW8B 2CPXA 1J5OA 1FCAA 3R5AA 4DG1B 3DOKA 1Y9OA 3J7A1 4N5SA 1VS3A 4K4WA 1CZ5A 2U1AA 4BBYA 2ZH8A 4CIOA 3TR5A 2I9SA 3T9ZA 2VFSA 2Y1RI 4URSA 4N56A 4ZHRA 2RKIB 4B3TF 4DMZA 2KDOA 3F41A 2O5DA 1QE1A 1A9NB 4KODA 3TVYA 1L3KA 1C1BB 4ZP7A 1U8SA 3K2YA 3BF4A 4TU7A 4B9VA 2KZMA 4JI7F 3D5MA 2HAIA 4PQAA 4B17A 3NMAA 2CJQA 1C0UA 5L9XA 1C4CA 1S1UB 5EHHA 3PR4A 2PMHA 4HH1A 1H5NA 2EBEA 3NGKA 2E5LF 2CPIA 2KVIA 1R27A 1DAXA 2VH7A 2YKMA 3H5UA 4LQ9A 4PG5A 4RW9B 3UQSA 3CCES 1AFJA 3SCIE 1FNMA 5CYQB 2DVIA 1HI1A 2CKWA 3I82A 3T9NA 4ECWA 3PW7A 4Q7AA 1HNVB 4I6YA 3HDSA 1YNND 3BGRB 1YIJS 2B6AB 2LQBA 1LFWA 2QIFA 1B7FA 3EYZA 5BYSA 3M05A 4IYQA 5L1LA 2DPIA 1H98A 2RQ4A 3T5JA 3FRZA 2R7VA 3M2RA 4PUOA 4HTIA 1DARA 2GC8A 3BR9A 4JV2A 2HNDA 3KG4A 4CO3A 1H38A 2C2EA 3EGWB 4B3OA 1OWXA 3DLJA 2PI8A 2E66A 2F7VA 4XIUA 2C2RA 1X4HA 2BE2A 3O5TB 4RU9A 2OSQA 2DNKA 1J5OB 2HMIB 3CZBA 3DOKB 3CJ2A 4JI6F 2CPYA 2ABYA 4HI1A 3AQOA 2M7SA 4ZPTR 4WFBQ 3MZIA 3H5XA 2HS3A 3IGVA 1YJWS 3S7RA 3ICLA 2FLLA 4O3PA 4DF8A 4ZHRB 2MB0B 4IRDA 1RTHA 2IM3A 2J5AA 3S1TA 2IM1A 3IXQA 2A2DA 1QE1B 2WBMA 4B9NA 3NRBA 2DR5A 4CCHA 2JA6A 4QZVB 3O1LA 1JNRB 1R8CA 2YNGB 4J9OA 1NK6A 2MDAA 3FQLA 3FQKA 1TWAA 3C46A 1VQLS 4K4VA 6FD1A 3BB5A 1N5YA 4ZVFA 3JB9k 3LW5C 2G9OA 1C0UB 4ZVHA 1U1MA 3KWMA 3P49B 3BR8A 3T5LA 2DRBA 3V5RA 5KT6A 2IMOA 3SSQA 3VAKA 2GJIA 2ZBCA 4OJ1A 3ML1A 3ZZ0A 2DGXA 1R27B 3PEJA 4FZVA 3GTLA 2YKMB 3UCZP 1U47A 2GQCA 4FPRA 1R8HA 1N36F 1TR0A 2VODA 3TA2A 1NO8A 2OMLA 3HXMA 4JV5F 1CR5A 4JOUA 2YX7A 3PACA 4D3GA 2VPXA 4HH0A 2HVHA 2B4PA 1PYQA 1HBOA 4RW7A 4W90B 3T5KA 1R8AA 2MZRA 2M8HA 5KFTA 2FLOA 2ZHAA 2N7YA 2U2FA 4ELVA 4IRKA 4X4SA 2G4BA 3M2RB 1A6LA 2PMZD 3MM6A 2IM2A 2V8DA 4R25A 2WB1A 2YU9A 2L48A 2ZKUA 3OXGA 3OFEA 2HNDB 4NLWA 2C3PA 4MMOA 3KLHA 2UVRA 1YSJA 4B3OB 5EWFA 5DYGA 2EFVA 3VQTA 4DWIA 4K0KF 1LW2A 3BGLA 3PNIA 3TM7B 5J1PA 2NR0A 4TLRA 2V45A 2ASDA 4ITSA 2VBWA 2OTJS 2JSXA 1T02A 4UQGA 4LFAF 4CQ1A 4KO0B 2DHAA 2PO4A 1JNZB 2KH9A 1WHVA 4OJ3A 3N6NA 3Q0AA 1KN6A 4ELTA 2PMZA 4CO2A 1MWYA 5M2PA 3TANA 1ZETA 1RTHB 3DXSX 3US5A 3CCWA 4NMLA 1KHVA 3K8VA 4TYBA 1JJ2R 1HBMA 1IQTA 2HS4A 4LVNP 1N5YB 4ZVGA 4CO1A 2VPZA 1JJ4A 2IBOA 1KHWA 2RRAA 3D0IE 2JEFA 2Z2MA 1RT7A 1V3SA 3KLGB 1X5PA 2DBBA 4QWBA 5KOWA 2MQQA 5J2PA 1CPZA 2GMJA 2ILZA 4K4UA 4E0DA 5AXKA 2KTQA 1Y0HA 4C0OC 2CQ2A 1CSJA 5KFGA 4AXIA 5GAEU 3J7YU 4NLTA 2CPJA 4O3QA 2IVFB 1XN9A 2HGLA 3ISND 4Q2LA 2VPXB 3C66A 3M8QA 1HBOB 2K7KA 2OPPA 4RW7B 4I69A 1ZPVA 4PXEA 5F9LA 1RT4A 4QWDA 2UVWA 4Q8EA 2M4MA 4IOCQ 4DR1F 4I6AA 1O8BA 3IA0A 4ECUA 1HYSA