4NOHA

1.5 angstrom crystal structure of putative lipoprotein from bacillus anthracis.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
ATGIVMYGDETGVQQTMDQYKDKIESQNKFEAKLGTVNEKKVLIMNKTTAEKMVKENMLKKVVKEDVEPIKALPAISDEAGIVFAKEEQKDVVIDGKKMKYEGNVVIGDARKYTDMYAVVSDAEYAKISEPVKTIGLASFKENPKEKIFPDIKRGSKVEEAHMVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Lipoprotein, putative
publication title 1.5 Angstrom Crystal Structure of Putative Lipoprotein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17294 Lipoprotein_22 Uncharacterised lipoprotein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.60 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4nohA02
3.30.70.3060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nohA01
4NOHA
chains in the Genus database with same CATH superfamily
4LIRA 4IRCA 4XPEA 3QGIA 4W98A 2CQ0A 1RDRA 4ETXA 3PO5A 4A8FA 2EFOA 5L1LA 3DLKB 2DT9A 3OFEA 4QQBA 3EVWA 3BN4A 3ADAC 3ZFVA 2E1CA 2GVZA 4E2FB 5IV3A 3I0SA 1M5VC 1BQNB 3TJ8A 3D4JA 2FZGB 1Y5NB 1ROFA 2B56A 1WCMA 3TYTA 4J9KA 1L3UA 3H40A 3UD3P 4K4YA 2X7IA 3DOLA 1HQ2A 1NRKA 3O1LA 2R2TA 1WC4A 4CYUA 3EZ5A 3GG0A 1GFWB 3O8WA 2DNRA 2OPQB 2BQRA 2OGUA 4P52A 1LWCB 3CDBA 1VBZA 3M6UA 1UVLA 3BR9A 2JNJA 1RAJA 2CVEA 4EUVA 2HS0A 2GZOA 1LWEA 2AJ1A 2O5DA 4N41A 4O44A 2LEPA 1U1MA 4OI3A 3I6PA 4CZCA 3ONQA 3U1LA 1B7YB 3H7HB 1IUJA 4ECYA 1G1XA 3D7SB 2YNHB 4MK7A 2NSCA 2DGTA 5J1EB 3BBCA 4DR7F 3BPDA 3P96A 4OLPA 3SFUA 2DK2A 1PIEA 3OR1B 3J81U 2HMIB 1NZAA 2PSZA 2X1GA 2H65B 2M88A 5HANA 3KLFA 4WK1A 3JSMB 2IBOA 2KT5A 3J81Y 3FEXB 2KHCA 1PQHA 1Q7LB 3K2YA 1B7FA 2WW4A 2QV6A 2GAEA 3QT6A 2AZ3A 3H5SA 1SMYD 2N4DA 2IM1A 2HRTA 1XEZA 5J1NA 4DSJA 1FA0A 3PJ9A 4AYBD 4I6YA 2EKNA 2PICA 2GVZB 4O3NA 4DPTA 5BJRA 4LF8F 1U1KA 2Z57B 2XMJA 4UZCA 3O5AA 3W62A 1Y3KA 3BSNA 2IMOA 5C2GA 1WACA 3DOLB 3PXGa 2NXEA 3TVKA 3OR2B 2CQHA 2EC0A 5ADZA 2IJFA 3GQCA 1WNEA 3L7PA 1X4GA 2BKOA 1EAYC 1XIQA 3ICLA 2M8DB 5B0DA 1LWEB 4TXSA 4FYXB 5AE3A 1IBMF 4OV6A 4PG8A 3K5MA 3OHBA 2DNMA 3P3DA 3HF5A 4FNHA 3E8OA 4KDIA 4OHZA 4X4TA 4M5DA 2RKIB 4HYKA 4QU6A 1IKWB 4QIFA 2Y0SA 4F2SA 2ZDPA 3LF0A 3MEEA 4O3RA 1BQMA 5GAGU 1RJJA 3W64A 2PI8A 2HQCA 5ETSA 2XYGB 1YNND 3PIOQ 3LW5C 1N5TA 3QIPA 2K7JA 3GIRA 4LF4J 2AZ1A 3EWGA 1SIZA 4OZLA 2D9PA 2FZKB 2A6ED 1NU4A 1R43A 4FYYB 4OZJA 5KFMA 2RQCA 3T1AA 1FXDA 3FRYA 3VZHA 2M52A 3ENQA 1GTEA 3VVTA 4PPDA 2FJXA 4MAKA 1D0EA 5K5MA 4DSEA 2G13A 1QM9A 1QCSA 4PQAA 2D3O1 4JP7A 1N56A 1NKEA 2PFFB 3OL6A 4DU8A 3F0NA 2VG7B 1S49A 2N7YA 3W2WA 5JXSA 1PBAA 5AXMA 5A6PA 3G8TA 3Q8QB 2HZAA 1R7IA 2DGSA 2MQOA 2PC6A 2CJAA 3E51A 2Z0GA 2IHR1 1R31A 4RX6A 4RNNA 3QZ7A 4B3OA 1SUQA 1S0MA 4ZP8A 4K5RA 2G5DA 1VQ6S 3VQSA 3BEGB 2R9LA 2UUWA 4DDFA 3ZZOA 3HHLD 5IZHA 4NRUA 3MM6A 4DS5A 4MFBA 2GHVC 2J8AA 2BRLA 1YKWA 1WOPA 5DYIA 2BKNA 2WB4A 1UWAA 4M5MA 4N5SA 3R3TA 4DN0A 5IWAJ 3KJQB 2F9JA 5FDLA 1HD1A 4BDPA 3W7BA 4O3OA 3H2LA 4ZCLA 1YITS 5T7LA 3FBEA 3QIPB 5LMNJ 5D77A 2R3VA 1QAYA 2XY6A 4C97A 4FF4A 2RT3A 2A2DA 2RUSA 2V67A 3B4MA 1N5QA 4M5LA 1C0UA 4H54A 2NPIA 3BSOA 3IBWA 4RL1A 5SUHA 1S4FA 3ETMA 1VQLS 1IR1A 1FVQA 1S4EA 3GYGA 1LK5A 4ZPAA 1FT8A 4NLSA 3LPEA 1S7IA 4KHPJ 3HU2A 2DCLA 2DHXA 1YRXA 1YGYA 1QY7A 1ZAXA 1IKXB 4KJIA 3IN5A 1XMBA 2FY1A 1JLBA 1U6BA 4DFPA 1TV6B 1G3OA 4DHVA 1OMSA 5B0FA 1LQ9A 3KLGB 2KDOA 4CLKA 3QRQA 3W2WB 1UWBA 3HZGA 2YNIA 2DEIA 3CD6S 1NSKL 3MMAB 4USKA 3DRXA 1GT8A 2BYCA 2AP6A 3WQPA 2JLEA 1VIOA 4B3OB 3QRPA 5ETKA 2HZVA 4ZVGA 1SUQB 1TUGB 3CMES 1F9HA 1HI8A 4OJGA 4F36A 2B63A 4WXWA 4ID8A 1MROB 2FJAB 1NUEA 1F0XA 1WHWA 2XC9A 5DDPC 4B3TF 4ZVRB 3IRXA 4MFBB 3V6HA 4FBTA 4L74A 5ETVA 3HVRA 1X0PA 3M8SA 1HI0P 4UY8T 3KK2A 3IR5B 4G65A 5FDLB 3GR0A 4KGKA 3G6ES 4DUZF 1WOSA 1TFWA 2DNNA 2VBYA 3R9LA 3RAQA 4OYIA 2HGNA 3OXLA 1T95A 3HD2A 1VQYA 1NJIT 4DV6J 1GMWD 2PEBA 2MQMA 4QPTA 2Z56B 5HI7A 2WAQA 3FSXA 4F7VA 4QYZK 2R42A 1C0UB 3LP2A 5KFPA 5KFHA 1S1XA 1TELA 2YPYA 2HNYA 3QBCA 4PRFA 3I82A 1QVFR 4OI6A 4MKAA 3HHEA 4U67Q 3CO9A 4C3MA 2A6HD 5EX3A 3FSIA 3AY0A 1RWNB 1U25A 4YDXA 1HNWJ 4B9VA 1EKSA 4H4OB 2YNIB 1N54B 1JJ4A 4X65F 2ZOMA 1UL3A 3CEDA 1M1KT 2FVCA 1LW2B 4AL5A 1CJVB 1Y0HA 4Y3CA 3SEOA 4CWBA 3DOMB 2QLWA 2QT7A 4RWWA 2NYAA 1WTFA 1UJ6A 2MKKA 4YMEA 1Y9OA 3KJVB 1DQAA 1M5PC 3GU0A 4Q7AA 3ZZUA 2M5YA 5JUMA 4JI4J 1UFLA 2WBRA 3D6MB 2Y1JA 1ZH5A 5HROB 4NEZA 3PO4A 4FXDA 2V4JA 1DLOA 4DL0C 4RU9A 2JFKA 3D54A 1JLGA 4CCHA 3GTLA 3LGMA 1HA1A 3DRPB 3UFCX 2HAIA 2E1PA 2ZHOA 4NPOA 3KG0A 1WF1A 1RQ0A 1SB6A 4ECUA 4PXEA 1WI8A 2KFNA 3DHXA 4DZ6A 3ZZPA 1CQMA 2I38A 4ZIWA 1X5OA 3I4HX 1RKIA 2J0QD 4BWJA 2DNOA 3RW7A 1XNQJ 2DHSA 1FE4A 1M5KC 4O3QA 3F41A 2JIMA 3NNHA 3C66A 3RAXA 1N88A 1N6QA 2Y1IA 1T7PA 5F8GA 3PY8A 3F73A 1M1HA 1SQFA 2I9SA 2VC0A 3V5RA 3FKBA 4RKUC 1DQ8A 3MFHA 3K59A 4LFAJ 3L7OA 4DV1J 2W2QP 4LF6J 3LP2B 4X4NA 1RT2A 2XGQA 1RHMB 4KH1B 1S1XB 3CJ4A 3CTRA 5LSOA 4EZ6A 2HNYB 2EK1A 3BO3A 3QAEA 3PNIA 4PZVA 5A8WA 1V5VA 4CLYA 4U8VA 3LUYA 2DKOB 2FY8A 1NLKL 1S48A 1G6BA 4WP8A 4KO0B 4KY3A 4NASA 3GV7B 1ZTTA 3CDEA 2FHJD 2GAGC 3D5MA 3TO8A 4OYOA 3VGVA 2PO4A 3PFEA 4CO1A 1NDKA 3AOBA 2Y1LB 3GFXA 2YKMB 2HHVA 2V34A 3BSAA 1U8WA 4BBYA 1WELA 8AT1B 4A8KA 4Y2CA 4LVOP 2W4PA 3I5BA 4KIAA 3NLCA 3WIVA 4Y0FA 1WC1A 3VGSA 4DV3J 1JLGB 3KG1A 2OTJS 1UEKA 1APSA 2YKOA 5D0EA 4C8YA 1WC6A 5A76A 3Q0AA 3GILA 3IXQA 3RB0A 2F9DA 1DTTA 3M8RA 2ZD1A 3UN5A 1FFGB 1YIJS 2NZCA 4HI1A 4NLGA 1VQ8S 2N3OA 1DZ5A 4TYBA 5L9XA 4C98A 1RAHB 3VAHA 1XC9A 1NKCA 1PSDA 3MAAA 4RBTA 3OHAA 2UUCF 4OZ1A 1RU2A 2DGQA 2CQ2A 2RU3A 4LF1A 2LYVA 1FERA 1GXUA 3R5CA 2CQ4A 1R6VA 1SL1A 2JFDA 3GMGA 2CG8A 3NS7B 1NEEA 2UXBF 1W26A 2FTRA 3IG1A 2H51B 1N4LA 1FFWB 4CTAB 3IS9A 4EYIB 4P73A 3G2XA 2XEXA 3N6MA 3MTKA 4RR5A 5GADI 3O2IA 3GSDA 4LQ9A 2GIFA 2R93A 1H73A 1H6KX 2NXJA 2MZRA 1BD6A 3KG4A 1XN9A 2RQ4A 2HBYB 2E7VA 3HFZB 1JJHA 2CPEA 3HX9A 4G6VB 4GKKJ 1RWOB 3NCPA 4X4VA 3MECA 2VG6B 3GTPA 1O6XA 5FIIA 3M32A 5I3QA 4YB5A 2OD6A 1WC3A 4F50A 1T3NA 4RW9A 4QIVA 1ELOA 5A8RB 4RNHA 5E3AA 3P5BP 3BZQA 1S9EA 1J5EJ 1XTZA 1E5VA 1S9GB 1SL0A 2MKYA 5HJXA 4DG1A 1LW0A 2B4PA 4AONB 1JLCA 3PKYA 2PI4A 2GX8A 3FRZA 3M2UA 2E5HA 4J91A 1IJFB 2FJWA 2PN6A 1N8RT 1C1BB 2JWNA 1FKOA 2WVBA 4TU9A 4CM0A 1NDPA 1HNZJ 2BV3A 1FDBA 5DLGA 1FX4A 2WBMA 2WVDA 1IR0A 4DOZA 3SIPB 2WZ1A 2OO4A 4MMOA 1SBRA 2HG4A 1VC0A 3TVYA 3QMQA 3HHKA 3HVWA 1FKAF 2BBEA 2V63A 3KLVA 4JUZA 2MQQA 2E66A 1RHUB 3ENAA 1N5YB 2XLJA 2MKHA 1N32J 4KPCA 3I31A 3GIIA 3X2PA 3SSSA 3FDSA 1D9AA 1UVNA 1H0HA 4HEA9 4QWDA 3FVYA 4X4PA 2YX7A 3MXHP 2NUUG 4IDKB 3X1LB 1VQ4S 1HBOB 2AGOA 2W9CB 1RT4B 3OTOJ 4KGXB 5B0AA 1YJTA 4WF9Q 2WONA 2W2NP 2F4VJ 1WC5A 3DM2A 1KQGA 6AT1B 3HSDA 3W60A 1NK5A 1LOUA 1LXJA 3ML1A 2N82B 3X2LA 1VI7A 5A2QU 2P5VA 3VF0B 1R9TA 4C0BA 1RABB 3IAS9 4DG1B 1S59A 3FQLA 4OYPA 1SKWA 4ELUA 4J9PA 3DLEA 2OEMA 1RAEB 5CYMA 4F4AA 4EYHB 2RDIA 5A2QY 3V6DA 3RYLA 2ADCA 3HI9A 2N3LA 4B9SA 2WCXA 1FKOB 2FLNA 5DQIA 1EX8A 4C8MA 2J6UA 2HRUA 1R7RA 2RUGA 1Q5VA 2WOMA 4OX6A 2YKPA 1PYUB 2CPIA 5DM6Q 3P49B 2L9NA 2VD3A 5KFFA 4UZBA 5H9EJ 4WKRA 2HURA 5KFKA 3ISNC 1HBUA 2PMHA 1HNIB 4LT6A 4JV5J 3Q89A 3H2VE 5CZVA 5KG4A 1H0HB 2DNHA 2BXJA 3NRBA 1Q7YT 1L3VA 4FPIA 5HBMA 3ZTQA 4GO5X 3SXLA 2BM1A 1DJ0A 2DHAA 1KEKA 4IG3A 1H7XA 3BGLA 5D78A 1K73T 2K3IA 4YOEA 2OSRA 3DLJA 4FYWB 2BJEA 5SZTA 5DO2A 2Y8WA 3MURP 4ZJQA 4HT7A 2HQ3A 4QPXA 4DSIA 2LDYA 3OFGA 3BO4A 4J9OA 3TZZA 1M5HA 2PNWA 4NI2B 4PXBA 2GA7A 2MQPA 3ILOA 5T5MD 1T9YA 2CXEA 1Z2LA 1D3WA 1Y3JA 2G0JA 4LF2A 3KHLA 2F8HA 2AJ0A 2JEIA 2VDHA 2F65A 3M2RA 3UR0A 1T05B 2V4RA 3I56S 5CYMB 6FDRA 4X4OA 1O8BA 2HSEB 2DD8S 4NEYA 2RSQA 1PYSB 3NGUA 1RTJB 2OSQA 2IM3A 1N0VC 2DBBA 5IT0A 1RLDA 3H20A 3JQMA 5I4MA 4N7TA 4NLTA 1MWYA 2W01A 2AD9A 3N79A 1H2VZ 2JH3A 1JLFA 5ETLA 1WC2A 2ZUGA 1ZA2B 4XIUA 1EP4B 3MCMA 1L5UA 3AD9C 2XMUA 1PC5A 3ETOA 3OVSA 2V2VA 1YX2A 3C2PA 1CQNA 1KHWA 4JJOA 4LF4F 4Z7YA 2B43A 5FD1A 2JA7A 1T9VA 2E1RA 1QDNA 2W2OP 4PEOA 2KZMA 1AT1B 1T03A 2FHOB 2UVWA 4LF9J 4RV0A 4ELTA 4Y6IA 2VQFJ 2V4QA 4I7FB 1REVA 2XS7A 3T6JA 1VQPS 5KFGA 4U9RA 2VZ9A 3QO9B 2BE5D 2E5IA 2GHPA 2DITA 5M2UA 2MMYA 4IH5A 4HHJA 1U47A 1KQFB 3RW6A 1DFDA 3ZZYA 3HULA 1SCJB 1RTIB 3H0GA 3W66A 3J7AN 1Q81T 2GO8A 3BGRA 3K57A 2C2OB 1U6FA 1HFEL 1TKXA 2QA4G 3V2UC 1KOOA 4KODA 3GWCA 3M1VB 3M2RB 2ABYA 2SXLA 1PCAA 2C28A 1JLQA 1S79A 1FNXH 1NSAA 2WVEA 5CCLA 4MKBA 1U26A 2HGMA 4TQSA 4LSNB 1TP7A 1XBWA 1RHRB 5DZ7A 4M95A 4PKDB 3S1TA 3FSYA 4NLQA 4KHRA 1Y5LB 1OSDA 1BMQB 1FTCA 4WK3A 3J7YI 1X4BA 4RZRA 1MN7A 2XHCA 4Z7CA 1X8DA 4P6QA 1XR7A 1PJ7A 2CQBA 3US5A 4PQUB 4GVLA 2KRBA 2IA6A 4K5SA 1VQNS 5FTJA 2YQ3A 3BGOP 2C3PA 2Y0BB 5HATA 3UCUP 2F3JA 3K5LA 4U95A 3FUYA 4NOHA 1PILA 2LQJA 2JX2A 5LMNF 2VHGA 4JP8A 1CEZA 3RU0A 3LPYA 1N0UA 2H48B 1NDLA 1FCAA 3LGNA 1SPBP 4DLGA 1UEVA 2FLLA 1DMSA 2C45A 2C1EB 2FIUA 2BW2A 2WSCC 3OSPA 3C19A 4ECZA 1ZOTA 1ZBTA 4LJMA 1R6YA 3D66A 2IIHA 1WORA 4KHPF 1H3DA 4JI0J 1C4AA 1EQMA 1HWKA 3N5BA 2A1BA 1HMVB 1J27A 5GAEU 4NL5A 3DRSA 1FXLA 2BDPA 2BW7A 3BGRB 1YSJA 4K8RA 1G2EA 2L08A 4DX7A 4G1QB 5ETTA 5D3GB 4QZVB 4LF5F 2D3OR 2H5IB 4NZ7A 2D3ZA 2DNPA 1ZC1A 1JLQB 3MUVP 1XQIA 4NE9C 2DPIA 4OYZA 2RRNA 4CP5A 3QNWB 3U7JA 4M1KA 1RT3A 3QJJA 1M5OC 5DM7Q 2IDEA 3Q8SB 4QYZJ 2CNLB 1UTAA 3MEDB 4O4GA 4U96A 4KB7A 4EBCA 4K59A 1PG5B 3OTCA 2GIQA 2BQ3A 2HWIA 2VF3A 4F4WA 4XDCA 5L39A 1Y7PA 1SJQA 2UUTA 1IR2A 1PT1A 3MMCB 1I94F 1CZ4A 4XK8C 1FKPB 4LF7J 1YDLA 3WHIA 2GCFA 2BEFA 4M5IA 3ZZ0A 4DMRA 4QWEA 3CCWA 3M8PB 3NS5A 3MMJA 3PVXA 3MUTP 2RS2A 2EEYA 4AVRA 3TZXA 2XMAA 4NXNF 1TTHB 3I9V9 1AYEA 1QE1A 2M3DA 2V5HG 1DURA 4K0KF 4PWDA 1C2PA 1UCNA 2LEAA 3QT7A 4ID5A 2MZ1A 1U0HA 4DFJA 3T5LA 2ROPA 1S1VB 5ETPA 3GIKA 1L8FA 3G6XA 2CQDA 1S6PA 4Y2MA 2VICA 3PR4A 3C6TB 2U1AA 1HKAA 5FTMA 3DRSB 1HNWF 4CH7A 5HL7Q 3K0JA 3OXFA 4XTTA 3JTOA 1L3SA 1SH3A 4B08A 1N52B 1KOHA 2GW8A 4Q8EA 1IJEB 2ZNZA 3GTQA 4NLRA 2M8HA 2M70A 5C5JA 3QWPA 2BMBA 2Z58B 3CC4S 1Q16A 1KQSR 2KXFA 2CPXA 5JVGQ 5KFVA 2GC8A 3C15B 4JI4F 3ENVA 3NAHA 3TUIC 2W2PP 2DHHA 3CVKA 4O4GB 4ZLLA 3QJPA 4A48A 2VPWA 1U0SA 5FTKA 3SQGA 4Q0BA 1RACB 1K9MT 4CS0A 4QIWD 2HIQA 4PABA 4WE1A 4GVBA 3KOAA 3FBFA 2LA4A 2FJDB 1U1QA 2XCAA 2RDDA 4CLTA 3NWRA 2FPHX 2HHPA 2PDAA 2PMZD 2AU0A 1AUDA 4ENGA 1XNQF 4OX8A 1TWHA 2MGZA 3CCZA 4J7CA 1VJQA 4CO4A 2AW0A 2CKWA 2CG4A 3R27A 3DLHA 4DX6A 2Z8QA 2JC1A 1J2VA 2H4YB 2DPJA 4DV1F 4B3MJ 4I67A 4RU2A 2R4FA 4LF6F 5E41A 1QE1B 1DTQB 2Z2ZA 2IMWP 4KSEB 1CJKA 3HSJA 2V0NA 1YBUA 3PG9A 4DR1J 5D4NA 2NYIA 1U2RA 4ID5B 1FDOA 1HBMA 5DETA 3H4DA 3WBZA 1VRUA 1S6PB 4DPXA 5T14A 4C8KA 4N8OA 2Z2YB 1Q79A 4K4ZA 1GNKA 4I69A 4MKYA 2CYYA 4USHA 1PJ5A 4YHHJ 2RD5C 2IVYA 4WCEQ 1B0PA 4FYDA 1HBNB 5HO4A 2UXDJ 5LT5A 1Q16B 1XJWB 3RUBL 2HKEA 4WIIA 5KG3A 4OZ3A 4TVAB 3KLIB 4IO9Q 2X1FA 1TL1B 4A46A 3G82A 4DL3A 1LWFB 5C42B 2F5GA 2B51A 4ES3A 2KG1A 2MHEA 1K83A 2ZHAA 1X5PA 2G2ZA 4PG6A 3TEGA 3WC0A 4NA2A 1SKSA 3PIPQ 5HSPA 4ENOA 1TZ0A 1N5VA 2CJXB 1VMBA 4MYTA 3MCNA 1RLCL 2KHDA 2BABA 4HH1A 2B7BB 1IKYA 3QFHA 4UW2A 4DV5F 2H5JB 1VISA 1E6VB 3T3FA 3M9MB 3SMZA 1GK8A 9RUBA 3POTB 3FMWA 5THWA 5K8PA 4LR9A 2DCUB 3PKMA 1HWJA 1RYRA 4V19J 3BH7B 1SIWA 4JB8B 3PFOA 4DSKA 1KS2A 3T19A 3VQTA 3PW5A 4WFBQ 2QLJB 3FQKA 3ISZA 3HT0A 5M2RA 2ATLA 4FXWA 1GMVA 1JKHA 2ACMA 2MKSA 2XSFA 1A0OB 1RADB 2FC9A 1S7HA 4DBQA 4QCLA 4RW7A 2QA4S 2LXUA 2FHKA 3CJTA 1ULRA 3V4MA 3M8QA 5F3TA 4G1IA 2FGOA 2GMJA 2G9OA 1JNRB 2E44A 2KL8A 2DISA 4JI6F 2XG8A 4FXVA 4B9TA 4KE5A 2HHSA 3JSRA 2E7ZA 3HKZA 4WJBA 4J9NA 4BS2A 4R8UA 2QL7B 2OUGA 3G82B 2ZJPQ 4GKKF 2O67A 2HBZB 4WXOA 2YUJA 2ZH1A 4ZVEA 4WBFA 3G8QA 4OYMA 1KWMA 3MFIA 4A8XA 4QR2A 4RNFA 4DV7J 3BV8A 4FBUA 2FJEB 1J5EF 1F5AA 2ZH2A 2CJQA 3IR6A 3BYRA 2CADA 3GJQB 4KFBA 1IKYB 2DNGA 1TWFA 1HPZA 4ZITA 2ZH5A 2UVVA 4P2SA 1OIAA 3OVBA 4H4MB 2V8PA 1VC5A 2DR9A 1AROP 4ED3A 5HVGA 2WSEC 4AL7A 4ECSA 1NZ8A 1S1TB 3VVUA 4DCOB 1S0OA 3M9OB 3M8YA 1HNZF 1WLFA 1RBLA 3TUZC 3CB4A 3OTEA 1UMJA 3SFGA 3SDEB 2YVSA 1KQKA 1SXLA 2YKAA 5KFRA 2RHSB 2OH2A 1JKHB 3PHEA 2MLYA 1LFWA 1VK8A 2YNFB 4RJVA 3L7UA 4LFCJ 2XY7A 4WZQA 5LL6d 2A2CA 3SUMA 1KBRA 2UVUA 4ED8A 2H9ZA 2QIFA 2QG9B 3RBDA 2H4WB 2XLIA 1N32F 4G3IA 3M8QB 1TL7A 2IRYA 2DH8A 4QIGA 5AXNA 1V5IB 2X3GA 3CCVS 2HBRB 1ZYQA 1X7VA 1P8GA 2XYPB 1CC7A 4C0HA 2ZFHA 4RPFA 3MAQA 4ILMA 3THVA 2HHTA 2VFSA 1GTHA 1A7GE 2IJRA 1QD1A 4Q43A 1S6QA 4DF4A 2AKWB 3NGTA 3EZUA 1Q8IA 2Z30B 3DRRA 3CPWR 1PQEA 3FZBA 2CQ1A 5I42B 1ZPVA 1QVGR 3GYXB 2R7ZA 1RA6A 3JSYA 4R5PB 1NSQA 4ZPDA 3V81A 2A68D 1KN6A 2MTLA 2UV8G 3LP0A 4GA6A 1SC3B 4Q5VA 2CAJA 1HPZB 4NZ0A 1QSYA 2YWHA 2LECA 2M9KA 1RI7A 5HLFA 2R8KA 4DX5A 3A3OB 1MN9A 5KG5A 2DR6A 4KYZA 2DNZA 5CAAA 4FVCA 4P74A 2WB1A 1R0AA 2VOOA 4ZA1A 4PAAA 3NG8A 4ZVHA 1KKHA 3DLGB 3DOKA 2ASDA 2ZBIA 1W25A 3CCMS 3VGTA 5K8NA 3QFWA 4OHXA 1UP1A 1XNRJ 2FJVA 4OX9J 3EVOA 3QGHA 4K50A 3IC1A 4TY8A 1PAUB 2VPXB 5U47A 4LRBA 3M2VB 4JV5F 4L6V3 1TL7B 3BREA 5GAGI 2MZTA 1TFYA 3PR5B 4P2XA 4N47A 1IW7D 3FJ2A 3PW0A 1X9SA 2IJNA 1FK9B 4TNOA 2R7QA 3DMJA 4TU7A 4NLUA 2E9RX 1CPZA 3EE3A 3M6WA 1IBCB 1FRHA 2QLFB 2VPZB 1IBKJ 3CJ3A 2VDIA 1S6QB 4IFVA 1SJFA 1WF0A 3F56A 4ES1A 2H54B 2KXHA 4HR2A 1QLNA 3UR3C 4ZPWR 5IFMA 5GMKa 2H3EB 1Y5IA 3ET6A 3HFKA 4CO0A 2I6WA 1C1CA 4ZS6A 4USMA 2OPSA 3V81B 3LP0B 5DS7A 3K7RA 2GFFA 1VQSA 3MEKA 1Q5YA 2W24A 3KKFA 8RUCA 2VONA 5FTNA 3UO0A 5HMZA 4R0JA 3AB4B 1XMQJ 3E01A 5HLFB 1M5SA 3MM8A 5A8KA 3QWZA 4FYVB 2HHHJ 4OJ3A 3RR8A 1H2UX 5IT9U 2QA2A 2XNRA 1R0AB 2BE2A 2ASLA 3LQVA 4LIWA 3OLAA 4ZPTR 4OFZA 4JI7J 4HLBA 3KHHA 1R8CA 3I32A 2Z2LA 2EBEA 3IM9A 3JYTB 2CZVC 1OY6A 4RWXA 5K9FA 4OHYA 5IM0A 4TY8B 2JLGA 2QL5B 3PTWA 3GTOA 1GX6A 2DR7A 3CMAS 4I2QA 1KLNA 3K89A 3CC2S 4HHHA 4UY85 1S76D 5KFBA 3VAGA 3QQ8A 2RQKA 2YQ1A 5DZ6A 3R2DJ 4AT1B 4KV8B 4TLRA 2VQFF 3SCLE 4NXMJ 3AHPA 3PW4A 1NPRA 1BQXA 2I2YA 1DHMA 2ZVSA 1Z2ZA 3EYZA 1SKRA 3BPSP 2QO3A 2AYGA 3K5NA 5C25A 1BWEA 3T5KA 1VQ5S 5C24B 3D6TB 4URQU 2GIRA 1LFPA 3UW1A 4CLSA 5JVHQ 3UDLA 1TKZA 3ET6B 4IRDA 1NK9A 4DL7A 3I96A 4B9NA 2V3VA 1JLEA 3J80U 3CWJA 1RCXB 5DRKA 3U1NA 5E5NA 5ETNA 3QYYA 4C11A 1N36J 2IYGA 5CXTA 4AE5A 3Q2TC 1AA1B 3E01B 1Q1KA 1YRTA 3PW2A 3MM8B 2W7PA 2DRDA 4RBUA 3J80Y 1RAIB 3PACA 4JYAJ 1SI9A 2AGPA 2A3JA 2QZ8A 2Z2MA 4AAYA 2HCZX 4IR1A 4HTJA 3TA1A 3D6HB 1Q8LA 1HIYA 2BJ3A 4IRKA 2H5EA 3FEYB 1SC4B 2R2UA 4PCQA 2YNHA 1JLAB 1G8KA 3HFVA 1EETB 4UOGA 4F3QA 5J1EA 1OJ4A 4OMFG 4DR5J 1UVKA 2P9CA 3N6LA 4I2QB 2LQBA 3IP0A 3K5PA 3SV4A 2HMIA 2P9GA 4DR3F 3S8SA 3JTPA 2XQCA 1ZETA 2EG2A 4J9LA 5E3CA 3JSMA 1X4AA 4L3KA 3R6GB 3SULA 4ED1A 3C16B 3PYEA 3EGVA 5KT2A 3DMRA 5C25B 4ED5A 2VPYB 2JA5A 2DVIA 1B0VA 4JI0F 4C48A 3HO1A 4LSLA 2EPIA 3P4UB 1H2TZ 1TKZB 1TK8A 1X9MA 1NKBA 4ELVA 3HSZA 3PYDA 2HFOA 1JLEB 4P72A 1T9WA 2P2CB 4CNYA 4XDDA 1K1QA 2LEBA 4I2PA 1R8BA 1K44A 3BKUA 3ELHA 1SC6A 4C11B 2D69A 4PYAA 1SV5B 4ED4A 2B7CB 3VHQA 1FWLA 3TQEA 3MCOA 3TUPA 2E1MC 3OR2A 3AJDA 4K4VA 4TLQA 2ZBRA 2FHMA 1X9WA 2ZITA 4L73A 2RB7A 2ACYA 3GCWP 3ZO7A 2V8DA 2DRBA 1RA7A 2QLBB 2GJ2A 1OPIA 3C8YA 3HPOA 3FZ2A 1LNQA 3MDFA 2ZC4A 3IBFB 4C6AA 1YBTA 2OELA 2CQGA 2XMVA 3DI6B 1RUSA 2XS2A 3V6JA 1SJ3P 1BUXA 3NGSA 4QWCA 4Y34A 3LO3A 1T02A 2DRAA 3H25A 4P9SA 1AFIA 3FGVA 5G0RB 2RKIA 4LF7F 5C18A 1IKWA 1IM4A 3CCUS 3OVAA 2CWKA 3R6LB 2GQQA 2MKJA 3I0RB 1P9QC 3CGIA 4DFMA 3MF5A 4B9MA 3BJYA 3MMBA 1U7LA 3NBPA 2CVIA 4U7UD 2XZWA 1KC8T 3CJKB 3QZ8A 1QAJA 4CNZA 1FDNA 1S77D 2DXEA 3I87A 3G86A 4AFFA 3HK2A 3PRBA 1U6ZA 2O66A 2P9EA 5F8LA 2AHOB 1RTDB 2MJUA 4PWUA 3TOQA 1VDHA 3T9NA 4EU0A 4WFXA 1VRTA 4LSLB 2AYMA 1UA1A 2J0XA 1T9TA 5H9EK 3K8WA 4EGLA 1ITPA 4KBIA 3WX4A 1RT1A 1HHTP 4A4JA 4I2PB 2W9BA 2G2YA 3NCQA 1LV5A 4O3PA 2W7AA 3OTDA 3ZTOA 2UXCJ 5ETQA 1I6JA 4KR0B 1ACMB 2VG7A 1NK7A 1T3OA 3T1YF 1E6YA 3D1HA 3W5XA 3CJ0A 3Q24A 2HK2A 4KRWA 5GM9A 1EZZB 3UD5A 4OI1A 5D4PA 4IQXA 4LFBJ 3NEKA 1M1GA 3W2VB 2RILA 2PFDA 1T9XA 2UUBJ 4BC7A 3RZAA 4IYQA 1B70B 4IR9A 4E0DA 1UEUA 3VWSA 3UCZP 5D15A 3UVJA 3R5BA 4Y2KA 1RBAA 3D68A 2LA6A 1YJ9S 2XMMA 2R7UA 4CO3A 3FFIA 2O1PA 5HVFA 1Y1VA 5L1KA 3TZWA 3MMBB 4O4RA 3NBPB 2Y9HA 1P1LA 2YKNB 1DY3A 1F2HA 2XZDB 4XPCA 4B3MF 4DUTA 2VASA 2DTJA 2F8EX 5KFQA 4RUAA 3O44A 1HD0A 2ZH4A 1LXNA 2UP1A 3HZEA 1S97A 2HS4A 4JI8F 1F2GA 2G4BA 2E7WA 2G0CA 3UN2A 1VRTB 5IQQA 2NXNA 5AXLA 2R7OA 3NXZA 2C3UA 2BJ1A 1RT1B 2HNDA 1IKXA 2RDJA 3K8VA 1HW9A 2W9BB 3TM7B 1I3OB 4Y65A 1GXTA 4K4UA 1AFJA 1TV6A 5DG9A 3KLGA 3PX0A 2EWHA 4ZKAA 2NVYA 1CVJA 2HFVA 3MMAA 5G4DA 3L95X 4P75A 1Y1WA 1E6YB 4K4TA 1AZSA 1QSSA 2AEMA 1NCLA 2VFUA 4QYRA 5IC4B 2HHXA 1RWKB 2VQEF 3H5YA 1FJCA 4ED0A 2J9DA 1MROA 2BKPA 2CPFA 2NQPA 1UPPA 3SI8A 3JS9A 2DHGA 1S72S 1N33J 1IBLJ 1ZYRD 2QMUB 2HEKA 3RG6A 1CG2A 3R5AA 2CDRB 3BQ1A 3UVJB 5KG1A 5L1JA 4FDFA 2RS8A 3A8IA 2Y1RI 3B4DA 3FFIB 4YP3A 3QQCD 1HNVA 4NX9A 3IR5A 3NMAA 1MSWD 2XYHB 1IN0A 2GVDB 2HWHA 2D9OA 2YX4A 4WU2A 2CJBA 5DGAA 2DJWA 4KGVB 4C8NA 4J9SA 1A9NB 3IGVA 4DL5A 1Y00A 1EKRA 3MR3A 5L38A 5J1PA 5DGBA 4WPAA 3Q8UA 5BYSA 1FWKA 1ZA1B 4ZN3A 1OGYA 7FDRA 3U02A 5LMUJ 5H4UA 7AT1B 4KGMA 4S0MA 3BDPA 2BOPA 1CULB 2JIRA 1FD8A 2HNDB 1CR5A 4B3TJ 2HHUA 2CJ9A 4DZDA 3PEHA 2CNNB 2E5JA 1EARA 1RAOA 2JZ5A 3UN3A 4H4OA 4PUOB 4PG4A 2ZZMA 1FESA 2LFVA 2UU9F 4K4XA 2J7UA 4DS4A 2HAFA 1LW2A 1CJVA 2FYXA 1AZSB 1ZAWA 2JJ4D 3CDUA 4FVMA 3DOMA 1NB7A 2WVCA 2DO0A 2KXNB 2XWXA 3LTOA 4NLVA 3UCGA 4DI6A 3DLBA 1OQ3A 3KJVA 1NJWA 1C0TB 3DHWC 3R2CJ 5HROA 4A8MP 3JQJA 4K4WA 4DV7F 4ZJOA 3S6EA 3FCHA 4LVNP 3DYAB 3Q8VA 4J9QA 3B6BA 3DRPA 4HDHA 4X64F 1SQGA 2C2ZB 4IOBA 1HNVB 5BR8J 2E5GA 2MSTA 2NYHA 1S0VA 3SZ2A 4LRCA 5KT7A 1GQEA 3OL9A 3AA8A 5JJBA 3VAKA 1FDIA 1KVJA 3F44A 3GIJA 2HRYA 2BJDA 2IYIA 2V68A 2BM0A 3PRVA 1OYDA 1TUVA 2PJJA 3LA0A 4X4QA 4X65J 1KONA 1U45A 2BANB 1RSCA 3EM1A 3W9IA 2FUG9 3ZTSA 5KT3A 2MYFA 2HFZA 3D9BA 5KFOA 4KO8A 1RTHB 5J2MB 2V45A 2J9CA 3SCJE 3CW2C 2V50A 2J7KA 1TWGA 2VC1A 1B64A 2IRUA 3GJRB 2WHOA 4PYDA 1WTBA 5KFAA 5CCMA 2AJQA 2VV5A 1S6OA 2IM2A 4KO0A 1SH0A 2G1HA 1K0TA 1SC1B 2YH1A 4M5KA 4P2FA 2V2QA 2APOA 1IM6A 3MR7A 4YFUA 2CQ3A 5KOWA 3NGRA 1HR0J 1URRA 1I51B 3BBBA 3TJ9A 4AYBA 3KK3B 2ZZNA 3WIUA 2YKMA 4ZVUB 3ZXWA 4FN5A 3KYLA 3RGIA 1X60A 2E2HA 3J7A1 4RW8A 1FX2A 3GFHA 4IH7A 1FRMA 3QPIA 4L76A 2QSFA 3OXGA 1S10A 2KFZA 2EVZA 4ZPVR 2OFGX 3VGUA 3SUKA 4WIQA 3NGKA 4W92B 4B3SJ 1NK4A 2OTLS 1ZM2A 4NLWA 4W4MA 2DNKA 1FTRA 1NDCA 1T11A 5HQ8A 4ANDA 5C1BA 2QN6B 2KO1A 2JSXA 3TNVA 3MR2A 1NH7A 2EFPA 4MTPA 3D30A 2DB1A 3MEGA 5BYRA 1FRIA 4ZLPA 2BQUA 4O23A 1O51A 1YJVA 3DC2A 1NK6A 3BGUA 4YY3F 4LSZB 1AB8A 1N5SA 2NSBA 4OQJA 1HQUB 2NREA 4F26A 2HYIB 5GMEA 1Y4ZB 2MKCA 1XNRF 2VB6A 4QU7A 1DAXA 4OX9F 4DEZA 2QFIA 4B02A 4WYWA 2R7RA 2DR8A 4QW8A 3WX8A 2ZM6J 2CPZA 1S5ZA 1OQ6A 4CTAA 1RHJB 3MM5A 3KK1B 3I4PA 3W5YA 2L3MA 1ZZFA 5HP1A 1VJWA 4U6PA 2NUHA 2F7VA 5F3ZA 4X66J 3C46A 1IBKF 1PBUA 4CLFA 1PJ6A 2CWXA 2CPYA 3FC9A 1TAUA 2Y0SD 4N8NA 2QA1A 2VG6A 3AD7C 4RW8B 4KTQA 2XULA 1CJTB 3A8EA 1UJ5A 3ILJA 2RH3A 2XSJB 1JK9B 4ZIVA 1KD1T 5AJ3J 3P45B 5E33A 2XY5A 3MCSA 5A8RA 1FJEB 3EJMA 4R25A 2BH0A 2VA2A 4IH6A 3GSIA 2AEFA 1S9GA 2ZOGA 5KFEA 2J6TA 1S1UA 3CF5Q 2MZSA 3MI7X 1XMQF 2UXBJ 2QYCA 1PT0A 1LKZA 5K20B 1Q86T 3FNNA 3HHLA 4TYAA 2YNGA 4FPRA 5KFDA 4URSA 5K8MA 4KDLA 3N0VA 2MQ8A 2D41A 1FRLA 3MEGB 3D0IE 1RB0A 3OUYB 4OYBA 1QAXA 3GR1A 4JI7F 1C1BA 4OYWA 1TL3B 4ZPBA 3M6VA 1WKLA 2CDQA 4UQGA 5D0HA 4G1PA 4ZP6A 4CLZA 2ZH7A 3QT8A 2HFSA 4UT4A 1NJXA 4F2RA 1FFSB 3SCIE 3OTBA 5F8IA 4HACB 3SSRA 1IVZA 4J9MA 5KFZA 3W63A 1OO0B 4ZVOB 1SJ1A 1FEHA 3MPUB 1QSLA 1Y10A 2IAJA 4DSLA 4NA1A 4HTIA 2LKZA 2GO9A 4NA3A 2R2RA 3JAMY 4LMZA 4PWWA 5KFWA 3V4IB 1SQEA 3EXCX 1N5YA 3CIMA 2OIHA 3SV3A 3MM5B 1YWXA 5HP1B 2LP4A 3KXDA 1KLMB 1FXRA 4RUCA 3KUGA 1KTVA 1YLXA 3JXOA 4NXMF 1TKTA 5J2PA 4MJKA 4ZCMA 1F3VA 3FBBA 1BGXT 2ZWOA 4IDKA 1MWZA 1U48A 1HBOA 4DPWA 2AYBA 1WSRA 3TI0A 3D3CJ 2W9CA 5GAHU 4I4BA 4YQWA 1RT4A 3BKFA 1U02A 3R1HA 4CO5A 4NLXA 1RBOB 2MJNA 2VA3A 3G71S 2QTWA 1NMEB 1FNMA 1GXLA 4X62F 3NWGA 1RT5B 3QQ7A 1OS5A 1ZAVA 3CJ5A 4YDDB 2QL9B 1N36F 5GAEI 5J2QA 1Q53A 1S1UB 3HHLB 2YNGB 1U49A 1S1WB 4CLLA 4OL8A 4WTYA 4ZOSA 1WI6A 2XS5A 2R7WA 4DL2A 3DU5A 2DNYA 3OLBA 4AZDA 4A8YA 2KYZA 2JVRA 4DR6J 5RUBA 3IM8A 2B4OA 1JQGA 1QUVA 1U1PA 4ZHRB 4GC7A 4HVZA 4CLPA 2IAJB 3CD5A 2Q3PA 3KWMA 1GMWA 2V8GA 5J2NA 4DR5F 5I3UA 4EEYA 2Q66A 1B99A 2WRMA 4OI0A 3AH6A 3PHTA 1GX5A 4ATNA 4ZMMA 2IVMA 1HNIA 1WWHA 1JIHA 5F9LA 3MM7A 3HT3A 1PYTA 3M30B 4GKJJ 1AUSL 4FFTA 1NPPA 1TKTB 3R97A 5J2PB 2DGWA 2KT2A 1URNA 3AFGA 3WC2A 2O5JD 1KHVA 5B6CA 6FD1A 3GJSB 5D6GA 2B9EA 4ED2A 2J9DE 1VR6A 5B0GA 3PEJA 1Z4UA 2KU7A 9ATCB 3AQOA 2QLXA 1QJHA 1KVIA 2UUAJ 4DV4J 2UVRA 2XMKA 3GFZA 4WYLA 4NI2A 3NKYA 1VQMS 3D0HE 5J2QB 2CPHA 1YHQS 2I5JA 1A6LA 2YH0A 2UZAA 3CT9A 3J7ZT 2ADBA 4AXJA 8ATCB 2WAQD 4IO1A 4ZCKA 5F8HA 3CSKA 3CE8A 2E9TA 2JOQA 2COLA 1T05A 3MD1A 3HHLC 1R0BG 2G0IA 3CDAA 4YN3B 1X5SA 3KUEA 2XLKA 4Y28C 4DQIA 1VIXA 1RTJA 4YEAA 3KJNB 2ZDOA 5D8HB 3NCRA 4ZM7A 5CABA 2GV1A 1M90T 3BGFA 3JTNA 4F02A 3H5UA 3SBMA 5HMYA 4B9LA 1VRQC 1OY9A 1MMNA 2CIMA 2P6SA 3ZZTA 5J2NB 1EQ0A 4H4KC 3HLUA 5I3UB 2GQ2A 1EP4A 3G8SA 2MHNA 3ENWA 4MH8A 4C9DA 3I0SB 2KKHA 3KJFB 5E0OA 2IV2X 3DFEA 2JIQA 3ZTRA 2ROEA 1NPKA 5IQ6A 3KHRA 3MM7B 1VLYA 1LWXA 1UFKA 2XO7A 1FWPA 4USUA 3PZPA 3CCSS 3QIDA 2ZC3A 4ILLA 4ED7A 1YJNS 4GRSA 4CYUB 1PAEX 1KP6A 3QSIA 4DL6A 3B8HA 5T41A 4F4ZA 4I7FA 2R8IA 2ZKTA 4A8SA 4NZ6A 1WD6A 3W1YC 2GJFA 5GVQA 2DIUA 4CIOA 3QO9A 3CUNA 2B9YA 4HDGA 2FHJA 1KQFA 1S57A 3BBFA 4O44B 2J8SA 4LRDA 1RTIA 5LJ5Y 2UXCF 1SL2A 4V1Ak 1WG4A 4JI2J 2I5JB 5B08A 1MG7A 5CYQA 4C8OA 3G4SS 1KR4A 4Y2AA 3DU6A 2DMRA 2X3DA 2CJKA 3EUNA 2EFNA 3MGJA 1VCTA 3M1VA 4IOAQ 4LFBF 1TR0A 4KPYA 1TQLA 3M8ZA 3FK4A 4LSNA 2FDNA 2UUBF 5DDOC 4K7QA 3GV8B 3KLFB 4DXLA 3G6YA 1D8YA 2R7XA 3B78A 3RBEA 2DXFA 2GMLA 1YTYA 2IVFB 3MPVA 2VH7A 3KFWX 3HVAA 4ECTA 5LJ3Y 3OT9A 2HQIA 1SKUB 3IMQJ 1U2FA 2ERRA 1RAGB 4RNOA 4PQUA 5F0UA 4KKOA 2EFQA 1JWWA 2NS1B 1FO1A 3HSGA 5LSRA 3C3LA 1FJ7A 4UQTA 3CNQP 4OLOA 1HWLA 2XMWA 3IWXA 3EX7B 2MY7A 2NLWA 4DJBA 2JC0A 3LAMA 3T5JA 4C4WA 2Q6BA 3LGHA 3VTIA 2WSFC 3W3SA 1R8AA 1X4FA 2C2MB 3TRGA 4IFYA 2MQLA 1U09A 5DQHA 1NSPA 3KMQA 2C3MA 2QMXA 4LRAA 1K8AT 4UOHA 2E5LJ 2M7SA 3TVZA 4KC5A 4DV0J 1XWLA 3EMTA 4O3SA 2KJVA 1HMVA 4X4SA 3OQ2A 4ZP7A 4DN9A 4AUKA 3H4BA 4DFKA 2DGVA 4JV2A 2B0GA 5CYQB 4M5DB 3LH2S 4G1QA 2O01C 3W5ZA 5D3GA 3O5TB 3MEEB 1L3TA 3VAFA 1PO6A 1BQMB 4FS1A 1I1GA 2LCWA 2I1RA 3AOAA 3UPFA 3L9ZA 3MHYA 1JJCB 4NCBA 1U24A 3UDCA 3GTGA 3R1LA 4KAIA 1N33F 2J5AA 1IBLF 2CPDA 3UNYA 3QAUA 3ISND 2AJFE 3CD0A 3MAHA 3VZIA 3A3NB 2C2RA 3DDNA 3MEDA 4X2BA 4F8RA 1HHQA 3IO1A 2E1AA 4TQRA 4USTA 3FEZA 1TL5A 4Z37A 1CSJA 2YWKA 1T94A 5D4OA 2YWWA 5IWAF 1SJ4P 4KKOB 4DV2J 1Q0NA 1WOOA 2NZ4A 3MMCA 1YVFA 2KFYA 1JXLA 1P27B 4USJC 1FKPA 1ZTWA 2MLXA 3GTMA 4M5HA 4DR4J 1MMDA 3PJWA 3LWLA 4TN2A 1BW3A 2B8PA 3M8PA 3AAWB 2B9WA 3M9NB 2GNKA 1FNOA 4IFYB 4LF5J 1ZM9A 5FJ4A 2VKRA 1N34J 4LUBA 2EK6A 4DQSA 4JBCA 5LMUF 4J9RA 4X4UA 1YI2S 2HFUA 2ZHBA 1MMLA 2ZBCA 1FJGJ 1H72C 2VKZG 1TMMA 4J9UE 1S1VA 3NY0A 3MM6B 3C6TA 4E8UA 3CJ8A 4CH1A 1N10A 2ZJRQ 2YX1A 2DGOA 2KI2A 2OPPA 4U7CA 3KHGA 2IM0A 2PD1A 4YR2A 3DRYA 1I94J 2YTCA 4YUDA 2KVQE 5T7LB 2ZBQA 4OHVA 2LDIA 3TX0A 1WEYA 2KTQA 1QTMA 3C15A 3HMJG 3MZIA 3U1MA 2CW0D 3HJVA 4J9VA 4D3GA 3C6UA 1TK5A 5HVHA 4DL4A 1R0CB 5F8MA 2VUGA 4I56A 1RU1A 2PIIA 1UHEA 3EVMA 3UWTA 4NXNJ 3I5CA 2PEHA 1HI1A 1UVJA 4OZ0A 5BR8F 1VHIA 2C2KB 4K0KJ 3UQSA 2QSWA 4I68A 3AJ2A 2J0SD 3CXCR 2MXYA 2KJWA 2OPRA 3GYNA 4QW9A 2OJ3A 2AJ2A 1JLBB 1VQOS 1P1TA 1U1OA 2E2IA 2ASYA 4LBIA 1G8JA 3TP2A 4DV6F 1R27A 1UWBB 4ZLJA 3WZ0A 3HU3A 3M3GA 1DTQA 3KDNA 4DUYJ 3N28A 2GJIA 2FVRA 2BJ8A 5L46A 2JHEA 2WTFA 1NM2A 3TANA 3X2KA 2VFRA 3IRXB 2W7OA 2BA9A 1BXNA 1CLFA 4F4YA 2XMTA 1DMRA 4ICLA 2PJHB 1JB0C 1H98A 3RRKA 1I3QA 1FD2A 2OPPB 1CC8A 3KK2B 4P7VA 2FVPA 1HR0F 1HBNA 2XTJP 3MR5A 2NR0A 3IFEA 3K5OA 2DXDA 2OP5A 3RB4A 3KLIA 3TJAA 4R0EA 1TL1A 5AE2A 2HVZA 3TQ1A 2AWZA 1LWFA 3C6UB 5C42A 2LVWA 3H98A 5L1IA 2L41A 4Q45A 1F6TA 3VV2B 2HGLA 4EK2A 1UVIA 4K4SA 1RZMA 5KG0A 2VL1A 2DY1A 3AB2B 4B3SF 2XM3A 4ZVPB 2OPRB 4KQZA 2GAHC 4C8ZA 1E6VA 4QOTA 1PQFA 1JXVA 4DPUA 4U8YA 1X4CA 2ENGA 1R27B 2EBGA 5F41A 4I6AA 2RRAA 4DCJB 3POTA 2L48A 3CDWA 5CD4A 5B09A 2VUMA 2DEJA 5K8OA 4LFAF 4W90B 4ITSA 3X2GA 4ZVQB 2POKA 2V94A 4ZLNA 1KTQA 3FBCA 5LXYA 1Q95G 4QIEA 2MY8A 3R7SB 5HJYA 3GCXP 5KFJA 2BX6A 1R8HA 2V4JB 2ZUAA 5AT1B 1DLOB 5AXKA 1H74A 2V9KA 4P7TA 2ZM6F 1U1LA 4LRFA 2XHWA 5IT4A 4ICLB 4USVA 3X2MA 2NPFA 2DH9A 5D4LA 2LU1A 1ZZNA 2FB0A 1L3KA 2BZ2A 5EUHA 3B82A 4CT9A 2OKQA 1DBDA 2DY9A 5F0WA 4X66F 2RAQA 4XAKA 5H9FJ 2VU5A 4DV5J 3V6KA 4XO0A 1ZS6A 2L9DA 4EZ9A 2HVEA 1N6QB 3BKTA 2R8GA 2HVIA 1FRXA 1S6UA 4DV3F 4LR8A 1B0TA 3NGDA 1KFDA 5AJ3F 3NNAA 2OHDA 2ZBPA 3I9ZA 2ZE2A 1RT2B 4I6WA 4WFNQ 1FDDA 4PXDA 2MKIA 5DG8A 3MOJB 1W7WA 1RT7A 1WDDA 2E7XA 2NXCA 1T8EA 4ZJLA 4YR0A 5A8WB 1IWAA 2X1BA 3FCWA 1J5OA 4F4XA 2LMIA 4H4MA 4NMXA 4M94A 1VK3A 4USWA 5DQGA 4F0KA 2EXUA 4FKYA 2EKYA 2EEOB 5FTLA 1NB2A 1S1TA 3HCXA 3MTJA 3CJRA 1VBKA 3DCAA 4BCAA 3I5AA 2DNLA 5F9NA 2F63A 5EN1A 4JI6J 3Q2SC 1NJZA 1RAFB 3SDEA 4LQ3A 2J76E 4ECVA 2P6TA 2AX1A 4CT8A 1WKJA 2MB0B 1KRPA 4B3RJ 3UDEA 2YNFA 1D09B 5KT5A 3G96A 3CO0P 2RIJA 1E32A 2F40A 3MPDA 1V3SA 2A6OA 2JEFA 4OJ1A 5KFSA 2JLFA 1UETA 1DTTB 3PYGA 4UOFA 2LXIA 2V69A 2ZD1B 3BS9A 3NS6A 3IA0A 4LBPA 2YPZA 5LSLA 3ZTPA 2A6MA 3CZBA 1XK8A 5M2PA 4Q44A 2CQPA 4X4RA 1UVMA 3MAAB 4AXIA 1P6TA 2H1YA 4C8LA 1FHTA 1OA9A 3A8JA 3G9CA 2PA8D 3TWZA 5KT6A 3CULA 1QTNB 3B54A 1F5CA 2ZE2B 1BHNA 5I42A 3QGGA 1HHSA 3PDNA 1RT7B 1HLWA 4C2MA 4R5PA 5KFXA 2ATCB 1RISA 3HVTA 3IBCB 5KFUA 3X2IA 4WTOB 1X4HA 4JP6A 1YZ7A 3OD2A 1XMOJ 1R8PA 3ZC4A 1J5OB 3R5DA 1IKVA 2OEKA 3IG1B 1HNXJ 2FVQA 3IS9B 3OW2R 4NCAA 2HW3A 2DH7A 4CM2A 4CLWA 5KG6A 2OEJA 4DR2J 1DRZA 4C0OC 2ZH9A 3NAIA 1N48A 3VALA 4DR6F 1UJ4A 3GLJA 2Y3YA 3DLGA 4C7QA 4OZ5A 3TR5A 1NJYA 1QUPA 3VAMA 4KHMA 3MECB 3IWNC 5EDWA 2QYGA 3M32B 2CUYA 1VLOA 1DARA 3QT5A 3VAIA 4NLPA 1WJ9A 4RW9B 2VPXA 2W1BA 2KM8B 1BC6A 2AX0A 3M2VA 4Q2LA 1S3SA 1S9EB 4A8OA 2K2PA 2RVJA 3IAM9 3Q8RB 1EU1A 4GKJF 2D3UA 1FK9A 1LW0B 1JLCB 2C2DA 4F0MA 4BC9A 3FKIA 4HT5A 2VFTA 5IOLA 3VCDA 4ZVSB 2PI5A 1SFOA 2I0XA 1UKUA 3M2UB 4I0WA 4IOCQ 2WVFA 3PW7A 3OTOF 2VPZA 1RAAB 2HS3A 2YY3A 5ETMA 2F4VF 2YWEA 2UUAF 4DV4F 3K17A 2ZEJA 2CFXA 1WDTA 2AT1B 4YB1P 4JI3J 4HH0A 1VOMA 3HVTB 5MAOA 4EFAC 1XERA 3M6XA 3H0PA 1VC6A 5H1SV 1F9EB 5F8NA 3PLXB 4NYOA 2XWYA 2Z4PA 4RBVA 1IKVB 3UD4P 3MOZA 4F3MA 4EMDA 2N7CA 4PXCA 2F4FA 1CS4A 2Q1LA 4QIWA 5LXRA 1Q82T 1IWGA 3BF4A 3RR7A 2FJBB 3DNCA 4JI1J 3AODA 2C3OA 2PMZA 5EWGA 3C14A 3D6FB 2B6AA 3OUGA 1E18A 3TZYA 1Q8KA 3ZNUA 1CJUA 1S9FA 3CJQA 3JYTA 3PJXA 4PG5A 4FNIA 4EO6A 2WONB 3T1HJ 5CQGA 1VQ7S 3J81j 3GZ7A 3RRHA 2B8QA 3DM2B 1KQGB 1AW0A 2BE7D 4FP9A 1TUWA 3CCJS 2R7VA 2HIYA 2BOAA 1FDAA 1RWXB 5E2QA 2KM8C 1JJ2R 4OHWA 3Q8YA 3RBXA 2F8MA 2VBXA 1YLEA 4MK9A 1UFWA 1RK8A 3MM9A 1X4DA 1QAIA 2D7SA 1BWVA 2BJ7A 2I8EA 2VODA 3DLEB 4KV8A 4N56A 5HQMA 2CPJA 2BACA 5CZXA 2HLTA 4OX7A 3V6DB 2AQ4A 3T9ZA 2LQ9A 2V2ZA 4D7ZB 1CBKA 3TUJC 1R89A 2GS8A 4GO7X 2R2SA 4F0HA 5C24A 1WHVA 3DLLQ 7FD1A 4IKAA 1OA7A 3W61A 5LM7E 2U2FA 4JI2F 2WOMB 1AA6A 4OI4A 2RHQB 3O6QA 3TAQA 5K14A 5JMNA 1TMOA 1X5TA 2YU9A 3CCES 4CRYG 4A8QA 1NHUA 3D67A 3D0GE 5KAKA 1HBUB 1CS4B 1P9YA 3DGVA 3KLEA 3D1OA 4AQYJ 5IV4A 1D9FA 3OFHA 1F1BB 4OYXA 2IA0A 4YB6A 3C14B 2B6AB 5HBMB 3X2OA 3TA0A 3GV5B 3THTA 1D9DA 3RB6A 3LAKA 4IG3B 2Q79A 4B17A 4UTGA 2XB2D 2ALYB 3OSNA 1CJUB 5IC6B 2W2MP 2HBQB 4AD6A 2YKQA 1JLAA 1EETA 4ANCA 3BR8A 1V6HA 2Y8YA 2KZZA 5BYQA 1HARA 3R7NB 2KYXA 2HVHA 3S01A 3N01A 1K1SA 2KRRA 1U4BA 2VIHA 1ZPWX 2QFJA 1I5OB 3HHDA 5I3PA 1KVKA 3SQOP 3MM9B 2RRBA 2W8LA 4ED6A 4LF9F 1IQTA 3NP5A 2RMLA 1RHKB 3HM9A 3C16A 4ALZA 2HFNA 3JSBA 5EPPA 2G2OA 2E5LF 4WP9A 4P2MA 2VPYA 1TKDA 4RW6A 3H59A 1RT6A 4DV0F 3DDKA 2RF2A 4M8LA 5EX0A 5BXIA 4JV1A 2MZQA 3G6VA 3E3XA 3KMSA 4JI5J 4FZVA 1JLFB 3CF2A 1RWMB 5K14B 3JQKA 3HXMA 3KTQA 2PMWA 4ZPCA 1SV5A 2ZZTA 3HP6A 4J37A 1FRJA 2K8GA 5KOXA 1NXIA 3D3BJ 3G87A 4F3OA 3KLEB 4DPYA 2NXUA 4OYAA 3OBIA 5GADU 3H90A 3T6BA 4I1TA 3ZZZA 2KQAA 2QC3A 1U8SA 2XBPA 4DR3J 3X3UA 5C2CA 4L75A 2QGFB 1G4CA 3TEHB 3DDIA 2L9WA 3T41A 1T03B 2Q43A 3LOUA 1TVRA 2V6AA 3GE9A 3KDOA 4UUWA 2B4VA 1REVB 3DI6A 5CH7B 2MSSA 3H42A 3DXSX 1PYQA 2V8VA 4DV2F 3NNCA 4MIWA 2M0GB 2GQCA 4P71A 2FZCB 2K06A 2XI3A 2FLOA 3AOCA 5G0RA 2DR5A 3AD8C 4EO8A 3HKZD 2AV5A 1BE4A 3JB9k 3I0RA 4DR4F 1MW7A 3QRRA 3PYFA 2YQ0A 1MLAA 1UPMB 3BB5A 2RE1A 1VC3B 3QJLA 1LK7A 4OJHA 1TKXB 2AJ4A 5FLXU 1N34F 3KUHA 3CJKA 4NYZA 3PCOB 2CNOB 1EB0A 2ILYA 4WFZA 2CNKB 4EWTA 1FJGF 4ECRA 3H5XA 3VAJA 4RW6B 1RT6B 1RTDA 2C22A 2MDAA 3GTYX 4JS7A 2RF2B 5DLFA 5FLXY 1K47A 2ZH3A 5CA5A 2EW9A 5HN0A 4ZCIA 2QMWA 4OI2A 2UV8A 1VS3A 3TA2A 1WEZA 3M05A 3UI3A 5DJBA 5B7WA 3N6NA 2W8KA 2J9EA 3NMRA 1HQEA 3M8WA 2ROGA 5B0CA 3SSQA 2KT3A 3HJFA 3UNGC 1EJ7L 1XR5A 5GLXA 1YBAA 3TARA 4DR7J 2LLZA 2VBZA 4NLYA 4OZNA 2IC3A 4U7UK 1AW8B 2BRKA 1SH2A 3CJSA 4JV0A 3CCRS 2AF6A 3PV8A 5HQLA 2B9XA 2P8IA 2AGQA 3GPAA 4HHUA 3W2VA 1RP5A 4M5GA 1GMUA 1RE1B 4N77A 3S7RA 1Q78A 2IPOB 3CC7S 1TVRB 2GMHA 1S0NA 1IQZA 1F3FA 1VQ9S 2HK3A 4DSFA 3BM7A 2ZJQQ 4CRJA 4L72B 2X51A 1NAQA 3U27A 1KFSA 3Q23A 4TY9A 4J5OA 1H5NA 2EFGA 1SVDA 4NLOA 5E7OB 4YS2A 1BW4A 3GJTB 1HL6A 3N5FA 3TX8A 4ZN1A 2YKNA 4LF8J 4F67A 4F04B 1F60B 2DYAA 2KI8A 1C4CA 3QWUA 5CD4H 5ETOA 3T1YJ 3A4TA 4DUYF 3L3CA 5DYGA 3EXYA 4CLUA 3TIWA 2DIVA 4ZK7M 2OAUA 3X2NA 3IRWP 1PYOB 2M4MA 2KH9A 1QDUB 1RT3B 4FKXA 4JCWA 4FG2A 2V2KA 3OL8A 1F9FA 3EZOA 1YJWS 2VBWA 1MWQA 2J6SA 1NBEB 4V19X 1VBYA 3FCVA 2ZOFA 1ZM3A 1IBMJ 3O3LA 2E9ZA 1U1NA 4HKQA 2EG1A 1HQEB 1E60A 4NYPA 2WB1D 3GTKA 1NK8A 2IC3B 2VOPA 1KDNA 4QBUA 2HQDA 4QWBA 4FF3A 3CCTA 3PX6A 5D0GA 1TWCA 4M5NA 2YXLA 4UF4A 3ILLA 1Z1ZA 3BQ0A 1PGZA 3H2UB 5T5ID 3EPGA 3OV7A 4WZMA 4FG4A 3ITHA 5HAOA 1NNDA 4PWDB 4O0NA 4HL9A 5DDQC 2VJVA 1D1UA 3I55S 1U0HB 1CZ5A 3HDSA 3OJUA 4JI8J 3QC8A 1HYSA 5EHHA 2PT0A 3Q83A 2GVDA 4MK8A 1RHQB 5KFIA 4WP3A 5LOQA 4DQPA 4BWMA 5DDRC 2G6GA 1O0PA 4GMKA 2OI2A 2W4CA 4JOUA 5HMWA 3Q8PB 1VBXA 4NLDA 4F4KA 2GGPA 4K2XA 4DR1F 3TW0A 1OPZA 4ECQA 2VQEJ 3R7BB 2FC8A 1GAOA 1K0VA 2PA3A 1REGX 5E3QA 1R3NA 4LREA 4QR0A 1FF2A 4DX8H 2VPWB 1CULA 3GG1A 3SQGB 3D28A 1VQKS 4Q0BB 3UE2A 2QX0A 2EC2A 1EIYB 1BY9A 1VGYA 3L4BC 4WE1B 3ZZRA 4YHHF 3DXBA 4GVBB 1WEXA 3NL0A 5A6WA 4BHQA 2C2NA 2RQMA 3OFFA 4URGA 4PUOA 4QJVA 2UXDF 2IRXA 2MQNA 1WHXA 1RKJA 2DGUA 2K3KA 1VHFA 4IQMA 5GMDA 3GIMA 1FE0A 3Q86A 2MGZB 2LU2A 5HK4A 1BLUA 1X0FA 5EGYA 4ETZA 5L9NA 1UZHA 2CA9A 2M2BA 1U1RA 4PG7A 5C7PA 1RTZA 2LQ8A 2YWGA 3UDVA 1C0TA 4D3HA 4QR1A 3ITHB 1WUUA 5GAHI 4KT0C 1CJKB 3DYAA 2R7SA 3D1QA 1HD5A 1WKKA 5KFNA 1HBMB 3EDQB 1MU2A 4NWBA 3KNAA 4F25A 4K2JA 3DKDA 3AXKA 1VRUB 2ZH6A 1HYSB 4FS2A 2DGXA 5EWFA 4DWIA 3BH6B 3DGPA 1TWAA 4ZP9A 2C2EA 4MYUA 1YZ6A 3LP1A 2IDLA 1AXQA 2LQ5A 1WG5A 1H7WA 4CH0S 4ANEA 4KLNA 2EI5A 4EBDA 3J7Z5 3T5HA 2A10A 2B5JA 2UU9J 2BANA 2GGPB 2QJ3A 1PKUA 1VFJA 3BQ2A 3BYPA 3CD7A 2ZNYA 2RJZA 4DF8A 3QATA 4ZVFA 1V3ZA 1RTHA 1PPYA 5J2MA 4B3RF 2HHQA 2CJYB 3J7YU 3GTJA 4MIBA 2BUNA 3X2JA 3GB0A 4YB7A 4J90A 2V9WA 5CHCB 5IS2A 4RLEA 4WKYA 4BLGA 5AE1A 2B3TB 1NHKL 4MIAA 2N4CA 3KLHA 2C3YA 4ECXA 2AEJA 4X64J 1YNJD 4E98A 3WDOA 2BVZA 3EGWB 2XI2A 1WHYA 2JL9A 2ZKUA 3K58A 4FF1A 4DUZJ 1RWPB 1WG1A 1WSVA 3Q22A 5B0BA 2QEXS 1Q8BA 3KK3A 2ZH8A 3HKWA 2ALZA 3RTVA 1FI4A 4CRZA 4EI2A 2CQCA 2A18A 2C42A 1HWIA 1YJ7A 2O3DA 1SIWB 3KNGA 2OFHX 2JEJA 4QWAA 2BJ9A 3SYZA 1MU2B 4Y00A 4KGZB 2JIPA 3CMQA 3QSYB 1ZM4A 1XMOF 2E29A 2J0WA 2JEGA 3ZNJ1 1V9OA 4ER8A 5A0YA 3H8YA 4ECWA 3DGPB 3TAMA 4DQRA 3PM9A 4RW7B 3EDRB 2OMLA 1HNXF 3LP1B 5ETRA 4NCGA 1S12A 1F5BA 2KVIA 1RWVB 3SUJA 3P5TL 4UUXA 4DR2F 2HZCA 2FVSA 5KFLA 2B5JB 3MPWA 3PRDA 2ZWPA 4ZDNA 4IG0A 4DPOA 3LALA 1FEEA 1GH8A 4LBHA 4RW4A 1YQHA 3VR1A 4R8UB 5KFTA 1HQUA 3CCLS 3PX4A 2K1RA 3RB3A 2NAPA 1EHWA 3HD1A 4LFCF 1Y4ZA 4M63A 4HI2A 1M0SA 4ILRA 4L3NA 1NH8A 4AL6A 3BN7A 3QLHA 4M5JA 4YR3A 5E3RA 5GLFA 3THPA 3KLHB 3M4XA 3MR6A 2ZVIA 1OSCA 2XO6A 3IR6B 2R8HA 4KFBB 3KK1A 3EPIA 2IFXA 1TAQA 1H38A 2GHWA 5IXUA 2VG5A 1RGVA 4P10A 4CQ1A 3LWMA 3NOCA 3A8KA 3HHNB 4MKVA 4Z2XA 2AE0X 1TMJA 1UZDA 2AIRB 2HQFA 3RRGA 4JI3F 5ITHA 3LANA 1KSPA 1CJTA 2G1DA 4I64A 4YY3J 4FF2A 2HVDA 2XSJA 2BR0A 3BO2A 1HWUA 4GC6A 2W25A 3FMBA 2CQIA 3EGZA 5A0YB 3AA9A 3TAMB 2FD2A 1O5JA 1JXEA 1SJRA 4NCGB 3A3PB 3AXMA 5MLCV 2PE8A 3BSCA 2FGCA 4PR6A 2IBKA 3W9HA 2HHWA 2OD4A 1FRKA 2DNQA 4JI1F 2A69D 2A0FB 2D1CA 1NHVA 1WC0A 4CDIA 3OUYA 3IR7A 3MWBA 4IG0B 4CO2A 1YJUA 1TL3A 4RW4B 3GP9A 2WK4A 5D0RA 1DQ9A 2K1RB 4HACA 4O0IA 1TL4A 2YWFA 1LEOA 3T1HF 4GA5A 3QLHB 2F1FA 3N9UC 3ENGA 3DRRB 3EICA 5KFCA 2KG0A 4NRTA 5L8RC 4EBEA 2MPUA 1Y11A 4OZ2A 4Q2MA 2JVOA 3V4IA 4X84A 1V3RA 2XZTB 4RUBA 2HLUA 2NVXA 1RXOB 4UOCA 3DN9A 2HQGA 4DMZA 2R8JA 2JA6A 2OLWA 1KLMA 3R8YA 1RCOB 2BE9B 2QE5A 1JMTA 4TKTA 4RUHA 2VG5B 2JRSA 3OPKA 1YJRA 2W4DA 2R92A 3CIZA 4DU7A 1S99A 3RJMB 2NCKL 2XNQA 5KG7A 2VJUA 3BDEA 3NOGA 4USIA 4RO0A 3D2WA 3CCQS 1W2IA 2UUCJ 1XR6A 1UW9A 2PGCA 2MEWA 3DOKB 3W8GA 1VYAA 2JDJA 1RT5A 4OV1A 2MZJA 3X2HA 1RWWB 4ERDA 2XGPA 1NO8A 3GONA 1HW8A 5IT9Y 4Y2IA 5KFYA 2DO4A 4L48A 4C3KA 3A12A 5KT4A 3SCKE 4ZVTB 2K7KA 3CQZA 3IGNA 2EFVA 3HU1A 1Q4RA 5KTQA 4AQYF 4WFYA 2HHHF 3QGPA 1S1WA 5H9FK 2ILZA 2HNZA 3GFYA 1IXKA 1ICEB 3A13A 3IR7B 3DMJB 3OJSA 5DG7A 1YRUA 1RWUA 1UA0A 1OYEA 4WWSA 3CJ2A 3W9JA 3JAMU 1RYSA 1X4EA 4Q8FA 3ILIA 1W2BR 4ES2A 3RAMA 2KB2A 2CZ9A 1NK0A 4N76A 4TU8A 5E3PA 2R7TA 4H4KA 4IFVB 2JIOA 4ZHRA 4B9UA 4AOKB 1OWXA 4FERA 3E2EA 1FVSA 3P8BB 3M7VA 2AMCB 3DLKA 3W8PA 1Y5IB 4PPZA 1G7CB 2VFVA 1C1CB 3AJ1A 2HWTA 4X62J 4WU3A 1UW4A 2J7WA 1B4SA 2OPSB 2ASJA 1BQNA 3MPYA 4A47A 3IWLA 1T9UA 1B3TA 1TK0A 5GLYA 1MNEA 3M30A 3MUMP 2W9AA 4C3LA 2RNEA 3EGNA 3P6YC 2X1AA 1YG0A 5A8KB 5EWEA 2AYEA 3A1YG 4CI0B 2OPQA 3AT1B 1GEHA 1E61A 2D74B 3RBZA 1LWCA 3L09A 4NMLA 2BE2B 5F8JA 1UAWA 1T0TV 2V8HA 3W65A 1X31C 3OL7A 3R5JB 4LR7A 4IUFA 4WFAQ 1JNZB 2OMOA 3R5GA 2RU9A 4JI5F 1UHDA 1D8ZA 4DQQA 2LXFA 1OY8A 3MD3A 3ULHA 4KH0B 2B4UA 1I50A 2IY5B 1TU0B 2CRLA 5IM0B 4MT1A 4OIXA 4DCPB 1U2CA 1JX4A 2Q6CA 5CYJA 2KN4A 5B0EA 2YBVA 2QRRA 1YK9A 3OR1A 2HNZB 4A8WA 3TAPA 4JYAF 4DLEA 4RNMA 2CZ4A 2FQQB 1KNZA 2FLPA 2MLZA 1PC4A 3AQPA 2XCPA 5KG2A 3N4WA 5HMXA 1WF2A 2HPUA 2WW8A
chains in the Genus database with same CATH topology
3R5DA 3DHWC 4LIRA 1G2EA 5HROA 4A8MP 2L08A 1IKVA 3IG1B 4G1QB 4K4WA 4DV7F 5D3GB 4QZVB 3S6EA 4LF5F 3FCHA 4IRCA 4XPEA 3QGIA 4LVNP 2CQ0A 3DYAB 2D3OR 1RDRA 4ETXA 2FVQA 4NZ7A 3IS9B 3PO5A 4J9QA 2D3ZA 4A8FA 2DNPA 1ZC1A 3OW2R 3DRPA 4HDHA 4NCAA 4X64F 1JLQB 2HW3A 2EFOA 2DH7A 3MUVP 5KG6A 5L1LA 3DLKB 2DT9A 4IOBA 2DPIA 3OFEA 1DRZA 2RRNA 1HNVB 4QQBA 3BN4A 3ZFVA 2E1CA 4C0OC 2E5GA 2MSTA 1S0VA 3SZ2A 2ZH9A 3NAIA 1N48A 3U7JA 3VALA 4M1KA 3I0SA 5KT7A 1M5VC 4DR6F 1GQEA 1BQNB 1UJ4A 3OL9A 1RT3A 3AA8A 5JJBA 3QJJA 3VAKA 1M5OC 5DM7Q 3DLGA 1FDIA 1KVJA 3F44A 1Y5NB 4C7QA 1ROFA 3Q8SB 4QYZJ 3GIJA 3MEDB 4O4GA 2HRYA 4OZ5A 4KB7A 2B56A 3TR5A 4EBCA 1WCMA 3TYTA 2BJDA 1QUPA 2IYIA 3VAMA 4KHMA 4J9KA 3MECB 4K59A 3IWNC 2BM0A 5EDWA 1L3UA 3H40A 3UD3P 4K4YA 3OTCA 3DOLA 2GIQA 2BQ3A 1TUVA 2HWIA 2PJJA 3M32B 1NRKA 3O1LA 2R2TA 4X4QA 4F4WA 1DARA 3EZ5A 3GG0A 4NLPA 3VAIA 1KONA 1U45A 4XDCA 5L39A 1Y7PA 2BANB 3O8WA 2DNRA 2FUG9 4RW9B 2OPQB 2VPXA 1SJQA 2BQRA 2KM8B 1BC6A 2AX0A 2UUTA 3M2VA 4Q2LA 1S3SA 5KT3A 1LWCB 3CDBA 1PT1A 2MYFA 3MMCB 2HFZA 5KFOA 1I94F 1CZ4A 1S9EB 3M6UA 4XK8C 4A8OA 2K2PA 1VBZA 1UVLA 4KO8A 2RVJA 1RTHB 1FKPB 3IAM9 3Q8RB 3BR9A 5J2MB 1EU1A 2V45A 2J9CA 3SCJE 1RAJA 2CVEA 4GKJF 4EUVA 2GCFA 2HS0A 2D3UA 2J7KA 1LWEA 1TWGA 1FK9A 2AJ1A 1LW0B 2O5DA 2VC1A 3ZZ0A 1B64A 1JLCB 4O44A 2LEPA 4DMRA 2IRUA 4QWEA 2C2DA 4BC9A 3CCWA 1U1MA 4N41A 3FKIA 3M8PB 3NS5A 2WHOA 3MMJA 2VFTA 4HT5A 4OI3A 3I6PA 3VCDA 4CZCA 3PVXA 3MUTP 3ONQA 3U1LA 2PI5A 1SFOA 2RS2A 2I0XA 1UKUA 3M2UB 1IUJA 4ECYA 1G1XA 4I0WA 4IOCQ 2YNHB 1WTBA 5KFAA 3PW7A 3OTOF 4MK7A 4NXNF 5CCMA 2NSCA 2DGTA 2VV5A 3I9V9 5J1EB 2VPZA 2AJQA 4DR7F 2M3DA 1QE1A 2HS3A 2YY3A 1S6OA 3P96A 2V5HG 4OLPA 1DURA 3SFUA 2IM2A 4K0KF 4KO0A 1SH0A 2DK2A 1K0TA 4PWDA 2F4VF 1C2PA 2YH1A 2YWEA 2UUAF 3OR1B 4DV4F 2CFXA 2APOA 2LEAA 4YFUA 1R0AB 2CQ3A 4ID5A 2MZ1A 4DFJA 5KOWA 4YB1P 3T5LA 2HMIB 2ROPA 1NZAA 1S1VB 2PSZA 3GIKA 1URRA 2X1GA 1VOMA 4HH0A 3G6XA 2CQDA 1S6PA 4Y2MA 2M88A 3PR4A 4AYBA 3C6TB 3KLFA 2U1AA 3HVTB 5MAOA 3KK3B 2ZZNA 4EFAC 4WK1A 5FTMA 2YKMA 3JSMB 1XERA 2IBOA 3DRSB 1HNWF 3M6XA 1VC6A 5H1SV 4FN5A 2KT5A 4CH7A 5HL7Q 3KYLA 3K0JA 5F8NA 3PLXB 4NYOA 3OXFA 2XWYA 2Z4PA 3JTOA 4RBVA 3J81Y 3FEXB 1L3SA 2E2HA 1SH3A 1IKVB 4B08A 3UD4P 3MOZA 1N52B 2KHCA 3J7A1 1KOHA 4F3MA 1PQHA 2GW8A 4Q8EA 1IJEB 1Q7LB 3K2YA 2N7CA 1B7FA 4RW8A 2ZNZA 4PXCA 3GTQA 4NLRA 2Q1LA 4QIWA 2QV6A 2M8HA 2GAEA 2M70A 1SMYD 3H5SA 2N4DA 5C5JA 3QWPA 3GFHA 2IM1A 4IH7A 1XEZA 5LXRA 1Q82T 5J1NA 4DSJA 1FA0A 3CC4S 1Q16A 3BF4A 3RR7A 2FJBB 1KQSR 1FRMA 3QPIA 2KXFA 3DNCA 2CPXA 4AYBD 5JVGQ 4I6YA 5KFVA 2QSFA 3OXGA 2PICA 2C3OA 1S10A 2GC8A 2EVZA 4ZPVR 2OFGX 2KFZA 4O3NA 4JI4F 2PMZA 5EWGA 3ENVA 3NAHA 3TUIC 5BJRA 2B6AA 3NGKA 4LF8F 3OUGA 4W92B 1U1KA 2XMJA 3CVKA 1NK4A 3O5AA 2OTLS 1E18A 4O4GB 1ZM2A 4NLWA 3QJPA 4A48A 2VPWA 2DNKA 1FTRA 5FTKA 1Y3KA 3SQGA 5HQ8A 5C1BA 4Q0BA 3BSNA 1K9MT 2KO1A 2IMOA 1WACA 3DOLB 2JSXA 4CS0A 2HIQA 4QIWD 3PXGa 1S9FA 3TNVA 3MR2A 1NH7A 3JYTA 3TVKA 2EFPA 3OR2B 2CQHA 3PJXA 4MTPA 4PG5A 4FNIA 2EC0A 4WE1A 4EO6A 2DB1A 2WONB 3KOAA 5ADZA 2LA4A 2IJFA 3MEGA 5CQGA 1VQ7S 5BYRA 2FJDB 3GZ7A 3GQCA 1FRIA 3RRHA 4ZLPA 1U1QA 2BQUA 3DM2B 1KQGB 4O23A 1AW0A 1WNEA 4FP9A 2XCAA 1O51A 1YJVA 3DC2A 1NK6A 3L7PA 3CCJS 3BGUA 4YY3F 1X4GA 2R7VA 2FPHX 1N5SA 2HHPA 2PDAA 2PMZD 2NSBA 4OQJA 2AU0A 1AUDA 1FDAA 5E2QA 2KM8C 3ICLA 1HQUB 2NREA 1XNQF 2M8DB 1JJ2R 4OHWA 4OX8A 5B0DA 4F26A 2F8MA 2HYIB 1TWHA 1Y4ZB 1LWEB 2MKCA 4TXSA 2VBXA 1XNRF 1YLEA 2VB6A 5AE3A 1DAXA 4MK9A 4QU7A 2MGZA 3CCZA 1IBMF 4OX9F 1UFWA 1RK8A 3MM9A 1X4DA 1QAIA 2D7SA 4DEZA 4PG8A 3K5MA 3OHBA 2I8EA 4B02A 2DNMA 4WYWA 2VODA 3DLEB 4CO4A 4KV8A 2R7RA 2AW0A 2CKWA 2DR8A 2CG4A 3R27A 4N56A 3DLHA 2CPJA 2BACA 5CZXA 2Z8QA 4QW8A 2HLTA 2JC1A 3P3DA 1J2VA 3HF5A 4FNHA 3E8OA 4KDIA 4OHZA 2DPJA 4DV1F 4X4TA 4OX7A 3V6DB 2AQ4A 4I67A 4M5DA 4RU2A 2R4FA 2RKIB 3T9ZA 5E41A 4HYKA 4LF6F 1QE1B 4QU6A 2LQ9A 1IKWB 4QIFA 2Y0SA 1DTQB 4F2SA 2ZDPA 3LF0A 2IMWP 4D7ZB 2CPZA 3MEEA 4KSEB 3TUJC 1R89A 4O3RA 4GO7X 1OQ6A 2V0NA 4CTAA 2R2SA 1BQMA 5GAGU 3MM5A 5C24A 1WHVA 3DLLQ 7FD1A 3I4PA 4IKAA 3KK1B 1RJJA 2PI8A 5D4NA 2NYIA 1U2RA 4ID5B 1FDOA 1HBMA 1ZZFA 2L3MA 5DETA 5HP1A 1VJWA 2U2FA 4U6PA 2NUHA 1YNND 3H4DA 3PIOQ 3WBZA 3LW5C 1VRUA 4JI2F 1S6PB 2F7VA 2WOMB 1N5TA 3QIPA 1AA6A 5F3ZA 2K7JA 4OI4A 5T14A 4C8KA 4N8OA 3O6QA 3C46A 3TAQA 1IBKF 1Q79A 4K4ZA 5K14A 1SIZA 4OZLA 1GNKA 4I69A 2D9PA 4MKYA 2A6ED 2CPYA 2CYYA 1TAUA 1NU4A 1R43A 1TMOA 4OZJA 4USHA 5KFMA 1X5TA 2Y0SD 2YU9A 3CCES 4N8NA 2RQCA 2QA1A 2VG6A 4CRYG 2RD5C 1FXDA 1NHUA 3FRYA 4RW8B 3T1AA 4A8QA 3D0GE 2IVYA 5KAKA 1HBUB 4WCEQ 1B0PA 4KTQA 3VZHA 2XULA 2M52A 4FYDA 3ENQA 1GTEA 1HBNB 3A8EA 3KLEA 1UJ5A 3D1OA 2RH3A 2XSJB 4PPDA 1JK9B 5HO4A 2FJXA 4MAKA 1KD1T 5LT5A 1D0EA 1D9FA 3OFHA 5E33A 1Q16B 5K5MA 4DSEA 2G13A 2XY5A 1QM9A 1QCSA 3MCSA 4PQAA 5A8RA 1FJEB 4WIIA 4R25A 2VA2A 5KG3A 4IH6A 2IA0A 1S9GA 3KLIB 4IO9Q 2ZOGA 5KFEA 2X1FA 4YB6A 1TL1B 4A46A 2J6TA 1S1UA 2B6AB 3CF5Q 5HBMB 4DL3A 2MZSA 1LWFB 3TA0A 1N56A 3MI7X 3GV5B 1NKEA 1XMQF 5C42B 3THTA 1D9DA 2PFFB 2QYCA 3RB6A 2B51A 3OL6A 1PT0A 4ES3A 3LAKA 2KG1A 1LKZA 2MHEA 4IG3B 1K83A 2ZHAA 2VG7B 1S49A 2N7YA 2Q79A 3FNNA 3HHLA 4TYAA 3W2WA 1X5PA 2YNGA 4B17A 4PG6A 4FPRA 2XB2D 5JXSA 3WC0A 3OSNA 5AXMA 4NA2A 5A6PA 5KFDA 4URSA 3G8TA 3Q8QB 5K8MA 1SKSA 4KDLA 3PIPQ 1R7IA 2DGSA 3N0VA 2MQOA 2PC6A 2CJAA 3E51A 1TZ0A 1N5VA 2YKQA 2Z0GA 2D41A 1FRLA 1VMBA 1JLAA 2IHR1 4MYTA 1R31A 3MEGB 3D0IE 1EETA 4RX6A 4RNNA 3BR8A 3QZ7A 3OUYB 1QAXA 3GR1A 4JI7F 2KHDA 1V6HA 2BABA 1C1BA 4B3OA 2KZZA 5BYQA 1TL3B 1HARA 4ZPBA 1SUQA 4HH1A 3M6VA 2B7BB 1S0MA 2CDQA 4UQGA 4ZP8A 4G1PA 4ZP6A 2KYXA 4K5RA 1IKYA 2G5DA 2HVHA 3S01A 1VQ6S 2ZH7A 3N01A 4UW2A 1K1SA 1NJXA 3VQSA 4F2RA 4DV5F 3SCIE 3OTBA 5F8IA 3SSRA 1E6VB 3BEGB 2R9LA 2UUWA 2KRRA 4DDFA 4J9MA 1U4BA 3T3FA 1NJYA 5KFZA 3ZZOA 1ZPWX 3HHLD 3M9MB 2QFJA 5IZHA 3HHDA 5I3PA 4NRUA 3MM6A 1OO0B 3MM9B 1SJ1A 1FEHA 4DS5A 3SMZA 4MFBA 2GHVC 2RRBA 3POTB 2W8LA 4ED6A 4LF9F 3FMWA 1IQTA 1QSLA 2IAJA 4DSLA 2J8AA 4HTIA 4NA1A 2BRLA 2LKZA 3NP5A 2RMLA 3HM9A 5DYIA 5THWA 2GO9A 4NA3A 5K8PA 2WW8A 2WB4A 2DCUB 2R2RA 4ALZA 4N5SA 3R3TA 2HFNA 3JSBA 4DN0A 3JAMY 5EPPA 4LMZA 3PKMA 1HWJA 5KFWA 1RYRA 2F9JA 3V4IB 1SQEA 2E5LF 1SIWA 4V19J 3EXCX 3PFOA 1N5YA 4DSKA 1KS2A 3T19A 5FDLA 2VPYA 3VQTA 3CIMA 4RW6A 1TKDA 3H59A 2OIHA 1RT6A 3PW5A 1HD1A 4WFBQ 4DV0F 4BDPA 3SV3A 3DDKA 3MM5B 2RF2A 4M8LA 3W7BA 3FQKA 4O3OA 3ISZA 3H2LA 1YWXA 4ZCLA 5HP1B 1YITS 5EX0A 1KLMB 1FXRA 5T7LA 4RUCA 5M2RA 2ATLA 4FXWA 4JV1A 1JKHA 2MZQA 1KTVA 3G6VA 3QIPB 2MKSA 2XSFA 3E3XA 4NXMF 3KMSA 1TKTA 5J2PA 4MJKA 4ZCMA 4FZVA 5D77A 2FC9A 1BGXT 1S7HA 4DBQA 1JLFB 3CF2A 1QAYA 5K14B 2XY6A 4QCLA 4RW7A 4IDKA 2QA4S 2LXUA 3HXMA 3KTQA 2FHKA 4C97A 1MWZA 4FF4A 4ZPCA 1U48A 1HBOA 1ULRA 1SV5A 2AYBA 3HP6A 2RT3A 4J37A 3V4MA 3M8QA 3TI0A 1FRJA 2A2DA 5F3TA 2W9CA 5GAHU 4G1IA 4I4BA 4YQWA 3B4MA 2K8GA 1RT4A 5KOXA 1N5QA 2FGOA 4CO5A 3R1HA 4NLXA 2GMJA 1C0UA 2MJNA 4H54A 2VA3A 2G9OA 2NPIA 1JNRB 2E44A 4F3OA 3BSOA 3G71S 3IBWA 2DISA 5SUHA 1S4FA 3KLEB 2NXUA 1FNMA 1VQLS 1GXLA 4X62F 4JI6F 1FVQA 3NWGA 3OBIA 1LK5A 2XG8A 1RT5B 4ZPAA 5GADU 3QQ7A 1FT8A 4FXVA 4NLSA 1OS5A 3T6BA 4B9TA 4I1TA 3ZZZA 4KE5A 3HU2A 1U8SA 1ZAVA 2DCLA 2DHXA 3CJ5A 1YRXA 3JSRA 1YGYA 2E7ZA 2XBPA 4YDDB 3HKZA 1QY7A 3X3UA 1ZAXA 4WJBA 4J9NA 1N36F 4R8UA 5GAEI