4NOHA

1.5 angstrom crystal structure of putative lipoprotein from bacillus anthracis.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
ATGIVMYGDETGVQQTMDQYKDKIESQNKFEAKLGTVNEKKVLIMNKTTAEKMVKENMLKKVVKEDVEPIKALPAISDEAGIVFAKEEQKDVVIDGKKMKYEGNVVIGDARKYTDMYAVVSDAEYAKISEPVKTIGLASFKENPKEKIFPDIKRGSKVEEAHMVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.5 Angstrom Crystal Structure of Putative Lipoprotein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Lipid binding protein
molecule keywords Lipoprotein, putative
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17294 Lipoprotein_22 Uncharacterised lipoprotein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.60 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4nohA02
3.30.70.3060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nohA01
4NOHA
chains in the Genus database with same CATH superfamily
3ZTSA 2KI2A 1ICEB 4OLOA 2W9CB 4MKYA 1JLAA 2BZ2A 3TYTA 3IWLA 3DMJA 2R2UA 1FK9B 4CO1A 3C14A 2UV8A 1HR0F 1GH8A 1VC3B 4LSNA 4RUHA 3PIOQ 4E2FB 3FKBA 4MK8A 4IQMA 3PFOA 1RLCL 4Y00A 4DV1J 1P1TA 2WVCA 5GVQA 1RTZA 2KI8A 2DT9A 5ETLA 3VZIA 4QR1A 5F8IA 3CCQS 2FGCA 1H0HB 3H8YA 1WEZA 1DQ9A 3DOLA 3R7BB 2HVHA 2HRTA 3BEGB 4AVRA 4AL5A 2GZOA 5HP1B 4J9SA 1FDDA 2MKJA 4ENOA 5I3QA 2MZTA 2JEJA 1RWKB 3MAAB 5J2PA 2E9TA 4LBPA 4OL8A 4NX9A 3CJSA 5D0RA 3UVJB 2CQDA 1IM6A 4DPUA 2GNKA 2CZVC 2AYGA 2YU9A 3MEEB 2BXJA 3HFZB 3CD6S 4CT9A 3N0VA 4F67A 4DS5A 2ZKTA 3NNCA 2D3ZA 4ZPAA 1CULB 5C18A 2G9OA 2HNZB 2CPXA 2QT7A 4OJGA 3KK2A 1UA0A 2GCFA 2KXFA 4ZVTB 5CABA 2IM1A 3CCWA 3QYYA 4ANEA 4ZMMA 3MR2A 1RAAB 3NY0A 3W2VA 1JB0C 4C0OC 3BKTA 2FC8A 2Z30B 1C4CA 4P52A 4AYBA 3MPDA 4B08A 3RAQA 3DM2B 2G2YA 3L9ZA 2IM0A 4DZDA 4X4SA 3AODA 1N36F 3ETMA 4NE9C 2OSRA 1DLOB 4ZVOB 3OL8A 4G3IA 2RD5C 1JLBB 3EZOA 2GX8A 4C8LA 2IIHA 2O3DA 2R42A 2ZITA 2NSBA 2B8QA 2ZM6J 1UJ5A 1REVB 3BYPA 1NMEB 4DN0A 3HSGA 2FJAB 1YLEA 3W7BA 2CG4A 2F5GA 4RLEA 5AJ3F 4JV5F 3L95X 5A0YA 5KFZA 1RT6A 5HQ8A 1TWGA 3PX0A 3MM5A 2RSQA 2VODA 2ZH8A 3NMAA 5DQIA 2GHVC 1F9HA 1HMVA 1PAUB 2DBBA 2KT2A 1SIWA 3B82A 2JVRA 3N5BA 4R8UB 2IBKA 4DR2F 2NPFA 1D3WA 4C6AA 1KVKA 2H4YB 5K8PA 4ZP6A 3N01A 5F0UA 3VAMA 3OR2A 4QWDA 2GFFA 4V19X 4EGLA 1XNRF 4GKJF 1RQ0A 2HAFA 2B6AB 4YN3B 2XBPA 3QO9B 5HJYA 2XLJA 2QEXS 1T9WA 4XO0A 3GFZA 1K8AT 1LWFA 3J7ZT 3SCLE 1NZAA 3TZWA 2PIIA 4O0NA 2VBZA 1GQEA 2MYFA 2H5EA 3NGSA 4RUBA 5GAGU 2DHHA 1U1QA 1NJZA 1XNQF 1Q7YT 5DLGA 3MDFA 4M5NA 4U7CA 4JI4F 1GX6A 4LT6A 2W9BB 4IFYA 4C8KA 3CCMS 2VFRA 3MF5A 1DQ8A 2YKMB 3BM7A 4O4RA 2HFVA 5DM6Q 1PBUA 1QD1A 1U26A 4RKUC 4F4AA 2HRUA 1SJ3P 2B4OA 5D0GA 3H40A 1S5ZA 2RT3A 2M7SA 4ATNA 4U6PA 4GA6A 2DEJA 3EVMA 3HHLB 1CS4B 5HVFA 5LJ5Y 1TVRB 4C3MA 4ALZA 2XYGB 2FQQB 5M2UA 2J9EA 4DV3J 3EJMA 2VOOA 4MKBA 2C2NA 2BMBA 2DGUA 2CA9A 4UZCA 5T5ID 2IVMA 1URRA 3FGVA 4Z7YA 3D3BJ 2UV8G 3TAMA 3I9ZA 1S1TB 3FBFA 2WSEC 5AJ3J 2EXUA 3TJAA 1R0AB 3KLVA 3FFIB 1FRMA 1TKDA 3IR7A 2JA6A 4U67Q 3UVJA 5IM0A 1LKZA 1HI0P 3H98A 2MB0B 5J2QB 3C19A 1LEOA 1RT3A 5K8OA 2LYVA 2VJUA 1RT5A 2PDAA 2DNMA 3J81Y 1XK8A 5FTLA 1S1VA 4OI4A 5KFGA 2PEBA 2RRNA 4LF7F 3CJRA 2JX2A 3JSBA 1QVGR 3C46A 1OY9A 4NLXA 1CJUA 3CJ2A 2DO0A 3DNCA 1HBNB 3R97A 5CYJA 3I0RA 1U0SA 1RK8A 2VUGA 2YNIA 2YH1A 4TY8A 4WE1A 5CYQB 5HBMA 1YITS 3J7A1 1I5OB 4TYAA 4DI6A 3FBCA 5HVHA 2UUWA 2RDJA 2PJJA 4QQBA 3G4SS 1K47A 2DPJA 3SUJA 3C16B 2ZH6A 4DV6F 2DRBA 2BDPA 2NVXA 1F9FA 1EARA 3IXQA 2R9LA 3GFHA 1QM9A 1YJTA 2GHPA 2QL7B 4LFBJ 4ECTA 2HBYB 4FP9A 1N33F 1HQEB 2IRXA 2ATCB 3CCTA 3HI9A 2BM1A 3GP9A 3T1HF 2W2OP 4EO6A 1KR4A 3TQ1A 3QQ8A 2YNIB 1OQ6A 2O66A 2PI5A 1UVNA 5HBMB 2QO3A 2CADA 3K2YA 2ADBA 3EE3A 2YNGB 4CP5A 3OTOJ 2GGPB 4IRKA 2XB2D 2IMOA 3NCQA 3AOBA 1EU1A 3P49B 2CIMA 2DCUB 1S1WB 2HFUA 3MAHA 4DR4F 5A8KB 3CB4A 2DD8S 3OR2B 1S1XB 2EFGA 1WOOA 2H54B 4FNHA 4J5OA 4P2MA 3OTBA 4KO0A 4M1KA 5FLXY 4G6VB 4DR1J 2FZGB 4NYOA 1HQEA 2E1AA 2RQMA 3CNQP 3PYDA 1RT5B 3LOUA 3HX9A 3QT7A 3R9LA 4FF3A 2ZUGA 4KPCA 3GSIA 4CLWA 4B9SA 2VDIA 1HD0A 1KC8T 2DNZA 5KFFA 2LKZA 1JJCB 3NNAA 2HVDA 3H0PA 3ZNJ1 2BR0A 4B3OA 3TP2A 4DEZA 4PG8A 2XEXA 4Y2KA 2WVDA 2GC8A 3B4MA 4GVBA 3HU2A 2FY1A 2NXCA 2VPWA 4Q2MA 3UD5A 1EX8A 5B0DA 3OTEA 5CZXA 2NVYA 1QAIA 3R5JB 2OI2A 4B3RJ 3TEGA 5LMUJ 3QLHA 5IC4B 5GM9A 1TMOA 3AJ2A 3R5CA 1XTZA 2H9ZA 5KFVA 3KLHA 1FJGJ 5A8RA 2CPDA 2G2OA 3GTYX 4W90B 2XS5A 2GMLA 4HL9A 5D4NA 3ILOA 3F41A 2ZBRA 5KFHA 3Q8PB 2BKOA 4HHJA 4B3OB 5C5JA 4NLSA 5CD4H 3L7UA 1PO6A 1QY7A 2QLWA 1YQHA 2B7BB 2Y1LB 5ETSA 3ZZ0A 3V4IB 1U24A 2KT5A 4HH0A 3M2UA 1U02A 4FPRA 4AQYF 1MW7A 4DWIA 2EBGA 4L74A 2GQ2A 4N47A 4ZCMA 5E3AA 3TQEA 2LLZA 1FTRA 3AD8C 3UI3A 3CQZA 3G6YA 3HZGA 4KDLA 4X4UA 4DR5J 3DDIA 2JFKA 3HVTB 2HGNA 3FZ2A 3BH6B 3W2WB 1JJHA 1MN9A 3BYRA 4H4OA 4ES3A 1F3VA 3IN5A 1IBKF 4IH5A 1T94A 1DTTB 3FVYA 1WKKA 1SC1B 2VPZA 1G8JA 3M4XA 1P6TA 3QIPB 5A76A 1FWPA 2QTWA 1KQKA 1HBOA 4DX8H 3AXMA 1NPRA 1Z1ZA 2FVCA 4OYZA 1VCTA 1MU2B 1S6UA 1RA6A 4F4KA 3MM7B 5I4MA 4GKKJ 2LU2A 4ICLA 3AHPA 2G0JA 4LF4F 4OI3A 3SYZA 3TJ9A 4BWMA 2HWTA 1ZPVA 4KGKA 2CUYA 4JI6F 3KK1A 3V81B 1HNXJ 1BQNA 3H2LA 4TVAB 5KG3A 3V6JA 1OPZA 3QWUA 4DXLA 2G4BA 3X2KA 4MYUA 2HLUA 4CLTA 2Y1JA 2RDDA 2RUGA 4FVCA 4DS4A 4NA2A 5F8NA 3M2VB 3EUNA 4B17A 1KLMA 4ZLJA 3IWNC 4M63A 4R0JA 3W9HA 4OI2A 4TQSA 4B3SF 3ENGA 1SPBP 2VG5B 2V50A 3CJ0A 2ZH2A 1QAJA 2LA6A 3MMBA 4RBTA 3M8PA 4JI7J 1V5VA 4ED5A 1U4BA 1DMRA 3H4BA 5C25B 2F40A 3G6VA 4OYWA 3CXCR 4QIVA 3AD7C 5E3PA 1FNMA 2HZCA 2ZFHA 4QR2A 2AJQA 2VASA 2WONA 3KJVA 3T1HJ 4K4VA 3F73A 2GJFA 4DLGA 2E5LJ 2JA5A 2RU9A 4DPOA 5ADZA 4FS1A 3H5XA 2KKHA 4PXBA 2XY7A 2AEFA 2AD9A 3W64A 1TKTA 5EX3A 1MN7A 3H0GA 4HHUA 4O3QA 2C2OB 1Q8IA 1VIOA 1ZM4A 1QTMA 1R27B 5L8RC 3HSJA 3PZPA 1VBYA 5AE3A 5A2QU 1C1CA 2PE8A 3GJSB 1IR2A 1FFSB 5E41A 3GTLA 2BQRA 4PQUB 2N4CA 2GMHA 4RV0A 2QV6A 3CWJA 5H4UA 2VB6A 4KKOA 4W98A 2VJVA 4W4MA 2RU3A 4BHQA 3RBEA 2RAQA 2DGOA 3UDEA 1N5SA 5KTQA 3W3SA 5KT3A 2V69A 3QBCA 4URSA 1K1SA 4W92B 3QLHB 1E5VA 1FI4A 4ILLA 3GTPA 1JLGA 1IXKA 2MQQA 1L3SA 4KJIA 4K0KF 1RAJA 1PT1A 2O5DA 3GTQA 3GV8B 5LMNF 2DPIA 1IR0A 1WOSA 5ETKA 3A8JA 1YVFA 3H7HB 3R27A 4MT1A 3Q8SB 4DPYA 1PYTA 4NLOA 1TL1A 2OAUA 4RW8B 3NXZA 4X4QA 2LFVA 2YX4A 4YUDA 3BKFA 5J1PA 1C1BA 2D41A 2ZDPA 1SL1A 1T8EA 4YDDB 4B9LA 3X2MA 4NXMJ 3K58A 1UZDA 4CO4A 4DX7A 1KFSA 1H7WA 2WONB 1ZZFA 2LQ8A 4CO0A 1KOOA 2CDRB 1FE4A 2IJRA 1IKVB 2K06A 1DAXA 3KK3A 4DFKA 1GMUA 2HKEA 4G1QB 2E2HA 3FQLA 3MTKA 3OXGA 2Y0SA 5KFBA 3ET6A 4URGA 2OEKA 5J1EA 3RB6A 4F3OA 4X4NA 1FF2A 1Y9OA 3QT6A 4GKJJ 5FJ4A 1WC0A 1HPZA 1N88A 2RQKA 3CO0P 2QSFA 1TVRA 4OYIA 3MEGA 3E01A 1F0XA 1HBOB 1R8AA 3HU3A 1FKOB 3DRYA 4GO5X 3AJDA 3G8SA 2NR0A 3PV8A 1E6VB 2BRKA 1TWAA 2HNYA 3NGRA 4L72B 1N32J 1NSAA 2BA9A 1TKXB 4LR7A 4PWUA 2L9WA 3NWGA 3AJ1A 1QUVA 4DBQA 4DMRA 2HAIA 2UVUA 3PW0A 1HPZB 4LRBA 5T41A 3DLHA 3ML1A 5HI7A 2MZRA 3P45B 3PKYA 3FEXB 2VBYA 3GONA 4YB5A 1QDNA 1XNRJ 1VQSA 2HHSA 1FERA 1SBRA 3CF2A 2HNYB 3KNGA 1PYSB 5KFUA 4QWBA 3TOQA 1R89A 4K4WA 1X4AA 2WW8A 4KYZA 4N77A 5B09A 1ZOTA 1SJRA 2ILYA 4PG7A 5B7WA 5DG7A 5E3RA 4JI4J 3HMJG 1CULA 4KTQA 4UOGA 2LP4A 4FVMA 3DRRB 1KOHA 2IHR1 1F5CA 3IRWP 5DZ7A 2MZ1A 1U49A 3MM6A 4LBHA 5IQQA 1NB2A 2J8AA 4ECZA 1XBWA 4LRAA 1FRJA 2YWKA 1VRTB 2RE1A 1T11A 3U1NA 2XSJA 4HEA9 4WP9A 3SXLA 4DG1A 3PRBA 2V63A 2VG7A 2CPFA 3X2HA 3U02A 3T1YF 5L1IA 1N10A 4NLQA 4IG0A 2CQGA 2ZOGA 2D69A 2MTLA 3S6EA 2ZHOA 4LQ3A 2LXUA 4AXJA 1WLFA 4N5SA 5HLFA 4P7VA 3EVOA 3CCUS 2OH2A 1FDBA 4OI6A 4DR4J 3AT1B 3T5KA 1R43A 2E29A 2M2BA 3NLCA 4KV8A 4NXNJ 3JTNA 3SDEB 1LFPA 5A6PA 3WX4A 2QX0A 4EFAC 2VC1A 4OX9J 2PA3A 2LMIA 4B3RF 2FD2A 2D3O1 4JV5J 5GLYA 3M30B 3FEZA 5ETTA 2BE2B 1LWFB 4LVOP 4USWA 5F0WA 4IFVB 3SQOP 2XHWA 1Y1VA 3TX8A 3PY8A 4LF5F 5DDPC 4P73A 1NJIT 1FX4A 1LWCB 3FC9A 3KJQB 3Q2SC 1LNQA 4I69A 2ZJPQ 3MM6B 1QAXA 5KT6A 4ECYA 1WORA 1HLWA 5IXUA 1TL3A 4IFYB 1D9DA 1UVKA 5A8RB 1RA7A 3UQSA 1VBXA 2GIQA 2CNOB 4CCHA 2NCKL 3C15A 3HKZA 4GRSA 1HNVB 2BJ8A 3K89A 3GTKA 4KRWA 1SFOA 3LAMA 3MFIA 1N54B 5AXMA 4B3TF 4LF8J 5A2QY 3K5OA 2OELA 3T6BA 1H5NA 2XM3A 1RTIB 1R6YA 4ID5B 3BGOP 2CQ4A 2B6AA 4RW4B 2DTJA 4PABA 3QQ7A 1OQ3A 1WHYA 4QZVB 5DO2A 4AFFA 4JJOA 5BR8J 1X4HA 2HHHJ 1QSYA 3DLBA 2U2FA 3TAMB 3NCPA 2OTJS 1UFWA 4TU9A 1CQMA 4N76A 3WQPA 1WACA 2A10A 2EFNA 2DNQA 3CEDA 3D68A 3DLEA 4FKYA 2W8LA 2FVRA 1FDIA 1YJRA 2RHSB 3ITHB 4KGXB 4UUWA 1T3OA 1P27B 1T03A 2ZE2B 2FB0A 2YUJA 3MMAA 4ED4A 1IBMJ 1KHWA 4NI2A 3NGUA 2OHDA 1RAEB 1RT3B 3CMAS 3QFHA 2MGZA 1NPKA 4DU7A 4L75A 4ECUA 1OIAA 2BUNA 4P2FA 1U25A 2E5HA 4ZCLA 5KAKA 1U0HB 1WDDA 1CZ5A 1GEHA 2ABYA 3L3CA 4N7TA 4A8XA 1SQGA 2B9XA 1RSCA 3NAHA 2JIPA 4B9TA 1UCNA 1YHQS 4C0BA 3VZHA 2NXJA 3KUHA 4HYKA 1KN6A 2GAHC 3MMCB 2R2TA 2BQUA 3BREA 2FVQA 4WYLA 2M52A 2FLOA 5DRKA 2ZNYA 4CH7A 4IG3B 4ELVA 4CT8A 2UVVA 1WHWA 2N3OA 5D8HB 1S9FA 1OJ4A 4CI0B 4CRJA 4L76A 2P6SA 1IQZA 2JEFA 2KFZA 2WBRA 2E9RX 2BANA 3QO9A 1GNKA 5T7LB 1WG1A 4EEYA 2XMJA 3AQPA 3BJYA 3BR8A 1FDAA 2V8GA 1GX5A 1Y0HA 3CJ8A 2UXDF 3MXHP 2KDOA 2EFVA 5DYGA 1CJKB 2H3EB 3R2CJ 1HQ2A 4YS2A 4LF2A 4MJKA 4AT1B 3LWLA 5I42A 1NJWA 4WFBQ 1VQ9S 2QA2A 1JXEA 3PEHA 1CR5A 5A8WA 3VTIA 2UXCJ 1AW8B 1D0EA 1QE1B 1SV5B 5CYMB 2VBXA 3OHAA 2QMWA 1CVJA 5EDWA 1R27A 3IBFB 3DLLQ 3GIJA 1NSKL 3RB4A 1H74A 1EETA 3CDUA 4QJVA 4S0MA 4YDXA 5HAOA 4AONB 1H2VZ 3X1LB 4K2XA 4U8YA 2F3JA 3FRZA 3FKIA 3NGTA 4AUKA 1BQMA 3E2EA 2XWYA 7AT1B 3C6TA 3A3OB 4X62F 2C42A 2Z58B 4B3MF 2RF2A 2E9ZA 4ZVHA 4PWWA 5E0OA 1Q95G 5B0EA 3MMCA 5SUHA 4JI2F 2L9DA 2JEIA 2V3VA 1VRUA 3KFWX 2OD4A 1PJ5A 4FN5A 3WIVA 4DX6A 4LRCA 3T3FA 3DLGB 2AYBA 2VIHA 2AX0A 3JQJA 4R25A 4Q8EA 1REVA 2DNOA 5IM0B 3IA0A 3M6VA 3LGMA 2HMIB 4DX5A 4NLPA 5LXRA 2Z57B 1ZAVA 2DR9A 1TKZB 1S6QB 1FKAF 1P9YA 4NZ6A 3TUJC 1DTQA 4A8OA 4MAKA 2OP5A 1N34F 1BGXT 1RCXB 2RDIA 4RW7B 3DGVA 1S4FA 1IWGA 1ZA2B 3QPIA 3DFEA 4WWSA 2X3GA 4YP3A 4FG2A 2A69D 1X8DA 3ZZZA 4YB6A 3CCVS 1WDTA 6FD1A 2HNDB 3D9BA 5ETMA 3TZYA 3Q8QB 5KFJA 4CIOA 1Q79A 4JP7A 1YJVA 3D1OA 1NAQA 2FJDB 3H2UB 3MOZA 1ZH5A 4LSLA 3KOAA 1FX2A 1Y4ZB 2LA4A 5KFKA 4USJC 1S79A 2B56A 3TZXA 1NJYA 4ZLLA 2V0NA 1RABB 3IRXA 1X5OA 4ECSA 4ECVA 5E33A 1NK0A 2HWHA 3KG1A 3P3DA 2HCZX 4JI3F 5L9NA 1JKHA 1HWIA 1QDUB 1RCOB 4CH1A 3CC2S 1Y5IB 2JNJA 3IR5B 4F4ZA 3PM9A 4J9QA 3M32B 4LREA 1SIZA 4N41A 2L9NA 2J7UA 8AT1B 2WRMA 2KVIA 2ZOMA 1D09B 2X1FA 2CQ2A 3D30A 1XN9A 3GYNA 4GKKF 1GMVA 3R7SB 3QJLA 3F56A 1HWLA 5D77A 2ERRA 4RW9A 5GLXA 4JBCA 1YKWA 4OYXA 4CDIA 4QIEA 2EK6A 1M1GA 3MPUB 3PEJA 4UW2A 3OHBA 2C1EB 3VAJA 4DR2J 1FRLA 4WK3A 2V2KA 3KMSA 3SBMA 4NCGA 4LF4J 2FJWA 1UWBB 2QLJB 3OR1A 1VDHA 4USKA 3ZZYA 4DR5F 1RHJB 2XZTB 1R0AA 3KJVB 3NNHA 3TIWA 1X9WA 1ZM2A 4IUFA 2C2MB 4GVBB 1XMOF 3MGJA 4RO0A 3TJ8A 1SVDA 1BD6A 3UWTA 2ZWOA 3GB0A 3CULA 5I3PA 1FXDA 1RISA 1TKTB 4EMDA 3ICLA 5G4DA 1W2IA 1ZYQA 2CPZA 2XLIA 1UZHA 5ETVA 5ETPA 1JLEB 5B0FA 1PAEX 2PA8D 4NLDA 4C4WA 5T5MD 4PKDB 3ZTQA 4YQWA 1WTFA 3IAM9 2G2ZA 5L1KA 4DL0C 2KL8A 4AQYJ 3BN4A 1U7LA 3THTA 4IYQA 1FXLA 4KB7A 1Y5IA 5KG1A 2D7SA 3PO4A 5EHHA 1RWWB 2MPUA 3TWZA 3OFHA 5D4LA 1C0UA 3M2UB 5DS7A 1X4CA 3PVXA 4QR0A 2M5YA 3C6UB 3DHXA 1I50A 4U8VA 1HHTP 2PT0A 4ED1A 1FJGF 1AB8A 2ENGA 2NXEA 3KUGA 2F4VF 2M3DA 3SFGA 2W8KA 5F8LA 1KHVA 4LSZB 5SZTA 5L1LA 2UVWA 4C7QA 3HXMA 2ACYA 3CJKB 3LW5C 2QFJA 1RYRA 4OHVA 4AOKB 2AQ4A 4X4PA 4PCQA 3G82B 5KFNA 1CS4A 5GMEA 1PYOB 1U1RA 3HSDA 4HI1A 2BOPA 3NGKA 1OPIA 3KLGA 2UUAJ 3QJPA 3X3UA 3H5SA 2UUCJ 2XG8A 4TYBA 4USIA 1S1XA 1LW0A 2G13A 2VZ9A 3DRXA 5MLCV 5EUHA 1VR6A 1MMLA 1Q8BA 3MCNA 4LSNB 1BY9A 1ROFA 3QGPA 3GR0A 1BQNB 2YKNA 3OVSA 1YTYA 5F9NA 4JI1F 3LH2S 5HROB 3PR5B 3MR3A 2HHWA 2HFSA 2GQQA 2HQCA 2NYHA 4ZJLA 4LIWA 3UN3A 3RR7A 1RAFB 2K7KA 2JL9A 2PMWA 3H25A 3OSPA 4A8YA 4O3RA 3HT0A 1X0PA 5HJXA 3MMBB 3X2IA 2GIRA 3KTQA 4DU8A 3EYZA 2GVDA 3I82A 4EUVA 1HWKA 4ED6A 3U27A 1KQGB 1T0TV 2DB1A 3IG1B 3MAAA 4H4KA 1C0UB 3MPYA 4KH1B 5J2PB 4ECXA 1H73A 1R0CB 3D28A 3OFEA 4I68A 1SCJB 3V6HA 1N33J 3HHLC 4P6QA 3M1VB 3PJWA 1QVFR 4TY8B 1UPPA 4WE1B 3AY0A 1GFWB 5K8NA 2AEMA 3MEEA 3OTCA 1F9EB 4OX7A 1U1NA 5DJBA 1S59A 1R0BG 2OFHX 4NWBA 5FIIA 5K5MA 3N4WA 2CAJA 2XZWA 5KFOA 2HVIA 4UQTA 2YWHA 1YRXA 5IOLA 1EZZB 2E7ZA 4ES2A 1T05B 4ZPDA 1XR7A 2W9AA 5BYSA 2ZH7A 4B9UA 1CLFA 4RBUA 2DXEA 4OIXA 4OQJA 4YHHJ 3HULA 3O5AA 1JXVA 1LK5A 3DOLB 3I5BA 4YB7A 4OYPA 1Y3KA 4JV1A 5L1JA 3DU6A 2R3VA 4AL6A 4PWDB 2O67A 2L41A 2NYIA 1ZM9A 2YNGA 3CTRA 1S3SA 2EKYA 4J9LA 4QU6A 3IM9A 2JZ5A 2WB1A 1O6XA 4KQZA 1WHXA 3UNYA 2CNKB 2P9GA 3HU1A 2CQBA 2AWZA 4PXEA 4PAAA 5KG6A 4AD6A 1A7GE 4EU0A 6AT1B 1FKPA 4Q44A 2ZH1A 1RHKB 2WSFC 4C11B 2AGQA 5FTMA 2DRDA 3W62A 3Q8YA 4F26A 4PWDA 1TAQA 4CH0S 2VPYB 3VQTA 4DCPB 1VHIA 3OUYB 2GVDB 2OPRB 4C3LA 4KC5A 2YY3A 3K59A 2AJ2A 3SULA 3G9CA 4FZVA 1NKEA 3O6QA 3RG6A 3IR7B 5AE2A 1X5TA 3DM2A 3RZAA 4M8LA 2ROEA 4ANDA 2BW7A 2ZBIA 3E8OA 5LSLA 1AA1B 3X2NA 1YGYA 3TUPA 3CCLS 1DZ5A 3QZ8A 2OTLS 2IC3B 2FUG9 3AB4B 2WCXA 5HMWA 2FZKB 4OHYA 1SB6A 4H4MA 4RU2A 5F8JA 4RW6B 5JJBA 1VQPS 1JXLA 3PDNA 2E1PA 2OO4A 4USVA 1MWZA 2HK3A 2XHCA 3K5PA 4OMFG 1U6BA 3IMQJ 1HBNA 2ZM6F 1D1UA 4FYYB 1E6YB 1FCAA 1X4GA 3EXYA 3QRQA 1TTHB 1JNRB 2YQ1A 3ZC4A 2V8PA 2DGXA 4CO3A 3KYLA 4C9DA 1O5JA 1WC1A 1PBAA 4MYTA 2PD1A 2VHGA 3TAQA 3NKYA 1VC6A 1VISA 3DCAA 1UW9A 3LP0A 2XY6A 2ZHAA 4QIWA 1T9YA 2M8DB 2KU7A 4KV8B 1NBEB 1CEZA 4K59A 4C11A 1M5SA 2DXFA 1CC7A 4N8NA 1HNZJ 4B9MA 3FSIA 3GR1A 2ZD1A 4P9SA 1E32A 1RAOA 2NPIA 2VICA 3OUYA 2UUCF 1AZSA 3KJNB 2CWXA 2YTCA 3IG1A 1CJVB 3AD9C 2JA7A 4OYAA 1PC5A 3Q24A 1FRIA 1VQ5S 2YNFA 1D8ZA 2FC9A 2U1AA 2XMMA 2ASDA 2HSEB 4C8MA 4DR6J 2QMXA 3OLBA 3VR1A 1V3SA 3M3GA 4F25A 3EZUA 2KQAA 2D3OR 1MMNA 3X2JA 1TQLA 1REGX 2C3PA 1S1UB 1YLXA 2VU5A 3DRPA 4DQSA 2F4VJ 4RW8A 4CLYA 2AJ4A 3J7AN 1HWUA 1VLOA 4Q0BB 3JQKA 4K4XA 4K4YA 3IBWA 2EEOB 1HW8A 2GAGC 4EBDA 4J9VA 1TELA 4DV5J 1Q8KA 1CJUB 4HT5A 4CYUA 1LV5A 3OPKA 3GMGA 2J0WA 1IBMF 1I1GA 3MD3A 2P9CA 2VQFJ 4XPCA 3QSYB 4J9RA 1HBUA 1Q78A 2VQEJ 2XYPB 2J7KA 3DOMB 4DQPA 2XCAA 4I7FA 1H2UX 3UDLA 1U1KA 1YZ6A 1HD1A 5IV4A 2HZVA 4OHZA 3JQMA 4X66J 3ZXWA 1D8YA 3H5YA 1TK0A 5JVGQ 4ECWA 3QC8A 1H72C 2MEWA 2OEJA 3QGGA 1UVJA 3ONQA 2XMUA 1OY6A 4TKTA 3MUVP 4QYZK 2X1GA 3HFKA 4DR3J 1FVSA 3GSDA 5DDQC 1IKXA 3HKWA 3BQ2A 1N36J 3LTOA 2Z2YB 2B51A 2KT3A 2VC0A 1Y10A 1UWBA 1SUQB 2DY1A 4ZPVR 2ADCA 2OJ3A 3DU5A 4N56A 3BB5A 4EYHB 5KFEA 2VQFF 3Q2TC 3S01A 2W2QP 3I0SB 4ED3A 2V2VA 2YNFB 4KKOB 1WC6A 4ZVQB 4FG4A 4FBTA 5F3TA 5AE1A 4GC7A 5GADU 1M1KT 1WC2A 1TK8A 3SCIE 1WG4A 4UT4A 4LF5J 1XR6A 3DLKA 1LWXA 2IV2X 1DLOA 4IH6A 2AE0X 4DR6F 5L38A 3G8QA 3IM8A 3PG9A 2GVZA 5GMDA 5CCMA 3K5MA 3PYGA 1VYAA 1T7PA 3PJXA 1V5IB 5LM7E 1NRKA 2PI8A 4GC6A 1B0PA 2F9DA 2MXYA 2Z56B 2F8EX 1RT4B 1IWAA 2Y1RI 3UFCX 1SH0A 2WZ1A 3RB0A 2E1CA 2MHNA 2DKOB 4DL5A 1BWEA 5F8GA 1YK9A 4DUZJ 1RZMA 2J9DA 2DXDA 2MSTA 1KQFB 2JLFA 2MQLA 2ALZA 3HVAA 4OJ1A 3CCJS 1UTAA 4IH7A 1VRTA 3UE2A 1KLNA 2IM2A 1FRHA 2H65B 4JYAF 3E51A 4G1QA 1OWXA 1S6OA 1U09A 3OXLA 4R8UA 1RWMB 1Q16B 2UUTA 4YY3J 3BGUA 1LW2B 3ITHA 3NOGA 2PFDA 4R0EA 3N5FA 2YH0A 3GILA 3G82A 1FESA 2G1HA 1RACB 3KUEA 4FF1A 3BO2A 3QAEA 3MEGB 2MZSA 3O8WA 1SUQA 2EC2A 3M8ZA 5KFTA 4WFYA 1FE0A 1S9GA 2I1RA 3GG1A 2IRUA 3QWPA 3W9JA 3HHNB 1OSCA 1DTQB 2HG4A 2Q1LA 2CQHA 2HQDA 1DJ0A 5E5NA 3G6XA 2EPIA 5D0HA 3AOCA 4ECQA 4K50A 4RNHA 1VQOS 4KAIA 3ZZOA 1Q16A 1UWAA 2PMZD 5LJ3Y 2F63A 2J0SD 1FWLA 2FY8A 5DYIA 1S1UA 2N3LA 3NRBA 1S7HA 3Q89A 5IZHA 1DTTA 4BS2A 2YKMA 4OJHA 1UVIA 3FNNA 3UO0A 2KM8C 2UVRA 3TARA 1VRUB 3N6NA 1RKJA 2CNNB 4AAYA 2H4WB 3IR6A 1RHUB 3CW2C 1NO8A 2BX6A 5JXSA 1JWWA 2RHQB 3VAKA 2BM0A 2H5JB 2KJWA 2XMTA 2NXUA 2V4JA 3BBFA 2WW4A 1N34J 5MAOA 1NDLA 2VFSA 3MEKA 1TKZA 2DITA 5G0RB 3QGHA 2IPOB 3I9V9 5K8MA 2J6SA 5D4PA 1VIXA 4LJMA 2NQPA 3IP0A 2EFPA 5HANA 3PKMA 1IUJA 2AIRB 3JAMU 2IJNA 3O1LA 4O3OA 1B64A 1RHQB 3R3TA 1EHWA 1YG0A 4NMLA 1APSA 3FCVA 3DMJB 4F02A 5A8WB 1RAIB 5D0EA 1T05A 4DL6A 3PYFA 3MWBA 4RJVA 3PTWA 3ZZUA 3WHIA 4DZ6A 3EM1A 5C25A 1F2HA 4X65F 5FTNA 2HS3A 2M9KA 1SQFA 4DHVA 2I5JA 3QWZA 1LXNA 3PHEA 4I2QB 1KS2A 4ID8A 4NA1A 1M5PC 4OI1A 1MNEA 3WIUA 2AGOA 1G3OA 1RTHB 4DSIA 2C2RA 3AAWB 1ZYRD 4FYWB 3BBCA 3OJUA 3VGTA 3MECB 3HKZD 4WFNQ 5FTKA 3NS7B 3ET6B 2QE5A 2XTJP 5DZ6A 3T41A 5J1EB 3PIPQ 2AGPA 3X2OA 2HWIA 3ADAC 2E7XA 2IBOA 3M32A 1XJWB 2QMUB 2UZAA 2YWFA 4NXMF 2F7VA 1WD6A 1WKLA 4CLPA 1U1LA 3TANA 3QAUA 3JSMB 1MROB 2YX7A 3DN9A 1UFKA 4XIUA 3BO3A 3BSCA 3A4TA 1BXNA 1RP5A 1VHFA 2EBEA 2KVQE 1WNEA 2BJ9A 3HF5A 2ZVSA 2A0FB 3RBDA 3CMES 3W8PA 1PYQA 2HNZA 1F60B 2RJZA 1U47A 1HNIA 1CPZA 4F4YA 4DQIA 4KIAA 4KBIA 1LWCA 3M6XA 1A0OB 3CD0A 2CQ0A 5IT0A 2A6ED 3OR1B 1RT7A 4OV6A 2DNPA 1DHMA 1RAGB 2CYYA 3IWXA 5HSPA 3M6UA 3QGIA 3KMQA 1S97A 3JTOA 1VQNS 3Q0AA 2BEFA 4B9NA 1GAOA 1N52B 3CJ5A 3KDNA 4P74A 3ZNUA 1UMJA 3PLXB 1PPYA 1FVQA 3RR8A 1S4EA 3I5CA 2DNNA 4K2JA 3CJKA 3KLEB 2ZH5A 2A6HD 2O5JD 2YBVA 4DSJA 4PQUA 1RTDB 1EQ0A 2MKYA 4HHHA 1RDRA 3H42A 3US5A 3H20A 4RW4A 1V9OA 1EQMA 4ES1A 3SFUA 1K0TA 2WAQA 1NLKL 1TV6A 2IDEA 4C8NA 4F0KA 3H90A 5I42B 4JYAJ 2UXBJ 3BSAA 2FJBB 3MM8B 3DOKB 1TFWA 3IR5A 2DMRA 1FEEA 2B43A 1NU4A 1PG5B 2PNWA 4HDGA 2EFQA 5KFMA 1NZ8A 2BACA 2C22A 2M8HA 1JLAB 1FT8A 1NK4A 1S0OA 3HO1A 2BOAA 1T03B 3SI8A 4Y2CA 2YKQA 2AW0A 2VFVA 4O44B 4WU3A 4A47A 1WOPA 3HFVA 1WSRA 1TUVA 4U7UD 3THPA 5KFPA 3C3LA 1J2VA 1JQGA 4DUYJ 4DV7J 4XPEA 4DSLA 2DGSA 2V8HA 2KM8B 3I55S 4WKYA 3JYTA 5ETRA 2W7PA 5HK4A 3QT8A 3FCWA 4QWAA 1HNXF 2VKZG 3IGNA 4ZHRB 1U45A 2I9SA 2J6UA 4X4RA 2X1AA 3LWMA 3HPOA 1FNXH 2ROPA 2DNLA 2KH9A 4M5IA 1H6KX 1NXIA 2MQPA 2HMIA 3I4PA 4RPFA 1IVZA 3X2GA 3J80U 2ZC4A 4QPTA 4OZLA 3D6FB 5K20B 5IS2A 1SC4B 1N5VA 1ZBTA 3K8VA 3MOJB 1BE4A 1RTDA 2R93A 2C3UA 2VPZB 3VHQA 4DPXA 1N4LA 1QCSA 1SKRA 1IKYA 2HHTA 1KFDA 2GO9A 4NL5A 5GADI 1L3TA 3UR0A 1TWCA 1XQIA 1VJQA 4LRDA 4CLFA 4DN9A 3IS9B 1CJKA 2B4VA 2G1DA 3DYAA 1UKUA 1UAWA 1JNZB 3POTA 2XWXA 2YWGA 2ZJQQ 1SJQA 1OA9A 2A18A 2YX1A 3FSYA 2Y1IA 2VBWA 5CCLA 2AU0A 5H9FJ 1JX4A 2J6TA 4QCLA 2BE9B 2Q43A 4AXIA 4TQRA 3RYLA 4KFBB 1Y3JA 4P2SA 3T9NA 1IM4A 1AROP 5GAGI 1K83A 2BE7D 3KLIB 3Q8VA 3PW5A 2ZOFA 1HYSA 3V4MA 3FJ2A 1IQTA 2Z4PA 4IOAQ 1YRUA 2CQ3A 4K4TA 2FJEB 1I94F 1RT2A 5F8HA 1U8SA 3DLEB 3MPVA 3POTB 1RT7B 3ZTOA 4A8QA 2LEPA 3DDNA 5B6CA 2P2CB 3AOAA 3TVKA 3H59A 1T9UA 4PUOB 4O0IA 5L9XA 3T5LA 1X0FA 2OEMA 3D3CJ 4M5LA 4CNZA 1HYSB 3JSYA 2BE2A 3GWCA 5F3ZA 1G8KA 3LUYA 4XTTA 2LDIA 4UF4A 3KLEA 1X5SA 1KQSR 3AA9A 2W4DA 3MD1A 1NKCA 3PR4A 5KFDA 4NCGB 2AJ0A 2PFFB 2WHOA 2ALYB 2KXHA 2LXFA 2Z0GA 3ZZRA 4JI8F 2DR7A 2UUBF 1IJFB 2DH9A 3DOKA 1HHSA 1PCAA 2CG8A 2OPRA 4NZ0A 4WTYA 1UVMA 2FHJD 3D54A 4XDCA 1J5OA 2MQOA 3TUZC 4F3QA 5A8KA 1O51A 1RWXB 1ULRA 3PCOB 4R5PB 2DVIA 3CPWR 5FTJA 2W9BA 1HR0J 4Q8FA 1KONA 4M5DA 5L46A 1R8PA 4CLKA 1WF2A 2XSFA 4KODA 1IN0A 2I38A 2FHJA 3A8KA 1VK8A 4OZ5A 2HS4A 3PW7A 1HKAA 2Q6CA 1RLDA 1EB0A 2F8MA 2VKRA 2V8DA 3UNGC 2XCPA 4JI2J 1GT8A 3RUBL 5EN1A 3MR5A 3ZTRA 1FJEB 2V9WA 1C1BB 3TA0A 4ED2A 1LOUA 1NH8A 5JUMA 4C8ZA 4ZPTR 5K14B 4JB8B 5D4OA 2HGLA 7FDRA 2NYAA 5KFLA 1S48A 3GLJA 2HK2A 4CM0A 1B0TA 4ZK7M 1TL5A 5T14A 1VQ7S 4DSFA 2LVWA 2MGZB 1Q81T 3CDWA 4DPWA 5C42A 2BYCA 1HL6A 4O3NA 2OPPA 1DARA 1Y11A 2CJAA 4PXCA 2CJYB 2W1BA 4NYZA 4ETXA 1RI7A 4Y0FA 4BBYA 4OX8A 1SQEA 3BBBA 4LFAJ 5CQGA 2V2ZA 5K14A 1RU1A 2WK4A 4A8WA 2A2CA 1RXOB 2R4FA 1HBUB 4NLWA 4D3HA 2CPYA 2KHDA 3LP2A 3EWGA 2DNGA 5CA5A 2P5VA 1SKUB 1FFGB 4DL2A 5DGAA 3QRRA 2E1MC 3DRSA 5H9FK 2ILZA 1S77D 4I6AA 4NEYA 3ISND 2VONA 2OPQA 4LBIA 4KDIA 1FEHA 1TMJA 1T9XA 2IC3A 2WVEA 3RJMB 3J7YU 3P4UB 1W7WA 2IRYA 3JSRA 2XS7A 2RUSA 1URNA 3SCJE 3TX0A 4YEAA 4JUZA 1LWEB 4ZPWR 2QRRA 4L73A 2BJ3A 2BJ7A 2I0XA 2NUUG 3W2VB 3UD3P 4LF6J 4OI0A 1QSSA 2V68A 3T9ZA 3ENWA 1VJWA 4RNMA 2PEHA 1OO0B 1B3TA 1K1QA 4D7ZB 2HS0A 1FDNA 2X7IA 4DUTA 4NMXA 1S0NA 3N6MA 1FXRA 3CIZA 2YWEA 3GV5B 3M8SA 1P9QC 1VBKA 2J8SA 4EWTA 2V45A 5IC6B 2ZBQA 2A2DA 1YX2A 2BVZA 1TWFA 1S99A 1UEVA 2QL5B 1LFWA 5LT5A 3GZ7A 1M5VC 2C45A 2JOQA 1BQMB 2AJ1A 4K8RA 3HP6A 2CVEA 2GVZB 3BV8A 2CPIA 3PHTA 2UU9J 1VQ6S 2B4UA 2Z2LA 4ZP8A 2KFYA 3M8PB 1WHVA 2GA7A 4P72A 4X64F 3ZZPA 4JI1J 1OYEA 4NPOA 1Q53A 1AZSB 1WWHA 3TW0A 3CCZA 1VLYA 1D9AA 3Q8RB 1SL0A 1MG7A 3W60A 1T95A 3J7YI 3MR7A 3MZIA 1RWOB 3TR5A 1KTQA 3PX6A 3I0SA 1Q0NA 3UW1A 3G86A 3EGVA 2WOMA 3G71S 5I3UA 2OSQA 3KG0A 3M2RA 3OFGA 4ER8A 3VAIA 5KFWA 2QG9B 3MFHA 3GU0A 1HA1A 2J9DE 3DMRA 2MZQA 1BWVA 2QYCA 5GLFA 1MLAA 2K3KA 1YBTA 1DURA 5A6WA 4LF1A 3T1YJ 4J9PA 1YI2S 4DFJA 4OYBA 4J37A 1TR0A 5U47A 1T3NA 1PSDA 3N79A 1U8WA 4NLUA 1CZ4A 2D9PA 1N8RT 2HURA 4I6YA 1Q5YA 1SXLA 3V6KA 2GS8A 2LQ5A 2RILA 3MM7A 2WB1D 2CZ4A 4F8RA 3LQVA 4JS7A 1W26A 4GMKA 2OIHA 3R5DA 1U6ZA 4Q2LA 2L3MA 3NBPA 1TL7B 3A8IA 5KG5A 1S10A 1KNZA 2XS2A 4HI2A 2MQ8A 4RWWA 1NUEA 1V3RA 3GIRA 5C42B 1FO1A 2Z2ZA 1TL4A 3FBEA 2DHGA 2HQGA 2MLYA 3I6PA 2FVSA 1L3UA 5LMUF 2FDNA 3BGFA 4NLRA 4WXOA 1V6HA 5KT7A 1NJXA 1LW2A 2HHPA 3ELHA 2APOA 3RTVA 4MFBB 5LXYA 4A8MP 2LCWA 1IKXB 2DGVA 3L09A 1FHTA 3OTDA 2HQFA 3CF5Q 4ZPCA 2AYEA 1T02A 1UPMB 3PRVA 2V8VA 3OT9A 1JMTA 3LP2B 4WIIA 2DR5A 1SC3B 2R8JA 3KHHA 3TAPA 3D0HE 4CRZA 3FFIA 3O5TB 1SI9A 1JLFB 1G1XA 2HNDA 1FK9A 3D1QA 3LP0B 4JOUA 5I3UB 2RRAA 1W25A 3MI7X 2YQ3A 4L3KA 3AFGA 4KO0B 2MLXA 1YIJS 4X4VA 3NCRA 2BQ3A 5D6GA 3HVWA 4OX6A 4DCJB 4EZ9A 2PICA 3F0NA 3HZEA 3CDBA 2BKNA 2DH7A 1VC5A 1VQLS 2D1CA 4K5RA 3CE8A 3EGZA 4ELUA 4TXSA 1FKPB 3KWMA 4IRDA 2JJ4D 2KG0A 2JIQA 2BW2A 4PEOA 4CNYA 4I2QA 1S57A 3D5MA 3GV7B 4ITSA 4M5JA 4PYDA 4WP8A 4DUZF 4NLVA 2LQJA 2FLNA 4WXWA 5DLFA 3MM9A 3FQKA 2FLLA 2BKPA 3NS6A 2EKNA 2QA4G 5J2NB 3DYAB 4P10A 5KOWA 2FJVA 2Y8YA 2N7YA 3JAMY 3NOCA 1OSDA 3SQGA 2J5AA 3W2WA 2RS2A 3N28A 5HROA 3C16A 3Q86A 2XMWA 2BH0A 3OV7A 4NCBA 2RRBA 3VGVA 1NDKA 2M88A 4KY3A 1IJEB 2MJUA 2EW9A 1NM2A 5IT4A 2K8GA 3VAFA 5IT9Y 1FWKA 4PG4A 2X51A 2R7QA 2XGQA 1HD5A 5EPPA 4A8FA 4RW6A 3JXOA 4PPDA 3RBZA 4FPIA 2XMAA 2GJIA 4FXWA 4OLPA 1HWJA 3UR3C 2FZCB 4DL3A 2V2QA 2LXIA 1CJTB 1HNIB 2QZ8A 3JTPA 4G1IA 4DF4A 4IR1A 3AA8A 1RWUA 5AXKA 3HD2A 3M1VA 1NEEA 8RUCA 1N6QB 4JV2A 3KK3B 5DQGA 1J5EF 2B63A 3HCXA 2H5IB 4OZ3A 3CUNA 3LPYA 3R1HA 2QFIA 3GCXP 5DM7Q 2CFXA 1PQEA 2MKCA 2MMYA 5KFCA 2R7WA 5DG8A 2FVPA 1VMBA 3UDVA 4QBUA 3KXDA 2DNRA 2ZUAA 4XAKA 4QW9A 3OSNA 3QSIA 3QRPA 1FJCA 3M8YA 1DBDA 2HYIB 1BQXA 5DETA 3IAS9 1WEXA 2XO6A 3BQ0A 1SIWB 2O1PA 3MTJA 3TVYA 1RUSA 4OZ0A 1VQ4S 3EGWB 3Q8UA 4JI5F 4C8YA 3C6TB 1DFDA 1Y1WA 3MM8A 1TL7A 2N4DA 2MKKA 4LR8A 2H1YA 3GYGA 3FK4A 5HATA 3UN2A 3DLKB 2CJQA 2IDLA 2MQNA 1O0PA 3EXCX 4ZN1A 1G7CB 4YHHF 4K4ZA 2VFTA 1IBLJ 2XZDB 3HHKA 4LF9J 3HK2A 4UOFA 1UJ6A 1WC3A 2AHOB 3PW2A 1Y00A 5ETQA 4ECRA 1KVIA 4Q0BA 2KZMA 4RL1A 3B6BA 4B3SJ 1RT4A 4ZM7A 4JI5J 4CRYG 1SH3A 4XK8C 2Y8WA 4UOHA 1FKOA 2I5JB 2HW3A 1WC4A 2SXLA 1E6VA 5C1BA 2IVYA 1U48A 1JJ2R 4GVLA 4QIWD 4ZLNA 1H7XA 4RX6A 1TP7A 4KH0B 4NASA 2XQCA 4JI6J 4O3PA 1ZTTA 1TL3B 4WIQA 4QWCA 3BS9A 1S0VA 2ZWPA 4J9OA 1ZC1A 3KG4A 5GAHI 2Y9HA 3KNAA 3A3NB 1ZZNA 3D0IE 3A12A 3SUMA 3W1YC 1J5EJ 4U95A 2CQPA 3PJ9A 3M9OB 2AZ3A 2KRRA 2JIOA 3OUGA 1MROA 2PO4A 1AUDA 3FDSA 2K3IA 2NAPA 2RMLA 4MIAA 1E6YA 5ETOA 3OL6A 4J90A 4ZVFA 3UCGA 5JMNA 2FGOA 2OUGA 2PMHA 4F0HA 1EAYC 5M2RA 4ZITA 1X9SA 4B9VA 5E2QA 4N8OA 2UXDJ 2GQCA 1I3QA 4BWJA 1RT1A 3CJQA 4TNOA 4CQ1A 4KO8A 1WSVA 1ZS6A 2E5JA 1I6JA 1OS5A 4K5SA 1JLGB 3T5HA 3S7RA 2DHXA 2HFZA 4YR2A 4MIWA 1SKWA 1ZAXA 5B0AA 1HW9A 2R8HA 2R8KA 4DV3F 1SKSA 1A6LA 2VG5A 3U1MA 1TU0B 2ZE2A 4PXDA 5LMNJ 2R7VA 4WZMA 4ZKAA 4C98A 4DV0F 1RYSA 2V34A 1L8FA 1BW4A 5J2MB 2Q66A 1S0MA 2PMZA 1ELOA 1XMBA 2RNEA 1RT1B 4WFAQ 1CJTA 1S49A 2C2KB 3G6ES 2QLBB 2BJEA 3TM7B 3EZ5A 2E7WA 1U0HA 2QIFA 1NB7A 4LF8F 3J80Y 1KDNA 3NWRA 1XR5A 3BH7B 4PPZA 1B99A 2J7WA 3ENQA 2AYMA 3A1YG 3LP1A 1TV6B 3R5AA 3DRPB 5GMKa 2D9OA 4Y65A 1ZM3A 2CNLB 2L48A 1OMSA 2CWKA 5KG0A 3EPGA 2LECA 2NXNA 2R7SA 2JHEA 2W2NP 3IS9A 5EWEA 2IAJA 2GV1A 1TK5A 4X4TA 5EWGA 2A68D 1S72S 1JJ4A 4X66F 2HPUA 4NCAA 3GTJA 3HJVA 2ASJA 1M5KC 1C1CB 4C3KA 3DGPA 4ED8A 1FNOA 4CLUA 3IBCB 2FYXA 3MHYA 2GHWA 4J9UE 5ITHA 2C2EA 3AH6A 4BC9A 2Y0SD 3MECA 2B5JB 4OX9F 1K73T 2ZBPA 3KJFB 1VK3A 4IFVA 1NSQA 1EP4A 1KKHA 1PYUB 3T19A 2R2RA 5D3GB 5BJRA 1S12A 3HHLD 3WC2A 4M5HA 4JP6A 2Q79A 1PIEA 4DV1F 4DV5F 4QW8A 1XWLA 2ZKUA 3ZFVA 4Z37A 1VQMS 3TI0A 1S76D 1G4CA 3KHLA 2JRSA 1ZAWA 2B0GA 4NRTA 1HFEL 1QE1A 1SV5A 3G87A 3KDOA 4CS0A 5CYMA 1NH7A 5LSRA 4DSEA 1JK9B 2UU9F 4NA3A 4DV4J 4NOHA 2HEKA 3I56S 3NMRA 3A8EA 1RGVA 4FFTA 2VD3A 4WU2A 3GIMA 3PX4A 2HGMA 1RE1B 4HTIA 3M8WA 3W65A 3OW2R 4DF8A 2BRLA 5CZVA 3NEKA 1AT1B 2CJ9A 3BSNA 3X2LA 3D2WA 3RGIA 2E5IA 1FA0A 1WUUA 3K5LA 2ZHBA 2R7OA 2QGFB 4MMOA 1RWVB 2XMKA 1TZ0A 4OFZA 4ZA1A 2B3TB 1HMVB 5H9EJ 1Y5NB 4OV1A 2XC9A 3QJJA 1AFJA 2AJFE 3CO9A 3SSSA 4ANCA 1HQUA 2QYGA 4EI2A 1FRKA 4GO7X 4ZIWA 3PFEA 5H1SV 4RNNA 2R8IA 4UZBA 1N0UA 1G2EA 3I31A 2IVFB 3W9IA 1IR1A 1IW7D 5C24A 3K0JA 2RKIA 3LGNA 3DGPB 2FJXA 4QIGA 3TEHB 1S6QA 2AEJA 2QA4S 4X64J 4O3SA 4I1TA 1KQFA 1JIHA 1ZTWA 5E3CA 5IQ6A 3EGNA 2QC3A 4E98A 4EK2A 1X9MA 2AP6A 3LPEA 4QYRA 4I6WA 3HT3A 5BXIA 4J91A 2KFNA 4FF2A 3B8HA 3ISNC 3MPWA 2VQEF 1IBCB 4KHMA 2HBZB 2XMVA 3FSXA 2CJBA 4DV6J 5H9EK 4NXNF 3ETOA 4DDFA 3LALA 6FDRA 1PGZA 1KRPA 3TA1A 2G6GA 1NDCA 1C0TA 1EETB 1PJ7A 3FEYB 3L7OA 5CHCB 1HNZF 2YKAA 3MMJA 2B9EA 3P5TL 2YKOA 2AMCB 2ZVIA 3RBXA 4A4JA 3R1LA 3KKFA 1NNDA 2IA0A 1WEYA 4ZCKA 1TWHA 3ILIA 3IO1A 2A1BA 4M5KA 3W5YA 2HHQA 4FXVA 4JI0F 3C2PA 2IYIA 4IOBA 3SQGB 2C2ZB 3KHGA 1OY8A 2W9CA 4KPYA 3MM5B 4BCAA 3K7RA 3NG8A 4DV2J 1TMMA 2COLA 3FCHA 4F3MA 1YJWS 3M2VA 3C14B 1S1TA 1XNQJ 1UEKA 4PZVA 4U9RA 4RZRA 3I5AA 1N0VC 1OYDA 3D7SB 4R5PA 3W5ZA 3K57A 4M95A 4MIBA 5CAAA 3W5XA 2DK2A 3DRSB 3N6LA 5HMYA 4DLEA 1MWQA 4KHRA 2AT1B 1VGYA 2PSZA 3M7VA 3B4DA 3UPFA 2IM3A 2V4QA 1WI6A 2E44A 2R7UA 1WI8A 3NP5A 1IKWB 3BQ1A 2EFOA 2B5JA 4QU7A 2KHCA 2FLPA 2DGQA 4UTGA 2HFOA 1S9EA 3F44A 2N82B 2A3JA 2A6OA 2PI4A 1S7IA 2JVOA 3A13A 3WBZA 2V67A 2OKQA 1GMWA 4LFBF 4F4XA 2QA1A 3PYEA 4UUXA 2W7OA 1R31A 4IDKA 5CYQA 3MMAB 2VFUA 1NPPA 3A3PB 1YNJD 2BANB 5T7LA 4ED0A 3GG0A 5E7OB 1QJHA 3TVZA 3VCDA 4AE5A 1GMWD 1YJUA 4ILMA 1BW3A 3QNWB 2HRYA 8ATCB 5DQHA 5IWAJ 2XO7A 4IQXA 3L4BC 4Y34A 2P6TA 3B78A 2E7VA 5BYRA 2GJ2A 3SMZA 4I56A 1X31C 2DO4A 1RT2B 4HVZA 5KFRA 1ZETA 1Z4UA 2OFGX 2ZNZA 3DHWC 3OVBA 1WC5A 2VF3A 1R7RA 2JEGA 4CLSA 3BO4A 4ZVEA 2YXLA 3RW6A 4KE5A 5KT5A 1N5YA 3CC4S 1KD1T 2FTRA 4F0MA 2JIMA 1WF0A 3DC2A 3M8RA 1NCLA 3GPAA 1HNVA 3C6UA 3MCOA 3R6GB 2CVIA 2MQMA 4ZVPB 4CO5A 3HSZA 4DCOB 5BYQA 4C8OA 2C3OA 2WOMB 5IV3A 1U1PA 4TN2A 1KWMA 1P1LA 2LQBA 3O3LA 4U7UK 1I3OB 1HI1A 1FTCA 2X3DA 2RQ4A 2Z2MA 9RUBA 4MFBA 1DY3A 2B7CB 1NK8A 4Y2AA 3WX8A 4E0DA 3MCSA 3CCRS 2JWNA 2CZ9A 1A9NB 2M4MA 1S9EB 1GXUA 4ZIVA 4FKXA 2LU1A 4LIRA 2FIUA 2EWHA 1S6PB 4WTOB 1UA1A 1BC6A 4OYMA 2PC6A 4ZDNA 4A48A 2VPWB 4M5DB 4DMZA 1IBLF 4LF9F 5F41A 4B02A 5BR8F 4A8KA 4IO1A 4ELTA 4HACA 4QPXA 3BN7A 4OYOA 4RNOA 2MHEA 4QWEA 3THVA 3ENVA 4H4OB 4DOZA 2JSXA 2VDHA 3QQCD 4HDHA 4PQAA 1H38A 3C8YA 4MKVA 4YOEA 1MSWD 1Y5LB 2EG1A 2EVZA 1DMSA 3C66A 3I87A 3LA0A 3PACA 4MH8A 1B7YB 5LL6d 1NK5A 1TAUA 4AZDA 2JFDA 3BGRB 4Q5VA 2DR8A 1PQHA 1VI7A 3R2DJ 1S6PA 1QUPA 2F1FA 2BBEA 2D74B 5C7PA 2O01C 1UFLA 2C3MA 5HN0A 4L48A 3DKDA 1PILA 3B54A 3IC1A 3T1AA 3DOMA 4XDDA 3BDEA 2V4RA 1UL3A 1N5QA 4J9KA 2NZ4A 1VQYA 4TLQA 1L3KA 4O44A 3GIIA 2W24A 2YNHB 3NS5A 4FNIA 5HO4A 4FF4A 4QYZJ 2JC1A 2R7ZA 2DIVA 3ENAA 3GYXB 1JKHB 2FHMA 3CMQA 1XMOJ 4F2RA 1RHMB 2XNRA 3BGLA 3JYTB 3RU0A 3DXBA 5A0YB 1RKIA 1XC9A 2KB2A 5THWA 4ZHRA 2GAEA 5DGBA 2MDAA 4UQGA 1R7IA 1KBRA 1Q7LB 3J81j 1WCMA 1VS3A 3I4HX 3WDOA 4DG1B 4BDPA 4J7CA 4Y6IA 3M9NB 2VV5A 4I0WA 5GAEI 1T9VA 1UETA 4EO8A 1SL2A 1EKRA 2DNHA 1Y4ZA 3DXSX 4LSLB 3TUIC 1HBMB 2DYAA 3H2VE 3M8QB 2XNQA 4HACB 3W66A 1NSPA 3MEDB 3TNVA 1J27A 3VF0B 4OHXA 2G0CA 4ERDA 2V5HG 4MKAA 4FYDA 4IG0B 1BUXA 2KO1A 2DH8A 2Y3YA 3HDSA 1TFYA 2V9KA 1KTVA 3EICA 3BKUA 3FUYA 4F50A 1IKYB 4NRUA 1C2PA 4JI0J 1LQ9A 2I6WA 4EBEA 3CZBA 4LUBA 2ZZTA 1U1OA 3VVTA 1KQGA 4RU9A 2HZAA 1VQ8S 2AV5A 3G2XA 3G96A 1HBMA 4KT0C 1F2GA 2X1BA 2D3UA 2XYHB 4ZP9A 3DLGA 4JV0A 2V6AA 5HMXA 2YQ0A 2DCLA 2EI5A 5C2GA 3RB3A 3OTOF 1UW4A 3OLAA 4RW9B 1GXTA 4ZJOA 3VALA 3Q22A 4DSKA 1X4DA 3M30A 2K7JA 4X4OA 1VFJA 4WFXA 4AL7A 2C3YA 2ZH9A 1LK7A 4HH1A 2OPPB 5FDLA 1YJ7A 4FYVB 3OJSA 3V2UC 4I4BA 1GK8A 1NHVA 1QTNB 2GGPA 1UP1A 1EJ7L 4LR9A 3ZO7A 1L5UA 2E5LF 4F2SA 1MU2A 4WYWA 4USUA 1X4EA 3VQSA 2WVBA 4PUOA 1YZ7A 2ZJRQ 2WVFA 4M94A 4NLGA 2EEYA 5HMZA 4DR7F 2MZJA 3P5BP 1Q8LA 3SIPB 4P7TA 4P71A 4LFCJ 1Q5VA 3C15B 1EKSA 2VH7A 2CRLA 4LRFA 1FRXA 3K17A 1RB0A 5C24B 4IKAA 2MY7A 3HHEA 3LO3A 3P96A 4C97A 2XGPA 4V19J 1RHRB 3V5RA 1UEUA 2OPQB 4OHWA 2IJFA 3GTGA 1X5PA 1GXLA 1RT6B 2E1RA 2ROGA 3BGRA 3CSKA 3OXFA 5AXLA 4CM2A 4YFUA 3NL0A 2M0GB 3CIMA 1AUSL 3J81U 5J2NA 4O4GA 2CXEA 1SMYD 1LW0B 1X4FA 3R6LB 3RRKA 1Z2ZA 2V4JB 3IFEA 4OZ1A 1XEZA 4DJBA 4DUYF 4PRFA 4KHPF 5KFYA 5IWAF 4UY8T 5EGYA 1GTHA 2POKA 3BF4A 3VWSA 3CDAA 1E18A 4NEZA 5IFMA 2NLWA 4CZCA 1IKVA 3GQCA 3DI6A 5DDOC 1Q1KA 2HVZA 2CJKA 3H5UA 3KLIA 4Y2IA 3PXGa 1VBZA 2UXCF 2HHVA 3OBIA 1FD8A 2OD6A 4LFAF 1AFIA 3R8YA 4F4WA 3LGHA 2W2PP 5FDLB 3UCZP 1M90T 3BPSP 4ZOSA 1ZPWX 3EVWA 4FXDA 2EK1A 4M5MA 3SEOA 4CYUB 2LEBA 4Y2MA 2I8EA 4LMZA 4WKRA 3HHDA 3GCWP 3SUKA 4G1PA 3K5NA 4C2MA 1WKJA 3I96A 3G8TA 5FLXU 2VOPA 1X60A 2DGTA 2OGUA 3CC7S 4B3MJ 5AXNA 4HTJA 2IA6A 4OZ2A 3DDKA 3MEDA 2ACMA 2CQ1A 4Z7CA 2Q3PA 2XSJB 2ZDOA 2BJDA 4EYIB 1M0SA 2DEIA 1NK7A 1VC0A 1X7VA 1F5AA 1JLEA 2CPHA 2DGWA 2QJ3A 3SSRA 2DRAA 4MK9A 3QIPA 4TU7A 2E5GA 3QT5A 1QAYA 2YKPA 1YBUA 4DFMA 1RBOB 2F4FA 1TL1B 2NZCA 5EX0A 3KK2B 4FBUA 3SV3A 4O4GB 1BLUA 4ICLB 1NDPA 1Z2LA 5FD1A 1W2BR 3OL9A 2RQCA 1PKUA 2CPEA 3CGIA 4YY3F 3SZ2A 1SJ4P 1R8HA 3BR9A 1EP4B 3CJ3A 1M5OC 4G65A 1RBAA 2NUHA 4RBVA 3HM9A 1FJ7A 4IDKB 3DRRA 3ILJA 4DV0J 1U2RA 3M05A 1CC8A 1HHQA 1E60A 3EDQB 3FMWA 7FD1A 3DI6B 3MR6A 3NBPB 1K9MT 2UUBJ 4JI8J 2WTFA 3SDEA 3LAKA 2XY5A 4K4UA 2WSCC 3Q83A 4EBCA 4RWXA 4LVNP 4WPAA 2C28A 1K44A 4YR0A 4FS2A 3VVUA 1P8GA 4YB1P 2K1RB 4KLNA 3X2PA 2LDYA 3FBBA 5L39A 2IAJB 1MMDA 3GFYA 4KSEB 3E01B 5LSOA 4L3NA 2RS8A 2J9CA 4IO9Q 4I67A 2OLWA 3KLGB 3D6HB 1G6BA 1OA7A 2DHAA 2R7XA 2PGCA 1RWNB 2KG1A 4DV2F 2WB4A 1PC4A 4GA5A 1BMQB 1U2FA 4PG6A 1NK6A 3MCMA 5B0CA 5B08A 5JVHQ 5KG4A 5KFQA 1WTBA 2LEAA 4TLRA 1UHEA 1BHNA 3GJTB 4F7VA 3GTOA 3GFXA 3D6MB 3P8BB 2KN4A 2ZEJA 4ZCIA 2BABA 5KFAA 1IBKJ 1QLNA 2VPYA 3O2IA 1KVJA 4ZPBA 1HI8A 3MUMP 1NHKL 4PYAA 3VGSA 2MKIA 2UUAF 2QN6B 4P2XA 2DIUA 2ZBCA 3ISZA 1YJNS 5J1NA 1E61A 2F65A 2CW0D 1VOMA 5LOQA 3OQ2A 2MJNA 3SCKE 1RJJA 2EG2A 2R2SA 4FERA 1HARA 4WK1A 4Y3CA 3KK1B 1MWYA 4DV4F 3KHRA 4Z2XA 4I7FB 1X4BA 5B0BA 1SJ1A 2VA2A 3QATA 3WZ0A 3DLJA 2ZZNA 2HHHF 1H2TZ 2IFXA 4QOTA 1CQNA 1LWEA 2BJ1A 3J7Z5 3RRGA 4J9NA 3OVAA 3ZZTA 1UHDA 3TZZA 3OFFA 3UCUP 3I0RB 3CCES 1I94J 2RKIB 1ZA1B 3D67A 3PNIA 3CT9A 2JIRA 1RTIA 2RIJA 5ETNA 2YPZA 2Y0BB 4ETZA 9ATCB 1NKBA 5IT9U 2R8GA 1Y7PA 4F04B 4URQU 2W4PA 4PG5A 1F6TA 3EMTA 3R7NB 4Y28C 3VV2B 1F5BA 2ASYA 2WBMA 4NYPA 3CCSS 3UD4P 2VPXB 2Q6BA 2YNHA 3QFWA 4DQRA 2XI3A 3N9UC 3V6DB 3P6YC 2DR6A 5J2QA 2MKSA 2DY9A 4ZJQA 4RUCA 4A8SA 1WJ9A 2ZZMA 3SSQA 1S1VB 2VL1A 4K4SA 2G5DA 2HFNA 4KFBA 1TKXA 4DR1F 1NHUA 1S9GB 1FD2A 3U1LA 4JP8A 1AW0A 5EWFA 2YPYA 3RAMA 3D6TB 2FPHX 1SH2A 2BV3A 2VA3A 1R6VA 2KJVA 2CDQA 2JH3A 3M8QA 1RBLA 5D3GA 4QIFA 2HHXA 2OMOA 3EPIA 4ZLPA 2NS1B 1B7FA 1WF1A 4I64A 1KP6A 3BPDA 3MAQA 2J0QD 1V3ZA 3UDCA 1YJ9S 2QLXA 3O44A 5HQMA 2K1RA 3T6JA 4EZ6A 2HIQA 1JLBA 2QSWA 3HJFA 2AKWB 1YRTA 4IG3A 3IR6B 2C2DA 4WJBA 4H4KC 2K2PA 4K7QA 3NGDA 2HQIA 1Q86T 4IRCA 1U6FA 3H4DA 4V1Ak 4ZVUB 5M2PA 2P9EA 2CQCA 3ULHA 1K0VA 1B0VA 3V81A 3HVRA 2CJXB 3VAHA 1N32F 3LP1B 2RF2B 3W63A 1S1WA 4IOCQ 4Q43A 1T9TA 2GIFA 4RNFA 1LXJA 2KYZA 3JB9k 3PO5A 1R8BA 2W7AA 2B9WA 2IYGA 2VPXA 3I32A 3IGVA 2ATLA 2UXBF 3TO8A 1EIYB 5D15A 4C0HA 4ILRA 1ACMB 2YWWA 4HLBA 1J5OB 1XERA 1YDLA 1R3NA 3OL7A 4UY85 2E66A 4CLLA 4YR3A 3HD1A 3M6WA 2P8IA 4WBFA 4ZN3A 2ZH4A 4B3TJ 1HNWF 2R7TA 2W2MP 5DDRC 4NLYA 2E2IA 4X2BA 1YBAA 1FDOA 3D4JA 3LANA 4USMA 5KG7A 4AYBD 1C0TB 2B8PA 3T5JA 1CJVA 1GTEA 1WELA 4JCWA 2LQ9A 2W25A 1JLFA 2OPSA 5DG9A 4OZNA 5CD4A 4DV7F 5KOXA 4HKQA 4IR9A 2ZC3A 1YSJA 3FMBA 1ITPA 1SC6A 2NSCA 3CVKA 3HLUA 4ZP7A 2CPJA 1OGYA 4WZQA 3UN5A 3RAXA 1XIQA 4NZ7A 3KLHB 2HBQB 2UP1A 2BE5D 4MK7A 1M1HA 3D1HA 4BLGA 1N5YB 1CBKA 1U2CA 3JSMA 1H3DA 2L08A 2HVEA 1C4AA 3CD5A 4USTA 2MKHA 2IY5B 3GTMA 2NREA 3SV4A 3GE9A 1RWPB 3HHLA 3S8SA 4RUAA 4NLTA 3MUTP 5J2MA 1HIYA 2HIYA 3TRGA 2GMJA 2JLGA 1O8BA 1XMQF 4Q7AA 1RAHB 3QMQA 4BC7A 5B0GA 1IKWA 3Q23A 2ZH3A 2RVJA 1JLQB 4X62J 2HHUA 1M5HA 2VG6B 1QSLA 4ZVSB 4J9MA 3VGUA 2GO8A 1B70B 3BZQA 4KHPJ 1KLMB 3E3XA 2W01A 2PJHB 2F9JA 2QL9B 1WG5A 3CD7A 4RW7A 3NAIA 1HQUB 2J76E 2WAQD 3EDRB 4M5GA 2GW8A 3HVTA 2OMLA 4USHA 2CQIA 3WC0A 4JI3J 3EX7B 5HQLA 4Q45A 2VG7B 4A46A 2Z8QA 1KSPA 4LF7J 2V94A 4DL7A 3CJTA 1U1MA 5F9LA 2VUMA 4CLZA 2DISA 2ASLA 3D0GE 3ILLA 1JLQA 1VQKS 4HR2A 4WFZA 2IMWP 2MLZA 2VG6A 3IRXB 3MM9B 4LQ9A 2XLKA 1DQAA 3OD2A 4DFPA 2B4PA 1H0HA 4WP3A 4DPTA 2MSSA 5KT4A 5HLFB 2B9YA 2I2YA 4L6V3 2CKWA 4DR7J 4X65J 2YVSA 4ED7A 5HP1A 5CXTA 4UOCA 5AT1B 4D3GA 3AB2B 3W61A 2FHKA 3V6DA 3PW4A 4X84A 4WCEQ 1JLCA 4ZVRB 3QIDA 4NI2B 2PN6A 4OZJA 4CO2A 3GJQB 1XMQJ 2RB7A 5HL7Q 2HLTA 5GAEU 2N7CA 1NK9A 5CH7B 1KEKA 1N56A 5KFIA 3GIKA 1SJFA 2DJWA 4F36A 2XI2A 2DNYA 1TUWA 5HVGA 5E3QA 2R7RA 5C2CA 1N5TA 5KFSA 4P75A 4TY9A 4E8UA 4LF6F 4I2PB 4KGZB 4OJ3A 1RTJB 2W4CA 2XULA 2G0IA 2DNKA 1RADB 1TUGB 4CTAB 4CWBA 3M9MB 1N6QA 3L7PA 4MTPA 4DQQA 4YMEA 2H48B 2H51B 2KZZA 1AXQA 3AQOA 1PJ6A 2RH3A 2R92A 4PR6A 3QZ7A 1N48A 2AZ1A 3RRHA 4FDFA 2HQ3A 2EC0A 5RUBA 4H4MB 4HT7A 2DHSA 2KRBA 1Q82T 4KGMA 4K0KJ 4LFCF 1B4SA 3GJRB 1VRQC 3M2RB 3PRDA 2QLFB 4JI7F 4H54A 1DRZA 2KTQA 4DL4A 5K9FA 2AX1A 2JC0A 2JDJA 4I2PA 5KFXA 2KXNB 3R5GA 4RR5A 3MURP 1HNWJ 4CTAA 1PQFA 2F8HA 2OPSB 3AXKA 4ID5A 1RTHA 4O23A 3VAGA 4U96A 1CG2A 2M70A 1UJ4A 3S1TA 3ZTPA 2JLEA 1AA6A 4KGVB 3KLFB 4C48A 5F8MA 3BSOA 4WF9Q 1I51B 3CDEA 5D78A 5KG2A 1F1BB 1CSJA 2MY8A 3FZBA 3JS9A 4KR0B 3W8GA 1JLCB 1UVLA 1AYEA 3CJ4A 4FYXB 1PT0A 3BDPA 2YKNB 1RU2A 3RW7A 1H98A 5GAHU 1L3VA 3FRYA 4ENGA 3TA2A 1F3FA 2ZD1B 5KT2A 1R8CA 4ZVGA 3K8WA 2KYXA 4TU8A 2AF6A 1D9FA 2J0XA 2FHOB 1Q4RA 4DR3F 4ZS6A 3KLFA 5G0RA 1FFWB 1R9TA 3LF0A 1RTJA 3D66A 1YNND 1YWXA 3V4IA 2A6MA 2HBRB 3R5BA 3U7JA
chains in the Genus database with same CATH topology
2KI2A 4OLOA 2W9CB 1JLAA 2BZ2A 3TYTA 3IWLA 3DMJA 2R2UA 1FK9B 4CO1A 2UV8A 1HR0F 1VC3B 4LSNA 4RUHA 3PIOQ 4MK8A 4IQMA 3PFOA 4Y00A 1P1TA 5GVQA 3VZIA 2KI8A 2DT9A 4QR1A 5F8IA 3CCQS 2FGCA 1H0HB 3H8YA 1WEZA 1DQ9A 3DOLA 2HVHA 3BEGB 4AL5A 5HP1B 4J9SA 1FDDA 2MKJA 5I3QA 2MZTA 2JEJA 5J2PA 2E9TA 4OL8A 4NX9A 2CQDA 2GNKA 2CZVC 2AYGA 2YU9A 3MEEB 2BXJA 3CD6S 4CT9A 3N0VA 4F67A 4DS5A 2ZKTA 3NNCA 2D3ZA 4ZPAA 2G9OA 5C18A 2HNZB 2QT7A 2CPXA 3KK2A 4OJGA 1UA0A 2GCFA 2KXFA 2IM1A 3CCWA 3QYYA 4ZMMA 3MR2A 6FD1A 3W2VA 5K8NA 1JB0C 4C0OC 3PIPQ 2FC8A 1C4CA 3RAQA 4AYBA 4B08A 3DM2B 2IM0A 4X4SA 1N36F 2OSRA 1DLOB 3OL8A 4G3IA 2RD5C 1JLBB 2GX8A 4C8LA 2O3DA 2ZITA 2NSBA 1UJ5A 1REVB 4DN0A 2FJAB 1YLEA 3W7BA 2CG4A 4RLEA 4JV5F 5AJ3F 3L95X 5A0YA 5KFZA 1RT6A 5HQ8A 1TWGA 3PX0A 3MM5A 2RSQA 2VODA 2ZH8A 3NMAA 5DQIA 2GHVC 1HMVA 2DBBA 3B82A 2KT2A 1SIWA 2JVRA 3N5BA 4R8UB 2IBKA 4DR2F 2NPFA 1D3WA 5K8PA 4ZP6A 3N01A 5F0UA 3VAMA 3OR2A 4QWDA 2GFFA 4V19X 4EGLA 1XNRF 4GKJF 1RQ0A 2B6AB 2QEXS 2XBPA 3QO9B 2XLJA 4XO0A 3GFZA 1K8AT 1LWFA 3J7ZT 3SCLE 1NZAA 2PIIA 3MR5A 2VBZA 1GQEA 2MYFA 2H5EA 5GAGU 1NJZA 1XNQF 1Q7YT 5DLGA 3MDFA 4U7CA 1GX6A 4LT6A 2W9BB 4IFYA 4C8KA 3CCMS 2VFRA 3MF5A 1DQ8A 2YKMB 3BM7A 4O4RA 5DM6Q 1U26A 4RKUC 2HRUA 1SJ3P 2B4OA 3H40A 2RT3A 2M7SA 4ATNA 4U6PA 4GA6A 3HHLB 5LJ5Y 1TVRB 4C3MA 4ALZA 5M2UA 2J9EA 2VOOA 4MKBA 2DGUA 5T5ID 2IVMA 1URRA 3FGVA 3TAMA 2UV8G 3I9ZA 1S1TB 2WSEC 1R0AB 3KLVA 3FFIB 1FRMA 1TKDA 3IR7A 2JA6A 4U67Q 5IM0A 1LKZA 1HI0P 3H98A 2MB0B 5J2QB 5K8OA 1RT3A 2LYVA 1RT5A 2PDAA 2DNMA 3J81Y 1XK8A 5FTLA 1S1VA 4OI4A 5KFGA 2RRNA 4LF7F 1QVGR 2JX2A 3JSBA 3C46A 4NLXA 3CJ2A 2DO0A 3DNCA 1HBNB 5CYJA 3I0RA 2YNIA 1RK8A 2VUGA 2YH1A 1YITS 4TY8A 4WE1A 5CYQB 5HBMA 3J7A1 4TYAA 2UUWA 2RDJA 2PJJA 4QQBA 3G4SS 2DPJA 2BDPA 2ZH6A 4DV6F 2DRBA 2NVXA 1F9FA 3IXQA 2R9LA 3GFHA 1QM9A 1YJTA 2GHPA 4ECTA 1N33F 4FP9A 1HQEB 2IRXA 3CCTA 3HI9A 2BM1A 3T1HF 4EO6A 1KR4A 3TQ1A 3QQ8A 2YNIB 1OQ6A 2O66A 2PI5A 1UVNA 5HBMB 2QO3A 3K2YA 2ADBA 2YNGB 2GGPB 4IRKA 2XB2D 2IMOA 3NCQA 3P49B 1EU1A 2CIMA 2DCUB 1S1WB 3MAHA 4DR4F 5A8KB 3CB4A 2DD8S 3OR2B 1S1XB 2EFGA 4J5OA 4FNHA 3OTBA 4KO0A 4M1KA 5FLXY 4G6VB 4NYOA 1HQEA 2E1AA 2RQMA 1RT5B 3LOUA 3HX9A 4FF3A 2ZUGA 4B9SA 1HD0A 1KC8T 2DNZA 5KFFA 2LKZA 3NNAA 2BR0A 4B3OA 3TP2A 4DEZA 4PG8A 2XEXA 4Y2KA 2GC8A 3B4MA 3HU2A 2FY1A 2VPWA 4Q2MA 5B0DA 3OTEA 5CZXA 2NVYA 1QAIA 3QLHA 3R5CA 1TMOA 3AJ2A 5KFVA 1XTZA 2H9ZA 3KLHA 5A8RA 2CPDA 4W90B 2XS5A 2GMLA 4HL9A 5D4NA 3F41A 5KFHA 3Q8PB 4HHJA 4B3OB 5C5JA 4NLSA 5CD4H 1PO6A 1QY7A 2QLWA 1YQHA 2B7BB 3ZZ0A 3V4IB 1U24A 2KT5A 4HH0A 3M2UA 4FPRA 4AQYF 1MW7A 4DWIA 2EBGA 4N47A 2GQ2A 4ZCMA 5E3AA 2LLZA 1FTRA 3UI3A 3CQZA 3G6YA 3HZGA 4KDLA 4X4UA 2JFKA 3HVTB 2HGNA 3FZ2A 3W2WB 1JJHA 4H4OA 4ES3A 3IN5A 1IBKF 4IH5A 1T94A 1DTTB 3FVYA 2VPZA 1G8JA 3M4XA 1P6TA 3QIPB 1KQKA 1HBOA 4DX8H 2FVCA 1Z1ZA 1MU2B 1S6UA 1RA6A 4F4KA 3MM7B 5I4MA 2LU2A 4ICLA 3AHPA 4LF4F 4OI3A 3SYZA 4BWMA 2HWTA 1ZPVA 4KGKA 3KK1A 4JI6F 3V81B 1BQNA 3H2LA 5KG3A 3V6JA 2G4BA 1OPZA 3QWUA 4MYUA 2HLUA 2Y1JA 2RUGA 4FVCA 4DS4A 4NA2A 5F8NA 3M2VB 3EUNA 4B17A 1KLMA 4M63A 4R0JA 4TQSA 4OI2A 4B3SF 2VG5B 1QAJA 3CJ0A 2ZH2A 2LA6A 3MMBA 4RBTA 3M8PA 4ED5A 1U4BA 1DMRA 3H4BA 5C25B 2F40A 3G6VA 3CXCR 4QIVA 2AJQA 5E3PA 1FNMA 2HZCA 2ZFHA 4QR2A 2VASA 2WONA 3KJVA 4K4VA 3F73A 4DLGA 2JA5A 2RU9A 4DPOA 5ADZA 4FS1A 3H5XA 2KKHA 4PXBA 2XY7A 2AD9A 1TKTA 5EX3A 3H0GA 4O3QA 1Q8IA 1VIOA 1ZM4A 1QTMA 1R27B 5L8RC 3PZPA 1VBYA 5AE3A 1C1CA 2PE8A 5E41A 3GTLA 2BQRA 2N4CA 2GMHA 4RV0A 2QV6A 3CWJA 2VB6A 4KKOA 2RU3A 3RBEA 4BHQA 2DGOA 5KTQA 1N5SA 3W3SA 5KT3A 4URSA 1K1SA 4W92B 3QLHB 1E5VA 4ILLA 3GTPA 1JLGA 1IXKA 2MQQA 1L3SA 4KJIA 4K0KF 1RAJA 1PT1A 2O5DA 3GTQA 3GV8B 5LMNF 2DPIA 1IR0A 3Q8SB 1YVFA 3R27A 4NLOA 4RW8B 1TL1A 2OAUA 4X4QA 4YUDA 2YX4A 5J1PA 1C1BA 2D41A 2ZDPA 1SL1A 1T8EA 4YDDB 4B9LA 3K58A 4CO4A 1KFSA 1H7WA 2WONB 1ZZFA 4CO0A 1KOOA 1FE4A 1IKVB 1DAXA 3KK3A 4DFKA 4G1QB 2E2HA 3FQLA 3MTKA 3OXGA 2Y0SA 5KFBA 4URGA 5J1EA 4X4NA 3RB6A 4F3OA 1FF2A 1Y9OA 5FJ4A 1HPZA 1N88A 2RQKA 2QSFA 1TVRA 3MEGA 3E01A 1F0XA 1HBOB 1R8AA 3HU3A 1FKOB 3DRYA 4GO5X 3G8SA 2NR0A 3PV8A 1E6VB 2HNYA 1TWAA 2BRKA 4L72B 2BA9A 1TKXB 4PWUA 2L9WA 3NWGA 3AJ1A 1QUVA 4DBQA 4DMRA 2HAIA 2UVUA 3PW0A 1HPZB 5T41A 3DLHA 3ML1A 5HI7A 2MZRA 3PKYA 3FEXB 2VBYA 4YB5A 1QDNA 1VQSA 2HHSA 1FERA 1SBRA 3CF2A 2HNYB 3KNGA 5KFUA 4QWBA 3TOQA 1R89A 4K4WA 1X4AA 2WW8A 4N77A 5B09A 5DG7A 1ZOTA 1SJRA 2ILYA 4PG7A 5B7WA 5E3RA 3HMJG 4KTQA 4FVMA 3DRRB 1KOHA 2IHR1 1F5CA 3IRWP 2MZ1A 1U49A 3MM6A 5IQQA 2J8AA 4ECZA 1XBWA 1FRJA 2YWKA 1VRTB 2RE1A 3U1NA 2XSJA 4HEA9 3SXLA 4DG1A 3PRBA 2VG7A 2CPFA 3U02A 3T1YF 5L1IA 4NLQA 4IG0A 2CQGA 2ZOGA 3S6EA 2ZHOA 4LQ3A 2LXUA 4AXJA 1WLFA 4N5SA 5HLFA 4P7VA 3CCUS 2OH2A 1FDBA 4OI6A 3T5KA 1R43A 2E29A 2M2BA 3NLCA 4KV8A 3JTNA 3SDEB 1LFPA 5A6PA 3WX4A 4EFAC 2VC1A 2PA3A 2LMIA 4B3RF 2FD2A 3M30B 3FEZA 2BE2B 1LWFB 4LVOP 5F0WA 4IFVB 2XHWA 1Y1VA 3TX8A 3PY8A 4LF5F 5DDPC 1NJIT 1LWCB 3Q2SC 4I69A 2ZJPQ 3MM6B 1QAXA 5KT6A 4ECYA 5IXUA 1TL3A 4IFYB 1D9DA 1UVKA 5A8RB 1RA7A 3UQSA 1VBXA 2GIQA 4CCHA 3HKZA 1HNVB 1N56A 3GTKA 4KRWA 1SFOA 3LAMA 3MFIA 1N54B 5AXMA 4B3TF 5A2QY 3K5OA 3T6BA 1H5NA 1RTIB 1R6YA 4ID5B 2CQ4A 2B6AA 4RW4B 2DTJA 4QZVB 3QQ7A 1OQ3A 1WHYA 4AFFA 5DO2A 2ASLA 3DLBA 4BS2A 1X4HA 1QSYA 2U2FA 3TAMB 3NCPA 1UFWA 4TU9A 1CQMA 4N76A 1WACA 2A10A 2EFNA 2DNQA 3CEDA 3DLEA 2W8LA 2FVRA 1FDIA 1YJRA 3ITHB 4UUWA 1T3OA 1P27B 1T03A 2ZE2B 2FB0A 2YUJA 3MMAA 1KHWA 1RT3B 3CMAS 2MGZA 4ECUA 1OIAA 2BUNA 4ZCLA 1U25A 2E5HA 5KAKA 1CZ5A 2ABYA 3L3CA 4A8XA 2B9XA 3NAHA 4B9TA 2JIPA 1YHQS 4C0BA 3VZHA 1KN6A 4HYKA 3MMCB 2R2TA 2BQUA 3BREA 4WYLA 2M52A 2FLOA 5DRKA 2ZNYA 4CH7A 4IG3B 4ELVA 4CT8A 1WHWA 2N3OA 5D8HB 1S9FA 4CI0B 2P6SA 1IQZA 2JEFA 2WBRA 2E9RX 2BANA 3QO9A 1GNKA 5T7LB 1WG1A 4EEYA 2XMJA 3AQPA 3BJYA 3BR8A 1FDAA 2V8GA 1GX5A 1Y0HA 3MXHP 2KDOA 2EFVA 5DYGA 3LWLA 4MJKA 1NJWA 5I42A 1VQ9S 4WFBQ 2QA2A 1JXEA 3PEHA 1CR5A 5A8WA 3VTIA 1AW8B 1D0EA 1QE1B 1SV5B 5CYMB 2VBXA 3OHAA 2QMWA 1CVJA 5EDWA 1R27A 3DLLQ 3GIJA 3RB4A 3CDUA 1EETA 4YDXA 4QJVA 4AONB 1H2VZ 4K2XA 2F3JA 3FRZA 3FKIA 3E2EA 4AUKA 1BQMA 2XWYA 4X62F 3C6TA 2C42A 4B3MF 2RF2A 2E9ZA 4ZVHA 5E0OA 5B0EA 3MMCA 5SUHA 4JI2F 2L9DA 2JEIA 2V3VA 1VRUA 3KFWX 2OD4A 4FN5A 3T3FA 2AYBA 3DLGB 2AX0A 4R25A 4Q8EA 1REVA 2DNOA 5IM0B 3IA0A 3M6VA 3LGMA 2HMIB 5LXRA 4NLPA 1ZAVA 2DR9A 1TKZB 1S6QB 1FKAF 4NZ6A 3TUJC 1DTQA 4A8OA 4MAKA 2OP5A 1N34F 1BGXT 5JVHQ 2RDIA 4RW7B 4YP3A 1S4FA 3QPIA 3DFEA 2X3GA 2HHXA 2A69D 1X8DA 3ZZZA 4YB6A 3CCVS 3Q8QB 2HNDB 5KFJA 4CIOA 1Q79A 1YJVA 3H2UB 3D1OA 1NAQA 2FJDB 3MOZA 3KOAA 1ZH5A 4LSLA 1Y4ZB 5KFKA 2LA4A 4USJC 1S79A 2B56A 1NJYA 2V0NA 3IRXA 1X5OA 4ECSA 4ECVA 5E33A 1NK0A 2HWHA 3KG1A 3P3DA 4JI3F 5L9NA 1JKHA 1HWIA 4CH1A 3CC2S 1Y5IB 3IR5B 4F4ZA 3PM9A 4J9QA 3M32B 1SIZA 4N41A 2L9NA 2J7UA 2WRMA 2KVIA 2ZOMA 2X1FA 2CQ2A 1XN9A 3GYNA 4GKKF 3QJLA 3F56A 1HWLA 5D77A 2ERRA 4RW9A 4JBCA 4QIEA 2EK6A 4UW2A 3PEJA 3VAJA 3OHBA 1FRLA 4WK3A 2V2KA 3KMSA 4NCGA 2FJWA 1UWBB 3OR1A 3ZZYA 4DR5F 1R0AA 3KJVB 3NNHA 3TIWA 1X9WA 1ZM2A 4IUFA 1XMOF 3MGJA 1BD6A 3UWTA 3CULA 3GB0A 5I3PA 1FXDA 1RISA 1TKTB 3ICLA 5G4DA 1W2IA 1ZYQA 2CPZA 2XLIA 1JLEB 5B0FA 4C4WA 2PA8D 4NLDA 5T5MD 4PKDB 4YQWA 1WTFA 3IAM9 5L1KA 4DL0C 3BN4A 1U7LA 3THTA 4IYQA 1FXLA 4KB7A 1Y5IA 5KG1A 2D7SA 3PO4A 5EHHA