4NOHA

1.5 angstrom crystal structure of putative lipoprotein from bacillus anthracis.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
b'ATGIVMYGDETGVQQTMDQYKDKIESQNKFEAKLGTVNEKKVLIMNKTTAEKMVKENMLKKVVKEDVEPIKALPAISDEAGIVFAKEEQKDVVIDGKKMKYEGNVVIGDARKYTDMYAVVSDAEYAKISEPVKTIGLASFKENPKEKIFPDIKRGSKVEEAHMVEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein, putative
publication title 1.5 Angstrom Crystal Structure of Putative Lipoprotein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Lipid binding protein
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17294 Lipoprotein_22 Uncharacterised lipoprotein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.60 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4nohA02
3.30.70.3060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nohA01
4NOHA
chains in the Genus database with same CATH superfamily
5FJ4A 3MTJA 4Y34A 3R6GB 3LP0B 4PKDB 3HULA 3A1YG 4ZVQB 2DEJA 4B9NA 3TVYA 2R42A 3MMAB 1Y3KA 1FJCA 5KT7A 3HSDA 4HDGA 5HP1B 4QR0A 2VH7A 2KTQA 1FKPA 4NZ6A 3KLEA 1KFSA 2B8PA 1DQAA 2BANA 4X4SA 4G1QB 3SFUA 1O0PA 4U96A 3CCQS 4FXDA 2QGFB 4NI2B 3BO3A 4WE1A 2XY5A 1SVDA 4LR7A 2W2OP 2BM1A 3CJ0A 3OD2A 2LQJA 4DR2F 2W01A 3OSNA 2HHXA 4P9SA 4C8OA 3T5JA 3BQ1A 4GVLA 3V6DA 2R7RA 3BO2A 3ENQA 3R7BB 3IS9A 4OJGA 4USIA 2RQMA 1JKHB 1LWCA 2AYEA 2LA4A 4WBFA 1RKJA 4ZMMA 2CG8A 3R5DA 1MWYA 1YSJA 4ZCIA 2JEJA 5E3QA 1TL1A 3HHLA 2VJVA 1C4CA 3D3BJ 1KC8T 3J7Z5 1Y11A 3DLJA 3A4TA 5E3RA 1IQZA 3MWBA 5A0YA 2GNKA 5F3ZA 1QE1B 2JEGA 2B51A 3QRPA 4F25A 3KHHA 2UUCF 1JLCB 5T5ID 4CCHA 3ZTPA 2C3YA 3HVRA 4DUZJ 2CJBA 2GO8A 2LXFA 2RS8A 5I3UB 1HYSA 1OYEA 4Q43A 2J0SD 5IS2A 3M2VB 3KWMA 4MAKA 4IDKA 4YB1P 4A47A 2CNKB 2BJ3A 2NSBA 3UR0A 2ATLA 2LEAA 4EEYA 3ZZPA 1GX5A 3TM7B 4AZDA 4K4SA 2QL9B 5DG8A 3A12A 3NOCA 2VPYB 1M0SA 1VDHA 1PYQA 1PJ7A 3FSIA 3QPIA 3SV4A 4B9TA 1DLOB 3O3LA 4ZK7M 4DQRA 3PZPA 3J81j 1WCMA 1RT2B 3H90A 1YJ7A 2AX0A 3GR1A 2MHEA 2UUAJ 2M0GB 3HKZD 4UW2A 2KXNB 3K59A 4JP7A 2E5LF 3D1QA 3LUYA 5H9EJ 4ID8A 4PG8A 4TY8B 2WOMA 2J8SA 1K1QA 3H5XA 4H4MA 3GIMA 2CVIA 3TX0A 2LQ8A 5HBMB 3AOCA 1WG1A 1LW0B 4WJBA 1XJWB 3SI8A 1ZM9A 2D9OA 2WVBA 3CC4S 1HPZA 1RKIA 2CJKA 5LMUF 4O44A 2VFVA 1F60B 2AMCB 1PYOB 3DOLA 1VRTB 3QNWB 5A6PA 2D9PA 4DPUA 3SUMA 3TQ1A 2AGQA 3PG9A 4N8NA 1AUDA 1XNRF 2FVCA 3I9ZA 2DGQA 5GLFA 1TKXA 1FI4A 4BDPA 3MFIA 2MQ8A 4KPCA 3WIUA 4NCGB 3F73A 4K5SA 5LJ5Y 2QSWA 5DZ7A 3K5NA 1WDDA 4E0DA 1UTAA 3CCZA 3MI7X 3BBFA 2ZUGA 2ATCB 4IRDA 4DX6A 1FTCA 2C1EB 3W65A 3UNGC 4DV6F 4OX8A 2DNGA 3P5TL 4C8NA 1WOSA 2L41A 4PXEA 4PQUB 1RI7A 2C2MB 5F3TA 1WI8A 2JRSA 3LTOA 3OR2B 1NAQA 4WK3A 2VFUA 4J90A 4GA6A 1NJZA 3MPVA 1S0OA 1TWFA 2BE9B 1TUVA 2OPRA 5E5NA 5A8RB 2B8QA 4NXMJ 2AJQA 2LECA 3H4BA 2JX2A 2Q6CA 4TNOA 4J91A 3K7RA 5IZHA 1ZYQA 4Q5VA 5IC4B 4U7UK 1AROP 1IKXA 3KG1A 2FPHX 3UCUP 1YBTA 4F3QA 5HANA 4Z7YA 4CDIA 3OUYA 1UWBB 3V5RA 3W8GA 3K5MA 5L1KA 5ETQA 3VV2B 2MKYA 3VGTA 5DYIA 2BXJA 2D7SA 2V8VA 3T5HA 1RTHA 3JXOA 1SFOA 3R5BA 3R3TA 1YK9A 4C11A 3B8HA 2NSCA 1S9GB 2LP4A 3MM8B 1Y5LB 2O1PA 1RU1A 1U6FA 3JQMA 1EHWA 3LWLA 3X2OA 3K57A 2CPDA 3HZEA 1MWQA 1A6LA 4OYBA 2JWNA 1Y1VA 2ILZA 2RF2A 4K2XA 3RB6A 2BR0A 2FHOB 1U1OA 1TMOA 3HVTA 3NGTA 1I5OB 4DPOA 1J5OB 2V2KA 2N82B 3TAMB 1X9WA 4J9OA 4IOAQ 3FC9A 3LGHA 2CQDA 1LK7A 3QJJA 2PJHB 1ZM2A 3TA2A 3KUGA 3PW2A 4DUZF 1Q8KA 2FJVA 1MROA 4I2QA 4I6AA 3T1HJ 4ICLB 2K1RB 1YRTA 2JC1A 4QQBA 4NYOA 3ILOA 5LSRA 3IR6A 3UWTA 2XS2A 2FJAB 3UD5A 2A6MA 1WC3A 4JI4F 3ILIA 1UZHA 3UPFA 3QIPA 4FVCA 4YR3A 2PN6A 3W2WA 3DGVA 3HSZA 4M5LA 3GV7B 4ZITA 2MZ1A 2VONA 2UUBJ 2W8LA 1WOOA 2VPWA 4OLOA 4DBQA 4RW8B 5D4LA 1F1BB 5KFKA 2HNZA 3SUKA 3C14B 1KDNA 2W9AA 4WU3A 2LQ5A 3SCLE 2VQFF 3N4WA 4BLGA 2BUNA 2HFOA 5G4DA 4JI1F 3FCVA 2HZAA 1RWMB 3RB3A 1U47A 3R5GA 4DV4J 2B9YA 3LP1A 1DQ8A 4OLPA 4PCQA 1FXRA 4C3KA 2C2ZB 1HHQA 3EYZA 3PW0A 2AGPA 3VGVA 2G1HA 3RRKA 1S57A 4LF7F 3T41A 1X5OA 3GIIA 1JWWA 3CIZA 4M94A 4WP3A 3THPA 1HMVB 1WLFA 2BOPA 3K17A 1BW3A 4GVBB 3WC2A 2HCZX 1UFKA 1N52B 4A8OA 6FD1A 2P6TA 2D3OR 3OJSA 3AJ1A 4LR9A 2GVZA 1TWCA 2E9ZA 1M5SA 5C25A 4ZCLA 1S1TB 1SJ3P 2EC0A 1HI1A 2RIJA 4X4QA 1QTMA 1VC3B 5IQQA 2LU2A 2WW4A 4DLGA 3G6ES 4BC7A 4ZVOB 3GP9A 3MM5A 3GJSB 2JLFA 5A2QU 3VWSA 2WZ1A 1N36F 4QPXA 5AXLA 4I64A 3UE2A 3HMJG 5K9FA 1U45A 4KKOA 5C7PA 3OUGA 4KO0B 2PD1A 5GAGU 1UL3A 2GO9A 3EZUA 3MEEA 4OJ1A 2HHTA 1T02A 1ZZNA 4C98A 5BR8F 4DR5J 1D0EA 5H4UA 5A8KB 1WTBA 4RUBA 4M5KA 3GMGA 3DGPB 1SI9A 1URRA 2ZH9A 3BBBA 4WIIA 4A4JA 1SUQA 1B3TA 1OS5A 4HL9A 4U7UD 3D0HE 3MCSA 3B4MA 4RUCA 1RWXB 3NMRA 2B43A 2XM3A 2ZC4A 1BW4A 2CG4A 2FJDB 3M4XA 2R8IA 4TLRA 4K0KJ 4OHWA 3DLKB 3TJ8A 5B6CA 1OIAA 1M1KT 3DRRA 2RB7A 1H98A 2AE0X 2HLTA 4LF6F 2VPZA 4K59A 4ZPVR 3J80Y 1RSCA 2E66A 4ED3A 3NGKA 1H74A 4KHPJ 2QYCA 5FD1A 3ZFVA 2GJ2A 3GG0A 3C6UA 4NMXA 1BWEA 1FA0A 4R8UA 2SXLA 1PT1A 3QWPA 3R7NB 1ZAWA 4W90B 1UJ6A 4A48A 3SCKE 2B7CB 4DF8A 2WBRA 3VGUA 1U1LA 2LYVA 3LQVA 2DCUB 2E2HA 1PO6A 3LALA 4Y2AA 3VVUA 5D4NA 1N32J 4NWBA 2OAUA 3K58A 3G9CA 1YX2A 4C4WA 4DLEA 3I87A 1NKBA 4B3MF 2DGXA 4TVAB 1PYUB 2GHVC 3G82A 5KTQA 3D0IE 3MPYA 4MT1A 5C5JA 1KLNA 2CZ4A 4WXOA 2YY3A 4U8VA 1MLAA 1PC5A 4TQSA 1CJTB 3EMTA 3SEOA 2W7PA 3CMQA 2UU9J 2A2DA 4EUVA 2H9ZA 4DXLA 2JEFA 3MEDB 3BPDA 1TWAA 1CJVB 3LA0A 2M5YA 2M9KA 1ZTTA 1HW8A 3ZZ0A 3X2IA 2HHSA 2MKSA 4O4GB 1PILA 2UZAA 2ERRA 5CYMB 5F9LA 4PEOA 5KFHA 1WWHA 4JCWA 3R6LB 4V19X 1B0TA 4P2FA 1N34F 4ZOSA 1GNKA 3KJQB 2LA6A 2QMUB 1Q95G 2CZ9A 4DFPA 4L75A 4OMFG 1RT4B 1XNQF 2XNQA 2UXDJ 3DOMB 1N33F 1ZM3A 4FNHA 2DNHA 3EICA 4JI3F 3G2XA 5I4MA 3UDVA 3L9ZA 3FBBA 5JUMA 3QQCD 4LBPA 1DMSA 1EETB 2I1RA 3GJTB 3CCMS 2XNRA 4H54A 2CQ4A 3QWUA 2MQQA 4F2SA 2XWYA 2DIUA 5BYSA 2KM8C 3M8QB 2O66A 3OL6A 1C1BA 3EGZA 3JYTB 5KT4A 4JI8J 3CD7A 1A0OB 3ZTQA 3NCRA 1F3VA 1FF2A 4RNFA 3PW4A 3AOAA 1QUVA 2QX0A 1RHRB 2KRBA 1XMOJ 5LXYA 3RUBL 2CQ1A 2OPQB 1IBCB 2YNGB 1IXKA 4ZLNA 2NVYA 2XHWA 3W3SA 4F4AA 3OTOJ 2DO0A 3SULA 1SIWA 3DU6A 1U02A 3SQGA 2AQ4A 4N41A 1NHKL 2H5JB 4B3SJ 3NGSA 3QYYA 5KFBA 3MCOA 3KXDA 2OO4A 4J9KA 5LOQA 2WCXA 2MLXA 4PUOB 2OPPA 2BRKA 5D3GB 4KIAA 4DR5F 1PPYA 2W2MP 4ERDA 2KKHA 2XY6A 1T9YA 3I6PA 4Y65A 4NLYA 3DLEA 3HD2A 3KDNA 3SSQA 1R31A 4DUYF 2VOPA 4JI7J 1NCLA 4WYLA 3UR3C 1SC6A 2V2ZA 4FBTA 4R5PA 2WK4A 1K0VA 2I5JA 5BJRA 1CJKA 4WFAQ 1LW2B 2FLLA 3GTKA 2IM3A 4LSLB 4RX6A 3D6TB 2NZ4A 2B5JA 2YH0A 1IQTA 5IOLA 1TV6B 1M5OC 1BQMA 3DLBA 4M8LA 2UVVA 1YBAA 1CS4B 3BGFA 3KK2A 3CMAS 3UW1A 1SC1B 3L7UA 2RU3A 2BM0A 2YX4A 2R7UA 2WONA 4YP3A 5AXMA 2BE7D 3DMJB 4JI5J 1RAOA 2R2UA 3CPWR 2I2YA 1U7LA 4KYZA 2XG8A 3AD8C 1PYSB 2DGSA 4I2PB 1SPBP 2DHAA 3PKMA 3CDWA 1RABB 4DCOB 2QE5A 4EI2A 1VI7A 2V34A 5HVFA 3Q8SB 1FKOA 4N47A 2ZVIA 2G2YA 3H98A 1N5YA 5I42B 4G1PA 3ZTRA 1AUSL 4PZVA 2HFNA 2GW8A 4DR1J 3U1MA 1B99A 3FEXB 1S6PA 3QRRA 2AZ3A 1REGX 2G4BA 4CO2A 1BQXA 5L1JA 1FDOA 4WPAA 2GA7A 1RCOB 1EKSA 2GAHC 1XQIA 1FDIA 2P9GA 2WVCA 4NLSA 4X4TA 1LKZA 1V5IB 3GCXP 5LXRA 2HYIB 1YG0A 3C46A 2Q66A 1F5CA 1V6HA 2VBXA 3C6TA 8AT1B 1R3NA 3CT9A 4FYYB 4HEA9 1K83A 4A8MP 4X64F 4Y2MA 1VQ4S 5IV3A 4B3OA 4LFCF 2EC2A 2RUSA 2DK2A 2MKCA 3DLGB 1D8YA 3BM7A 4RNMA 5T5MD 3KMQA 3G8QA 3MR7A 3MECA 4OHXA 3Q8YA 1HFEL 1S6QA 1E18A 1NLKL 2HBRB 2V9KA 2RE1A 1V3RA 1NMEB 3IGNA 3MMCA 5KFAA 1EAYC 2HHPA 4WFZA 1KFDA 3K89A 2Y8YA 2MSTA 4RBUA 5K14A 1U2FA 4V1Ak 1AZSB 2PICA 2O5JD 4OI2A 3N6NA 3SFGA 1YTYA 3G6YA 3HSJA 1BHNA 5HATA 1RAEB 4B02A 4MMOA 1M1GA 3KLHA 3DRSB 1N0VC 3MM9A 6AT1B 1KSPA 1RBAA 5IFMA 4ED1A 1UEKA 4IKAA 2QMWA 1TAQA 1OPIA 1WHYA 5JVHQ 4DV2J 5FIIA 2EFNA 5F8GA 2BE2B 1HBMA 1S1VB 4K4YA 5HN0A 3QMQA 1Q5VA 2E7WA 4AVRA 3LGNA 2QLJB 3KKFA 4HT5A 3ITHB 2LQ9A 2XYPB 2IJFA 4CNZA 2RH3A 1W7WA 4F0MA 2OPSA 2GIFA 2ADCA 5A8WA 2LLZA 3R1LA 2HHHJ 2FHJA 1IKWA 2BZ2A 3DHXA 4NPOA 3M32A 1FCAA 2HBYB 4NLQA 3KJVB 2FLPA 1NK8A 3SSSA 2BW7A 1HHTP 3GLJA 4N76A 1S9EA 3NOGA 2V4JA 3TVZA 2FY1A 2CXEA 3Q86A 3POTA 4EFAC 1YNJD 4HI1A 2F63A 1WJ9A 2KG0A 1Y7PA 4XDDA 1FRLA 1CZ4A 4HYKA 2D3ZA 4ZCMA 3I56S 3JSMA 3GFHA 4A8XA 4U95A 2YKNB 5DDPC 3PACA 5FTMA 1FEEA 5HL7Q 4CH7A 3EM1A 2G13A 1S1XA 3LH2S 2MQMA 3TEGA 1TL5A 2CUYA 2KM8B 3V4MA 2POKA 2B56A 4LFAF 2KG1A 2C3OA 3GIJA 2VFTA 3V6JA 3QQ7A 4ECSA 3DI6B 3JSRA 2PSZA 3R5AA 3O5TB 1Q53A 2DKOB 2DNZA 5H9FJ 4MIWA 3I0RA 4EZ9A 5J2PA 3GCWP 1S1UA 1KVKA 3K2YA 2GAGC 2IA0A 2X1AA 4DQPA 1BWVA 1UVJA 2HHWA 1R89A 2ZH1A 5KFYA 1VC6A 4NMLA 4F3MA 4ED5A 4NXNJ 2XSJB 3W5ZA 2UUWA 5IWAJ 5CAAA 4IH6A 2X7IA 1VR6A 3OQ2A 1O51A 2ROGA 2H51B 1AYEA 1S97A 4F4WA 5G0RB 4OZ5A 3BB5A 5I3PA 1HWUA 2YXLA 3KLIB 1BD6A 1NEEA 3N5BA 3UCZP 2GGPB 3JTOA 2C2OB 2KXFA 4YB5A 2EG1A 2I8EA 1CLFA 1NK9A 2VG7B 1K8AT 4KH1B 1NB7A 1JIHA 3G6XA 3D5MA 4DSIA 2MZQA 3A8EA 2F40A 1CULA 2JOQA 3T5LA 1IJFB 2HAFA 1YHQS 4MIAA 3VAIA 3HVWA 3ET6A 3MTKA 4DG1B 3DLHA 1U49A 5DG7A 4O0IA 4EO8A 4QOTA 3QT5A 2H4WB 2IIHA 1C2PA 1G8KA 1H5NA 1Q7LB 4UZBA 4F4YA 1RAJA 5K20B 3TJ9A 3KHLA 3U02A 2NR0A 5HQMA 4ED0A 1XR5A 1P1TA 2DHXA 2CPHA 4YEAA 4FF4A 2FJXA 5JMNA 3W5YA 3EZOA 3ZTSA 2IJRA 1S76D 2YU9A 4OYMA 1T03A 1I94J 1QY7A 1RGVA 1Y5NB 2IYIA 3MEGA 1VIXA 3FDSA 1CC7A 2E5GA 5K8MA 2J7UA 4DQIA 2JIQA 2N3LA 1T05B 3PX0A 1Y0HA 4JUZA 3QFWA 4IFYB 4OHYA 1S1WB 2VL1A 1WNEA 4HT7A 2R7XA 3IR7B 3H5SA 4WXWA 3BR8A 3F44A 2QG9B 1U8WA 3KUEA 2KT3A 1L8FA 2ZH5A 3EE3A 2BOAA 4I6WA 4YUDA 4CI0B 4ZDNA 1GXUA 2CRLA 1WC6A 3DM2B 2G1DA 3GSIA 3K8VA 3IG1A 5EWFA 1NH8A 4LREA 2GCFA 3MMBB 1VRQC 1U0HB 3PTWA 5KG0A 3KK3A 5GMKa 4I68A 2H3EB 3FCWA 4ITSA 3TARA 2J9EA 5DM6Q 2A6HD 1F9HA 3MR5A 4DPXA 4ZPBA 3C16A 1ULRA 2R7TA 2DNMA 3CCTA 1GT8A 4RZRA 2DR7A 4UTGA 1S6OA 1KLMA 5ETVA 4QPTA 2DRAA 1E6VB 1R9TA 4LFBJ 1LXJA 3PJWA 1T7PA 3DOKA 1N5QA 1KQGA 4YDXA 2RUGA 3RW7A 3MCMA 3KNGA 1G6BA 2JVOA 2AGOA 1GFWB 4GC6A 3PW5A 2CPJA 4P75A 1RAAB 1OY9A 3CCVS 2V8PA 2WRMA 1R8PA 2PEBA 3R2DJ 5KG6A 2KO1A 2HBZB 1H0HA 1DTQB 5H1SV 4F3OA 1P1LA 2I6WA 3AA8A 3D28A 2FD2A 2FDNA 1IR1A 4PG5A 4DV1J 5FTNA 3A8JA 3PVXA 4PXBA 2QMXA 2CQGA 1GMVA 1NRKA 1NHVA 1MU2A 3TUIC 2GMLA 2KVIA 1S59A 2BJ9A 4DUTA 4DWIA 3MD1A 1UW9A 3QAEA 1FK9B 3CIMA 4H4OB 1F2HA 3BQ2A 1Y10A 5D4PA 3I5BA 1OGYA 4PABA 2HWIA 2F8HA 4ID5B 1X7VA 2P8IA 3OT9A 3QT6A 4WFXA 2HGNA 4M63A 3LANA 2IY5B 2P5VA 4ZIVA 4GC7A 2HK2A 1N48A 1FWKA 3BSCA 2PA3A 5DO2A 4AQYF 3O5AA 1FRXA 1Q16A 4C8YA 2PMZA 3HXMA 4HHJA 2ZJPQ 1N4LA 1FD2A 5LSOA 3J7AN 4JJOA 5BYRA 3J81Y 4IOBA 2EK1A 3IRWP 2XYGB 4NLTA 3PYDA 3W62A 2QA4G 4DR3J 3EGNA 3VVTA 2UXCJ 2ADBA 2Y9HA 4C3MA 4Y2CA 2R2TA 3D3CJ 4TYAA 1TTHB 4OI4A 4C6AA 2B6AB 4IG0A 5DDQC 3K0JA 3GONA 3NMAA 3E2EA 5E3AA 3CUNA 3DC2A 4XDCA 1XMBA 1YI2S 2ILYA 4CP5A 1BMQB 3PW7A 1UP1A 3N0VA 3I0SA 4KGZB 1YGYA 1DJ0A 1XR6A 3TZZA 4KV8A 3I4HX 5D4OA 3A13A 3KFWX 4QBUA 4DV5J 4J9RA 5CQGA 2PIIA 5JJBA 1R0BG 3J7ZT 1AW8B 4D7ZB 3TUPA 1S79A 2R7OA 3PFOA 2XLJA 2VOOA 3RZAA 1RT5A 1FNXH 2PMWA 4RO0A 4NCAA 3OTCA 6FDRA 3KK1A 1X5SA 2ZD1A 3U27A 1HR0F 2DY1A 1PSDA 1WKKA 2GAEA 1MWZA 4HACB 1PYTA 2BJEA 5HMXA 1S7HA 3LP0A 4YHHJ 5F8HA 2ABYA 3MR6A 4UOGA 1HBNB 3MMAA 3QSYB 3IXQA 1VQYA 3V81B 1N6QB 2D74B 3W61A 1HNWJ 5HP1A 4ZPAA 2ZJRQ 2HFZA 2HIQA 4L76A 2EPIA 3R8YA 1RWPB 5T7LB 1J2VA 3BZQA 2PI8A 2N4DA 3TR5A 2RHQB 4G1QA 4ZA1A 1B7FA 2W9CB 4KSEB 4YDDB 4NI2A 3N79A 5EWEA 1EARA 1VFJA 4FXVA 2AYGA 1SKRA 4OI3A 3N6MA 2XMWA 5J2QB 3QC8A 2Y0SD 3GV8B 2W24A 3NXZA 2LEBA 2CNOB 3AXMA 1SQEA 4E98A 2HRYA 2LKZA 2CDRB 3GG1A 2MQOA 3M9MB 1CR5A 1AXQA 2EFGA 4D3HA 2DR8A 2V68A 2C22A 1JKHA 1M5VC 1UWAA 4PG7A 1IBMF 3ZXWA 5CYJA 3IMQJ 4YN3B 2CADA 2PJJA 1KVJA 1XBWA 4ZP7A 3M1VB 3CJRA 4B17A 2HS3A 2ZC3A 1VBZA 1GXTA 3UI3A 2UP1A 4DDFA 4DV3J 3MUMP 2OUGA 2F4FA 1VQ8S 3KLFB 3B54A 1QE1A 1RAFB 1S4EA 2Z2YB 3JAMU 1JLCA 4KHRA 4LBIA 3WX4A 4TKTA 1B4SA 5I3UA 4CTAB 2V94A 1DHMA 4YFUA 2LFVA 3M2VA 1TKDA 3MFHA 2WW8A 3P96A 3W63A 1RU2A 2LVWA 2XB2D 1VK3A 3C2PA 3OVAA 1E61A 5KOWA 4QYZK 4W98A 1RA7A 1U1RA 2HURA 4CLSA 2PNWA 4OYXA 3GYGA 1UW4A 1APSA 2VPYA 2ZBIA 2ZKTA 2EFOA 4OQJA 3NS6A 4C0OC 2R2SA 1BGXT 2RKIB 2VFSA 1DLOA 4RW7B 4JI2J 1PIEA 3I31A 3T1YF 1RYRA 1RYSA 1RT2A 1ICEB 4WFYA 1LNQA 1H2UX 4M5NA 2CQ3A 3RGIA 1UZDA 3TO8A 5D78A 4ENGA 2GJFA 1GK8A 3I96A 4I69A 4TY8A 4ED2A 4LF2A 1NJWA 1Z2LA 4AD6A 4C8LA 3SCJE 1YZ7A 1VQ7S 3X2HA 3I82A 5HBMA 3ETMA 4QYZJ 2E2IA 3O2IA 1NJXA 1LW0A 1JJ4A 5CCLA 4DL6A 4JI0F 4O3PA 3CTRA 1R8CA 4Z37A 1NSAA 3H40A 1X4AA 4GO5X 4UUXA 4NEYA 4DS5A 1YQHA 5E3CA 3HHNB 1VRTA 3VALA 1DTTB 2EKNA 4Q0BB 1DRZA 3DU5A 2IA6A 4EBDA 3OL7A 5I3QA 2XSFA 1KOHA 2CW0D 3X2JA 2M4MA 3M30B 4YY3J 3OTDA 3QATA 1IR0A 5KFDA 1VQNS 3G8SA 2F3JA 5IQ6A 3O1LA 2AJ2A 1VQ9S 3L95X 2PFFB 4C9DA 2YUJA 2Z2LA 3RR7A 4NCGA 5SZTA 1UVNA 2ZZTA 2WB1D 1TWHA 1U48A 4LQ9A 1RAIB 4K4WA 2GVDB 2OI2A 2XMAA 2AD9A 4FS2A 3O8WA 1VHIA 5HO4A 1FO1A 2FTRA 3AB2B 1LK5A 3BH7B 4GKKF 4PQUA 1WG5A 1PC4A 3CB4A 2V63A 2IVMA 3OR2A 5AE1A 3W9IA 2N4CA 1Y5IB 3GB0A 2AEFA 4USTA 5A8RA 4OZ0A 3J80U 4IRKA 1SMYD 1IBLJ 2NUHA 1RE1B 1UEVA 3AOBA 1HNWF 5D0RA 1N5TA 1RHMB 3PYEA 2LEPA 4O4RA 5C2CA 3M9OB 2W1BA 1EB0A 1ZA2B 3ICLA 4DPWA 1KN6A 3LGMA 4DV0J 2BACA 4RW6B 1CJUB 2E7XA 1UWBA 5F0WA 4P2SA 1SH2A 1H72C 1FT8A 4WKYA 1EKRA 2PFDA 3U1LA 3W60A 2HSEB 5IXUA 1S9GA 1JLEB 3MM8A 1L3SA 2DXEA 2HZVA 1K73T 2R3VA 3RR8A 2UVUA 3LP2B 3A3NB 1HD0A 5E7OB 3TYTA 3FKBA 3SYZA 2DNPA 4LF5J 3LOUA 2RMLA 2PC6A 2W7OA 1XWLA 1WDTA 3RRHA 2B4PA 5GAHI 4FS1A 3WX8A 1SL0A 1WHVA 1VYAA 2QT7A 2GQ2A 4LT6A 4DR2J 1J5OA 3D6FB 4KH0B 4QIWA 5ETLA 3TAMA 2Y8WA 4DX8H 3IBWA 2CNLB 1VCTA 2C3PA 1AFIA 4OZ2A 2ZH2A 2H48B 3GTOA 2XLKA 1SXLA 1FVSA 3Q8VA 3DLLQ 4KGMA 1D9DA 2J9DE 4IQMA 1S48A 2R8JA 3I5CA 1SC4B 1GX6A 2QV6A 3D7SB 3IA0A 3JSYA 4ICLA 2RILA 2K1RA 3R5JB 3RYLA 1S7IA 3AD7C 4ANEA 3TEHB 2G5DA 3P3DA 5K8PA 2AF6A 5DS7A 4LVNP 2CJQA 1I6JA 4DS4A 2UUCJ 4OJ3A 1WF0A 1UVLA 1HL6A 3GTLA 1M5KC 1S77D 2GZOA 5EX3A 3MXHP 2QIFA 2NVXA 4JV5F 4RW8A 2Z2MA 1QAJA 3C14A 2I9SA 2VBYA 2J7WA 3BYRA 3S1TA 1Q8LA 3G6VA 1F9FA 3H20A 2OD6A 2W4PA 2MZJA 1OQ6A 4CO0A 2MZTA 4LUBA 4JOUA 4CZCA 2H54B 3CJ8A 1QDUB 2VUGA 1B7YB 4FG2A 3FBCA 4QIFA 3H4DA 4ZP8A 4DZ6A 5ETOA 3VQSA 4P2XA 4NRUA 3RAXA 1HMVA 4AL5A 4RNNA 1XR7A 2E5LJ 3JTNA 2ZITA 4GVBA 4OYZA 2MDAA 3P45B 4Y28C 4OX9F 1HBOB 3BH6B 1Y4ZB 5HVHA 1S12A 3I4PA 1FWLA 4DEZA 2F4VF 1YJWS 3M8SA 1S1TA 2ZHBA 1BE4A 2CPIA 3CE8A 2HQDA 3Q0AA 1OA7A 4LJMA 3KG4A 4N77A 1T8EA 1TKTB 3X2GA 2CQCA 1RWWB 3IWLA 4DR6F 3BR9A 4CM2A 5LMUJ 3LO3A 4ZP6A 2MQLA 3HO1A 4NLPA 1FDNA 4CO5A 1R6YA 1IM6A 1T9WA 1DURA 1XNRJ 5HSPA 4QWCA 4KO0A 3IR5B 3I9V9 2V8GA 4IFVB 4U6PA 2R92A 3SIPB 2DMRA 4NRTA 4MH8A 1X4CA 2VV5A 3DCAA 4N7TA 1MSWD 2ZH6A 2NS1B 4DOZA 5A8KA 3FK4A 2A10A 4FDFA 2DNRA 4IO1A 3TOQA 2WAQD 5RUBA 2R7ZA 2PI4A 5C42B 3Q22A 3DGPA 2PT0A 4KPYA 4DV6J 4CLKA 2Y0BB 4MJKA 2GX8A 5F8LA 2B7BB 4GA5A 2CPXA 3MAHA 1Z2ZA 2B4UA 3EDRB 2HQGA 2G0CA 1HNXF 4RNOA 5IT9Y 5J2MB 4W92B 3RG6A 3R2CJ 1A9NB 1KRPA 2VQEF 1FRIA 1QAYA 4YR2A 2AU0A 4DN9A 2CQ2A 4HTIA 1N5SA 2C45A 3W5XA 4PPDA 1LWFB 3W9JA 2BQUA 1H3DA 1T95A 4LF5F 2CYYA 2MHNA 4Y0FA 3NAHA 2J76E 2L48A 5LJ3Y 3KLVA 2RS2A 2C2EA 5LT5A 2ZHOA 3VGSA 2B4OA 2ZDOA 5K5MA 4QWBA 3RB4A 3BJYA 1XC9A 3GSDA 1CVJA 5KFMA 1JLFB 2BH0A 3BGUA 4YMEA 2W4CA 4OYAA 4OYOA 1F5BA 1TELA 3KHRA 2CQIA 4UOFA 1ZPWX 2DNOA 4NE9C 4USHA 2DHHA 4Q2MA 4ECQA 3KOAA 3Q89A 5HMWA 2K3IA 1CJTA 1VOMA 4PPZA 1SJRA 3W2VB 3OHAA 3MEDA 1S10A 2DRDA 3OXFA 1CJVA 2EG2A 2YVSA 1W2IA 1OO0B 3RJMB 1BQNB 1WG4A 1TP7A 2D41A 2DNNA 1RWNB 1X4FA 1PBUA 4O4GA 2YKQA 4TQRA 3PKYA 1LXNA 5CYMA 4LSNB 1WUUA 3W1YC 1WHXA 3X2LA 1KQKA 5AJ3F 1YJNS 3DRPB 3DKDA 2NUUG 4LRDA 5DZ6A 4HI2A 4X2BA 2YNIB 1PJ5A 3OJUA 5A2QY 4NLGA 2HBQB 1RT4A 3P5BP 4JI4J 4NL5A 2EVZA 1TMJA 3DOMA 3QZ8A 1JLGB 2V45A 1HA1A 2YNFB 3H0GA 4FBUA 2W9BB 3Q83A 1J5EF 3ISZA 4OV1A 9RUBA 1UVMA 5HROB 1WC0A 3HX9A 4OHZA 3HHLD 2PMHA 1EETA 4ZVFA 3VAFA 4J5OA 3ZZZA 4E2FB 2IHR1 1HNZF 2IBKA 2R7QA 2HQIA 3M8QA 2JZ5A 4C97A 2VQFJ 2XMUA 4JI1J 1GMUA 7FDRA 1NDPA 2AV5A 3KDOA 3CCES 1T9UA 3CO0P 4LMZA 3KLGB 3M8RA 2NXCA 3WZ0A 3FEYB 5A76A 1HQEA 4AUKA 2IFXA 2HS4A 1TKZB 1FRKA 2OPQA 4LF7J 4KO8A 2DISA 4BHQA 5KG1A 2IMOA 2YNGA 4JB8B 2ZBRA 1FJGF 5B7WA 2FLOA 4OJHA 2VG5B 3KMSA 3IC1A 4KDIA 5GM9A 1UA1A 5KG3A 3ADAC 3QO9B 5EDWA 1X5TA 3NNHA 3HZGA 1NZAA 2IAJB 2AJ4A 2DHGA 3OL8A 2ZM6F 2E7ZA 2HVDA 2IRUA 1DFDA 3LAKA 4K5RA 4PUOA 4M5MA 5D3GA 1P9QC 1P8GA 2QA1A 1QD1A 4L3KA 1YVFA 2GV1A 1PG5B 1RT1B 4MKBA 4USJC 1D1UA 4F4XA 3X2PA 3MM7B 2Z2ZA 1N36J 4WCEQ 3PRDA 4XPEA 2HKEA 5EN1A 1NU4A 3W8PA 2K7JA 1UETA 2DYAA 2V8HA 1SB6A 4ELUA 3ISND 5DG9A 3FQKA 2GMHA 2OEMA 4OYWA 2B9WA 1K9MT 4IO9Q 2RQKA 1IJEB 2RRNA 1LW2A 2VF3A 5BR8J 4RW9B 1ITPA 4LSLA 2K2PA 1HD5A 2MPUA 3PHEA 2M7SA 2VC1A 1DZ5A 2W2QP 3FVYA 2XC9A 1TV6A 3TW0A 3ZZUA 2IV2X 2HAIA 3NGUA 2ROEA 5T14A 4OYIA 1ZOTA 1SC3B 1CS4A 1R6VA 2NPIA 3OVBA 4DV7F 2ZBQA 3OTEA 2EI5A 2P6SA 1RXOB 1S72S 5E41A 3DMJA 3EVOA 1HI8A 4F04B 2XO7A 2BVZA 5EPPA 1NNDA 3MAQA 4WP8A 5KFIA 4ELVA 5DM7Q 2F9JA 4MYUA 4I2PA 4ED4A 3RRGA 5DQGA 3RB0A 5AE3A 4LF6J 2R93A 1PGZA 1SL1A 2L9DA 4CLPA 3AHPA 3D30A 2BW2A 4URQU 1JLQB 1XERA 3GTPA 1X5PA 4AYBA 1IKVB 1R0AB 3TIWA 1RT6B 1YJUA 3AQOA 1DBDA 2DR9A 1X0FA 1MNEA 2N3OA 1VRUB 1S3SA 5BYQA 4ENOA 3BSNA 2EBEA 2ZZNA 2ZH7A 1KKHA 4CRZA 4DQQA 2XYHB 3CO9A 1RTDB 4YQWA 1FXDA 3M32B 2HVZA 3DXBA 1CZ5A 3VAKA 4B3MJ 3C19A 2NAPA 3LWMA 2M8HA 3FEZA 4DR4F 3CCJS 4M5DB 4N8OA 3HU3A 2F1FA 1JXVA 2KFZA 1YBUA 4OZNA 2GHWA 1R8HA 4QIEA 2F65A 2KHDA 3MZIA 1FX4A 1C1CB 1Q81T 3K5PA 4F8RA 3HCXA 3DLGA 3QGPA 1D09B 1HKAA 4IR1A 3PO4A 2QN6B 4X84A 3W7BA 2HMIB 1NK4A 1HQUB 3HSGA 3AY0A 3NWGA 1LQ9A 2YWWA 2WB1A 4LSZB 2E5HA 4B3RF 2M88A 5SUHA 1N34J 3GTYX 4F26A 1BXNA 1AZSA 3MMJA 4LIRA 2RQ4A 3D54A 4UT4A 2FZKB 1G7CB 1N8RT 2R8KA 4URSA 2KT2A 1L3TA 1F2GA 4IRCA 1NK5A 2VG6B 1XNQJ 3DRSA 3SDEB 4ZJQA 1UA0A 2HHQA 1N33J 2BJ8A 1W25A 1BUXA 1S49A 2IRYA 2DIVA 4JI3J 1MN9A 4CT8A 3X2KA 1V3SA 4F0HA 5HLFB 2P9CA 3C15B 3T6BA 3HDSA 2BE2A 2E29A 1S1VA 3DXSX 8ATCB 5LMNF 1TZ0A 4DU7A 1JJ2R 1J27A 4FF1A 2KB2A 3BGOP 3EPGA 1I3QA 5IC6B 2Z4PA 5AE2A 2V4QA 3A3OB 1WI6A 3GFYA 3IBFB 3D66A 3QFHA 1EZZB 5KG2A 1RT3B 1X4GA 2A3JA 1RZMA 4FNIA 1WEZA 5CH7B 4C3LA 4CLZA 3KJVA 4P72A 4Y2KA 4F36A 1F9EB 3PR4A 5E2QA 3RU0A 1C0TB 3PR5B 3Q2TC 3UCGA 1Z1ZA 1ACMB 2GHPA 5HQ8A 4ATNA 4ECTA 3FGVA 2QFIA 3GJRB 2BA9A 2YKNA 3BGRB 4ECRA 2D3O1 3FBEA 3PX6A 4NX9A 2RQCA 3J81U 4A46A 5K8NA 3DMRA 3R1HA 1X9MA 5L9NA 3G4SS 1YDLA 1P27B 4DUYJ 3DI6A 2BKOA 5FLXU 2HNDB 3GE9A 3GIKA 2JLGA 2XGQA 3PM9A 2J5AA 1XTZA 2XCPA 3T9NA 2MKJA 2Z0GA 4J9QA 1YKWA 4AFFA 4KHMA 2XSJA 3FNNA 3H0PA 5GMEA 3FUYA 1T3NA 3UQSA 5FTJA 2QL5B 3BPSP 2OLWA 1VBKA 3M2UB 1Y9OA 5G0RA 2BQ3A 1V5VA 2WVFA 4KFBB 1IBKF 1PT0A 1UVIA 3KLIA 4ZLPA 2JEIA 3K8WA 4ZHRB 2VPXB 2GGPA 1KHVA 1QAXA 2VG7A 3HU2A 2EEOB 2J6SA 4OHVA 1IUJA 1H7WA 2FHMA 5B0FA 5GLXA 1U4BA 1REVB 1VC5A 1QTNB 4J9UE 1U24A 2QLXA 2O5DA 1P6TA 2KZZA 1IKYB 4JP6A 1D9AA 3EGWB 2DD8S 4WTOB 4DG1A 1JMTA 2UVRA 2DNYA 3VZHA 2MZRA 4IR9A 2J0XA 1VK8A 4EBCA 1S99A 5JXSA 3KHGA 5EHHA 1WTFA 3BREA 5E3PA 2R4FA 3DN9A 1X4EA 5CYQB 1XEZA 3CXCR 2MEWA 1N88A 1HWLA 1QJHA 1OY6A 3AXKA 5FTKA 1WOPA 1QSYA 3FRZA 3CJ4A 1F0XA 3TWZA 2E1PA 2V0NA 1KEKA 2LMIA 2KDOA 4CH1A 4KY3A 4UF4A 4ZPTR 3FMWA 4DL7A 4X65F 1T05A 3K5LA 4X66F 4IFYA 1S1WA 3Q24A 1F3FA 5HMYA 4U9RA 4X64J 4OX7A 1QLNA 4LFCJ 3IR7A 4NOHA 4TYBA 2G2ZA 1VLOA 3PO5A 1VQPS 4X62F 1OA9A 4ED7A 2HGLA 5IT0A 4EZ6A 1ZAVA 2WSCC 1QAIA 3FZBA 4KGXB 3DM2A 3E51A 4DHVA 4J9PA 4Y2IA 3MMBA 5L8RC 1U0HA 1KP6A 2XHCA 4CYUB 1EU1A 2I38A 4LRFA 4M5JA 1QM9A 4K2JA 2DVIA 2G6GA 2FIUA 2HQ3A 4K50A 2Q1LA 2WAQA 2Y3YA 3PXGa 4LF1A 4I7FB 5IT4A 4GKJF 3V4IB 1FXLA 1R27B 3FFIB 4ZVSB 1FX2A 1T9TA 3TQEA 1C4AA 3OLAA 5J1EB 1WF1A 2Q6BA 2AP6A 4NZ7A 2X1GA 1Y3JA 4H4KC 4TN2A 1CQNA 2KT5A 3PYGA 2ZH4A 2LQBA 4KJIA 1HWKA 4CLLA 4KRWA 4ER8A 2XTJP 1TL3B 1NK0A 1CQMA 5E33A 1E6VA 3HFKA 1TK8A 3QZ7A 5KFQA 1K1SA 4FKXA 5T41A 1MMNA 1W26A 4F4KA 3BQ0A 1C0UB 2GFFA 4CRJA 2IC3B 4BS2A 3P8BB 2MMYA 4FYDA 4D3GA 5DGBA 1G8JA 2AJ0A 3JB9k 4DMZA 4OI1A 3OHBA 1KS2A 5M2UA 4O0NA 4U7CA 4TU7A 2V69A 3M8YA 4ILLA 1G2EA 1DTQA 1I50A 3ENWA 4FF3A 3NNCA 3A8KA 5KFNA 2BBEA 2ASYA 5JVGQ 3HHKA 2KN4A 1AFJA 3HJFA 2DRBA 2Z8QA 2C3MA 5KFGA 2VA2A 1ROFA 5ETKA 2UXBF 4LR8A 1HNVB 2JVRA 3QBCA 1ZH5A 3MDFA 4OYPA 3BN7A 1RTJB 3O6QA 3PFEA 4G65A 1FK9A 2BKPA 3EWGA 2ACYA 2W7AA 4H4OA 2JDJA 4ZVTB 2Z58B 4KB7A 4ECVA 1HWJA 4ID5A 3B78A 1Q5YA 4WZMA 3MGJA 3THTA 1Q82T 1QSSA 4LFAJ 3ZNJ1 3CW2C 1PQFA 3HFZB 1PBAA 4LF9F 3BBCA 1WC5A 2J0WA 4USUA 1HQ2A 4S0MA 4IH7A 2JSXA 2DPJA 4FYWB 1IR2A 1OQ3A 2HNYB 3N01A 4JV2A 2IDLA 3RBZA 3V2UC 2VU5A 1UAWA 4HDHA 2DO4A 4HHUA 4DPTA 1RCXB 1RAGB 2XWXA 1Q8IA 1NJYA 2COLA 2B6AA 4DX5A 2DH8A 2RU9A 1KQFB 3CVKA 2ZNZA 4BCAA 2EWHA 3CJ2A 1ZPVA 4LRAA 3UDCA 3UD4P 3NRBA 1CSJA 2JJ4D 2LXUA 5GAGI 3FZ2A 5HMZA 3F56A 5F9NA 5LSLA 2UUTA 4LF8F 2YWGA 1HI0P 4DSLA 1IW7D 1WD6A 2HVHA 5ETRA 4KE5A 1LWEB 4CNYA 4ZCKA 1JB0C 1KNZA 1L3UA 3HKZA 1FJ7A 5L1LA 3M6VA 4F50A 2H4YB 4RW4B 1SV5B 3QT8A 2CVEA 1YIJS 5EX0A 4ILRA 4JS7A 4HACA 5H9EK 2R7SA 2DHSA 5C1BA 5D0GA 2XCAA 3OBIA 2QA2A 2BABA 2J8AA 3NBPB 2AJFE 1H73A 4KAIA 3CJKB 1HBNA 3GYXB 3EVWA 4B9UA 1SQGA 4K4ZA 4KT0C 3W66A 3V81A 1N6QA 2IVFB 3T19A 3B82A 3MM6B 5LM7E 4DSEA 1Q1KA 1Q78A 3AFGA 5T7LA 1SIZA 2QLFB 3M05A 5C24B 4L73A 1GQEA 2OIHA 2W9CA 1PCAA 2CZVC 2ZOGA 4QZVB 5D8HB 4PYDA 5J2QA 4DR7F 2WSEC 3EZ5A 5L38A 4ES3A 4PWDB 1WEYA 3T5KA 3QGGA 1SH0A 1Y00A 1SJFA 1RLCL 2RHSB 4ZJLA 5M2RA 2CPFA 2BRLA 3BGLA 3CWJA 2PEHA 1HBUB 4YB7A 4B3TF 1RK8A 2ENGA 1DMRA 3H59A 3IRXB 4GO7X 4TLQA 4ES1A 1MMLA 3RAQA 3PIOQ 2HK3A 3SBMA 3GYNA 3UNYA 4ZIWA 1VQMS 4WTYA 1VMBA 2B9EA 4PG6A 1ZC1A 3M1VA 1UPMB 2HQFA 3OVSA 4NLDA 4CLTA 1KTQA 3EXYA 1RTZA 2YNHB 4P71A 2MXYA 4LF4F 5CD4H 3U7JA 4QWAA 3ELHA 1CG2A 3PLXB 1YWXA 4CO1A 4J9MA 5AXKA 2RDJA 3M3GA 3Q8PB 2PA8D 3KLFA 2ZWPA 4DCJB 4JI6F 2R8GA 2UVWA 4DL0C 4RKUC 2XGPA 3EX7B 1CPZA 3PX4A 4G3IA 1HLWA 3OR1B 4PXDA 1B64A 1V9OA 1AA6A 2O67A 3PYFA 4CTAA 3IWNC 3UD3P 4ILMA 4Q7AA 3HVAA 2E5JA 2CIMA 4B9MA 4K4XA 2A0FB 2C3UA 4EMDA 2YTCA 5HQLA 4YOEA 5J2NB 1I1GA 2KJWA 3KJNB 4CS0A 2J0QD 3QSIA 4UOCA 3TA1A 4QW9A 2GIRA 2RDDA 5DQIA 1E60A 3VTIA 4O3QA 2JFDA 2CPZA 4LQ3A 2YKMB 3CSKA 2RKIA 4PYAA 4RW7A 1WSRA 3AA9A 4RUHA 4AXIA 1CBKA 4DSFA 2NXUA 3VAJA 2XMTA 1FRJA 3M8WA 2FGOA 4HVZA 4FG4A 3TVKA 3OSPA 2EFQA 1I3OB 2OHDA 5K8OA 1NK6A 3R97A 2XI2A 3HHLC 4M5HA 1Q0NA 4BBYA 1G4CA 1JX4A 2YWHA 2QO3A 3O44A 3EPIA 2FHJD 2AHOB 3C8YA 1H6KX 1W2BR 4CO4A 4BC9A 4NLWA 1DARA 4WP9A 4OI6A 3QT7A 2J6UA 4MYTA 3NLCA 1FVQA 1NKEA 3CGIA 1YNND 3DDNA 2QYGA 3QJPA 2AT1B 3H2UB 1AW0A 2XQCA 2DNQA 4ZVEA 5B0CA 5GAEU 1DTTA 3Q8RB 5FTLA 2GMJA 4Q0BA 4USMA 5KG7A 1MG7A 2IRXA 4KBIA 1QVFR 4AQYJ 3RBEA 1RISA 3QAUA 3M30A 4HR2A 5IM0B 3GILA 1DAXA 1RACB 4OZ1A 1UFLA 2VBZA 5CCMA 2MTLA 4OZJA 1JLAB 1U0SA 3M9NB 5DQHA 4I67A 1N5VA 2IPOB 1KD1T 4CT9A 2GVDA 4NYZA 4L6V3 1EIYB 5KFXA 2XZTB 4UUWA 4P52A 1ZA1B 2CQHA 2FQQB 3S01A 3DDKA 2ASLA 4EWTA 5IT9U 1WELA 4OZ3A 5KFZA 3DYAB 1PKUA 3NP5A 3I5AA 3ISNC 2YX1A 2MGZB 2K7KA 3W9HA 1N56A 4RWXA 1Y5IA 1V3ZA 3HM9A 3E01B 4ZPDA 2FGCA 3FQLA 2WVEA 2DR6A 4CM0A 3BDEA 4I0WA 3E3XA 5FDLB 3UFCX 5C18A 1HW9A 3QJLA 4P2MA 2I0XA 4L3NA 4AT1B 2ZZMA 2H1YA 3IAS9 1U6BA 4RW6A 1HR0J 5B08A 1R43A 4ZVUB 1JLBB 1S5ZA 1CJUA 1RADB 3MAAB 4IG3B 2EFVA 1K44A 4CLFA 2DGWA 2BDPA 3ENGA 1TK5A 3TA0A 2UUAF 4F7VA 2X1FA 3WDOA 2ZE2A 3JAMY 1OPZA 4C8KA 4ALZA 3UN5A 1ELOA 2FB0A 2GIQA 1JLEA 3P49B 4J9SA 2EKYA 3GPAA 5DYGA 3LP2A 3GTQA 4Q8EA 4CLYA 1RTIB 1TL7B 4NA2A 2KYZA 3OV7A 1AT1B 3VHQA 1XMQJ 1VJQA 3IWXA 3IAM9 2E1AA 2BJDA 4MTPA 1NDLA 3AJ2A 2VUMA 4PR6A 5LL6d 1KONA 5J1NA 4EGLA 1UHEA 3AD9C 1WORA 2FJBB 2XO6A 3H5UA 3V6KA 3NS7B 4X4RA 3D68A 4WFBQ 2R2RA 1KQSR 1OJ4A 1F5AA 1VQOS 1SH3A 3QLHB 1TWGA 2GQQA 3HK2A 2FHKA 1RT7B 1FNMA 3FCHA 1IBMJ 1LFWA 3TNVA 3M8PB 4X4VA 2MKHA 5F41A 3VZIA 1L3KA 3M2RB 1HNIB 3OFGA 3JQKA 1SJ1A 2F9DA 2OFGX 4YR0A 2BX6A 2JFKA 4DF4A 3H5YA 4MFBB 3MUTP 3QWZA 1U25A 5KFLA 2AEMA 4LRBA 4QWDA 4B08A 1E6YB 3EGVA 2HIYA 2N7CA 1TVRB 1EP4B 3TZXA 3D4JA 4Y3CA 1VHFA 3J7YU 1FHTA 5KFSA 4NXMF 4P7VA 2QJ3A 3MEKA 2XMVA 1TUGB 1XK8A 2YPYA 5IV4A 4LBHA 2NLWA 2MB0B 2W25A 2EFPA 2DGVA 2Y1JA 2MQNA 2GC8A 3UVJB 3OW2R 2OMOA 2PI5A 4DMRA 3RW6A 1IVZA 1AB8A 4USWA 5AT1B 5KFCA 1NDCA 4O3OA 4JP8A 4O3RA 4I6YA 4RL1A 2CQPA 3T1YJ 1U2RA 4ANDA 2XBPA 2HEKA 2HZCA 4FYXB 1EQ0A 3IFEA 5D0EA 2AJ1A 1OSCA 2HVEA 2CFXA 1LV5A 1FKPB 1U6ZA 1G3OA 2CNNB 1HBOA 1Y4ZA 3KLEB 1QCSA 2GJIA 2BANB 4ECWA 2Z30B 2FLNA 2W4DA 3OXGA 4F67A 2XMMA 3G86A 2QFJA 2MLYA 4WE1B 4F0KA 1RUSA 4KGKA 2R8HA 1OY8A 5EUHA 4JI0J 5E0OA 3B4DA 1TKTA 3ZZRA 4ZVHA 3MD3A 1K47A 3V6HA 3BYPA 3V6DB 4NYPA 3IS9B 3JQJA 2LDYA 1LWCB 2MYFA 2B4VA 2DTJA 3IR5A 3BV8A 1X9SA 2DXFA 4CRYG 3PNIA 3T1HF 4IFVA 1ZZFA 3JS9A 4J9LA 1PAUB 4RUAA 2L08A 3D6MB 2CDQA 1S0MA 1TL1B 2CPEA 2M2BA 3HHLB 1UEUA 3U1NA 4C8MA 1H38A 2RSQA 2PMZD 1O5JA 5C42A 4ANCA 4AONB 5A0YB 2CQ0A 2RRAA 2NPFA 1VISA 3Q23A 2EW9A 3VQTA 1NO8A 4GKKJ 2UUBF 4IQXA 4RV0A 2Z57B 2VDIA 2NZCA 4P74A 1HYSB 1TL4A 1MMDA 5MLCV 5KOXA 2EEYA 4RNHA 4RPFA 4IDKB 5J2MA 1UCNA 3KUHA 1SCJB 5GMDA 2V6AA 5GAEI 1X31C 4DL4A 3BKFA 2A6ED 4XTTA 4Q44A 4DSKA 4DN0A 1VIOA 4DV4F 2QLBB 4HTJA 4ETZA 2BJ7A 1U1MA 1YRUA 1LWFA 2CJAA 2MSSA 4ZKAA 3MR3A 1XMQF 4C0HA 4O3NA 5HAOA 3ENVA 2NXJA 3BKUA 2CKWA 4NA3A 4OZLA 4CIOA 1RWUA 2WOMB 2FY8A 4ECYA 3CCRS 4X4PA 4H4MB 4RU2A 1JLFA 2DGOA 2K3KA 2KU7A 1ZYRD 4A8FA 3FRYA 3UN2A 4HH1A 1HQEB 2BMBA 4TU9A 2KL8A 1JXLA 1Y1WA 4IUFA 1KHWA 3MURP 3T1AA 1HPZB 5KFRA 2CAJA 4O44B 2JA5A 2IM0A 1R8BA 2YQ3A 3DOLB 2DH9A 2FC9A 3W2VA 3CJQA 2YPZA 5KG5A 3D9BA 2HQCA 2V4RA 1M1HA 1X4BA 3HT0A 2X3GA 2FJEB 2HLUA 1TKXB 4ZPWR 1BQNA 1TFYA 1EQMA 4ELTA 3LF0A 3ZNUA 4NASA 2EBGA 4U67Q 3KYLA 3BSOA 3BKTA 3SQOP 3VAGA 3EVMA 4LSNA 2H5EA 2ZH8A 2Q79A 4RR5A 3UDLA 3WQPA 3CCWA 1HD1A 3DRPA 3OXLA 1RBLA 3MUVP 1E5VA 5KFFA 3VCDA 2MJNA 2G2OA 4FF2A 1WKLA 2ASDA 4ZJOA 5ITHA 3IBCB 4NLOA 2YNIA 1U1KA 2A68D 3S6EA 2JIOA 2MJUA 2IM2A 3ZTOA 1JLGA 4KR0B 2ZKUA 2YNFA 4QR1A 5KFUA 2W9BA 1QUPA 1S0VA 3X2MA 4K0KF 2Y1RI 1YJ9S 2OPRB 4J9NA 3F0NA 2MQPA 5HROA 4WZQA 2JIRA 4JV5J 4PWUA 3HU1A 2Y1IA 4E8UA 1IKXB 1S9FA 4RJVA 2ZH3A 5F0UA 2KFNA 4KHPF 1DQ9A 3OUYB 3CQZA 2C28A 2W2NP 3KLGA 3ZZTA 1Q4RA 1FTRA 4PRFA 5CZXA 4QU7A 1LFPA 3MCNA 1RTHB 4WYWA 2VKZG 2JA6A 4NA1A 1TKZA 3I55S 2KH9A 4A8WA 2VC0A 4RWWA 4ZPCA 1SJ4P 4C11B 2YWEA 2QZ8A 4I1TA 3CF5Q 3X2NA 2LCWA 3TANA 1GTEA 2ASJA 2VG5A 4QYRA 1N32F 4OX9J 1I51B 5AXNA 1DY3A 2DXDA 1VS3A 2RF2B 3QO9A 4MK9A 2HHUA 1WEXA 2F4VJ 1EJ7L 2AX1A 2IAJA 4ECXA 2Q43A 3J7YI 3ILLA 4X4OA 1XN9A 3OLBA 3UO0A 3SSRA 2WVDA 3CDUA 3F41A 2KFYA 2UU9F 1KWMA 2CWXA 3HVTB 3JTPA 2FVRA 5CZVA 4TU8A 1SKWA 4FKYA 4KTQA 3GU0A 4DR6J 4B9LA 3X1LB 5B0EA 2OP5A 1RT1A 3PEJA 1P9YA 3MM7A 2XS5A 2V67A 1F6TA 4XIUA 4C8ZA 1YJRA 5KT3A 4A8YA 3N5FA 4OL8A 1WC1A 1X8DA 4ETXA 2IJNA 2NYHA 1MROB 4I2QB 2B63A 4AL7A 1HHSA 2V50A 2IM1A 2QLWA 3R7SB 4RW9A 2IMWP 3AJDA 1CC8A 4OX6A 5KT6A 3M6XA 5KFTA 2GQCA 2L3MA 5DRKA 4DU8A 2E7VA 2V8DA 3IR6B 2JIMA 2JA7A 2NCKL 3TAQA 2AW0A 5F8JA 4WKRA 4F2RA 3H42A 2UXDF 1RB0A 2M52A 3QIPB 1S0NA 2OSQA 2V3VA 2DEIA 3W2WB 3G8TA 3G71S 1RLDA 2JHEA 3Q8QB 3GQCA 3NKYA 2AYMA 2DITA 2FVSA 3GJQB 1URNA 2VPWB 1WACA 3EUNA 2XMKA 3HFVA 5DJBA 3SUJA 2HG4A 3EDQB 1HNXJ 2HNZB 4K4VA 4L72B 4AE5A 4G6VB 4JI8F 2VQEJ 4PG4A 4NLVA 2QTWA 3WC0A 1WC2A 1NXIA 2BQRA 4NZ0A 3CD5A 2NXEA 3CJSA 4R0EA 3HT3A 5KFJA 4DFJA 3LP1B 2V2VA 1XMOF 2GS8A 3CCUS 2YQ0A 3TJAA 1JLQA 5DLFA 4XO0A 3PY8A 2A2CA 2FYXA 2G0IA 3FJ2A 4DZDA 1NK7A 1IKVA 1NUEA 2VKRA 5A6WA 1R0AA 3RBXA 1RT6A 2B9XA 4DSJA 2D3UA 1VRUA 3OTOF 3DFEA 5KAKA 1NB2A 3LPEA 1NH7A 1Q86T 4FERA 3WHIA 2GVZB 4AL6A 2XY7A 4BWMA 1UHDA 3GIRA 3SCIE 5C25B 4B3SF 1VBXA 1RTDA 1YLXA 3C3LA 3GFXA 3GTJA 1NPKA 4UY8T 3OFFA 3PIPQ 3BS9A 5H9FK 3B6BA 3MM5B 1BC6A 1VBYA 4M5DA 4PWWA 2F8EX 2X3DA 1K0TA 3K5OA 4JI7F 3GR0A 4ZVGA 3DNCA 2QSFA 1C1CA 3H25A 1SL2A 2IVYA 2BJ1A 2KYXA 4LIWA 2RD5C 1GMWD 4KKOB 3ZO7A 2QRRA 4ZP9A 3MEEB 5GLYA 3L09A 2HMIA 1H2VZ 2HPUA 1L5UA 1HQUA 2ZOMA 4P73A 4CLWA 3PDNA 2AKWB 2OSRA 3VAMA 5AJ3J 4WU2A 1Q8BA 3LAMA 4QIWD 1X0PA 5GADU 4DCPB 1JK9B 5B0DA 3TAPA 2C2RA 1ZTWA 1HIYA 3BN4A 3CZBA 3R9LA 2EXUA 1SKUB 1SUQB 3H8YA 2VG6A 3SDEA 2O3DA 3DHWC 2YKPA 5ETPA 5HJYA 4CQ1A 5F8MA 1NPPA 1J5EJ 4JI5F 2XZDB 1FRHA 5HLFA 5DDRC 2X51A 3C15A 3TZYA 4MKVA 5B0AA 3DRRB 2PGCA 1D8ZA 2YQ1A 4KLNA 1HNZJ 5F8IA 5KT5A 5DLGA 2VPZB 2APOA 2ZJQQ 4CLUA 4PAAA 1NSQA 1NSKL 1IM4A 1UJ5A 4PXCA 2NXNA 4U8YA 3C6UB 2RJZA 1U2CA 5GVQA 2HS0A 3SMZA 2RT3A 4J9VA 3C66A 4R8UB 3US5A 4DR1F 2C42A 2A6OA 1T3OA 1RT3A 4ZN3A 2XLIA 1WHWA 3FSXA 5KG4A 1NM2A 5L9XA 2AIRB 2RNEA 4QCLA 2ZVSA 1C0TA 1FJGJ 2KZMA 1TU0B 1UJ4A 1RJJA 1TR0A 3WIVA 3ZZYA 2F5GA 4URGA 2OKQA 4J7CA 3W64A 4ZVRB 4KQZA 1GAOA 1PJ6A 1TK0A 3G82B 1O6XA 3LPYA 3IGVA 4AOKB 3BGRA 2ZM6J 2J7KA 2E44A 3A8IA 4QW8A 5KFPA 1WF2A 3VF0B 1FFGB 4WK1A 1FE4A 4P6QA 2QC3A 1R7RA 4LRCA 2CJXB 2DGUA 3CDEA 2FJWA 3CJTA 3FMBA 4LVOP 4C48A 2R7VA 2VDHA 1RAHB 2HNDA 1L3VA 3UN3A 4ZM7A 4KODA 4NLXA 5B0GA 3NY0A 4Z7CA 2NQPA 2DB1A 2WHOA 4ECZA 1JNZB 3FSYA 4QJVA 2M70A 4A8KA 1U09A 3DLKA 1UKUA 3M2UA 5KFWA 4DX7A 3CF2A 3NNAA 2DGTA 4ED8A 3AAWB 1WC4A 4KFBA 4DFMA 7FD1A 1A7GE 1RWVB 5U47A 4ZLLA 2OTLS 3MF5A 5D0HA 4ZHRA 2VPXA 1FJEB 3QIDA 1GH8A 2BEFA 2OGUA 1FFSB 1FESA 4K7QA 4DV7J 4DV2F 4FP9A 2RDIA 2NREA 1KVIA 1O8BA 3TX8A 4CH0S 5L39A 1VQ6S 4NLUA 4OFZA 1JJHA 3PRBA 1C1BB 2ZHAA 1REVA 3SXLA 4M95A 3MPWA 3TI0A 2XULA 1VQSA 4ZN1A 4UQTA 4O3SA 2FZCB 1IKYA 2HHHF 4EO6A 3TZWA 4R0JA 2E9TA 2L9NA 2OEKA 1IWGA 4KC5A 3NCQA 2OH2A 3NS5A 5THWA 4P7TA 2FVQA 5CYQA 1KTVA 4HHHA 2VJUA 4MKYA 4L48A 1SIWB 2K8GA 3D1HA 3AH6A 4RLEA 4UZCA 4J37A 3SQGB 1KBRA 4I4BA 5MAOA 4Q8FA 2KJVA 3NL0A 2OPPB 2DBBA 2XMJA 2KQAA 1ZS6A 2WTFA 5C2GA 4DR4J 3DLEB 4IYQA 3CD6S 3KJFB 2HFVA 2MY8A 2DR5A 2MZSA 3T3FA 2ZBPA 1U1NA 3HF5A 4PQAA 4R5PB 3QQ8A 5BXIA 2NYIA 1VC0A 4USKA 2AZ1A 2I5JB 1Z4UA 1CJKB 1R0CB 1X4DA 1SQFA 4AAYA 4NXNF 5IWAF 2UV8G 2OD4A 5DGAA 3CC2S 2V2QA 2YKAA 2K06A 4Z2XA 4CYUA 4C0BA 3D2WA 4EYHB 2B5JB 2VD3A 3IP0A 3T9ZA 1XIQA 4B3RJ 5CHCB 2XZWA 2A1BA 1BQMB 2NYAA 2JH3A 1LWXA 2YWFA 4I7FA 1KOOA 3V4IA 1R27A 3FFIA 2AEJA 2MKKA 3JYTA 4XPCA 4I56A 5J1EA 4IH5A 5HVGA 3KK2B 2D69A 5KT2A 5FLXY 3HHEA 3BF4A 4MKAA 2WONB 2R9LA 1CEZA 1MN7A 1VQLS 3PJ9A 1N54B 1TL3A 1GTHA 3ML1A 4WFNQ 5D77A 2P2CB 2A69D 4Y00A 5LMNJ 3RBDA 2DJWA 4NLRA 1C0UA 4DL5A 2IC3A 4ZLJA 4KDLA 1H7XA 4RBTA 1KR4A 3CD0A 4CO3A 1ZBTA 1FWPA 3OPKA 1FKOB 4A8QA 1N5YB 2ZEJA 5GAHU 4ZVPB 1JXEA 2DT9A 3ULHA 1R7IA 1SJQA 1S6PB 5GADI 1FDBA 4FPRA 4P10A 2Y0SA 1NSPA 2JC0A 2P9EA 2FVPA 1HNVA 2OJ3A 2KI8A 3BSAA 3CMES 1RTJA 1I94F 3L7PA 4YB6A 3Q8UA 3BDPA 4QU6A 3C6TB 3CC7S 1RWKB 2MKIA 2RAQA 4X4UA 2BE5D 1UPPA 3TP2A 2VASA 1JJCB 1YJTA 4B3OB 3RTVA 3NGDA 2AWZA 2VODA 1RHUB 3QRQA 1RHQB 1M90T 3OFEA 3QGIA 5CABA 2W2PP 3N28A 1PQHA 3MECB 1S6QB 3D6HB 1OMSA 2HNYA 4GRSA 2O01C 1IWAA 3MMCB 1T11A 1TQLA 1N10A 3OFHA 4KGVB 2C2KB 2V5HG 4OIXA 4B9SA 5K14B 4JYAJ 2Z56B 2B0GA 4HLBA 3AT1B 4FXWA 4M5IA 3T6JA 2CQBA 1Q7YT 2WB4A 1VLYA 4L74A 4DQSA 3AQPA 1KQFA 3DRXA 3ILJA 2KVQE 3KLHB 2VB6A 3P6YC 5ETMA 5ADZA 1NJIT 3MM9B 3PHTA 1IBKJ 5HI7A 5HJXA 3L3CA 2Y1LB 2DCLA 4FPIA 5ETTA 5F8NA 2JL9A 4F02A 4ES2A 1FD8A 4LFBF 2YBVA 4DJBA 3CEDA 5I42A 3S7RA 1HBMB 3IM8A 1LWEA 4DI6A 4MK8A 3CULA 2VIHA 1RWOB 1VJWA 1WSVA 1RQ0A 5B0BA 3THVA 3R5CA 1NZ8A 4FFTA 1T9XA 4EK2A 1UMJA 1TMMA 2IBOA 4RW4A 1RBOB 2OPSB 2A18A 1SV5A 2JLEA 5A8WB 2E1MC 2BV3A 4TXSA 1D9FA 2CJYB 1IKWB 1X60A 1MW7A 3N6LA 2OELA 1OWXA 3NCPA 4QIGA 1PQEA 3CJ5A 3NEKA 2R7WA 2LDIA 1R8AA 3HPOA 5KFOA 3NBPA 2HVIA 3UDEA 1VQKS 1BLUA 4DV1F 3MOJB 3PJXA 2IYGA 1G1XA 3CJKA 4JBCA 5L46A 2G9OA 3G87A 1GXLA 4EYIB 4EU0A 4FVMA 1M5PC 2OMLA 1BY9A 1S9EB 2CPYA 2V4JB 3MM6A 3GV5B 2XEXA 3SZ2A 3POTB 1T9VA 1EX8A 3A3PB 2RVJA 3J7A1 3JSMB 3D0GE 5C24A 8RUCA 2OTJS 4AYBD 4Q2LA 1S1XB 5EWGA 1YJVA 1VGYA 2G0JA 2HW3A 4O23A 4X65J 4R25A 3OTBA 4PWDA 4UOHA 3TUZC 4X66J 1TUWA 2HHVA 5HK4A 2JIPA 2DNKA 3KG0A 3NGRA 2LU1A 2ZNYA 2KRRA 3I0RB 5J2PB 4NCBA 5DETA 1S1UB 3L4BC 2VBWA 1HBUA 4FN5A 4G1IA 4X62J 3MR2A 4DR3F 3IRXA 2HGMA 2UXCF 4IOCQ 2ROPA 4FYVB 2JNJA 3S8SA 4ZS6A 3SV3A 4XAKA 4MIBA 4USVA 1ZETA 1SKSA 3M8ZA 1NDKA 2ALZA 1U1PA 2YNHA 3CCSS 1PAEX 3CNQP 2U2FA 4DPYA 4GKJJ 2ZFHA 3ITHA 4UQGA 2PE8A 5D6GA 2HWTA 2J9DA 4DV5F 3BEGB 2HWHA 3OR1A 1FDAA 4K8RA 4GMKA 3NAIA 2E5IA 4B9VA 1RP5A 2C2DA 1YZ6A 3PCOB 1CULB 3LW5C 5CXTA 2YWKA 4UY85 1AA1B 1UFWA 2Q3PA 5J2NA 3IM9A 3AODA 3CDAA 2DPIA 1H2TZ 5CA5A 1WKJA 3ET6B 1NBEB 4YHHF 3I32A 2FC8A 3TRGA 2YKMA 4BWJA 2VFRA 3GFZA 1TFWA 2HRTA 4K4UA 4WF9Q 1OYDA 5ETSA 1JNRB 3OL9A 3X3UA 2VA3A 3MPDA 3G96A 3M6UA 1FDDA 2UXBJ 1ZAXA 4QR2A 3GZ7A 4M5GA 2CA9A 1QVGR 2D1CA 4H4KA 1T03B 1VQ5S 1QSLA 3HLUA 3MEGB 2MLZA 4MK7A 2ZE2B 2IDEA 1LOUA 1S4FA 3D67A 3HD1A 3HKWA 4JYAF 2N7YA 2ACMA 2EK6A 3GWCA 3VR1A 4F4ZA 4DL3A 5EGYA 1GMWA 1NHUA 4LF9J 4AXJA 9ATCB 4EBEA 2XI3A 5M2PA 1X4HA 3ZZOA 5IM0A 1T94A 2B3TB 2L9WA 4V19J 2VZ9A 1FERA 1JLAA 2WBMA 2E9RX 5ETNA 3IG1B 1TAUA 2X1BA 2W8KA 4JV0A 4NEZA 3KK3B 1JQGA 3ETOA 2DY9A 4HH0A 1B0VA 4TY9A 3MPUB 2J6TA 1HWIA 1E32A 2BKNA 2H5IB 3EXCX 2FUG9 3R27A 4DV3F 3C16B 3H7HB 4FZVA 4A8SA 3TUJC 1UVKA 1HARA 2YH1A 3RAMA 1M5HA 2C2NA 4DFKA 2VICA 3MOZA 4XK8C 2F7VA 3DYAA 4RBVA 2KXHA 2DH7A 1KLMB 2MY7A 2MGZA 1FRMA 3PEHA 3N9UC 4LF8J 4Y6IA 4WWSA 2F8MA 3HP6A 3E01A 7AT1B 1NKCA 3DOKB 1Q79A 4DL2A 3PRVA 2ALYB 1KQGB 2E1CA 1RHKB 5FDLA 1T0TV 3VAHA 3KNAA 2ZBCA 2HFSA 5J1PA 5B09A 4K4TA 3KTQA 4JI2F 1JLBA 2VHGA 2ZUAA 3AB4B 3WBZA 2ZDPA 3MAAA 4IG3A 3JSBA 1H0HB 2UV8A 5KFVA 1SBRA 2J9CA 3CCLS 2WSFC 2XS7A 4N5SA 1FE0A 2PO4A 3CDBA 4ED6A 1MU2B 2QA4S 1YLEA 1FFWB 3EJMA 1B0PA 3MHYA 2OFHX 2H65B 1RTIA 1TL7A 1FEHA 1RDRA 4X4NA 3FBFA 2KI2A 1YRXA 1S6UA 1QDNA 3ONQA 2RRBA 3DRYA 2E1RA 4DR7J 2CWKA 2V9WA 3GTMA 3HHDA 1GEHA 3IN5A 2QL7B 2ZWOA 4OI0A 2YKOA 3M7VA 5D15A 1Q16B 4YY3F 1RHJB 4C2MA 2HFUA 4ECUA 2ZOFA 2M8DB 3QLHA 4B3TJ 5DDOC 2QEXS 4M1KA 4OV6A 3NG8A 1RT7A 4QWEA 4HKQA 2CJ9A 3Q2SC 1FKAF 1RA6A 1ZM4A 3HI9A 3M8PA 2AYBA 4IG0B 3H2LA 3M2RA 2LXIA 1HNIA 2OEJA 1FNOA 5L1IA 4LF4J 1N0UA 2HRUA 4MFBA 1LEOA 3ENAA 1NPRA 1U1QA 3PV8A 3GTGA 3I0SB 1IN0A 3FKIA 4W4MA 2YX7A 4WIQA 3QGHA 1E6YA 4JV1A 1D3WA 2BYCA 1TVRA 1B70B 4KV8B 1EP4A 4JI6J 5CD4A 3H2VE 3NWRA 3DDIA 1U8SA 3D1OA 4N56A 2U1AA 3IO1A 3P4UB 5KFEA 4RU9A 3M6WA 4QIVA 4Q45A 2PDAA 1IBLF 3ZC4A 1RT5B 2FZGB 3CJ3A 3L7OA 1U26A 3HJVA 3BO4A 4CWBA 2KHCA 3KK1B 2ZD1B 4DV0F 3UVJA 2DNLA 3E8OA 4C7QA 1YITS 4YS2A 2M3DA 1OSDA
chains in the Genus database with same CATH topology
2MJUA 4X84A 5FJ4A 3MTJA 1S76D 3W7BA 2YU9A 2IM2A 2HMIB 4Y34A 1JLGA 1T03A 1QY7A 1RGVA 1NK4A 1Y5NB 2ZKUA 3LP0B 4KR0B 1HQUB 2IYIA 2YNFA 3AY0A 3MEGA 4PKDB 4QR1A 1VIXA 3FDSA 3A1YG 5KFUA 1QUPA 2W9BA 1CC7A 2E5GA 3NWGA 1S0VA 4B9NA 3TVYA 2J7UA 5K8MA 4K0KF 1LQ9A 2Y1RI 1YJ9S 4DQIA 2JIQA 2OPRB 4J9NA 2WB1A 2N3LA 2MQPA 3MMAB 3PX0A 5HROA 1T05B 1Y0HA 4JUZA 4WZQA 1Y3KA 2JIRA 1FJCA 4IFYB 4OHYA 1S1WB 2E5HA 4B3RF 5KT7A 2M88A 2VL1A 5SUHA 1WNEA 4PWUA 4HT7A 2R7XA 4F26A 3IR7B 3HU1A 3H5SA 4HDGA 4WXWA 5HP1B 2Y1IA 4QR0A 3BR8A 3MMJA 2VH7A 4LIRA 4E8UA 2KTQA 1IKXB 3F44A 1FKPA 1S9FA 2RQ4A 3D54A 4NZ6A 1G7CB 1N8RT 3KLEA 2R8KA 2ZH3A 1KFSA 4URSA 2KT2A 5F0UA 2KFNA 1DQAA 1DQ9A 2BANA 2KT3A 1L3TA 4IRCA 4KHPF 4X4SA 2VG6B 2ZH5A 3DRSA 1NK5A 1F2GA 3SDEB 1UA0A 4G1QB 2HHQA 3SFUA 4I6WA 3OUYB 1O0PA 3CQZA 4YUDA 4CI0B 3CCQS 4ZDNA 2C28A 3KLGA 1GXUA 1W25A 3ZZTA 4FXDA 1Q4RA 1S49A 1FTRA 4PRFA 2IRYA 3BO3A 2DIVA 5CZXA 2CRLA 4QU7A 4WE1A 3DM2B 2G1DA 1LFPA 2XY5A 3K8VA 1RTHB 4WYWA 2VKZG 2JA6A 4NA1A 3IG1A 4CT8A 1TKZA 1NH8A 1V3SA 5EWFA 3I55S 2KH9A 2BM1A 2GCFA 2VC0A 3CJ0A 3MMBB 4A8WA 5HLFB 2P9CA 4RWWA 4ZPCA 3T6BA 2LQJA 4DR2F 5KG0A 3OSNA 3HDSA 2BE2A 3KK3A 2E29A 4I68A 5GMKa 1SJ4P 4C11B 1S1VA 4C8OA 3DXSX 2YWEA 2QZ8A 4I1TA 5LMNF 3T5JA 1TZ0A 3BQ1A 3CF5Q 1JJ2R 3V6DA 4ITSA 2LCWA 3TANA 3TARA 4FF1A 2R7RA 2J9EA 2KB2A 1GTEA 5DM6Q 2A6HD 3ENQA 3BO2A 2VG5A 2ASJA 4QYRA 3MR5A 3EPGA 1N32F 4ZPBA 3IS9A 4OJGA 1I3QA 4USIA 1ULRA 2R7TA 2RQMA 2Z4PA 1JKHB 5AE2A 5AXNA 1LWCA 2V4QA 2DNMA 2AYEA 1VS3A 2RF2B 3QO9A 4MK9A 2HHUA 1WEXA 2LA4A 1RKJA 2AX1A 2IAJA 4ZMMA 3CCTA 4ECXA 2Q43A 3J7YI 1GT8A 4RZRA 2DR7A 3R5DA 4X4OA 1XN9A 1WI6A 1MWYA 3OLBA 3GFYA 1S6OA 1KLMA 3SSRA 4QPTA 3CDUA 3F41A 1YSJA 2KFYA 2UU9F 2DRAA 1E6VB 5KG2A 1RT3B 1R9TA 1X4GA 3HVTB 4ZCIA 3JTPA 1LXJA 3PJWA 2A3JA 1T7PA 2JEJA 5E3QA 4FNIA 4C3LA 1WEZA 1TL1A 5CH7B 5CZVA 3KJVA 3HHLA 2FVRA 4TU8A 3DOKA 1SKWA 4Y2KA 4KTQA 1C4CA 4B9LA 1KC8T 3X1LB 5B0EA 2OP5A 1N5QA 1RT1A 3J7Z5 1KQGA 3PEJA 5E2QA 3RU0A 3PR4A 1C0TB 3PR5B 3DLJA 3MM7A 4YDXA 2RUGA 3RW7A 5E3RA 2XS5A 3KNGA 1G6BA 1IQZA 3MWBA 2JVOA 3Q2TC 5A0YA 2GNKA 5F3ZA 2AGOA 1QE1B 3UCGA 4XIUA 1Z1ZA 1YJRA 2B51A 2GHPA 5KT3A 4GC6A 4A8YA 3PW5A 2JEGA 4C8ZA 5HQ8A 3N5FA 2CPJA 4OL8A 4F25A 3KHHA 3CCVS 4ATNA 4ECTA 2UUCF 1X8DA 1JLCB 2WRMA 3FGVA 4ETXA 1R8PA 5T5ID 4CCHA 2BA9A 2C3YA 3HVRA 2YKNA 3BGRB 2IJNA 2CJBA 1MROB 2KO1A 2GO8A 4I2QB 5KG6A 2LXFA 1H0HA 2B63A 2RS8A 1DTQB 5I3UB 4AL7A 1HHSA 5H1SV 1HYSA 4ECRA 4F3OA 2IM1A 1P1LA 3AA8A 4Q43A 2QLWA 3D28A 2J0SD 5IS2A 3M2VB 3KWMA 4MAKA 2FD2A 4RW9A 2IMWP 1CC8A 2FDNA 4OX6A 3PX6A 4IDKA 5KT6A 3M6XA 4PG5A 5KFTA 4YB1P 5FTNA 4A47A 3PVXA 2GQCA 2NSBA 4PXBA 2L3MA 5DRKA 3UR0A 2ATLA 2QMXA 4NX9A 2CQGA 2RQCA 2LEAA 2V8DA 4EEYA 3IR6B 3ZZPA 4A46A 1GX5A 5K8NA 3DMRA 3R1HA 2JIMA 3TM7B 4AZDA 1NRKA 5L9NA 1NHVA 1MU2A 3G4SS 3TUIC 2JA7A 2GMLA 3TAQA 2AW0A 5F8JA 4WKRA 1P27B 4F2RA 2KVIA 4K4SA 3DI6A 2UXDF 5DG8A 2M52A 3QIPB 2HNDB 4DWIA 3MD1A 2VPYB 1M0SA 3GE9A 1S0NA 3GIKA 2JLGA 2OSQA 2XGQA 1PYQA 2V3VA 3QAEA 3PM9A 1FK9B 3W2WB 2J5AA 3CIMA 3FSIA 1XTZA 2XCPA 3G8TA 3T9NA 2MKJA 4H4OB 3BQ2A 3QPIA 5D4PA 3SV4A 2Z0GA 4B9TA 1DLOB 3I5BA 3G71S 3O3LA 2JHEA 3Q8QB 3GQCA 3NKYA 4J9QA 1OGYA 2AYMA 2DITA 4ZK7M 4DQRA 3PZPA 2FVSA 2HWIA 1URNA 2F8HA 2VPWB 1WCMA 1RT2B 4ID5B 1X7VA 1WACA 3EUNA 2XMKA 5DJBA 2AX0A 4AFFA 3GR1A 2MHEA 2HG4A 4KHMA 2M0GB 4WFXA 2HGNA 2XSJA 3FNNA 2HNZB 4M63A 3LANA 3HKZD 4K4VA 4UW2A 2KXNB 3K59A 2P5VA 4L72B 1T3NA 2E5LF 3UQSA 5FTJA 3D1QA 4AE5A 4GC7A 1N48A 2OLWA 4G6VB 3LUYA 4JI8F 3BSCA 4ID8A 4PG4A 5H9EJ 3M2UB 1Y9OA 4PG8A 2PA3A 4NLVA 4TY8B 5DO2A 2WOMA 5G0RA 3WC0A 2BQ3A 2BQRA 4NZ0A 4AQYF 3O5AA 1FRXA 1Q16A 3CD5A 1K1QA 4C8YA 4R0EA 2PMZA 4H4MA 3HT3A 3HXMA 3H5XA 5KFJA 4HHJA 4KFBB 1PT0A 2ZJPQ 3GIMA 1N4LA 1FD2A 5LSOA 4DFJA 1UVIA 3LP1B 3KLIA 2CVIA 4ZLPA 5BYRA 2JEIA 3K8WA 3J81Y 1XMOF 4IOBA 4ZHRB 2EK1A 3IRWP 2VPXB 2GGPA 5HBMB 3CCUS 1WG1A 4NLTA 1KHVA 1JLQA 1LW0B 4WJBA 2QA4G 5DLFA 4XO0A 3EGNA 3SI8A 3PY8A 2A2CA 1ZM9A 3FJ2A 1QAXA 2ADBA 2VG7A 1NK7A 1IKVA 2D9OA 4C3MA 3HU2A 2VKRA 5A6WA 4Y2CA 2EEOB 1R0AA 2J6SA 3CC4S 1HPZA 2R2TA 1RT6A 4TYAA 1RKIA 4OHVA 2CJKA 5LMUF 1IUJA 4O44A 1H7WA 2FHMA 2B9XA 2VFVA 4DSJA 4OI4A 1F60B 2B6AB 2D3UA 4IG0A 5DDQC 5B0FA 3K0JA 3DOLA 1VRTB 1U4BA 1VRUA 3OTOF 3NMAA 1REVB 3E2EA 1VC5A 3DFEA 5E3AA 5KAKA 5A6PA 1U24A 1NH7A 3CUNA 3DC2A 2QLXA 2D9PA 1Q86T 3TQ1A 2AGQA 4XDCA 2O5DA 4N8NA 1XMBA 4AL6A 2XY7A 2ILYA 1YI2S 1AUDA 1XNRF 4BWMA 1UHDA 1P6TA 2FVCA 1UP1A 3PW7A 3SCIE 5C25B 3N0VA 3I9ZA 4B3SF 1VBXA 2DGQA 2KZZA 3I0SA 1IKYB 5GLFA 1RTDA 3C3LA 1TKXA 3GFXA 1D9AA 1YGYA 4BDPA 1DJ0A 3EGWB 1XR6A 3MFIA 2DD8S 4DG1A 4KV8A 1JMTA 3GTJA 3I4HX 2UVRA 5D4OA 4UY8T 2DNYA 3OFFA 3PIPQ 3KFWX 3BS9A 3VZHA 2MZRA 4QBUA 4IR9A 4NCGB 5CQGA 4J9RA 2J0XA 2PIIA 4K5SA 5JJBA 1VK8A 5LJ5Y 3F73A 3MM5B 4EBCA 2QSWA 3J7ZT 1S99A 1AW8B 4D7ZB 1BC6A 5JXSA 3K5NA 1VBYA 3KHGA 1S79A 4E0DA 5EHHA 1WTFA 3BREA 3CCZA 5E3PA 3MI7X 2R7OA 4M5DA 3PFOA 2F8EX 2XLJA 2ZUGA 2R4FA 2VOOA 3DN9A 1X4EA 5CYQB 3RZAA 4IRDA 1K0TA 1XEZA 3CXCR 1RT5A 3K5OA 4JI7F 1FNXH 3GR0A 1FTCA 1N88A 3UNGC 4NCAA 4ZVGA 3DNCA 4DV6F 3OTCA 1HWLA 1C1CA 2QSFA 4OX8A 6FDRA 3KK1A 2DNGA 3H25A 1QJHA 2IVYA 1X5SA 1SL2A 4LIWA 2KYXA 2ZD1A 3P5TL 5FTKA 2RD5C 3U27A 1HR0F 1PSDA 4KKOB 4C8NA 1QSYA 3FRZA 3CJ4A 2L41A 4PXEA 4PQUB 1F0XA 2GAEA 2QRRA 1MWZA 1RI7A 4ZP9A 3MEEB 3L09A 5F3TA 2HMIA 1WI8A 1H2VZ 2JRSA 2BJEA 2HPUA 5HMXA 2V0NA 3OR2B 1KEKA 1S7HA 2LMIA 3LP0A 1L5UA 1HQUA 2KDOA 1NAQA 5F8HA 4CH1A 2ABYA 2ZOMA 4WK3A 2VFUA 4GA6A 1NJZA 3MPVA 1S0OA 1TWFA 3MR6A 4ZPTR 3PDNA 3FMWA 4DL7A 2OSRA 4X65F 1TUVA 2OPRA 3VAMA 5E5NA 5A8RB 1HBNB 3MMAA 1T05A 3IXQA 1VQYA 4X66F 3K5LA 2LECA 3V81B 3H4BA 1N6QB 2JX2A 2AJQA 4IFYA 4WU2A 1S1WA 3Q24A 5HMYA 4U9RA 1Q8BA 2D74B 2Q6CA 3LAMA 1X0PA 4OX7A 4QIWD 5GADU 1QLNA 4TNOA 3IR7A 5HP1A 4ZPAA 4NOHA 3K7RA 4TYBA 5IZHA 4Q5VA 1ZYQA 2ZJRQ 1JK9B 5B0DA 3TAPA 2HFZA 2C2RA 1ZTWA 2HIQA 3BN4A 1AROP 1IKXA 4U7UK 3KG1A 3CZBA 2EPIA 2FPHX 3UCUP 3PO5A 5T7LB 1J2VA 1VQPS 1SUQB 4F3QA 3BZQA 2PI8A 2N4DA 3H8YA 3TR5A 4X62F 4ED7A 2VG6A 2HGLA 5IT0A 3SDEA 4G1QA 4EZ6A 3OUYA 1UWBB 4ZA1A 3V5RA 2O3DA 3DHWC 2YKPA 1ZAVA 1B7FA 3K5MA 5L1KA 4CQ1A 2W9CB 2WSCC 5F8MA 1QAIA 4KSEB 3FZBA 4YDDB 3N79A 5EWEA 1VFJA 5DYIA 2BXJA 2D7SA 4FXVA 1SKRA 2V8VA 3DM2A 4OI3A 3T5HA 3E51A 4DHVA 3N6MA 2AYGA 4JI5F 1RTHA 2XMWA 5J2QB 4J9PA 3QC8A 1FRHA 4Y2IA 1SFOA 3MMBA 5HLFA 3R5BA 5L8RC 5DDRC 2Y0SD 2X51A 1EU1A 2I38A 3GV8B 2W24A 3R3TA 2LEBA 4E98A 1SQEA 5B0AA 3DRRB 1QM9A 4C11A 2DVIA 2HRYA 3B8HA 2LKZA 2NSCA 2PGCA 2G6GA 1S9GB 3MM8B 1D8ZA 1Y5LB 2FIUA 2HQ3A 2O1PA 4KLNA 4K50A 2Q1LA 1U6FA 3GG1A 2WAQA 3PXGa 3LWLA 2MQOA 3M9MB 5F8IA 3K57A 5KT5A 4I7FB 1CR5A 5IT4A 4GKJF 3V4IB 1FXLA 1AXQA 1R27B 3FFIB 2CPDA 2EFGA 2VPZB 3HZEA 4D3HA 2APOA 5DLGA 2ZJQQ 2DR8A 1A6LA 1IM4A 2C22A 1C4AA 1JKHA 3OLAA 5J1EB 2JWNA 1WF1A 1M5VC 1Y1VA 1UJ5A 2ILZA 2RF2A 4PXCA 1VQNS 4K2XA 2Q6BA 2AP6A 3RB6A 3C6UB 4NZ7A 2RJZA 2X1GA 4PG7A 5GVQA 1IBMF 1Y3JA 2HS0A 4H4KC 4TN2A 3SMZA 1CQNA 2RT3A 5CYJA 2KT5A 2BR0A 3C66A 2FHOB 1U1OA 2ZH4A 4R8UB 2LQBA 4KJIA 1HWKA 3US5A 4DR1F 1TMOA 2PJJA 2C42A 4KRWA 1KVJA 1XBWA 1TL3B 1NK0A 1CQMA 4ZP7A 5E33A 3M1VB 1E6VA 3HFKA 1TK8A 1T3OA 1RT3A 3HVTA 3QZ7A 2XLIA 5KFQA 1K1SA 1WHWA 3FSXA 4B17A 4DPOA 5T41A 1J5OB 2HS3A 2ZC3A 5KG4A 1MMNA 5L9XA 2V2KA 1VBZA