3SUKA

Crystal structure of cerato-platanin 2 from m. perniciosa (mpcp2)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
124
Chain Sequence
b'GAVQLRFDNTYDNASGSMNTVACSTGANGLSQRFPTFGSVPTFPHIGASSDIGGFNSPACGNCYTISFTFQGVTRSINLVAIDHAGNGFNVAQAAMDELTNGNAVALGTIDVQSQQVARSVCGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin-like protein
molecule tags Unknown function
source organism Moniliophthora perniciosa
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
total genus 38
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sukA00
1BW3A 1OA9A 1HD5A 2BH0A 2PNWA 4FG2A 4JCWA 3SUKA 3X2NA 3D30A 5GLXA 3X2IA 3X2MA 1BW4A 3ENGA 5GM9A 3X2JA 4FG4A 4JP6A 4ENGA 1L8FA 3X2GA 3CZBA 5GLYA 4AVRA 5H4UA 3X2OA 2ENGA 3M3GA 4JJOA 1WC2A 3X2LA 2KQAA 1OA7A 2HCZX 2PI8A 1N10A 2AE0X 2PICA 3SULA 2GAEA 4FERA 2PJJA 2G5DA 4L48A 2G6GA 4JP7A 3X2KA 3SUJA 4FFTA 4ZM7A 4JS7A 3X2PA 3X2HA 3SUMA
chains in the Genus database with same CATH superfamily
3H0GA 4KDLA 5DYGA 2JIMA 1KQFA 3X2NA 3X2IA 2O5JD 3ML1A 1PT0A 4CRYG 1E5VA 1BW4A 2JIOA 1ZC1A 3IR7A 2NVXA 1L8FA 1TWFA 3X2GA 2Y0SA 5GLYA 1H5NA 5H4UA 1Y1VA 1PQFA 3HKZA 3QWZA 4NOHA 3X2LA 2YUJA 1E32A 2HCZX 1DMSA 3DMRA 1E18A 1PQEA 1PQHA 3HU3A 2GAEA 1K83A 2VPXA 2G5DA 3GTOA 2B63A 3TM7B 3SUJA 3GTJA 1WCMA 1PYQA 4KODA 4AYBA 3X2PA 2A6HD 2NAPA 2E7ZA 1HD5A 1OA9A 3OUGA 3SUKA 4D7ZB 2JIRA 3CQZA 1DMRA 1G8JA 3QQ8A 4FG4A 4JP6A 3GTGA 2VPYA 4GA6A 4ENGA 3CZBA 1PPYA 4AONB 1S3SA 1PYUB 3IR5A 5EPPA 2R7ZA 1WC2A 1H0HA 3QC8A 1OA7A 1AW8B 2VPWA 5FTLA 2V3VA 2AE0X 2PICA 3QQ7A 2V45A 5FTKA 3SULA 3FKIA 1I50A 2VPZA 2R93A 1CR5A 4JP7A 3GTKA 2NVYA 4AOKB 3X2KA 4FFTA 1CZ5A 3GTPA 3X2HA 1FDIA 2C45A 3SUMA 5C18A 4QIWA 2BH0A 1YNND 2PNWA 4JCWA 1Q16A 5GLXA 3HU2A 2IV2X 1IW7D 1QDNA 2EEOB 4GA5A 4KO8A 1UHDA 1KQGA 3TIWA 1EU1A 2WB1A 4AVRA 2BE5D 3X2OA 4JJOA 3M3GA 5DYIA 2YU9A 2PJHB 1Y1WA 2JA6A 1Y4ZA 1ZYRD 2KI8A 1QCSA 2A68D 2JA5A 5FTNA 2DMRA 4KLNA 4L48A 1VC3B 5FTJA 5B6CA 5T5ID 5FTMA 1TWGA 4DMRA 1SFOA 2E2HA 1E60A 2A69D 2VUMA 1YLEA 2JIQA 1E61A 2NYAA 2JIPA 2CW0D 1PT1A 4C2MA 1R27A 2PMZA 1TWAA 3HU1A 1YNJD 1BW3A 2R92A 4FG2A 3X2MA 3D30A 3GTMA 3ENGA 3O5AA 3PLXB 5GM9A 3X2JA 3GTLA 2WAQA 5C1BA 3IR6A 2E2IA 2ENGA 1AA6A 1SIWA 2KQAA 1TWCA 1CZ4A 1SMYD 4KDIA 4RV0A 1WLFA 2PI8A 1OGYA 4CS0A 1N10A 4CRZA 2A6ED 1FDOA 1TMOA 1R7RA 4FERA 5T5MD 1Y5IA 2PJJA 1I3QA 3GTQA 2G6GA 4AAYA 1R9TA 3CF2A 1TWHA 5GLFA 4ZM7A 2JA7A 1G8KA 4AZDA 4JS7A 1UHEA
chains in the Genus database with same CATH topology
1BW3A 1OA9A 1HD5A 2BH0A 2PNWA 4FG2A 4JCWA 3SUKA 3X2NA 3D30A 5GLXA 3X2IA 3X2MA 1BW4A 3ENGA 5GM9A 3X2JA 4FG4A 4JP6A 4ENGA 1L8FA 3X2GA 3CZBA 5GLYA 4AVRA 5H4UA 3X2OA 2ENGA 3M3GA 4JJOA 1WC2A 3X2LA 2KQAA 1OA7A 2HCZX 2PI8A 1N10A 2AE0X 2PICA 3SULA 2GAEA 4FERA 2PJJA 2G5DA 4L48A 2G6GA 4JP7A 3X2KA 3SUJA 4FFTA 4ZM7A 4JS7A 3X2PA 3X2HA 3SUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BW3 A;  1OA9 A;  1HD5 A;  2BH0 A;  2PNW A;  4FG2 A;  4JCW A;  3SUK A;  3X2N A;  3D30 A;  5GLX A;  3X2I A;  3X2M A;  1BW4 A;  3ENG A;  5GM9 A;  3X2J A;  4FG4 A;  4JP6 A;  4ENG A;  1L8F A;  3X2G A;  3CZB A;  5GLY A;  4AVR A;  5H4U A;  3X2O A;  2ENG A;  3M3G A;  4JJO A;  1WC2 A;  3X2L A;  2KQA A;  1OA7 A;  2HCZ X;  2PI8 A;  1N10 A;  2AE0 X;  2PIC A;  3SUL A;  2GAE A;  4FER A;  2PJJ A;  2G5D A;  4L48 A;  2G6G A;  4JP7 A;  3X2K A;  3SUJ A;  4FFT A;  4ZM7 A;  4JS7 A;  3X2P A;  3X2H A;  3SUM A; 
#chains in the Genus database with same CATH topology
 3H0G A;  4KDL A;  5DYG A;  2JIM A;  1KQF A;  3X2N A;  3X2I A;  2O5J D;  3ML1 A;  1PT0 A;  4CRY G;  1E5V A;  1BW4 A;  2JIO A;  1ZC1 A;  3IR7 A;  2NVX A;  1L8F A;  1TWF A;  3X2G A;  2Y0S A;  5GLY A;  1H5N A;  5H4U A;  1Y1V A;  1PQF A;  3HKZ A;  3QWZ A;  4NOH A;  3X2L A;  2YUJ A;  1E32 A;  2HCZ X;  1DMS A;  3DMR A;  1E18 A;  1PQE A;  1PQH A;  3HU3 A;  2GAE A;  1K83 A;  2VPX A;  2G5D A;  3GTO A;  2B63 A;  3TM7 B;  3SUJ A;  3GTJ A;  1WCM A;  1PYQ A;  4KOD A;  4AYB A;  3X2P A;  2A6H D;  2NAP A;  2E7Z A;  1HD5 A;  1OA9 A;  3OUG A;  3SUK A;  4D7Z B;  2JIR A;  3CQZ A;  1DMR A;  1G8J A;  3QQ8 A;  4FG4 A;  4JP6 A;  3GTG A;  2VPY A;  4GA6 A;  4ENG A;  3CZB A;  1PPY A;  4AON B;  1S3S A;  1PYU B;  3IR5 A;  5EPP A;  2R7Z A;  1WC2 A;  1H0H A;  3QC8 A;  1OA7 A;  1AW8 B;  2VPW A;  5FTL A;  2V3V A;  2AE0 X;  2PIC A;  3QQ7 A;  2V45 A;  5FTK A;  3SUL A;  3FKI A;  1I50 A;  2VPZ A;  2R93 A;  1CR5 A;  4JP7 A;  3GTK A;  2NVY A;  4AOK B;  3X2K A;  4FFT A;  1CZ5 A;  3GTP A;  3X2H A;  1FDI A;  2C45 A;  3SUM A;  5C18 A;  4QIW A;  2BH0 A;  1YNN D;  2PNW A;  4JCW A;  1Q16 A;  5GLX A;  3HU2 A;  2IV2 X;  1IW7 D;  1QDN A;  2EEO B;  4GA5 A;  4KO8 A;  1UHD A;  1KQG A;  3TIW A;  1EU1 A;  2WB1 A;  4AVR A;  2BE5 D;  3X2O A;  4JJO A;  3M3G A;  5DYI A;  2YU9 A;  2PJH B;  1Y1W A;  2JA6 A;  1Y4Z A;  1ZYR D;  2KI8 A;  1QCS A;  2A68 D;  2JA5 A;  5FTN A;  2DMR A;  4KLN A;  4L48 A;  1VC3 B;  5FTJ A;  5B6C A;  5T5I D;  5FTM A;  1TWG A;  4DMR A;  1SFO A;  2E2H A;  1E60 A;  2A69 D;  2VUM A;  1YLE A;  2JIQ A;  1E61 A;  2NYA A;  2JIP A;  2CW0 D;  1PT1 A;  4C2M A;  1R27 A;  2PMZ A;  1TWA A;  3HU1 A;  1YNJ D;  1BW3 A;  2R92 A;  4FG2 A;  3X2M A;  3D30 A;  3GTM A;  3ENG A;  3O5A A;  3PLX B;  5GM9 A;  3X2J A;  3GTL A;  2WAQ A;  5C1B A;  3IR6 A;  2E2I A;  2ENG A;  1AA6 A;  1SIW A;  2KQA A;  1TWC A;  1CZ4 A;  1SMY D;  4KDI A;  4RV0 A;  1WLF A;  2PI8 A;  1OGY A;  4CS0 A;  1N10 A;  4CRZ A;  2A6E D;  1FDO A;  1TMO A;  1R7R A;  4FER A;  5T5M D;  1Y5I A;  2PJJ A;  1I3Q A;  3GTQ A;  2G6G A;  4AAY A;  1R9T A;  3CF2 A;  1TWH A;  5GLF A;  4ZM7 A;  2JA7 A;  1G8K A;  4AZD A;  4JS7 A;  1UHE A; 
#chains in the Genus database with same CATH homology
 1BW3 A;  1OA9 A;  1HD5 A;  2BH0 A;  2PNW A;  4FG2 A;  4JCW A;  3SUK A;  3X2N A;  3D30 A;  5GLX A;  3X2I A;  3X2M A;  1BW4 A;  3ENG A;  5GM9 A;  3X2J A;  4FG4 A;  4JP6 A;  4ENG A;  1L8F A;  3X2G A;  3CZB A;  5GLY A;  4AVR A;  5H4U A;  3X2O A;  2ENG A;  3M3G A;  4JJO A;  1WC2 A;  3X2L A;  2KQA A;  1OA7 A;  2HCZ X;  2PI8 A;  1N10 A;  2AE0 X;  2PIC A;  3SUL A;  2GAE A;  4FER A;  2PJJ A;  2G5D A;  4L48 A;  2G6G A;  4JP7 A;  3X2K A;  3SUJ A;  4FFT A;  4ZM7 A;  4JS7 A;  3X2P A;  3X2H A;  3SUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...