5GLYA

Crystal structure of a glycoside hydrolase in complex with cellotetrose from thielavia terrestris nrrl 8126
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 45 protein
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
molecule tags Hydrolase
total genus 71
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5glyA00
4JP6A 3X2HA 3SUKA 2ENGA 5GM9A 5H4UA 3X2NA 1BW4A 3ENGA 4JCWA 3X2KA 1N10A 3X2GA 1OA7A 3X2JA 5GLYA 2G5DA 3CZBA 4FG2A 2BH0A 4FFTA 1WC2A 4JP7A 3X2LA 4L48A 3SULA 4ZM7A 2GAEA 2PICA 4JJOA 3D30A 3X2PA 2PJJA 2AE0X 4ENGA 5GLXA 3X2MA 4JS7A 3X2IA 2G6GA 4FERA 2PI8A 3SUJA 1BW3A 2PNWA 1OA9A 1HD5A 3M3GA 3X2OA 2KQAA 4FG4A 1L8FA 4AVRA 3SUMA 2HCZX
chains in the Genus database with same CATH superfamily
1WLFA 4JP6A 2A68D 2VPZA 4KDIA 3X2NA 1BW4A 3TIWA 4AZDA 2IV2X 5C1BA 1UHDA 2V45A 3X2GA 1OA7A 2KI8A 2JIPA 1AW8B 3CZBA 2BE5D 2PJHB 4FFTA 3GTJA 1WC2A 2CW0D 1DMSA 4JP7A 3GTQA 3X2LA 4AONB 1TWGA 1TWFA 5FTKA 1TWHA 1YNJD 3SULA 4ZM7A 1KQGA 1DMRA 5GLFA 3QC8A 2NAPA 4AOKB 1PQFA 3DMRA 2B63A 2VPXA 4JS7A 1G8JA 1H0HA 1TMOA 2PI8A 1BW3A 1R9TA 1OA9A 4CRYG 1VC3B 3SUMA 5DYIA 5T5ID 3GTGA 1PQHA 2PMZA 2VPYA 2JIMA 4KODA 2VUMA 3CQZA 1ZYRD 3QWZA 1E60A 1Y4ZA 3ENGA 3X2KA 2JIOA 1Q16A 2NVXA 1N10A 5FTNA 2G5DA 2E7ZA 2E2IA 1OGYA 4AYBA 1TWAA 1CZ5A 1CZ4A 5DYGA 4QIWA 1I50A 1PYQA 4JJOA 1Y1VA 2JA5A 1E61A 4D7ZB 3GTKA 2DMRA 3CF2A 3GTOA 1PT0A 2A6HD 2E2HA 4FERA 2JA6A 2PNWA 1HD5A 1TWCA 2KQAA 4FG4A 1L8FA 3HU3A 1H5NA 4KDLA 3QQ8A 4RV0A 5EPPA 2YU9A 1FDOA 3O5AA 3GTPA 3GTMA 1YNND 5C18A 4JCWA 4C2MA 2C45A 3HU1A 1I3QA 5GLYA 1R27A 4FG2A 1EU1A 1QCSA 3PLXB 4KLNA 1E32A 1YLEA 3IR7A 2R7ZA 3IR5A 1R7RA 1PPYA 4CRZA 2PICA 3D30A 2JIQA 3X2PA 1K83A 4ENGA 3X2MA 1AA6A 2R92A 2G6GA 5FTJA 3SUJA 2WB1A 1IW7D 3TM7B 4CS0A 1SMYD 3M3GA 1E5VA 3X2OA 3HU2A 2A6ED 1E18A 2R93A 5T5MD 5B6CA 3X2HA 4AAYA 1Y1WA 3ML1A 5FTMA 2JA7A 4AVRA 1UHEA 3SUKA 2ENGA 5GM9A 1PT1A 1PQEA 5H4UA 3HKZA 3IR6A 4GA6A 2O5JD 2JIRA 2Y0SA 1SIWA 5FTLA 2EEOB 3X2JA 4GA5A 2WAQA 4DMRA 4NOHA 1Y5IA 3OUGA 1WCMA 2BH0A 2NYAA 4L48A 2V3VA 3QQ7A 1FDIA 2GAEA 1QDNA 3FKIA 1CR5A 2NVYA 2VPWA 2PJJA 2AE0X 3H0GA 5GLXA 2YUJA 1SFOA 1PYUB 1ZC1A 3X2IA 1S3SA 3GTLA 4KO8A 2A69D 1G8KA 2HCZX 1KQFA
chains in the Genus database with same CATH topology
4JP6A 3X2HA 3SUKA 2ENGA 5GM9A 5H4UA 3X2NA 1BW4A 3ENGA 4JCWA 3X2KA 1N10A 3X2GA 1OA7A 3X2JA 5GLYA 2G5DA 3CZBA 4FG2A 2BH0A 4FFTA 1WC2A 4JP7A 3X2LA 4L48A 3SULA 4ZM7A 2GAEA 2PICA 4JJOA 3D30A 3X2PA 2PJJA 2AE0X 4ENGA 5GLXA 3X2MA 4JS7A 3X2IA 2G6GA 4FERA 2PI8A 3SUJA 1BW3A 2PNWA 1OA9A 1HD5A 3M3GA 3X2OA 2KQAA 4FG4A 1L8FA 4AVRA 3SUMA 2HCZX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JP6 A;  3X2H A;  3SUK A;  2ENG A;  5GM9 A;  5H4U A;  3X2N A;  1BW4 A;  3ENG A;  4JCW A;  3X2K A;  1N10 A;  3X2G A;  1OA7 A;  3X2J A;  5GLY A;  2G5D A;  3CZB A;  4FG2 A;  2BH0 A;  4FFT A;  1WC2 A;  4JP7 A;  3X2L A;  4L48 A;  3SUL A;  4ZM7 A;  2GAE A;  2PIC A;  4JJO A;  3D30 A;  3X2P A;  2PJJ A;  2AE0 X;  4ENG A;  5GLX A;  3X2M A;  4JS7 A;  3X2I A;  2G6G A;  4FER A;  2PI8 A;  3SUJ A;  1BW3 A;  2PNW A;  1OA9 A;  1HD5 A;  3M3G A;  3X2O A;  2KQA A;  4FG4 A;  1L8F A;  4AVR A;  3SUM A;  2HCZ X; 
#chains in the Genus database with same CATH topology
 1WLF A;  4JP6 A;  2A68 D;  2VPZ A;  4KDI A;  3X2N A;  1BW4 A;  3TIW A;  4AZD A;  2IV2 X;  5C1B A;  1UHD A;  2V45 A;  3X2G A;  1OA7 A;  2KI8 A;  2JIP A;  1AW8 B;  3CZB A;  2BE5 D;  2PJH B;  4FFT A;  3GTJ A;  1WC2 A;  2CW0 D;  1DMS A;  4JP7 A;  3GTQ A;  3X2L A;  4AON B;  1TWG A;  1TWF A;  5FTK A;  1TWH A;  1YNJ D;  3SUL A;  4ZM7 A;  1KQG A;  1DMR A;  5GLF A;  3QC8 A;  2NAP A;  4AOK B;  1PQF A;  3DMR A;  2B63 A;  2VPX A;  4JS7 A;  1G8J A;  1H0H A;  1TMO A;  2PI8 A;  1BW3 A;  1R9T A;  1OA9 A;  4CRY G;  1VC3 B;  3SUM A;  5DYI A;  5T5I D;  3GTG A;  1PQH A;  2PMZ A;  2VPY A;  2JIM A;  4KOD A;  2VUM A;  3CQZ A;  1ZYR D;  3QWZ A;  1E60 A;  1Y4Z A;  3ENG A;  3X2K A;  2JIO A;  1Q16 A;  2NVX A;  1N10 A;  5FTN A;  2G5D A;  2E7Z A;  2E2I A;  1OGY A;  4AYB A;  1TWA A;  1CZ5 A;  1CZ4 A;  5DYG A;  4QIW A;  1I50 A;  1PYQ A;  4JJO A;  1Y1V A;  2JA5 A;  1E61 A;  4D7Z B;  3GTK A;  2DMR A;  3CF2 A;  3GTO A;  1PT0 A;  2A6H D;  2E2H A;  4FER A;  2JA6 A;  2PNW A;  1HD5 A;  1TWC A;  2KQA A;  4FG4 A;  1L8F A;  3HU3 A;  1H5N A;  4KDL A;  3QQ8 A;  4RV0 A;  5EPP A;  2YU9 A;  1FDO A;  3O5A A;  3GTP A;  3GTM A;  1YNN D;  5C18 A;  4JCW A;  4C2M A;  2C45 A;  3HU1 A;  1I3Q A;  5GLY A;  1R27 A;  4FG2 A;  1EU1 A;  1QCS A;  3PLX B;  4KLN A;  1E32 A;  1YLE A;  3IR7 A;  2R7Z A;  3IR5 A;  1R7R A;  1PPY A;  4CRZ A;  2PIC A;  3D30 A;  2JIQ A;  3X2P A;  1K83 A;  4ENG A;  3X2M A;  1AA6 A;  2R92 A;  2G6G A;  5FTJ A;  3SUJ A;  2WB1 A;  1IW7 D;  3TM7 B;  4CS0 A;  1SMY D;  3M3G A;  1E5V A;  3X2O A;  3HU2 A;  2A6E D;  1E18 A;  2R93 A;  5T5M D;  5B6C A;  3X2H A;  4AAY A;  1Y1W A;  3ML1 A;  5FTM A;  2JA7 A;  4AVR A;  1UHE A;  3SUK A;  2ENG A;  5GM9 A;  1PT1 A;  1PQE A;  5H4U A;  3HKZ A;  3IR6 A;  4GA6 A;  2O5J D;  2JIR A;  2Y0S A;  1SIW A;  5FTL A;  2EEO B;  3X2J A;  4GA5 A;  2WAQ A;  4DMR A;  4NOH A;  1Y5I A;  3OUG A;  1WCM A;  2BH0 A;  2NYA A;  4L48 A;  2V3V A;  3QQ7 A;  1FDI A;  2GAE A;  1QDN A;  3FKI A;  1CR5 A;  2NVY A;  2VPW A;  2PJJ A;  2AE0 X;  3H0G A;  5GLX A;  2YUJ A;  1SFO A;  1PYU B;  1ZC1 A;  3X2I A;  1S3S A;  3GTL A;  4KO8 A;  2A69 D;  1G8K A;  2HCZ X;  1KQF A; 
#chains in the Genus database with same CATH homology
 4JP6 A;  3X2H A;  3SUK A;  2ENG A;  5GM9 A;  5H4U A;  3X2N A;  1BW4 A;  3ENG A;  4JCW A;  3X2K A;  1N10 A;  3X2G A;  1OA7 A;  3X2J A;  5GLY A;  2G5D A;  3CZB A;  4FG2 A;  2BH0 A;  4FFT A;  1WC2 A;  4JP7 A;  3X2L A;  4L48 A;  3SUL A;  4ZM7 A;  2GAE A;  2PIC A;  4JJO A;  3D30 A;  3X2P A;  2PJJ A;  2AE0 X;  4ENG A;  5GLX A;  3X2M A;  4JS7 A;  3X2I A;  2G6G A;  4FER A;  2PI8 A;  3SUJ A;  1BW3 A;  2PNW A;  1OA9 A;  1HD5 A;  3M3G A;  3X2O A;  2KQA A;  4FG4 A;  1L8F A;  4AVR A;  3SUM A;  2HCZ X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...