5GLYA

Crystal structure of a glycoside hydrolase in complex with cellotetrose from thielavia terrestris nrrl 8126
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
b'ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 45 protein
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
molecule tags Hydrolase
total genus 71
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5glyA00
1OA7A 3X2MA 1L8FA 2AE0X 1HD5A 4JP7A 3X2NA 3X2GA 3X2OA 2HCZX 2ENGA 5H4UA 1BW3A 4ENGA 2PJJA 2PNWA 1N10A 4JJOA 3D30A 4ZM7A 4JS7A 3X2IA 3X2KA 2PICA 4FFTA 5GM9A 2G6GA 5GLXA 3SUJA 4FG2A 4FERA 2KQAA 3ENGA 4JCWA 2GAEA 3CZBA 3SULA 3SUKA 3X2HA 1BW4A 4JP6A 1WC2A 3SUMA 3M3GA 5GLYA 2PI8A 4AVRA 4L48A 2BH0A 2G5DA 3X2PA 3X2LA 3X2JA 1OA9A 4FG4A
chains in the Genus database with same CATH superfamily
5C18A 1OA7A 3GTOA 4KO8A 1HD5A 2R7ZA 3GTPA 1DMSA 4AOKB 4AONB 2HCZX 5EPPA 2JA5A 2NYAA 3IR6A 1KQGA 5FTNA 4CRYG 1TWFA 1SIWA 2A68D 3D30A 1TWAA 1KQFA 2V3VA 4NOHA 1E60A 2NAPA 4FFTA 3H0GA 2G6GA 2YU9A 1Y1WA 3SUJA 5FTLA 4AYBA 1TWCA 1WCMA 2NVXA 4JCWA 3CZBA 4D7ZB 3SUKA 4KODA 5C1BA 3X2HA 1PT0A 2WB1A 1WC2A 1Q16A 1TWHA 1SMYD 1G8JA 4DMRA 2B63A 1ZYRD 5B6CA 1TMOA 2JIRA 1CZ5A 1L8FA 1YLEA 3HKZA 2WAQA 1SFOA 2VUMA 2C45A 4JP7A 3IR5A 3X2NA 3X2GA 2NVYA 3O5AA 3IR7A 1AW8B 1PYQA 2IV2X 1FDOA 4ENGA 2VPXA 2PNWA 4ZM7A 4JS7A 3HU3A 2VPZA 3X2KA 3FKIA 1H0HA 5DYIA 1EU1A 1OGYA 4GA6A 1PT1A 5GLFA 4FERA 2VPYA 2KQAA 1S3SA 3CF2A 1E61A 1E5VA 4JP6A 4KLNA 5FTMA 3M3GA 5GLYA 3QWZA 1K83A 5T5MD 3X2LA 1YNND 1OA9A 4FG4A 2VPWA 2A6ED 1E18A 3X2MA 3GTLA 2AE0X 2DMRA 3OUGA 3X2OA 3HU2A 1VC3B 5DYGA 1R7RA 1PQFA 2EEOB 3CQZA 2PJJA 4KDLA 3QQ7A 1Y4ZA 4CS0A 3X2IA 2YUJA 2PICA 5GM9A 1CR5A 4QIWA 5GLXA 1I50A 3QQ8A 2JA7A 1FDIA 3ENGA 2O5JD 2GAEA 1UHEA 3SULA 2R92A 1IW7D 1BW4A 3ML1A 3TIWA 2E7ZA 2R93A 3SUMA 4AVRA 3HU1A 4L48A 4KDIA 3X2PA 3X2JA 1QDNA 2JIQA 1R27A 3TM7B 1QCSA 3GTMA 2A69D 1G8KA 2E2IA 3QC8A 4AAYA 2Y0SA 2PMZA 1PPYA 1TWGA 4CRZA 3PLXB 2ENGA 5H4UA 2JA6A 3GTGA 5T5ID 2CW0D 4RV0A 5FTJA 1BW3A 2V45A 1PQHA 1ZC1A 1N10A 4JJOA 1PQEA 1YNJD 2A6HD 2JIPA 2JIMA 1DMRA 2KI8A 4C2MA 1R9TA 2BE5D 1Y1VA 2JIOA 4FG2A 5FTKA 1E32A 1I3QA 2E2HA 1Y5IA 2PJHB 1UHDA 4AZDA 1H5NA 3GTQA 1PYUB 2PI8A 2BH0A 2G5DA 3GTKA 3DMRA 1CZ4A 4GA5A 1AA6A 3GTJA 1WLFA
chains in the Genus database with same CATH topology
1OA7A 3X2MA 1L8FA 2AE0X 1HD5A 4JP7A 3X2NA 3X2GA 3X2OA 2HCZX 2ENGA 5H4UA 1BW3A 4ENGA 2PJJA 2PNWA 1N10A 4JJOA 3D30A 4ZM7A 4JS7A 3X2IA 3X2KA 2PICA 4FFTA 5GM9A 2G6GA 5GLXA 3SUJA 4FG2A 4FERA 2KQAA 3ENGA 4JCWA 2GAEA 3CZBA 3SULA 3SUKA 3X2HA 1BW4A 4JP6A 1WC2A 3SUMA 3M3GA 5GLYA 2PI8A 4AVRA 4L48A 2BH0A 2G5DA 3X2PA 3X2LA 3X2JA 1OA9A 4FG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OA7 A;  3X2M A;  1L8F A;  2AE0 X;  1HD5 A;  4JP7 A;  3X2N A;  3X2G A;  3X2O A;  2HCZ X;  2ENG A;  5H4U A;  1BW3 A;  4ENG A;  2PJJ A;  2PNW A;  1N10 A;  4JJO A;  3D30 A;  4ZM7 A;  4JS7 A;  3X2I A;  3X2K A;  2PIC A;  4FFT A;  5GM9 A;  2G6G A;  5GLX A;  3SUJ A;  4FG2 A;  4FER A;  2KQA A;  3ENG A;  4JCW A;  2GAE A;  3CZB A;  3SUL A;  3SUK A;  3X2H A;  1BW4 A;  4JP6 A;  1WC2 A;  3SUM A;  3M3G A;  5GLY A;  2PI8 A;  4AVR A;  4L48 A;  2BH0 A;  2G5D A;  3X2P A;  3X2L A;  3X2J A;  1OA9 A;  4FG4 A; 
#chains in the Genus database with same CATH topology
 5C18 A;  1OA7 A;  3GTO A;  4KO8 A;  1HD5 A;  2R7Z A;  3GTP A;  1DMS A;  4AOK B;  4AON B;  2HCZ X;  5EPP A;  2JA5 A;  2NYA A;  3IR6 A;  1KQG A;  5FTN A;  4CRY G;  1TWF A;  1SIW A;  2A68 D;  3D30 A;  1TWA A;  1KQF A;  2V3V A;  4NOH A;  1E60 A;  2NAP A;  4FFT A;  3H0G A;  2G6G A;  2YU9 A;  1Y1W A;  3SUJ A;  5FTL A;  4AYB A;  1TWC A;  1WCM A;  2NVX A;  4JCW A;  3CZB A;  4D7Z B;  3SUK A;  4KOD A;  5C1B A;  3X2H A;  1PT0 A;  2WB1 A;  1WC2 A;  1Q16 A;  1TWH A;  1SMY D;  1G8J A;  4DMR A;  2B63 A;  1ZYR D;  5B6C A;  1TMO A;  2JIR A;  1CZ5 A;  1L8F A;  1YLE A;  3HKZ A;  2WAQ A;  1SFO A;  2VUM A;  2C45 A;  4JP7 A;  3IR5 A;  3X2N A;  3X2G A;  2NVY A;  3O5A A;  3IR7 A;  1AW8 B;  1PYQ A;  2IV2 X;  1FDO A;  4ENG A;  2VPX A;  2PNW A;  4ZM7 A;  4JS7 A;  3HU3 A;  2VPZ A;  3X2K A;  3FKI A;  1H0H A;  5DYI A;  1EU1 A;  1OGY A;  4GA6 A;  1PT1 A;  5GLF A;  4FER A;  2VPY A;  2KQA A;  1S3S A;  3CF2 A;  1E61 A;  1E5V A;  4JP6 A;  4KLN A;  5FTM A;  3M3G A;  5GLY A;  3QWZ A;  1K83 A;  5T5M D;  3X2L A;  1YNN D;  1OA9 A;  4FG4 A;  2VPW A;  2A6E D;  1E18 A;  3X2M A;  3GTL A;  2AE0 X;  2DMR A;  3OUG A;  3X2O A;  3HU2 A;  1VC3 B;  5DYG A;  1R7R A;  1PQF A;  2EEO B;  3CQZ A;  2PJJ A;  4KDL A;  3QQ7 A;  1Y4Z A;  4CS0 A;  3X2I A;  2YUJ A;  2PIC A;  5GM9 A;  1CR5 A;  4QIW A;  5GLX A;  1I50 A;  3QQ8 A;  2JA7 A;  1FDI A;  3ENG A;  2O5J D;  2GAE A;  1UHE A;  3SUL A;  2R92 A;  1IW7 D;  1BW4 A;  3ML1 A;  3TIW A;  2E7Z A;  2R93 A;  3SUM A;  4AVR A;  3HU1 A;  4L48 A;  4KDI A;  3X2P A;  3X2J A;  1QDN A;  2JIQ A;  1R27 A;  3TM7 B;  1QCS A;  3GTM A;  2A69 D;  1G8K A;  2E2I A;  3QC8 A;  4AAY A;  2Y0S A;  2PMZ A;  1PPY A;  1TWG A;  4CRZ A;  3PLX B;  2ENG A;  5H4U A;  2JA6 A;  3GTG A;  5T5I D;  2CW0 D;  4RV0 A;  5FTJ A;  1BW3 A;  2V45 A;  1PQH A;  1ZC1 A;  1N10 A;  4JJO A;  1PQE A;  1YNJ D;  2A6H D;  2JIP A;  2JIM A;  1DMR A;  2KI8 A;  4C2M A;  1R9T A;  2BE5 D;  1Y1V A;  2JIO A;  4FG2 A;  5FTK A;  1E32 A;  1I3Q A;  2E2H A;  1Y5I A;  2PJH B;  1UHD A;  4AZD A;  1H5N A;  3GTQ A;  1PYU B;  2PI8 A;  2BH0 A;  2G5D A;  3GTK A;  3DMR A;  1CZ4 A;  4GA5 A;  1AA6 A;  3GTJ A;  1WLF A; 
#chains in the Genus database with same CATH homology
 1OA7 A;  3X2M A;  1L8F A;  2AE0 X;  1HD5 A;  4JP7 A;  3X2N A;  3X2G A;  3X2O A;  2HCZ X;  2ENG A;  5H4U A;  1BW3 A;  4ENG A;  2PJJ A;  2PNW A;  1N10 A;  4JJO A;  3D30 A;  4ZM7 A;  4JS7 A;  3X2I A;  3X2K A;  2PIC A;  4FFT A;  5GM9 A;  2G6G A;  5GLX A;  3SUJ A;  4FG2 A;  4FER A;  2KQA A;  3ENG A;  4JCW A;  2GAE A;  3CZB A;  3SUL A;  3SUK A;  3X2H A;  1BW4 A;  4JP6 A;  1WC2 A;  3SUM A;  3M3G A;  5GLY A;  2PI8 A;  4AVR A;  4L48 A;  2BH0 A;  2G5D A;  3X2P A;  3X2L A;  3X2J A;  1OA9 A;  4FG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...