5GLYA

Crystal structure of a glycoside hydrolase in complex with cellotetrose from thielavia terrestris nrrl 8126
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 45 protein
total genus 71
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5glyA00
4L48A 1L8FA 2PI8A 2PJJA 2AE0X 1WC2A 1OA7A 5GM9A 3SUKA 3SUMA 2KQAA 4JJOA 4FG2A 3D30A 3X2IA 2G5DA 2PNWA 3CZBA 2GAEA 4JS7A 4JP6A 4ZM7A 3SULA 3X2KA 3X2PA 3ENGA 1N10A 3X2GA 3X2NA 1OA9A 2G6GA 3M3GA 2HCZX 4JCWA 1BW3A 2BH0A 2PICA 3X2MA 4FFTA 3X2OA 3X2JA 2ENGA 5H4UA 5GLYA 1BW4A 5GLXA 4ENGA 1HD5A 4FG4A 4FERA 3X2LA 3X2HA 4AVRA 3SUJA 4JP7A
chains in the Genus database with same CATH superfamily
1QDNA 2PJJA 2AE0X 4KODA 1PYQA 4AONB 1CR5A 2JIOA 2A6ED 3SUKA 2A6HD 2KQAA 4JJOA 3GTPA 1I3QA 2R7ZA 4AYBA 1IW7D 2E2HA 3D30A 2EEOB 5DYIA 1TWCA 1TWFA 2VPWA 1Y1VA 5FTNA 3X2KA 3FKIA 3X2PA 2JIMA 3X2GA 4D7ZB 2G6GA 5DYGA 1PQEA 3HKZA 2BH0A 4FFTA 1TWHA 2ENGA 2NVXA 5H4UA 3H0GA 4CRZA 5C1BA 2E7ZA 1KQGA 3X2LA 3GTKA 3X2HA 3IR7A 5C18A 2KI8A 3QC8A 5EPPA 5T5MD 1L8FA 1OGYA 2JIRA 4CRYG 2PMZA 1PT1A 1VC3B 2JA7A 4RV0A 2JA5A 1S3SA 5FTKA 1DMRA 5GLFA 2NVYA 2BE5D 4KO8A 2VUMA 2GAEA 4JS7A 4JP6A 2DMRA 1Y4ZA 2VPYA 3ENGA 3GTLA 4GA5A 3X2NA 1E61A 1YNJD 3PLXB 1R27A 1G8JA 1SMYD 2JA6A 3X2MA 2PICA 3O5AA 2VPZA 4AOKB 2B63A 5FTLA 1KQFA 1PPYA 1FDIA 1HD5A 1SIWA 4FERA 4GA6A 3HU1A 5FTMA 1Y5IA 2A69D 4L48A 4DMRA 2V45A 3HU2A 4CS0A 2YUJA 1CZ4A 2NYAA 1OA7A 1E5VA 1TWGA 3QWZA 2JIPA 2WAQA 2IV2X 1WLFA 2PJHB 3TM7B 3X2IA 1CZ5A 2PNWA 1I50A 2R93A 1UHEA 4ZM7A 3SULA 1YNND 3OUGA 3GTMA 2NAPA 1AA6A 3M3GA 2CW0D 2HCZX 4KLNA 4JCWA 1BW3A 3GTQA 2O5JD 2YU9A 3X2JA 3X2OA 1ZC1A 3ML1A 2E2IA 2R92A 1G8KA 3GTOA 1YLEA 5GLXA 4ENGA 1Q16A 1PQFA 3DMRA 4QIWA 2VPXA 3SUJA 1AW8B 1R7RA 1E60A 2PI8A 2A68D 3CQZA 2V3VA 3HU3A 1WC2A 3IR6A 4NOHA 5T5ID 1SFOA 1R9TA 2C45A 4KDLA 5GM9A 3CF2A 1UHDA 3GTGA 3SUMA 1DMSA 1PQHA 4C2MA 4FG2A 1PYUB 1QCSA 3TIWA 1ZYRD 2G5DA 3CZBA 3IR5A 1H0HA 4KDIA 3QQ7A 1H5NA 1N10A 1PT0A 4AAYA 1OA9A 1K83A 5FTJA 1E18A 3QQ8A 1WCMA 2JIQA 1EU1A 2Y0SA 1FDOA 5GLYA 1E32A 1Y1WA 1BW4A 5B6CA 3GTJA 4FG4A 2WB1A 1TMOA 4AVRA 4JP7A 4AZDA 1TWAA
chains in the Genus database with same CATH topology
4L48A 1L8FA 2PI8A 2PJJA 2AE0X 1WC2A 1OA7A 5GM9A 3SUKA 3SUMA 2KQAA 4JJOA 4FG2A 3D30A 3X2IA 2G5DA 2PNWA 3CZBA 2GAEA 4JS7A 4JP6A 4ZM7A 3SULA 3X2KA 3X2PA 3ENGA 1N10A 3X2GA 3X2NA 1OA9A 2G6GA 3M3GA 2HCZX 4JCWA 1BW3A 2BH0A 2PICA 3X2MA 4FFTA 3X2OA 3X2JA 2ENGA 5H4UA 5GLYA 1BW4A 5GLXA 4ENGA 1HD5A 4FG4A 4FERA 3X2LA 3X2HA 4AVRA 3SUJA 4JP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L48 A;  1L8F A;  2PI8 A;  2PJJ A;  2AE0 X;  1WC2 A;  1OA7 A;  5GM9 A;  3SUK A;  3SUM A;  2KQA A;  4JJO A;  4FG2 A;  3D30 A;  3X2I A;  2G5D A;  2PNW A;  3CZB A;  2GAE A;  4JS7 A;  4JP6 A;  4ZM7 A;  3SUL A;  3X2K A;  3X2P A;  3ENG A;  1N10 A;  3X2G A;  3X2N A;  1OA9 A;  2G6G A;  3M3G A;  2HCZ X;  4JCW A;  1BW3 A;  2BH0 A;  2PIC A;  3X2M A;  4FFT A;  3X2O A;  3X2J A;  2ENG A;  5H4U A;  5GLY A;  1BW4 A;  5GLX A;  4ENG A;  1HD5 A;  4FG4 A;  4FER A;  3X2L A;  3X2H A;  4AVR A;  3SUJ A;  4JP7 A; 
#chains in the Genus database with same CATH topology
 1QDN A;  2PJJ A;  2AE0 X;  4KOD A;  1PYQ A;  4AON B;  1CR5 A;  2JIO A;  2A6E D;  3SUK A;  2A6H D;  2KQA A;  4JJO A;  3GTP A;  1I3Q A;  2R7Z A;  4AYB A;  1IW7 D;  2E2H A;  3D30 A;  2EEO B;  5DYI A;  1TWC A;  1TWF A;  2VPW A;  1Y1V A;  5FTN A;  3X2K A;  3FKI A;  3X2P A;  2JIM A;  3X2G A;  4D7Z B;  2G6G A;  5DYG A;  1PQE A;  3HKZ A;  2BH0 A;  4FFT A;  1TWH A;  2ENG A;  2NVX A;  5H4U A;  3H0G A;  4CRZ A;  5C1B A;  2E7Z A;  1KQG A;  3X2L A;  3GTK A;  3X2H A;  3IR7 A;  5C18 A;  2KI8 A;  3QC8 A;  5EPP A;  5T5M D;  1L8F A;  1OGY A;  2JIR A;  4CRY G;  2PMZ A;  1PT1 A;  1VC3 B;  2JA7 A;  4RV0 A;  2JA5 A;  1S3S A;  5FTK A;  1DMR A;  5GLF A;  2NVY A;  2BE5 D;  4KO8 A;  2VUM A;  2GAE A;  4JS7 A;  4JP6 A;  2DMR A;  1Y4Z A;  2VPY A;  3ENG A;  3GTL A;  4GA5 A;  3X2N A;  1E61 A;  1YNJ D;  3PLX B;  1R27 A;  1G8J A;  1SMY D;  2JA6 A;  3X2M A;  2PIC A;  3O5A A;  2VPZ A;  4AOK B;  2B63 A;  5FTL A;  1KQF A;  1PPY A;  1FDI A;  1HD5 A;  1SIW A;  4FER A;  4GA6 A;  3HU1 A;  5FTM A;  1Y5I A;  2A69 D;  4L48 A;  4DMR A;  2V45 A;  3HU2 A;  4CS0 A;  2YUJ A;  1CZ4 A;  2NYA A;  1OA7 A;  1E5V A;  1TWG A;  3QWZ A;  2JIP A;  2WAQ A;  2IV2 X;  1WLF A;  2PJH B;  3TM7 B;  3X2I A;  1CZ5 A;  2PNW A;  1I50 A;  2R93 A;  1UHE A;  4ZM7 A;  3SUL A;  1YNN D;  3OUG A;  3GTM A;  2NAP A;  1AA6 A;  3M3G A;  2CW0 D;  2HCZ X;  4KLN A;  4JCW A;  1BW3 A;  3GTQ A;  2O5J D;  2YU9 A;  3X2J A;  3X2O A;  1ZC1 A;  3ML1 A;  2E2I A;  2R92 A;  1G8K A;  3GTO A;  1YLE A;  5GLX A;  4ENG A;  1Q16 A;  1PQF A;  3DMR A;  4QIW A;  2VPX A;  3SUJ A;  1AW8 B;  1R7R A;  1E60 A;  2PI8 A;  2A68 D;  3CQZ A;  2V3V A;  3HU3 A;  1WC2 A;  3IR6 A;  4NOH A;  5T5I D;  1SFO A;  1R9T A;  2C45 A;  4KDL A;  5GM9 A;  3CF2 A;  1UHD A;  3GTG A;  3SUM A;  1DMS A;  1PQH A;  4C2M A;  4FG2 A;  1PYU B;  1QCS A;  3TIW A;  1ZYR D;  2G5D A;  3CZB A;  3IR5 A;  1H0H A;  4KDI A;  3QQ7 A;  1H5N A;  1N10 A;  1PT0 A;  4AAY A;  1OA9 A;  1K83 A;  5FTJ A;  1E18 A;  3QQ8 A;  1WCM A;  2JIQ A;  1EU1 A;  2Y0S A;  1FDO A;  5GLY A;  1E32 A;  1Y1W A;  1BW4 A;  5B6C A;  3GTJ A;  4FG4 A;  2WB1 A;  1TMO A;  4AVR A;  4JP7 A;  4AZD A;  1TWA A; 
#chains in the Genus database with same CATH homology
 4L48 A;  1L8F A;  2PI8 A;  2PJJ A;  2AE0 X;  1WC2 A;  1OA7 A;  5GM9 A;  3SUK A;  3SUM A;  2KQA A;  4JJO A;  4FG2 A;  3D30 A;  3X2I A;  2G5D A;  2PNW A;  3CZB A;  2GAE A;  4JS7 A;  4JP6 A;  4ZM7 A;  3SUL A;  3X2K A;  3X2P A;  3ENG A;  1N10 A;  3X2G A;  3X2N A;  1OA9 A;  2G6G A;  3M3G A;  2HCZ X;  4JCW A;  1BW3 A;  2BH0 A;  2PIC A;  3X2M A;  4FFT A;  3X2O A;  3X2J A;  2ENG A;  5H4U A;  5GLY A;  1BW4 A;  5GLX A;  4ENG A;  1HD5 A;  4FG4 A;  4FER A;  3X2L A;  3X2H A;  4AVR A;  3SUJ A;  4JP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...