5GLYA

Crystal structure of a glycoside hydrolase in complex with cellotetrose from thielavia terrestris nrrl 8126
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 45 protein
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
total genus 71
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5glyA00
3D30A 3SUJA 4FERA 3M3GA 5GM9A 3SULA 3X2GA 1HD5A 3SUMA 4FG4A 3SUKA 2GAEA 4JP6A 3X2LA 2G6GA 2PICA 3X2OA 2PJJA 4L48A 3X2PA 4FFTA 3X2NA 4JCWA 4JP7A 1BW3A 1OA9A 1L8FA 2ENGA 2PNWA 4AVRA 2AE0X 2G5DA 3X2HA 1N10A 3CZBA 2KQAA 4JS7A 1BW4A 5GLYA 1WC2A 2BH0A 3X2KA 3X2IA 4ZM7A 5H4UA 1OA7A 4JJOA 3ENGA 2HCZX 5GLXA 3X2JA 3X2MA 4FG2A 4ENGA 2PI8A
chains in the Genus database with same CATH superfamily
1R27A 4KODA 4AAYA 4FERA 1E5VA 3IR7A 5GM9A 2VPWA 3X2GA 2VPYA 1KQGA 4FG4A 2JIPA 2R7ZA 1TWFA 3GTQA 1YNND 4L48A 3X2PA 4FFTA 3X2NA 1FDOA 1E32A 1PT1A 4JP7A 1OA9A 2ENGA 4AVRA 2E2HA 3HKZA 4NOHA 2YU9A 1G8JA 2KQAA 1WCMA 5GLFA 2A6ED 4KLNA 3X2KA 3X2IA 4ZM7A 4DMRA 4C2MA 1K83A 1G8KA 4JJOA 1PYUB 5GLXA 2R92A 3X2JA 1TWAA 2BE5D 1PYQA 4FG2A 2NYAA 2PI8A 3D30A 3GTOA 1H5NA 2NVYA 1FDIA 2JIQA 3SUMA 1Q16A 1AA6A 4KDIA 2WB1A 1SIWA 1TWGA 3QQ8A 2PJJA 1S3SA 2YUJA 4CRYG 1Y1VA 3HU1A 3CQZA 4JCWA 1R9TA 1R7RA 3GTPA 3H0GA 1QCSA 2G5DA 3GTLA 2EEOB 5FTLA 4QIWA 3IR5A 1CZ4A 1WLFA 2BH0A 3CF2A 5GLYA 5T5ID 5FTNA 5H4UA 5DYIA 4D7ZB 1KQFA 4AOKB 1QDNA 2PMZA 1EU1A 1YLEA 3SUJA 1PQHA 3IR6A 3SULA 1ZC1A 1PQEA 3SUKA 2VPXA 2GAEA 1I3QA 3X2LA 2G6GA 3X2OA 5B6CA 2JIRA 1DMSA 1Y1WA 2JA6A 1OGYA 3OUGA 4AYBA 1IW7D 2R93A 1CZ5A 3ML1A 3QC8A 1TMOA 5FTJA 3GTKA 2AE0X 3TM7B 3X2HA 1N10A 2A6HD 3CZBA 3HU2A 3FKIA 1BW4A 1WC2A 3DMRA 4AONB 2A68D 4AZDA 3QWZA 1OA7A 2VUMA 3GTMA 1VC3B 4RV0A 1CR5A 2O5JD 2JIOA 3X2MA 5C18A 2WAQA 1I50A 1H0HA 2PJHB 2NAPA 2Y0SA 4ENGA 3O5AA 1E60A 3GTGA 2A69D 2VPZA 3HU3A 2V3VA 3M3GA 5EPPA 1HD5A 1Y4ZA 4CS0A 5FTKA 2JIMA 1SMYD 1PPYA 1YNJD 2IV2X 4JP6A 2JA7A 3TIWA 2B63A 1PT0A 5C1BA 1ZYRD 1PQFA 4KO8A 1UHDA 2DMRA 3GTJA 1Y5IA 1BW3A 2CW0D 1L8FA 2C45A 2PNWA 1E61A 2NVXA 1DMRA 1UHEA 2V45A 4JS7A 3PLXB 2KI8A 2E7ZA 5FTMA 2E2IA 1SFOA 5T5MD 5DYGA 3ENGA 1TWHA 2HCZX 3QQ7A 1E18A 4KDLA 1TWCA 4GA6A 2JA5A 1AW8B 4CRZA 4GA5A 2PICA
chains in the Genus database with same CATH topology
3D30A 3SUJA 4FERA 3M3GA 5GM9A 3SULA 3X2GA 1HD5A 3SUMA 4FG4A 3SUKA 2GAEA 4JP6A 3X2LA 2G6GA 2PICA 3X2OA 2PJJA 4L48A 3X2PA 4FFTA 3X2NA 4JCWA 4JP7A 1BW3A 1OA9A 1L8FA 2ENGA 2PNWA 4AVRA 2AE0X 2G5DA 3X2HA 1N10A 3CZBA 2KQAA 4JS7A 1BW4A 5GLYA 1WC2A 2BH0A 3X2KA 3X2IA 4ZM7A 5H4UA 1OA7A 4JJOA 3ENGA 2HCZX 5GLXA 3X2JA 3X2MA 4FG2A 4ENGA 2PI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D30 A;  3SUJ A;  4FER A;  3M3G A;  5GM9 A;  3SUL A;  3X2G A;  1HD5 A;  3SUM A;  4FG4 A;  3SUK A;  2GAE A;  4JP6 A;  3X2L A;  2G6G A;  2PIC A;  3X2O A;  2PJJ A;  4L48 A;  3X2P A;  4FFT A;  3X2N A;  4JCW A;  4JP7 A;  1BW3 A;  1OA9 A;  1L8F A;  2ENG A;  2PNW A;  4AVR A;  2AE0 X;  2G5D A;  3X2H A;  1N10 A;  3CZB A;  2KQA A;  4JS7 A;  1BW4 A;  5GLY A;  1WC2 A;  2BH0 A;  3X2K A;  3X2I A;  4ZM7 A;  5H4U A;  1OA7 A;  4JJO A;  3ENG A;  2HCZ X;  5GLX A;  3X2J A;  3X2M A;  4FG2 A;  4ENG A;  2PI8 A; 
#chains in the Genus database with same CATH topology
 1R27 A;  4KOD A;  4AAY A;  4FER A;  1E5V A;  3IR7 A;  5GM9 A;  2VPW A;  3X2G A;  2VPY A;  1KQG A;  4FG4 A;  2JIP A;  2R7Z A;  1TWF A;  3GTQ A;  1YNN D;  4L48 A;  3X2P A;  4FFT A;  3X2N A;  1FDO A;  1E32 A;  1PT1 A;  4JP7 A;  1OA9 A;  2ENG A;  4AVR A;  2E2H A;  3HKZ A;  4NOH A;  2YU9 A;  1G8J A;  2KQA A;  1WCM A;  5GLF A;  2A6E D;  4KLN A;  3X2K A;  3X2I A;  4ZM7 A;  4DMR A;  4C2M A;  1K83 A;  1G8K A;  4JJO A;  1PYU B;  5GLX A;  2R92 A;  3X2J A;  1TWA A;  2BE5 D;  1PYQ A;  4FG2 A;  2NYA A;  2PI8 A;  3D30 A;  3GTO A;  1H5N A;  2NVY A;  1FDI A;  2JIQ A;  3SUM A;  1Q16 A;  1AA6 A;  4KDI A;  2WB1 A;  1SIW A;  1TWG A;  3QQ8 A;  2PJJ A;  1S3S A;  2YUJ A;  4CRY G;  1Y1V A;  3HU1 A;  3CQZ A;  4JCW A;  1R9T A;  1R7R A;  3GTP A;  3H0G A;  1QCS A;  2G5D A;  3GTL A;  2EEO B;  5FTL A;  4QIW A;  3IR5 A;  1CZ4 A;  1WLF A;  2BH0 A;  3CF2 A;  5GLY A;  5T5I D;  5FTN A;  5H4U A;  5DYI A;  4D7Z B;  1KQF A;  4AOK B;  1QDN A;  2PMZ A;  1EU1 A;  1YLE A;  3SUJ A;  1PQH A;  3IR6 A;  3SUL A;  1ZC1 A;  1PQE A;  3SUK A;  2VPX A;  2GAE A;  1I3Q A;  3X2L A;  2G6G A;  3X2O A;  5B6C A;  2JIR A;  1DMS A;  1Y1W A;  2JA6 A;  1OGY A;  3OUG A;  4AYB A;  1IW7 D;  2R93 A;  1CZ5 A;  3ML1 A;  3QC8 A;  1TMO A;  5FTJ A;  3GTK A;  2AE0 X;  3TM7 B;  3X2H A;  1N10 A;  2A6H D;  3CZB A;  3HU2 A;  3FKI A;  1BW4 A;  1WC2 A;  3DMR A;  4AON B;  2A68 D;  4AZD A;  3QWZ A;  1OA7 A;  2VUM A;  3GTM A;  1VC3 B;  4RV0 A;  1CR5 A;  2O5J D;  2JIO A;  3X2M A;  5C18 A;  2WAQ A;  1I50 A;  1H0H A;  2PJH B;  2NAP A;  2Y0S A;  4ENG A;  3O5A A;  1E60 A;  3GTG A;  2A69 D;  2VPZ A;  3HU3 A;  2V3V A;  3M3G A;  5EPP A;  1HD5 A;  1Y4Z A;  4CS0 A;  5FTK A;  2JIM A;  1SMY D;  1PPY A;  1YNJ D;  2IV2 X;  4JP6 A;  2JA7 A;  3TIW A;  2B63 A;  1PT0 A;  5C1B A;  1ZYR D;  1PQF A;  4KO8 A;  1UHD A;  2DMR A;  3GTJ A;  1Y5I A;  1BW3 A;  2CW0 D;  1L8F A;  2C45 A;  2PNW A;  1E61 A;  2NVX A;  1DMR A;  1UHE A;  2V45 A;  4JS7 A;  3PLX B;  2KI8 A;  2E7Z A;  5FTM A;  2E2I A;  1SFO A;  5T5M D;  5DYG A;  3ENG A;  1TWH A;  2HCZ X;  3QQ7 A;  1E18 A;  4KDL A;  1TWC A;  4GA6 A;  2JA5 A;  1AW8 B;  4CRZ A;  4GA5 A;  2PIC A; 
#chains in the Genus database with same CATH homology
 3D30 A;  3SUJ A;  4FER A;  3M3G A;  5GM9 A;  3SUL A;  3X2G A;  1HD5 A;  3SUM A;  4FG4 A;  3SUK A;  2GAE A;  4JP6 A;  3X2L A;  2G6G A;  2PIC A;  3X2O A;  2PJJ A;  4L48 A;  3X2P A;  4FFT A;  3X2N A;  4JCW A;  4JP7 A;  1BW3 A;  1OA9 A;  1L8F A;  2ENG A;  2PNW A;  4AVR A;  2AE0 X;  2G5D A;  3X2H A;  1N10 A;  3CZB A;  2KQA A;  4JS7 A;  1BW4 A;  5GLY A;  1WC2 A;  2BH0 A;  3X2K A;  3X2I A;  4ZM7 A;  5H4U A;  1OA7 A;  4JJO A;  3ENG A;  2HCZ X;  5GLX A;  3X2J A;  3X2M A;  4FG2 A;  4ENG A;  2PI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...