4JP6A

High resolution structure of a papaya barwin-like protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
ESASNVRATYHFYNAQQNGWDLRKVSAYCATWDADKPYSWRSKYGWTAFCGPVGPHGRAACGKCLRVTNTKTRAETTVRIVDQCSNGGLDLDWSVFKKLDTDGSGYLRGHLIVNYQFVNCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords papaya barwin-like protein
publication title High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulfur-SAD phasing.
pubmed doi rcsb
molecule tags Unknown function
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00967 Barwin Barwin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jp6A00
1L8FA 3SULA 3M3GA 1WC2A 1BW3A 2AE0X 4FFTA 5H4UA 2ENGA 2PJJA 4ENGA 3D30A 2PNWA 3CZBA 2BH0A 4FERA 5GM9A 3X2NA 3ENGA 1OA7A 4JP6A 3X2IA 3X2LA 3SUJA 2HCZX 4FG4A 4ZM7A 1HD5A 1N10A 3X2GA 3SUMA 4FG2A 3X2OA 4JCWA 2PICA 4JP7A 5GLYA 2GAEA 4AVRA 5GLXA 1BW4A 3X2MA 2G6GA 4L48A 2G5DA 2PI8A 4JS7A 4JJOA 3X2PA 3SUKA 3X2JA 2KQAA 1OA9A 3X2HA 3X2KA
chains in the Genus database with same CATH superfamily
1L8FA 1UHDA 3M3GA 2VPZA 1AW8B 2YU9A 2AE0X 1CR5A 3OUGA 4FFTA 4KLNA 1BW3A 1R27A 2VPXA 3H0GA 3QQ7A 4FERA 5T5MD 1G8JA 2JIQA 5C1BA 3IR7A 1R7RA 1KQFA 1N10A 1TWHA 2PJHB 2YUJA 3IR6A 1PPYA 5FTMA 2PICA 5GLYA 3HU3A 2GAEA 2R93A 1TWGA 1Y5IA 1AA6A 1CZ4A 1TMOA 1TWCA 3X2MA 2JA7A 3HU2A 2G5DA 4JS7A 4KO8A 3X2PA 2NAPA 3DMRA 2KQAA 2V3VA 1YLEA 1PYQA 3CF2A 3IR5A 4CS0A 2JIMA 3SULA 5H4UA 5T5ID 4CRZA 1EU1A 4ENGA 4KODA 4C2MA 1ZC1A 1E61A 1PYUB 1UHEA 1ZYRD 1SFOA 5B6CA 1S3SA 1WCMA 2WB1A 4AAYA 3GTPA 3ENGA 1OA7A 4GA6A 3TIWA 1PT0A 1Y1VA 4FG4A 3SUMA 3GTMA 2O5JD 4FG2A 1R9TA 4JCWA 4CRYG 4AOKB 4AZDA 2C45A 2NVXA 2NVYA 4AYBA 2BE5D 5DYIA 2E7ZA 2B63A 2G6GA 4L48A 3GTJA 3X2JA 1OA9A 5FTJA 4RV0A 5FTNA 3X2KA 5FTKA 3TM7B 1Y4ZA 1WC2A 1KQGA 3HU1A 3QQ8A 1PQHA 3GTQA 1E5VA 2KI8A 4D7ZB 1TWAA 2BH0A 3FKIA 5GM9A 3X2NA 2VPYA 5C18A 1TWFA 1K83A 1YNND 2CW0D 1DMRA 1PQFA 1E32A 4GA5A 3SUJA 4ZM7A 2JA5A 3PLXB 2NYAA 2PMZA 1H0HA 4AVRA 5DYGA 4DMRA 1I3QA 1Q16A 4JJOA 1G8KA 1DMSA 2DMRA 2R92A 2WAQA 2V45A 3X2OA 3GTOA 2JIPA 5EPPA 3GTGA 2VPWA 1OGYA 3ML1A 1PQEA 1PT1A 5FTLA 1SIWA 1VC3B 4KDIA 2A68D 2ENGA 2PJJA 2Y0SA 3D30A 2JA6A 2A6ED 2PNWA 3CZBA 2R7ZA 1FDIA 3O5AA 1FDOA 1WLFA 2E2HA 4JP6A 2IV2X 3X2IA 3X2LA 1Y1WA 2HCZX 1HD5A 3X2GA 4AONB 4QIWA 3QWZA 1E18A 2JIRA 3QC8A 4JP7A 2A6HD 1I50A 3GTLA 3GTKA 2VUMA 1YNJD 1E60A 2EEOB 2JIOA 3HKZA 1IW7D 5GLXA 1BW4A 4KDLA 1QCSA 2E2IA 2PI8A 1QDNA 4NOHA 3SUKA 1H5NA 2A69D 1SMYD 5GLFA 3X2HA 3CQZA 1CZ5A
chains in the Genus database with same CATH topology
1L8FA 3SULA 3M3GA 1WC2A 1BW3A 2AE0X 4FFTA 5H4UA 2ENGA 2PJJA 4ENGA 3D30A 2PNWA 3CZBA 2BH0A 4FERA 5GM9A 3X2NA 3ENGA 1OA7A 4JP6A 3X2IA 3X2LA 3SUJA 2HCZX 4FG4A 4ZM7A 1HD5A 1N10A 3X2GA 3SUMA 4FG2A 3X2OA 4JCWA 2PICA 4JP7A 5GLYA 2GAEA 4AVRA 5GLXA 1BW4A 3X2MA 2G6GA 4L48A 2G5DA 2PI8A 4JS7A 4JJOA 3X2PA 3SUKA 3X2JA 2KQAA 1OA9A 3X2HA 3X2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L8F A;  3SUL A;  3M3G A;  1WC2 A;  1BW3 A;  2AE0 X;  4FFT A;  5H4U A;  2ENG A;  2PJJ A;  4ENG A;  3D30 A;  2PNW A;  3CZB A;  2BH0 A;  4FER A;  5GM9 A;  3X2N A;  3ENG A;  1OA7 A;  4JP6 A;  3X2I A;  3X2L A;  3SUJ A;  2HCZ X;  4FG4 A;  4ZM7 A;  1HD5 A;  1N10 A;  3X2G A;  3SUM A;  4FG2 A;  3X2O A;  4JCW A;  2PIC A;  4JP7 A;  5GLY A;  2GAE A;  4AVR A;  5GLX A;  1BW4 A;  3X2M A;  2G6G A;  4L48 A;  2G5D A;  2PI8 A;  4JS7 A;  4JJO A;  3X2P A;  3SUK A;  3X2J A;  2KQA A;  1OA9 A;  3X2H A;  3X2K A; 
#chains in the Genus database with same CATH topology
 1L8F A;  1UHD A;  3M3G A;  2VPZ A;  1AW8 B;  2YU9 A;  2AE0 X;  1CR5 A;  3OUG A;  4FFT A;  4KLN A;  1BW3 A;  1R27 A;  2VPX A;  3H0G A;  3QQ7 A;  4FER A;  5T5M D;  1G8J A;  2JIQ A;  5C1B A;  3IR7 A;  1R7R A;  1KQF A;  1N10 A;  1TWH A;  2PJH B;  2YUJ A;  3IR6 A;  1PPY A;  5FTM A;  2PIC A;  5GLY A;  3HU3 A;  2GAE A;  2R93 A;  1TWG A;  1Y5I A;  1AA6 A;  1CZ4 A;  1TMO A;  1TWC A;  3X2M A;  2JA7 A;  3HU2 A;  2G5D A;  4JS7 A;  4KO8 A;  3X2P A;  2NAP A;  3DMR A;  2KQA A;  2V3V A;  1YLE A;  1PYQ A;  3CF2 A;  3IR5 A;  4CS0 A;  2JIM A;  3SUL A;  5H4U A;  5T5I D;  4CRZ A;  1EU1 A;  4ENG A;  4KOD A;  4C2M A;  1ZC1 A;  1E61 A;  1PYU B;  1UHE A;  1ZYR D;  1SFO A;  5B6C A;  1S3S A;  1WCM A;  2WB1 A;  4AAY A;  3GTP A;  3ENG A;  1OA7 A;  4GA6 A;  3TIW A;  1PT0 A;  1Y1V A;  4FG4 A;  3SUM A;  3GTM A;  2O5J D;  4FG2 A;  1R9T A;  4JCW A;  4CRY G;  4AOK B;  4AZD A;  2C45 A;  2NVX A;  2NVY A;  4AYB A;  2BE5 D;  5DYI A;  2E7Z A;  2B63 A;  2G6G A;  4L48 A;  3GTJ A;  3X2J A;  1OA9 A;  5FTJ A;  4RV0 A;  5FTN A;  3X2K A;  5FTK A;  3TM7 B;  1Y4Z A;  1WC2 A;  1KQG A;  3HU1 A;  3QQ8 A;  1PQH A;  3GTQ A;  1E5V A;  2KI8 A;  4D7Z B;  1TWA A;  2BH0 A;  3FKI A;  5GM9 A;  3X2N A;  2VPY A;  5C18 A;  1TWF A;  1K83 A;  1YNN D;  2CW0 D;  1DMR A;  1PQF A;  1E32 A;  4GA5 A;  3SUJ A;  4ZM7 A;  2JA5 A;  3PLX B;  2NYA A;  2PMZ A;  1H0H A;  4AVR A;  5DYG A;  4DMR A;  1I3Q A;  1Q16 A;  4JJO A;  1G8K A;  1DMS A;  2DMR A;  2R92 A;  2WAQ A;  2V45 A;  3X2O A;  3GTO A;  2JIP A;  5EPP A;  3GTG A;  2VPW A;  1OGY A;  3ML1 A;  1PQE A;  1PT1 A;  5FTL A;  1SIW A;  1VC3 B;  4KDI A;  2A68 D;  2ENG A;  2PJJ A;  2Y0S A;  3D30 A;  2JA6 A;  2A6E D;  2PNW A;  3CZB A;  2R7Z A;  1FDI A;  3O5A A;  1FDO A;  1WLF A;  2E2H A;  4JP6 A;  2IV2 X;  3X2I A;  3X2L A;  1Y1W A;  2HCZ X;  1HD5 A;  3X2G A;  4AON B;  4QIW A;  3QWZ A;  1E18 A;  2JIR A;  3QC8 A;  4JP7 A;  2A6H D;  1I50 A;  3GTL A;  3GTK A;  2VUM A;  1YNJ D;  1E60 A;  2EEO B;  2JIO A;  3HKZ A;  1IW7 D;  5GLX A;  1BW4 A;  4KDL A;  1QCS A;  2E2I A;  2PI8 A;  1QDN A;  4NOH A;  3SUK A;  1H5N A;  2A69 D;  1SMY D;  5GLF A;  3X2H A;  3CQZ A;  1CZ5 A; 
#chains in the Genus database with same CATH homology
 1L8F A;  3SUL A;  3M3G A;  1WC2 A;  1BW3 A;  2AE0 X;  4FFT A;  5H4U A;  2ENG A;  2PJJ A;  4ENG A;  3D30 A;  2PNW A;  3CZB A;  2BH0 A;  4FER A;  5GM9 A;  3X2N A;  3ENG A;  1OA7 A;  4JP6 A;  3X2I A;  3X2L A;  3SUJ A;  2HCZ X;  4FG4 A;  4ZM7 A;  1HD5 A;  1N10 A;  3X2G A;  3SUM A;  4FG2 A;  3X2O A;  4JCW A;  2PIC A;  4JP7 A;  5GLY A;  2GAE A;  4AVR A;  5GLX A;  1BW4 A;  3X2M A;  2G6G A;  4L48 A;  2G5D A;  2PI8 A;  4JS7 A;  4JJO A;  3X2P A;  3SUK A;  3X2J A;  2KQA A;  1OA9 A;  3X2H A;  3X2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...