4JP6A

High resolution structure of a papaya barwin-like protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
b'ESASNVRATYHFYNAQQNGWDLRKVSAYCATWDADKPYSWRSKYGWTAFCGPVGPHGRAACGKCLRVTNTKTRAETTVRIVDQCSNGGLDLDWSVFKKLDTDGSGYLRGHLIVNYQFVNCGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords papaya barwin-like protein
molecule tags Unknown function
publication title High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulfur-SAD phasing.
pubmed doi rcsb
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00967 Barwin Barwin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jp6A00
1L8FA 3X2LA 1OA7A 5GLYA 4FG4A 3CZBA 4FERA 4JS7A 3SULA 2PI8A 4JP7A 2G6GA 1N10A 1WC2A 1HD5A 1OA9A 2PICA 2BH0A 1BW4A 5GLXA 3X2JA 4FG2A 2PJJA 4ZM7A 3ENGA 2G5DA 3M3GA 2ENGA 3X2IA 4JCWA 2HCZX 5GM9A 3X2MA 2AE0X 3X2PA 3X2OA 3X2NA 4AVRA 4FFTA 4JP6A 2PNWA 2GAEA 3X2GA 4ENGA 3SUKA 5H4UA 3D30A 4JJOA 4L48A 3SUMA 1BW3A 3X2HA 2KQAA 3SUJA 3X2KA
chains in the Genus database with same CATH superfamily
1UHDA 4GA6A 1PQEA 2JIRA 1OA7A 1G8KA 2NVXA 4FG4A 1E61A 5FTJA 2PI8A 4JP7A 2B63A 1WC2A 3GTJA 2WB1A 1YNND 2NAPA 2A68D 1H0HA 2EEOB 5GLXA 4C2MA 4FG2A 5T5MD 1TMOA 3PLXB 3HKZA 1DMSA 3X2PA 3TIWA 2V3VA 2VPWA 5DYGA 4AVRA 4JP6A 2PNWA 2GAEA 3TM7B 2YUJA 3X2GA 1AA6A 2R93A 3ML1A 1I3QA 1TWFA 3D30A 4AZDA 1BW3A 3X2HA 2R92A 2A69D 1UHEA 1CZ4A 5DYIA 3X2LA 5GLYA 1Y5IA 4FERA 2Y0SA 3QC8A 4JS7A 3O5AA 5FTLA 3CQZA 1HD5A 1TWGA 5FTNA 1PQFA 1SMYD 3GTLA 1BW4A 1FDOA 5C1BA 3X2JA 2DMRA 1ZYRD 2PJJA 3HU1A 4ZM7A 3ENGA 2E2HA 1PQHA 5FTMA 3OUGA 2A6HD 1S3SA 1DMRA 2C45A 4JCWA 5GM9A 2AE0X 1R9TA 2V45A 4KODA 3X2NA 4FFTA 1E60A 3IR7A 1PT1A 1PYQA 5H4UA 1YNJD 2BE5D 2KQAA 2JA5A 5EPPA 3DMRA 4AOKB 2KI8A 1KQFA 1I50A 2VPXA 2G6GA 1Y4ZA 1E32A 1TWCA 1Y1VA 1OA9A 4QIWA 1CZ5A 2JA6A 1OGYA 2NYAA 1H5NA 1ZC1A 4KO8A 1EU1A 1E5VA 1KQGA 4NOHA 1K83A 2E2IA 2ENGA 2JIPA 3X2IA 4D7ZB 2NVYA 1FDIA 2HCZX 1TWHA 3X2MA 3X2OA 3QWZA 4AAYA 3CF2A 1VC3B 1WCMA 2PMZA 2JIOA 2A6ED 5T5ID 2WAQA 4AONB 2JIMA 1R27A 3HU3A 3FKIA 5FTKA 2VPZA 3SUKA 1E18A 1YLEA 1Y1WA 1PT0A 3SUJA 3X2KA 1L8FA 2CW0D 5B6CA 2VUMA 4AYBA 4CRYG 3GTGA 3SULA 3CZBA 4CS0A 2R7ZA 1WLFA 2YU9A 4KLNA 1N10A 3GTQA 1AW8B 2PICA 2BH0A 3GTKA 3IR6A 3GTOA 3GTPA 3HU2A 1IW7D 3QQ8A 3H0GA 1SIWA 1QCSA 4DMRA 4KDLA 2G5DA 3M3GA 3IR5A 1PPYA 4GA5A 1PYUB 4CRZA 1R7RA 1TWAA 1Q16A 2JIQA 3GTMA 1CR5A 2JA7A 2E7ZA 2PJHB 4ENGA 1QDNA 2IV2X 1SFOA 1G8JA 3QQ7A 4RV0A 5GLFA 5C18A 4JJOA 2VPYA 4L48A 3SUMA 2O5JD 4KDIA
chains in the Genus database with same CATH topology
1L8FA 3X2LA 1OA7A 5GLYA 4FG4A 3CZBA 4FERA 4JS7A 3SULA 2PI8A 4JP7A 2G6GA 1N10A 1WC2A 1HD5A 1OA9A 2PICA 2BH0A 1BW4A 5GLXA 3X2JA 4FG2A 2PJJA 4ZM7A 3ENGA 2G5DA 3M3GA 2ENGA 3X2IA 4JCWA 2HCZX 5GM9A 3X2MA 2AE0X 3X2PA 3X2OA 3X2NA 4AVRA 4FFTA 4JP6A 2PNWA 2GAEA 3X2GA 4ENGA 3SUKA 5H4UA 3D30A 4JJOA 4L48A 3SUMA 1BW3A 3X2HA 2KQAA 3SUJA 3X2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L8F A;  3X2L A;  1OA7 A;  5GLY A;  4FG4 A;  3CZB A;  4FER A;  4JS7 A;  3SUL A;  2PI8 A;  4JP7 A;  2G6G A;  1N10 A;  1WC2 A;  1HD5 A;  1OA9 A;  2PIC A;  2BH0 A;  1BW4 A;  5GLX A;  3X2J A;  4FG2 A;  2PJJ A;  4ZM7 A;  3ENG A;  2G5D A;  3M3G A;  2ENG A;  3X2I A;  4JCW A;  2HCZ X;  5GM9 A;  3X2M A;  2AE0 X;  3X2P A;  3X2O A;  3X2N A;  4AVR A;  4FFT A;  4JP6 A;  2PNW A;  2GAE A;  3X2G A;  4ENG A;  3SUK A;  5H4U A;  3D30 A;  4JJO A;  4L48 A;  3SUM A;  1BW3 A;  3X2H A;  2KQA A;  3SUJ A;  3X2K A; 
#chains in the Genus database with same CATH topology
 1UHD A;  4GA6 A;  1PQE A;  2JIR A;  1OA7 A;  1G8K A;  2NVX A;  4FG4 A;  1E61 A;  5FTJ A;  2PI8 A;  4JP7 A;  2B63 A;  1WC2 A;  3GTJ A;  2WB1 A;  1YNN D;  2NAP A;  2A68 D;  1H0H A;  2EEO B;  5GLX A;  4C2M A;  4FG2 A;  5T5M D;  1TMO A;  3PLX B;  3HKZ A;  1DMS A;  3X2P A;  3TIW A;  2V3V A;  2VPW A;  5DYG A;  4AVR A;  4JP6 A;  2PNW A;  2GAE A;  3TM7 B;  2YUJ A;  3X2G A;  1AA6 A;  2R93 A;  3ML1 A;  1I3Q A;  1TWF A;  3D30 A;  4AZD A;  1BW3 A;  3X2H A;  2R92 A;  2A69 D;  1UHE A;  1CZ4 A;  5DYI A;  3X2L A;  5GLY A;  1Y5I A;  4FER A;  2Y0S A;  3QC8 A;  4JS7 A;  3O5A A;  5FTL A;  3CQZ A;  1HD5 A;  1TWG A;  5FTN A;  1PQF A;  1SMY D;  3GTL A;  1BW4 A;  1FDO A;  5C1B A;  3X2J A;  2DMR A;  1ZYR D;  2PJJ A;  3HU1 A;  4ZM7 A;  3ENG A;  2E2H A;  1PQH A;  5FTM A;  3OUG A;  2A6H D;  1S3S A;  1DMR A;  2C45 A;  4JCW A;  5GM9 A;  2AE0 X;  1R9T A;  2V45 A;  4KOD A;  3X2N A;  4FFT A;  1E60 A;  3IR7 A;  1PT1 A;  1PYQ A;  5H4U A;  1YNJ D;  2BE5 D;  2KQA A;  2JA5 A;  5EPP A;  3DMR A;  4AOK B;  2KI8 A;  1KQF A;  1I50 A;  2VPX A;  2G6G A;  1Y4Z A;  1E32 A;  1TWC A;  1Y1V A;  1OA9 A;  4QIW A;  1CZ5 A;  2JA6 A;  1OGY A;  2NYA A;  1H5N A;  1ZC1 A;  4KO8 A;  1EU1 A;  1E5V A;  1KQG A;  4NOH A;  1K83 A;  2E2I A;  2ENG A;  2JIP A;  3X2I A;  4D7Z B;  2NVY A;  1FDI A;  2HCZ X;  1TWH A;  3X2M A;  3X2O A;  3QWZ A;  4AAY A;  3CF2 A;  1VC3 B;  1WCM A;  2PMZ A;  2JIO A;  2A6E D;  5T5I D;  2WAQ A;  4AON B;  2JIM A;  1R27 A;  3HU3 A;  3FKI A;  5FTK A;  2VPZ A;  3SUK A;  1E18 A;  1YLE A;  1Y1W A;  1PT0 A;  3SUJ A;  3X2K A;  1L8F A;  2CW0 D;  5B6C A;  2VUM A;  4AYB A;  4CRY G;  3GTG A;  3SUL A;  3CZB A;  4CS0 A;  2R7Z A;  1WLF A;  2YU9 A;  4KLN A;  1N10 A;  3GTQ A;  1AW8 B;  2PIC A;  2BH0 A;  3GTK A;  3IR6 A;  3GTO A;  3GTP A;  3HU2 A;  1IW7 D;  3QQ8 A;  3H0G A;  1SIW A;  1QCS A;  4DMR A;  4KDL A;  2G5D A;  3M3G A;  3IR5 A;  1PPY A;  4GA5 A;  1PYU B;  4CRZ A;  1R7R A;  1TWA A;  1Q16 A;  2JIQ A;  3GTM A;  1CR5 A;  2JA7 A;  2E7Z A;  2PJH B;  4ENG A;  1QDN A;  2IV2 X;  1SFO A;  1G8J A;  3QQ7 A;  4RV0 A;  5GLF A;  5C18 A;  4JJO A;  2VPY A;  4L48 A;  3SUM A;  2O5J D;  4KDI A; 
#chains in the Genus database with same CATH homology
 1L8F A;  3X2L A;  1OA7 A;  5GLY A;  4FG4 A;  3CZB A;  4FER A;  4JS7 A;  3SUL A;  2PI8 A;  4JP7 A;  2G6G A;  1N10 A;  1WC2 A;  1HD5 A;  1OA9 A;  2PIC A;  2BH0 A;  1BW4 A;  5GLX A;  3X2J A;  4FG2 A;  2PJJ A;  4ZM7 A;  3ENG A;  2G5D A;  3M3G A;  2ENG A;  3X2I A;  4JCW A;  2HCZ X;  5GM9 A;  3X2M A;  2AE0 X;  3X2P A;  3X2O A;  3X2N A;  4AVR A;  4FFT A;  4JP6 A;  2PNW A;  2GAE A;  3X2G A;  4ENG A;  3SUK A;  5H4U A;  3D30 A;  4JJO A;  4L48 A;  3SUM A;  1BW3 A;  3X2H A;  2KQA A;  3SUJ A;  3X2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...