4JP6A

High resolution structure of a papaya barwin-like protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
ESASNVRATYHFYNAQQNGWDLRKVSAYCATWDADKPYSWRSKYGWTAFCGPVGPHGRAACGKCLRVTNTKTRAETTVRIVDQCSNGGLDLDWSVFKKLDTDGSGYLRGHLIVNYQFVNCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulfur-SAD phasing.
pubmed doi rcsb
molecule tags Unknown function
molecule keywords papaya barwin-like protein
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00967 Barwin Barwin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jp6A00
1HD5A 1OA9A 3SULA 2AE0X 2PJJA 2PICA 4L48A 2BH0A 2PI8A 5GLXA 5H4UA 2PNWA 4FFTA 3X2MA 3X2GA 4JJOA 4JP7A 3X2IA 4JS7A 1WC2A 3SUMA 3ENGA 4FG2A 3X2KA 4FG4A 4ZM7A 3SUJA 5GM9A 4FERA 2KQAA 3CZBA 3X2JA 2G6GA 2G5DA 3M3GA 3SUKA 3X2NA 3D30A 1BW4A 1OA7A 4JCWA 3X2HA 4AVRA 1N10A 1BW3A 4JP6A 3X2PA 2GAEA 3X2OA 5GLYA 2HCZX 4ENGA 3X2LA 1L8FA 2ENGA
chains in the Genus database with same CATH superfamily
1HD5A 3IR7A 4KLNA 1CZ4A 2VPWA 2B63A 1PQEA 1PT1A 1R7RA 3ML1A 1H5NA 4L48A 2O5JD 5GLXA 2BE5D 4FFTA 1G8JA 2R92A 3IR6A 3GTOA 2JA5A 2VUMA 5EPPA 3X2IA 4DMRA 4AOKB 1TWAA 2A68D 3HKZA 1DMRA 2KQAA 1PYUB 4NOHA 1WLFA 1QDNA 3OUGA 1AW8B 2VPZA 1SMYD 2JA6A 2JIMA 2NAPA 4QIWA 1N10A 3GTMA 3X2PA 2YUJA 3HU1A 1L8FA 2NVYA 2IV2X 3HU3A 4KO8A 2JIQA 1CZ5A 5FTNA 1YNND 2C45A 1DMSA 2EEOB 4KDIA 1UHEA 3HU2A 3GTGA 1TWGA 2BH0A 2E2HA 1S3SA 1E60A 3X2MA 4AYBA 5GLFA 4JJOA 3X2GA 1PQHA 2NVXA 1UHDA 5FTKA 4CRYG 1WC2A 1ZC1A 1OGYA 4FG2A 1AA6A 3X2JA 1G8KA 5FTJA 3X2NA 1Y1VA 2PMZA 3D30A 2A6ED 3TM7B 3CF2A 4AVRA 2Y0SA 4JP6A 2JIPA 2PJHB 5DYIA 4D7ZB 2DMRA 2V3VA 5GLYA 1ZYRD 2HCZX 2ENGA 2E2IA 4GA5A 1E61A 1OA9A 2V45A 3SULA 3O5AA 4KDLA 3GTLA 2PJJA 1Y5IA 1PPYA 2PI8A 2PNWA 3GTQA 4AONB 4JP7A 1CR5A 5T5ID 3TIWA 1E18A 1EU1A 2A6HD 2JIOA 3IR5A 4JS7A 5DYGA 5T5MD 4ZM7A 3ENGA 1FDIA 1PQFA 4FG4A 3X2LA 1TWFA 2VPXA 3PLXB 4KODA 3SUJA 5GM9A 3GTPA 1YLEA 4FERA 1H0HA 5FTLA 2G6GA 2G5DA 3M3GA 3SUKA 4CS0A 1Y1WA 1TMOA 1SIWA 2WB1A 1BW4A 1E32A 4JCWA 3QQ8A 2R7ZA 2NYAA 2GAEA 3X2OA 1E5VA 4ENGA 1KQFA 3GTKA 1QCSA 1SFOA 1Q16A 1Y4ZA 1K83A 2WAQA 4RV0A 2YU9A 4GA6A 2AE0X 2PICA 1PYQA 5H4UA 1TWCA 2A69D 3DMRA 1TWHA 3QWZA 3GTJA 2R93A 1R27A 3FKIA 3SUMA 3H0GA 3X2KA 5B6CA 1I50A 4CRZA 1I3QA 3CZBA 4AZDA 4C2MA 1IW7D 2JA7A 2E7ZA 3QC8A 1OA7A 3CQZA 3X2HA 1FDOA 1R9TA 5C18A 1BW3A 1WCMA 1YNJD 5FTMA 2KI8A 1VC3B 5C1BA 3QQ7A 2VPYA 4AAYA 2CW0D 1PT0A 1KQGA 2JIRA
chains in the Genus database with same CATH topology
1HD5A 1OA9A 3SULA 2AE0X 2PJJA 2PICA 4L48A 2BH0A 2PI8A 5GLXA 5H4UA 2PNWA 4FFTA 3X2MA 3X2GA 4JJOA 4JP7A 3X2IA 4JS7A 1WC2A 3SUMA 3ENGA 4FG2A 3X2KA 4FG4A 4ZM7A 3SUJA 5GM9A 4FERA 2KQAA 3CZBA 3X2JA 2G6GA 2G5DA 3M3GA 3SUKA 3X2NA 3D30A 1BW4A 1OA7A 4JCWA 3X2HA 4AVRA 1N10A 1BW3A 4JP6A 3X2PA 2GAEA 3X2OA 5GLYA 2HCZX 4ENGA 3X2LA 1L8FA 2ENGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD5 A;  1OA9 A;  3SUL A;  2AE0 X;  2PJJ A;  2PIC A;  4L48 A;  2BH0 A;  2PI8 A;  5GLX A;  5H4U A;  2PNW A;  4FFT A;  3X2M A;  3X2G A;  4JJO A;  4JP7 A;  3X2I A;  4JS7 A;  1WC2 A;  3SUM A;  3ENG A;  4FG2 A;  3X2K A;  4FG4 A;  4ZM7 A;  3SUJ A;  5GM9 A;  4FER A;  2KQA A;  3CZB A;  3X2J A;  2G6G A;  2G5D A;  3M3G A;  3SUK A;  3X2N A;  3D30 A;  1BW4 A;  1OA7 A;  4JCW A;  3X2H A;  4AVR A;  1N10 A;  1BW3 A;  4JP6 A;  3X2P A;  2GAE A;  3X2O A;  5GLY A;  2HCZ X;  4ENG A;  3X2L A;  1L8F A;  2ENG A; 
#chains in the Genus database with same CATH topology
 1HD5 A;  3IR7 A;  4KLN A;  1CZ4 A;  2VPW A;  2B63 A;  1PQE A;  1PT1 A;  1R7R A;  3ML1 A;  1H5N A;  4L48 A;  2O5J D;  5GLX A;  2BE5 D;  4FFT A;  1G8J A;  2R92 A;  3IR6 A;  3GTO A;  2JA5 A;  2VUM A;  5EPP A;  3X2I A;  4DMR A;  4AOK B;  1TWA A;  2A68 D;  3HKZ A;  1DMR A;  2KQA A;  1PYU B;  4NOH A;  1WLF A;  1QDN A;  3OUG A;  1AW8 B;  2VPZ A;  1SMY D;  2JA6 A;  2JIM A;  2NAP A;  4QIW A;  1N10 A;  3GTM A;  3X2P A;  2YUJ A;  3HU1 A;  1L8F A;  2NVY A;  2IV2 X;  3HU3 A;  4KO8 A;  2JIQ A;  1CZ5 A;  5FTN A;  1YNN D;  2C45 A;  1DMS A;  2EEO B;  4KDI A;  1UHE A;  3HU2 A;  3GTG A;  1TWG A;  2BH0 A;  2E2H A;  1S3S A;  1E60 A;  3X2M A;  4AYB A;  5GLF A;  4JJO A;  3X2G A;  1PQH A;  2NVX A;  1UHD A;  5FTK A;  4CRY G;  1WC2 A;  1ZC1 A;  1OGY A;  4FG2 A;  1AA6 A;  3X2J A;  1G8K A;  5FTJ A;  3X2N A;  1Y1V A;  2PMZ A;  3D30 A;  2A6E D;  3TM7 B;  3CF2 A;  4AVR A;  2Y0S A;  4JP6 A;  2JIP A;  2PJH B;  5DYI A;  4D7Z B;  2DMR A;  2V3V A;  5GLY A;  1ZYR D;  2HCZ X;  2ENG A;  2E2I A;  4GA5 A;  1E61 A;  1OA9 A;  2V45 A;  3SUL A;  3O5A A;  4KDL A;  3GTL A;  2PJJ A;  1Y5I A;  1PPY A;  2PI8 A;  2PNW A;  3GTQ A;  4AON B;  4JP7 A;  1CR5 A;  5T5I D;  3TIW A;  1E18 A;  1EU1 A;  2A6H D;  2JIO A;  3IR5 A;  4JS7 A;  5DYG A;  5T5M D;  4ZM7 A;  3ENG A;  1FDI A;  1PQF A;  4FG4 A;  3X2L A;  1TWF A;  2VPX A;  3PLX B;  4KOD A;  3SUJ A;  5GM9 A;  3GTP A;  1YLE A;  4FER A;  1H0H A;  5FTL A;  2G6G A;  2G5D A;  3M3G A;  3SUK A;  4CS0 A;  1Y1W A;  1TMO A;  1SIW A;  2WB1 A;  1BW4 A;  1E32 A;  4JCW A;  3QQ8 A;  2R7Z A;  2NYA A;  2GAE A;  3X2O A;  1E5V A;  4ENG A;  1KQF A;  3GTK A;  1QCS A;  1SFO A;  1Q16 A;  1Y4Z A;  1K83 A;  2WAQ A;  4RV0 A;  2YU9 A;  4GA6 A;  2AE0 X;  2PIC A;  1PYQ A;  5H4U A;  1TWC A;  2A69 D;  3DMR A;  1TWH A;  3QWZ A;  3GTJ A;  2R93 A;  1R27 A;  3FKI A;  3SUM A;  3H0G A;  3X2K A;  5B6C A;  1I50 A;  4CRZ A;  1I3Q A;  3CZB A;  4AZD A;  4C2M A;  1IW7 D;  2JA7 A;  2E7Z A;  3QC8 A;  1OA7 A;  3CQZ A;  3X2H A;  1FDO A;  1R9T A;  5C18 A;  1BW3 A;  1WCM A;  1YNJ D;  5FTM A;  2KI8 A;  1VC3 B;  5C1B A;  3QQ7 A;  2VPY A;  4AAY A;  2CW0 D;  1PT0 A;  1KQG A;  2JIR A; 
#chains in the Genus database with same CATH homology
 1HD5 A;  1OA9 A;  3SUL A;  2AE0 X;  2PJJ A;  2PIC A;  4L48 A;  2BH0 A;  2PI8 A;  5GLX A;  5H4U A;  2PNW A;  4FFT A;  3X2M A;  3X2G A;  4JJO A;  4JP7 A;  3X2I A;  4JS7 A;  1WC2 A;  3SUM A;  3ENG A;  4FG2 A;  3X2K A;  4FG4 A;  4ZM7 A;  3SUJ A;  5GM9 A;  4FER A;  2KQA A;  3CZB A;  3X2J A;  2G6G A;  2G5D A;  3M3G A;  3SUK A;  3X2N A;  3D30 A;  1BW4 A;  1OA7 A;  4JCW A;  3X2H A;  4AVR A;  1N10 A;  1BW3 A;  4JP6 A;  3X2P A;  2GAE A;  3X2O A;  5GLY A;  2HCZ X;  4ENG A;  3X2L A;  1L8F A;  2ENG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...