4JP7A

High resolution structure of a papaya barwin-like protein (crystal form 2)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
b'ESASNVRATYHFYNAQQNGWDLRKVSAYCATWDADKPYSWRSKYGWTAFCGPVGPHGRAACGKCLRVTNTKTRAETTVRIVDQCSNGGLDLDWSVFKKLDTDGSGYLRGHLIVNYQFVNCGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords papaya barwin-like protein
publication title High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulfur-SAD phasing.
pubmed doi rcsb
molecule tags Unknown function
total genus 42
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00967 Barwin Barwin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jp7A00
3X2HA 3X2GA 2HCZX 1BW4A 2PICA 4JP7A 2PJJA 3SUMA 5GM9A 3X2OA 4JS7A 4FG4A 4JCWA 4ENGA 3D30A 4L48A 2BH0A 3SUKA 2G6GA 3CZBA 3ENGA 5GLXA 3X2PA 1L8FA 2ENGA 1OA7A 3M3GA 3SULA 5GLYA 1N10A 3X2KA 2GAEA 1HD5A 4FFTA 3X2LA 2KQAA 4JJOA 2AE0X 5H4UA 3X2MA 4AVRA 2PI8A 3SUJA 2G5DA 1OA9A 3X2NA 1WC2A 4FG2A 4JP6A 3X2IA 4FERA 1BW3A 2PNWA 3X2JA 4ZM7A
chains in the Genus database with same CATH superfamily
3GTOA 2BE5D 3X2GA 1BW4A 2PICA 1I50A 4AYBA 1CZ4A 5C18A 5GM9A 1UHEA 3FKIA 4FG4A 4ENGA 1PT0A 2KI8A 1KQFA 2CW0D 1IW7D 3DMRA 2WAQA 2JIMA 1PQFA 3TM7B 4GA5A 1YLEA 3CQZA 1Y5IA 3ML1A 3GTJA 2E2IA 2KQAA 5H4UA 2VPWA 3QQ8A 3X2MA 3GTLA 3GTPA 2PI8A 3GTQA 1OA9A 3X2NA 1VC3B 1G8KA 1E18A 2A6HD 3X2IA 2NVXA 4FERA 5T5ID 1L8FA 1E60A 5T5MD 2JA7A 1TWAA 1PPYA 1Q16A 1K83A 2HCZX 3GTKA 2V3VA 2PJJA 3HU1A 1PQHA 1I3QA 2PMZA 2YU9A 3QQ7A 2JA5A 4D7ZB 1FDOA 1TWFA 4AAYA 3QC8A 3CZBA 1R27A 5GLXA 3X2PA 4DMRA 2JIQA 2B63A 1OA7A 3M3GA 2JA6A 3QWZA 1YNND 1DMSA 2VPZA 2NVYA 1Y1VA 4AOKB 4CS0A 2E2HA 1PQEA 1HD5A 1R7RA 2VPYA 4AONB 2R7ZA 1Y1WA 1WCMA 4JJOA 5FTJA 2O5JD 1AW8B 1E32A 3IR5A 2G5DA 2JIRA 1ZYRD 1WC2A 2PJHB 3HU3A 2PNWA 3GTGA 2VUMA 3X2HA 3H0GA 4GA6A 1DMRA 2R92A 4JP7A 3SUMA 4NOHA 2R93A 1EU1A 3X2OA 4JS7A 1ZC1A 3D30A 2G6GA 3ENGA 2A69D 2VPXA 5EPPA 4KDIA 3IR7A 3SULA 1AA6A 1QDNA 1TMOA 3CF2A 1N10A 1UHDA 1YNJD 3X2KA 2V45A 3X2LA 2AE0X 1KQGA 2WB1A 4QIWA 4KODA 1FDIA 2JIPA 2DMRA 1R9TA 1WLFA 5GLFA 4FG2A 4RV0A 1TWHA 4CRYG 3TIWA 1H5NA 5DYIA 3PLXB 3X2JA 1G8JA 2JIOA 4AZDA 5B6CA 3IR6A 1TWCA 1TWGA 5DYGA 1OGYA 5FTNA 1SFOA 4CRZA 3OUGA 2Y0SA 4KDLA 4JCWA 4L48A 1H0HA 1QCSA 2BH0A 3SUKA 5FTMA 2ENGA 5FTKA 4KLNA 1CZ5A 3HU2A 4KO8A 1PYUB 1SIWA 2EEOB 1Y4ZA 1PT1A 5GLYA 1SMYD 3O5AA 4C2MA 5FTLA 2GAEA 2A6ED 4FFTA 1E5VA 1S3SA 2NAPA 2IV2X 1E61A 1PYQA 4AVRA 2A68D 1CR5A 2NYAA 3SUJA 2YUJA 3GTMA 2C45A 2E7ZA 4JP6A 5C1BA 1BW3A 3HKZA 4ZM7A
chains in the Genus database with same CATH topology
3X2HA 3X2GA 2HCZX 1BW4A 2PICA 4JP7A 2PJJA 3SUMA 5GM9A 3X2OA 4JS7A 4FG4A 4JCWA 4ENGA 3D30A 4L48A 2BH0A 3SUKA 2G6GA 3CZBA 3ENGA 5GLXA 3X2PA 1L8FA 2ENGA 1OA7A 3M3GA 3SULA 5GLYA 1N10A 3X2KA 2GAEA 1HD5A 4FFTA 3X2LA 2KQAA 4JJOA 2AE0X 5H4UA 3X2MA 4AVRA 2PI8A 3SUJA 2G5DA 1OA9A 3X2NA 1WC2A 4FG2A 4JP6A 3X2IA 4FERA 1BW3A 2PNWA 3X2JA 4ZM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2H A;  3X2G A;  2HCZ X;  1BW4 A;  2PIC A;  4JP7 A;  2PJJ A;  3SUM A;  5GM9 A;  3X2O A;  4JS7 A;  4FG4 A;  4JCW A;  4ENG A;  3D30 A;  4L48 A;  2BH0 A;  3SUK A;  2G6G A;  3CZB A;  3ENG A;  5GLX A;  3X2P A;  1L8F A;  2ENG A;  1OA7 A;  3M3G A;  3SUL A;  5GLY A;  1N10 A;  3X2K A;  2GAE A;  1HD5 A;  4FFT A;  3X2L A;  2KQA A;  4JJO A;  2AE0 X;  5H4U A;  3X2M A;  4AVR A;  2PI8 A;  3SUJ A;  2G5D A;  1OA9 A;  3X2N A;  1WC2 A;  4FG2 A;  4JP6 A;  3X2I A;  4FER A;  1BW3 A;  2PNW A;  3X2J A;  4ZM7 A; 
#chains in the Genus database with same CATH topology
 3GTO A;  2BE5 D;  3X2G A;  1BW4 A;  2PIC A;  1I50 A;  4AYB A;  1CZ4 A;  5C18 A;  5GM9 A;  1UHE A;  3FKI A;  4FG4 A;  4ENG A;  1PT0 A;  2KI8 A;  1KQF A;  2CW0 D;  1IW7 D;  3DMR A;  2WAQ A;  2JIM A;  1PQF A;  3TM7 B;  4GA5 A;  1YLE A;  3CQZ A;  1Y5I A;  3ML1 A;  3GTJ A;  2E2I A;  2KQA A;  5H4U A;  2VPW A;  3QQ8 A;  3X2M A;  3GTL A;  3GTP A;  2PI8 A;  3GTQ A;  1OA9 A;  3X2N A;  1VC3 B;  1G8K A;  1E18 A;  2A6H D;  3X2I A;  2NVX A;  4FER A;  5T5I D;  1L8F A;  1E60 A;  5T5M D;  2JA7 A;  1TWA A;  1PPY A;  1Q16 A;  1K83 A;  2HCZ X;  3GTK A;  2V3V A;  2PJJ A;  3HU1 A;  1PQH A;  1I3Q A;  2PMZ A;  2YU9 A;  3QQ7 A;  2JA5 A;  4D7Z B;  1FDO A;  1TWF A;  4AAY A;  3QC8 A;  3CZB A;  1R27 A;  5GLX A;  3X2P A;  4DMR A;  2JIQ A;  2B63 A;  1OA7 A;  3M3G A;  2JA6 A;  3QWZ A;  1YNN D;  1DMS A;  2VPZ A;  2NVY A;  1Y1V A;  4AOK B;  4CS0 A;  2E2H A;  1PQE A;  1HD5 A;  1R7R A;  2VPY A;  4AON B;  2R7Z A;  1Y1W A;  1WCM A;  4JJO A;  5FTJ A;  2O5J D;  1AW8 B;  1E32 A;  3IR5 A;  2G5D A;  2JIR A;  1ZYR D;  1WC2 A;  2PJH B;  3HU3 A;  2PNW A;  3GTG A;  2VUM A;  3X2H A;  3H0G A;  4GA6 A;  1DMR A;  2R92 A;  4JP7 A;  3SUM A;  4NOH A;  2R93 A;  1EU1 A;  3X2O A;  4JS7 A;  1ZC1 A;  3D30 A;  2G6G A;  3ENG A;  2A69 D;  2VPX A;  5EPP A;  4KDI A;  3IR7 A;  3SUL A;  1AA6 A;  1QDN A;  1TMO A;  3CF2 A;  1N10 A;  1UHD A;  1YNJ D;  3X2K A;  2V45 A;  3X2L A;  2AE0 X;  1KQG A;  2WB1 A;  4QIW A;  4KOD A;  1FDI A;  2JIP A;  2DMR A;  1R9T A;  1WLF A;  5GLF A;  4FG2 A;  4RV0 A;  1TWH A;  4CRY G;  3TIW A;  1H5N A;  5DYI A;  3PLX B;  3X2J A;  1G8J A;  2JIO A;  4AZD A;  5B6C A;  3IR6 A;  1TWC A;  1TWG A;  5DYG A;  1OGY A;  5FTN A;  1SFO A;  4CRZ A;  3OUG A;  2Y0S A;  4KDL A;  4JCW A;  4L48 A;  1H0H A;  1QCS A;  2BH0 A;  3SUK A;  5FTM A;  2ENG A;  5FTK A;  4KLN A;  1CZ5 A;  3HU2 A;  4KO8 A;  1PYU B;  1SIW A;  2EEO B;  1Y4Z A;  1PT1 A;  5GLY A;  1SMY D;  3O5A A;  4C2M A;  5FTL A;  2GAE A;  2A6E D;  4FFT A;  1E5V A;  1S3S A;  2NAP A;  2IV2 X;  1E61 A;  1PYQ A;  4AVR A;  2A68 D;  1CR5 A;  2NYA A;  3SUJ A;  2YUJ A;  3GTM A;  2C45 A;  2E7Z A;  4JP6 A;  5C1B A;  1BW3 A;  3HKZ A;  4ZM7 A; 
#chains in the Genus database with same CATH homology
 3X2H A;  3X2G A;  2HCZ X;  1BW4 A;  2PIC A;  4JP7 A;  2PJJ A;  3SUM A;  5GM9 A;  3X2O A;  4JS7 A;  4FG4 A;  4JCW A;  4ENG A;  3D30 A;  4L48 A;  2BH0 A;  3SUK A;  2G6G A;  3CZB A;  3ENG A;  5GLX A;  3X2P A;  1L8F A;  2ENG A;  1OA7 A;  3M3G A;  3SUL A;  5GLY A;  1N10 A;  3X2K A;  2GAE A;  1HD5 A;  4FFT A;  3X2L A;  2KQA A;  4JJO A;  2AE0 X;  5H4U A;  3X2M A;  4AVR A;  2PI8 A;  3SUJ A;  2G5D A;  1OA9 A;  3X2N A;  1WC2 A;  4FG2 A;  4JP6 A;  3X2I A;  4FER A;  1BW3 A;  2PNW A;  3X2J A;  4ZM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...