4JP7A

High resolution structure of a papaya barwin-like protein (crystal form 2)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
ESASNVRATYHFYNAQQNGWDLRKVSAYCATWDADKPYSWRSKYGWTAFCGPVGPHGRAACGKCLRVTNTKTRAETTVRIVDQCSNGGLDLDWSVFKKLDTDGSGYLRGHLIVNYQFVNCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulfur-SAD phasing.
pubmed doi rcsb
molecule tags Unknown function
molecule keywords papaya barwin-like protein
total genus 42
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00967 Barwin Barwin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jp7A00
3X2LA 3X2JA 4FFTA 4JJOA 3SUKA 1HD5A 3D30A 3CZBA 3X2OA 4JP7A 3X2HA 2ENGA 3X2PA 4AVRA 4JCWA 5GLYA 1BW3A 3X2MA 4JP6A 2PNWA 1OA9A 3SUMA 2G5DA 4FG4A 2G6GA 2PI8A 3X2IA 4JS7A 3ENGA 3M3GA 2KQAA 4L48A 3SUJA 3SULA 5GLXA 5H4UA 2GAEA 2HCZX 2PJJA 2AE0X 4ENGA 4FG2A 1N10A 3X2GA 4ZM7A 2PICA 4FERA 2BH0A 5GM9A 1OA7A 3X2KA 1BW4A 1WC2A 1L8FA 3X2NA
chains in the Genus database with same CATH superfamily
3X2LA 1G8JA 4FFTA 2VPXA 1TWHA 3FKIA 1K83A 2Y0SA 4AZDA 1E32A 4JP7A 3X2HA 2E7ZA 1Y1WA 1PQEA 4AVRA 1VC3B 2PJHB 2DMRA 1PT0A 1AW8B 1S3SA 2EEOB 2CW0D 5DYIA 1KQGA 4AYBA 1H0HA 4KO8A 4C2MA 1E18A 1YLEA 1PYUB 4CRZA 4DMRA 1SMYD 1KQFA 3SULA 1R27A 3QQ7A 5FTMA 1I3QA 5H4UA 2A6ED 2GAEA 4QIWA 3QQ8A 1Y4ZA 1PQHA 2VPZA 2R93A 3CF2A 1PYQA 2JIPA 2BH0A 5GM9A 3HU2A 3QWZA 1L8FA 1E60A 3X2NA 1YNJD 4KDIA 2YUJA 3X2JA 4JJOA 5C18A 3CQZA 3D30A 1R7RA 1DMSA 2C45A 3X2PA 2V45A 2JA6A 1TWCA 2JIRA 2A69D 2PMZA 2E2IA 1CR5A 2G5DA 5GLFA 1R9TA 2G6GA 5EPPA 1CZ4A 1SIWA 1Y1VA 2KI8A 5GLXA 2HCZX 3OUGA 5FTJA 1DMRA 2A68D 1ZC1A 1N10A 4FG2A 2JIQA 2V3VA 3X2GA 1I50A 1WLFA 3GTGA 1PQFA 4FERA 2VPYA 3X2KA 1OA7A 3GTJA 1SFOA 4AONB 3PLXB 5DYGA 5C1BA 3GTQA 2JIMA 3CZBA 3X2OA 4CS0A 3IR6A 3HU1A 2WAQA 2R92A 4JCWA 5GLYA 3X2MA 4D7ZB 1OGYA 1ZYRD 2PNWA 3HKZA 4GA5A 2IV2X 3GTLA 2VUMA 4FG4A 2PI8A 2VPWA 4JS7A 3GTPA 3DMRA 4L48A 2KQAA 3SUJA 3GTOA 2B63A 2AE0X 1TWAA 2PJJA 4KDLA 4ENGA 4KODA 2YU9A 3H0GA 1QCSA 3TIWA 1TWFA 3GTMA 1EU1A 1BW4A 1WC2A 1CZ5A 2NAPA 1Q16A 2A6HD 2BE5D 3IR5A 3SUKA 1HD5A 2JA7A 1IW7D 1E5VA 5FTKA 3TM7B 4AOKB 2ENGA 1TWGA 4CRYG 1TMOA 2WB1A 2E2HA 1YNND 2NVXA 4RV0A 5FTLA 1BW3A 1FDIA 1UHDA 3IR7A 4JP6A 2JA5A 1OA9A 4KLNA 3GTKA 3SUMA 5B6CA 2R7ZA 1E61A 1AA6A 5T5ID 3HU3A 3X2IA 2NYAA 3O5AA 2O5JD 1UHEA 5FTNA 1FDOA 5T5MD 3ENGA 3M3GA 1PT1A 1H5NA 3ML1A 1Y5IA 4GA6A 1G8KA 4ZM7A 1PPYA 3QC8A 4AAYA 1WCMA 2JIOA 2PICA 1QDNA 4NOHA 2NVYA
chains in the Genus database with same CATH topology
3X2LA 3X2JA 4FFTA 4JJOA 3SUKA 1HD5A 3D30A 3CZBA 3X2OA 4JP7A 3X2HA 2ENGA 3X2PA 4AVRA 4JCWA 5GLYA 1BW3A 3X2MA 4JP6A 2PNWA 1OA9A 3SUMA 2G5DA 4FG4A 2G6GA 2PI8A 3X2IA 4JS7A 3ENGA 3M3GA 2KQAA 4L48A 3SUJA 3SULA 5GLXA 5H4UA 2GAEA 2HCZX 2PJJA 2AE0X 4ENGA 4FG2A 1N10A 3X2GA 4ZM7A 2PICA 4FERA 2BH0A 5GM9A 1OA7A 3X2KA 1BW4A 1WC2A 1L8FA 3X2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2L A;  3X2J A;  4FFT A;  4JJO A;  3SUK A;  1HD5 A;  3D30 A;  3CZB A;  3X2O A;  4JP7 A;  3X2H A;  2ENG A;  3X2P A;  4AVR A;  4JCW A;  5GLY A;  1BW3 A;  3X2M A;  4JP6 A;  2PNW A;  1OA9 A;  3SUM A;  2G5D A;  4FG4 A;  2G6G A;  2PI8 A;  3X2I A;  4JS7 A;  3ENG A;  3M3G A;  2KQA A;  4L48 A;  3SUJ A;  3SUL A;  5GLX A;  5H4U A;  2GAE A;  2HCZ X;  2PJJ A;  2AE0 X;  4ENG A;  4FG2 A;  1N10 A;  3X2G A;  4ZM7 A;  2PIC A;  4FER A;  2BH0 A;  5GM9 A;  1OA7 A;  3X2K A;  1BW4 A;  1WC2 A;  1L8F A;  3X2N A; 
#chains in the Genus database with same CATH topology
 3X2L A;  1G8J A;  4FFT A;  2VPX A;  1TWH A;  3FKI A;  1K83 A;  2Y0S A;  4AZD A;  1E32 A;  4JP7 A;  3X2H A;  2E7Z A;  1Y1W A;  1PQE A;  4AVR A;  1VC3 B;  2PJH B;  2DMR A;  1PT0 A;  1AW8 B;  1S3S A;  2EEO B;  2CW0 D;  5DYI A;  1KQG A;  4AYB A;  1H0H A;  4KO8 A;  4C2M A;  1E18 A;  1YLE A;  1PYU B;  4CRZ A;  4DMR A;  1SMY D;  1KQF A;  3SUL A;  1R27 A;  3QQ7 A;  5FTM A;  1I3Q A;  5H4U A;  2A6E D;  2GAE A;  4QIW A;  3QQ8 A;  1Y4Z A;  1PQH A;  2VPZ A;  2R93 A;  3CF2 A;  1PYQ A;  2JIP A;  2BH0 A;  5GM9 A;  3HU2 A;  3QWZ A;  1L8F A;  1E60 A;  3X2N A;  1YNJ D;  4KDI A;  2YUJ A;  3X2J A;  4JJO A;  5C18 A;  3CQZ A;  3D30 A;  1R7R A;  1DMS A;  2C45 A;  3X2P A;  2V45 A;  2JA6 A;  1TWC A;  2JIR A;  2A69 D;  2PMZ A;  2E2I A;  1CR5 A;  2G5D A;  5GLF A;  1R9T A;  2G6G A;  5EPP A;  1CZ4 A;  1SIW A;  1Y1V A;  2KI8 A;  5GLX A;  2HCZ X;  3OUG A;  5FTJ A;  1DMR A;  2A68 D;  1ZC1 A;  1N10 A;  4FG2 A;  2JIQ A;  2V3V A;  3X2G A;  1I50 A;  1WLF A;  3GTG A;  1PQF A;  4FER A;  2VPY A;  3X2K A;  1OA7 A;  3GTJ A;  1SFO A;  4AON B;  3PLX B;  5DYG A;  5C1B A;  3GTQ A;  2JIM A;  3CZB A;  3X2O A;  4CS0 A;  3IR6 A;  3HU1 A;  2WAQ A;  2R92 A;  4JCW A;  5GLY A;  3X2M A;  4D7Z B;  1OGY A;  1ZYR D;  2PNW A;  3HKZ A;  4GA5 A;  2IV2 X;  3GTL A;  2VUM A;  4FG4 A;  2PI8 A;  2VPW A;  4JS7 A;  3GTP A;  3DMR A;  4L48 A;  2KQA A;  3SUJ A;  3GTO A;  2B63 A;  2AE0 X;  1TWA A;  2PJJ A;  4KDL A;  4ENG A;  4KOD A;  2YU9 A;  3H0G A;  1QCS A;  3TIW A;  1TWF A;  3GTM A;  1EU1 A;  1BW4 A;  1WC2 A;  1CZ5 A;  2NAP A;  1Q16 A;  2A6H D;  2BE5 D;  3IR5 A;  3SUK A;  1HD5 A;  2JA7 A;  1IW7 D;  1E5V A;  5FTK A;  3TM7 B;  4AOK B;  2ENG A;  1TWG A;  4CRY G;  1TMO A;  2WB1 A;  2E2H A;  1YNN D;  2NVX A;  4RV0 A;  5FTL A;  1BW3 A;  1FDI A;  1UHD A;  3IR7 A;  4JP6 A;  2JA5 A;  1OA9 A;  4KLN A;  3GTK A;  3SUM A;  5B6C A;  2R7Z A;  1E61 A;  1AA6 A;  5T5I D;  3HU3 A;  3X2I A;  2NYA A;  3O5A A;  2O5J D;  1UHE A;  5FTN A;  1FDO A;  5T5M D;  3ENG A;  3M3G A;  1PT1 A;  1H5N A;  3ML1 A;  1Y5I A;  4GA6 A;  1G8K A;  4ZM7 A;  1PPY A;  3QC8 A;  4AAY A;  1WCM A;  2JIO A;  2PIC A;  1QDN A;  4NOH A;  2NVY A; 
#chains in the Genus database with same CATH homology
 3X2L A;  3X2J A;  4FFT A;  4JJO A;  3SUK A;  1HD5 A;  3D30 A;  3CZB A;  3X2O A;  4JP7 A;  3X2H A;  2ENG A;  3X2P A;  4AVR A;  4JCW A;  5GLY A;  1BW3 A;  3X2M A;  4JP6 A;  2PNW A;  1OA9 A;  3SUM A;  2G5D A;  4FG4 A;  2G6G A;  2PI8 A;  3X2I A;  4JS7 A;  3ENG A;  3M3G A;  2KQA A;  4L48 A;  3SUJ A;  3SUL A;  5GLX A;  5H4U A;  2GAE A;  2HCZ X;  2PJJ A;  2AE0 X;  4ENG A;  4FG2 A;  1N10 A;  3X2G A;  4ZM7 A;  2PIC A;  4FER A;  2BH0 A;  5GM9 A;  1OA7 A;  3X2K A;  1BW4 A;  1WC2 A;  1L8F A;  3X2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...