4JP7A

High resolution structure of a papaya barwin-like protein (crystal form 2)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
ESASNVRATYHFYNAQQNGWDLRKVSAYCATWDADKPYSWRSKYGWTAFCGPVGPHGRAACGKCLRVTNTKTRAETTVRIVDQCSNGGLDLDWSVFKKLDTDGSGYLRGHLIVNYQFVNCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords papaya barwin-like protein
publication title High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulfur-SAD phasing.
pubmed doi rcsb
molecule tags Unknown function
total genus 42
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00967 Barwin Barwin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jp7A00
2PICA 3SULA 1L8FA 2PNWA 1HD5A 5GM9A 4FFTA 2PI8A 3ENGA 1OA9A 1BW3A 4L48A 3M3GA 4ZM7A 4JCWA 4JP7A 3SUKA 4JS7A 2PJJA 3CZBA 3D30A 5GLYA 2GAEA 5GLXA 3SUMA 3SUJA 3X2PA 4AVRA 1WC2A 4ENGA 2G5DA 3X2IA 1BW4A 1N10A 4FERA 3X2MA 3X2GA 2AE0X 2HCZX 4JJOA 1OA7A 3X2OA 4FG2A 2ENGA 2BH0A 3X2HA 3X2JA 3X2LA 3X2NA 4FG4A 3X2KA 5H4UA 2KQAA 4JP6A 2G6GA
chains in the Genus database with same CATH superfamily
1UHEA 2A68D 1R7RA 3GTMA 1G8KA 1CZ4A 3CQZA 1UHDA 4KLNA 3GTOA 1PT0A 5FTLA 1DMRA 1BW3A 3QC8A 2B63A 4RV0A 1PQEA 1R27A 4JS7A 1PQHA 2PJJA 3D30A 1H0HA 3CF2A 4AVRA 3TM7B 3SUJA 1K83A 1I50A 5FTJA 1I3QA 1EU1A 4AYBA 1CR5A 1DMSA 3GTPA 5DYGA 1E18A 2AE0X 3QWZA 2VUMA 2PMZA 3GTJA 1E5VA 1PPYA 5T5MD 2E7ZA 5GLFA 3GTKA 1AA6A 2A69D 3X2LA 3GTLA 2IV2X 1TWHA 1ZYRD 2JIQA 4GA6A 1FDOA 1TWGA 1G8JA 2PI8A 3ENGA 1OA9A 4KDLA 1TWFA 4CRZA 4ZM7A 1KQGA 4JP7A 3SUKA 2JIRA 2GAEA 3QQ7A 5C18A 3HU2A 2V45A 5FTNA 1OGYA 4FERA 4D7ZB 3X2MA 2WB1A 2CW0D 4KODA 3X2GA 1QDNA 2NVYA 2R92A 5EPPA 3PLXB 3DMRA 1E60A 1YNND 1FDIA 2VPXA 1PYQA 1KQFA 1R9TA 2E2HA 4FG4A 3X2KA 2PICA 3SULA 2VPYA 1L8FA 2R7ZA 1ZC1A 2JA7A 5FTMA 1IW7D 1AW8B 1S3SA 2YUJA 1YLEA 1SFOA 4FFTA 2PJHB 2DMRA 1TMOA 3GTGA 3M3GA 3IR5A 3IR7A 4JCWA 4AZDA 4C2MA 3HU1A 2O5JD 5DYIA 4CRYG 3CZBA 3HU3A 5T5ID 1WLFA 1QCSA 1Q16A 3X2PA 1H5NA 1WC2A 4ENGA 2E2IA 1Y1WA 3X2IA 1N10A 2NYAA 4CS0A 2C45A 2A6HD 3O5AA 5B6CA 4QIWA 2A6ED 3OUGA 3HKZA 4JJOA 2Y0SA 2YU9A 1OA7A 2V3VA 4DMRA 2ENGA 2BH0A 4AONB 1Y1VA 3X2JA 1PT1A 2KQAA 4JP6A 3X2HA 1TWCA 2EEOB 2PNWA 2VPWA 1HD5A 4GA5A 5GM9A 4KO8A 2JIPA 2NAPA 2KI8A 1TWAA 3H0GA 3QQ8A 4L48A 2JA6A 3IR6A 2JA5A 2VPZA 1E32A 5GLYA 5FTKA 1YNJD 3SUMA 4NOHA 5GLXA 1SMYD 2G5DA 1PYUB 1BW4A 2JIMA 5C1BA 2R93A 2JIOA 3TIWA 2HCZX 1CZ5A 1SIWA 1E61A 1Y5IA 3FKIA 3X2OA 4AOKB 1PQFA 2NVXA 4FG2A 2WAQA 3ML1A 4KDIA 4AAYA 1Y4ZA 2BE5D 5H4UA 1WCMA 3X2NA 3GTQA 1VC3B 2G6GA
chains in the Genus database with same CATH topology
2PICA 3SULA 1L8FA 2PNWA 1HD5A 5GM9A 4FFTA 2PI8A 3ENGA 1OA9A 1BW3A 4L48A 3M3GA 4ZM7A 4JCWA 4JP7A 3SUKA 4JS7A 2PJJA 3CZBA 3D30A 5GLYA 2GAEA 5GLXA 3SUMA 3SUJA 3X2PA 4AVRA 1WC2A 4ENGA 2G5DA 3X2IA 1BW4A 1N10A 4FERA 3X2MA 3X2GA 2AE0X 2HCZX 4JJOA 1OA7A 3X2OA 4FG2A 2ENGA 2BH0A 3X2HA 3X2JA 3X2LA 3X2NA 4FG4A 3X2KA 5H4UA 2KQAA 4JP6A 2G6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIC A;  3SUL A;  1L8F A;  2PNW A;  1HD5 A;  5GM9 A;  4FFT A;  2PI8 A;  3ENG A;  1OA9 A;  1BW3 A;  4L48 A;  3M3G A;  4ZM7 A;  4JCW A;  4JP7 A;  3SUK A;  4JS7 A;  2PJJ A;  3CZB A;  3D30 A;  5GLY A;  2GAE A;  5GLX A;  3SUM A;  3SUJ A;  3X2P A;  4AVR A;  1WC2 A;  4ENG A;  2G5D A;  3X2I A;  1BW4 A;  1N10 A;  4FER A;  3X2M A;  3X2G A;  2AE0 X;  2HCZ X;  4JJO A;  1OA7 A;  3X2O A;  4FG2 A;  2ENG A;  2BH0 A;  3X2H A;  3X2J A;  3X2L A;  3X2N A;  4FG4 A;  3X2K A;  5H4U A;  2KQA A;  4JP6 A;  2G6G A; 
#chains in the Genus database with same CATH topology
 1UHE A;  2A68 D;  1R7R A;  3GTM A;  1G8K A;  1CZ4 A;  3CQZ A;  1UHD A;  4KLN A;  3GTO A;  1PT0 A;  5FTL A;  1DMR A;  1BW3 A;  3QC8 A;  2B63 A;  4RV0 A;  1PQE A;  1R27 A;  4JS7 A;  1PQH A;  2PJJ A;  3D30 A;  1H0H A;  3CF2 A;  4AVR A;  3TM7 B;  3SUJ A;  1K83 A;  1I50 A;  5FTJ A;  1I3Q A;  1EU1 A;  4AYB A;  1CR5 A;  1DMS A;  3GTP A;  5DYG A;  1E18 A;  2AE0 X;  3QWZ A;  2VUM A;  2PMZ A;  3GTJ A;  1E5V A;  1PPY A;  5T5M D;  2E7Z A;  5GLF A;  3GTK A;  1AA6 A;  2A69 D;  3X2L A;  3GTL A;  2IV2 X;  1TWH A;  1ZYR D;  2JIQ A;  4GA6 A;  1FDO A;  1TWG A;  1G8J A;  2PI8 A;  3ENG A;  1OA9 A;  4KDL A;  1TWF A;  4CRZ A;  4ZM7 A;  1KQG A;  4JP7 A;  3SUK A;  2JIR A;  2GAE A;  3QQ7 A;  5C18 A;  3HU2 A;  2V45 A;  5FTN A;  1OGY A;  4FER A;  4D7Z B;  3X2M A;  2WB1 A;  2CW0 D;  4KOD A;  3X2G A;  1QDN A;  2NVY A;  2R92 A;  5EPP A;  3PLX B;  3DMR A;  1E60 A;  1YNN D;  1FDI A;  2VPX A;  1PYQ A;  1KQF A;  1R9T A;  2E2H A;  4FG4 A;  3X2K A;  2PIC A;  3SUL A;  2VPY A;  1L8F A;  2R7Z A;  1ZC1 A;  2JA7 A;  5FTM A;  1IW7 D;  1AW8 B;  1S3S A;  2YUJ A;  1YLE A;  1SFO A;  4FFT A;  2PJH B;  2DMR A;  1TMO A;  3GTG A;  3M3G A;  3IR5 A;  3IR7 A;  4JCW A;  4AZD A;  4C2M A;  3HU1 A;  2O5J D;  5DYI A;  4CRY G;  3CZB A;  3HU3 A;  5T5I D;  1WLF A;  1QCS A;  1Q16 A;  3X2P A;  1H5N A;  1WC2 A;  4ENG A;  2E2I A;  1Y1W A;  3X2I A;  1N10 A;  2NYA A;  4CS0 A;  2C45 A;  2A6H D;  3O5A A;  5B6C A;  4QIW A;  2A6E D;  3OUG A;  3HKZ A;  4JJO A;  2Y0S A;  2YU9 A;  1OA7 A;  2V3V A;  4DMR A;  2ENG A;  2BH0 A;  4AON B;  1Y1V A;  3X2J A;  1PT1 A;  2KQA A;  4JP6 A;  3X2H A;  1TWC A;  2EEO B;  2PNW A;  2VPW A;  1HD5 A;  4GA5 A;  5GM9 A;  4KO8 A;  2JIP A;  2NAP A;  2KI8 A;  1TWA A;  3H0G A;  3QQ8 A;  4L48 A;  2JA6 A;  3IR6 A;  2JA5 A;  2VPZ A;  1E32 A;  5GLY A;  5FTK A;  1YNJ D;  3SUM A;  4NOH A;  5GLX A;  1SMY D;  2G5D A;  1PYU B;  1BW4 A;  2JIM A;  5C1B A;  2R93 A;  2JIO A;  3TIW A;  2HCZ X;  1CZ5 A;  1SIW A;  1E61 A;  1Y5I A;  3FKI A;  3X2O A;  4AOK B;  1PQF A;  2NVX A;  4FG2 A;  2WAQ A;  3ML1 A;  4KDI A;  4AAY A;  1Y4Z A;  2BE5 D;  5H4U A;  1WCM A;  3X2N A;  3GTQ A;  1VC3 B;  2G6G A; 
#chains in the Genus database with same CATH homology
 2PIC A;  3SUL A;  1L8F A;  2PNW A;  1HD5 A;  5GM9 A;  4FFT A;  2PI8 A;  3ENG A;  1OA9 A;  1BW3 A;  4L48 A;  3M3G A;  4ZM7 A;  4JCW A;  4JP7 A;  3SUK A;  4JS7 A;  2PJJ A;  3CZB A;  3D30 A;  5GLY A;  2GAE A;  5GLX A;  3SUM A;  3SUJ A;  3X2P A;  4AVR A;  1WC2 A;  4ENG A;  2G5D A;  3X2I A;  1BW4 A;  1N10 A;  4FER A;  3X2M A;  3X2G A;  2AE0 X;  2HCZ X;  4JJO A;  1OA7 A;  3X2O A;  4FG2 A;  2ENG A;  2BH0 A;  3X2H A;  3X2J A;  3X2L A;  3X2N A;  4FG4 A;  3X2K A;  5H4U A;  2KQA A;  4JP6 A;  2G6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...