4JP7A

High resolution structure of a papaya barwin-like protein (crystal form 2)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
b'ESASNVRATYHFYNAQQNGWDLRKVSAYCATWDADKPYSWRSKYGWTAFCGPVGPHGRAACGKCLRVTNTKTRAETTVRIVDQCSNGGLDLDWSVFKKLDTDGSGYLRGHLIVNYQFVNCGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords papaya barwin-like protein
molecule tags Unknown function
publication title High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulfur-SAD phasing.
pubmed doi rcsb
total genus 42
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00967 Barwin Barwin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 4jp7A00
3X2IA 3X2KA 4ZM7A 2PICA 5GLYA 3X2NA 1N10A 3SUJA 4JP7A 1HD5A 1OA9A 4FERA 3SUMA 3SUKA 1BW4A 1L8FA 4FG2A 3CZBA 2ENGA 5GLXA 2BH0A 5H4UA 2GAEA 2PNWA 4L48A 3X2HA 4AVRA 3X2PA 2G6GA 4FFTA 1OA7A 3M3GA 3ENGA 5GM9A 3X2MA 2PJJA 1WC2A 4FG4A 4JJOA 4JS7A 3SULA 3X2LA 3X2JA 4JCWA 2PI8A 2HCZX 2G5DA 3X2GA 4ENGA 1BW3A 4JP6A 3X2OA 2KQAA 2AE0X 3D30A
chains in the Genus database with same CATH superfamily
1E5VA 3X2IA 4AZDA 1TWAA 3CQZA 1G8JA 5T5ID 4D7ZB 3GTGA 2YU9A 2CW0D 1PYQA 3OUGA 4JP7A 2JIMA 1WLFA 2E7ZA 2NVYA 1TMOA 5FTMA 3SUMA 1UHDA 2E2HA 1L8FA 3CZBA 4KODA 3QQ7A 3IR7A 4GA6A 1PQEA 2GAEA 3TIWA 5B6CA 4L48A 1OGYA 3X2HA 4KO8A 4AVRA 4AAYA 2VUMA 1SIWA 2NVXA 1Y4ZA 1CZ5A 4FG4A 4JS7A 1I3QA 3SULA 2O5JD 5C18A 2NYAA 1E18A 1Y5IA 4KLNA 2VPXA 1E32A 1R7RA 1R9TA 4AONB 4NOHA 1E60A 1DMSA 1PT1A 5GLYA 3X2NA 2R93A 2VPZA 1Q16A 3SUJA 4CRZA 4FERA 1BW4A 2A68D 3PLXB 1ZC1A 5FTKA 2A69D 3FKIA 2BH0A 1VC3B 3QQ8A 5H4UA 2JIPA 1K83A 5GLFA 3O5AA 3X2PA 1SMYD 1OA7A 3ENGA 1H0HA 2WAQA 5FTNA 1WC2A 1Y1VA 1H5NA 4DMRA 2JA7A 3DMRA 1FDIA 1TWCA 2PI8A 5FTJA 3IR5A 4ENGA 3HU2A 4AYBA 3X2OA 5FTLA 2JA5A 1TWHA 4AOKB 4ZM7A 1SFOA 3TM7B 3GTQA 2B63A 5DYGA 2C45A 1YLEA 2A6HD 1AA6A 2A6ED 1CZ4A 5DYIA 1PT0A 1N10A 2YUJA 5T5MD 3H0GA 3SUKA 2KI8A 2WB1A 2ENGA 2V45A 2BE5D 5GLXA 1FDOA 4CS0A 2PNWA 1Y1WA 2R92A 1R27A 2V3VA 1KQGA 2VPYA 3HKZA 2E2IA 5GM9A 3X2MA 1DMRA 2DMRA 2PJJA 2Y0SA 4JJOA 4KDIA 3X2LA 1S3SA 1E61A 1I50A 3IR6A 4QIWA 3GTMA 2IV2X 1AW8B 1TWGA 2HCZX 2G5DA 3X2GA 1BW3A 4JP6A 2JIRA 1UHEA 1EU1A 5EPPA 2AE0X 3GTKA 1CR5A 1WCMA 2VPWA 3X2KA 2JA6A 3HU1A 3ML1A 3GTJA 4KDLA 2PICA 1YNND 1PPYA 2NAPA 1PQHA 1ZYRD 4GA5A 1YNJD 1HD5A 1OA9A 3QWZA 4CRYG 4FG2A 5C1BA 1PYUB 3CF2A 3GTPA 3HU3A 1KQFA 1IW7D 1QDNA 2G6GA 4FFTA 3GTLA 3GTOA 3M3GA 2PMZA 2EEOB 3QC8A 3X2JA 2JIOA 4JCWA 4RV0A 2JIQA 2R7ZA 1G8KA 1QCSA 2KQAA 1TWFA 4C2MA 2PJHB 1PQFA 3D30A
chains in the Genus database with same CATH topology
3X2IA 3X2KA 4ZM7A 2PICA 5GLYA 3X2NA 1N10A 3SUJA 4JP7A 1HD5A 1OA9A 4FERA 3SUMA 3SUKA 1BW4A 1L8FA 4FG2A 3CZBA 2ENGA 5GLXA 2BH0A 5H4UA 2GAEA 2PNWA 4L48A 3X2HA 4AVRA 3X2PA 2G6GA 4FFTA 1OA7A 3M3GA 3ENGA 5GM9A 3X2MA 2PJJA 1WC2A 4FG4A 4JJOA 4JS7A 3SULA 3X2LA 3X2JA 4JCWA 2PI8A 2HCZX 2G5DA 3X2GA 4ENGA 1BW3A 4JP6A 3X2OA 2KQAA 2AE0X 3D30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2I A;  3X2K A;  4ZM7 A;  2PIC A;  5GLY A;  3X2N A;  1N10 A;  3SUJ A;  4JP7 A;  1HD5 A;  1OA9 A;  4FER A;  3SUM A;  3SUK A;  1BW4 A;  1L8F A;  4FG2 A;  3CZB A;  2ENG A;  5GLX A;  2BH0 A;  5H4U A;  2GAE A;  2PNW A;  4L48 A;  3X2H A;  4AVR A;  3X2P A;  2G6G A;  4FFT A;  1OA7 A;  3M3G A;  3ENG A;  5GM9 A;  3X2M A;  2PJJ A;  1WC2 A;  4FG4 A;  4JJO A;  4JS7 A;  3SUL A;  3X2L A;  3X2J A;  4JCW A;  2PI8 A;  2HCZ X;  2G5D A;  3X2G A;  4ENG A;  1BW3 A;  4JP6 A;  3X2O A;  2KQA A;  2AE0 X;  3D30 A; 
#chains in the Genus database with same CATH topology
 1E5V A;  3X2I A;  4AZD A;  1TWA A;  3CQZ A;  1G8J A;  5T5I D;  4D7Z B;  3GTG A;  2YU9 A;  2CW0 D;  1PYQ A;  3OUG A;  4JP7 A;  2JIM A;  1WLF A;  2E7Z A;  2NVY A;  1TMO A;  5FTM A;  3SUM A;  1UHD A;  2E2H A;  1L8F A;  3CZB A;  4KOD A;  3QQ7 A;  3IR7 A;  4GA6 A;  1PQE A;  2GAE A;  3TIW A;  5B6C A;  4L48 A;  1OGY A;  3X2H A;  4KO8 A;  4AVR A;  4AAY A;  2VUM A;  1SIW A;  2NVX A;  1Y4Z A;  1CZ5 A;  4FG4 A;  4JS7 A;  1I3Q A;  3SUL A;  2O5J D;  5C18 A;  2NYA A;  1E18 A;  1Y5I A;  4KLN A;  2VPX A;  1E32 A;  1R7R A;  1R9T A;  4AON B;  4NOH A;  1E60 A;  1DMS A;  1PT1 A;  5GLY A;  3X2N A;  2R93 A;  2VPZ A;  1Q16 A;  3SUJ A;  4CRZ A;  4FER A;  1BW4 A;  2A68 D;  3PLX B;  1ZC1 A;  5FTK A;  2A69 D;  3FKI A;  2BH0 A;  1VC3 B;  3QQ8 A;  5H4U A;  2JIP A;  1K83 A;  5GLF A;  3O5A A;  3X2P A;  1SMY D;  1OA7 A;  3ENG A;  1H0H A;  2WAQ A;  5FTN A;  1WC2 A;  1Y1V A;  1H5N A;  4DMR A;  2JA7 A;  3DMR A;  1FDI A;  1TWC A;  2PI8 A;  5FTJ A;  3IR5 A;  4ENG A;  3HU2 A;  4AYB A;  3X2O A;  5FTL A;  2JA5 A;  1TWH A;  4AOK B;  4ZM7 A;  1SFO A;  3TM7 B;  3GTQ A;  2B63 A;  5DYG A;  2C45 A;  1YLE A;  2A6H D;  1AA6 A;  2A6E D;  1CZ4 A;  5DYI A;  1PT0 A;  1N10 A;  2YUJ A;  5T5M D;  3H0G A;  3SUK A;  2KI8 A;  2WB1 A;  2ENG A;  2V45 A;  2BE5 D;  5GLX A;  1FDO A;  4CS0 A;  2PNW A;  1Y1W A;  2R92 A;  1R27 A;  2V3V A;  1KQG A;  2VPY A;  3HKZ A;  2E2I A;  5GM9 A;  3X2M A;  1DMR A;  2DMR A;  2PJJ A;  2Y0S A;  4JJO A;  4KDI A;  3X2L A;  1S3S A;  1E61 A;  1I50 A;  3IR6 A;  4QIW A;  3GTM A;  2IV2 X;  1AW8 B;  1TWG A;  2HCZ X;  2G5D A;  3X2G A;  1BW3 A;  4JP6 A;  2JIR A;  1UHE A;  1EU1 A;  5EPP A;  2AE0 X;  3GTK A;  1CR5 A;  1WCM A;  2VPW A;  3X2K A;  2JA6 A;  3HU1 A;  3ML1 A;  3GTJ A;  4KDL A;  2PIC A;  1YNN D;  1PPY A;  2NAP A;  1PQH A;  1ZYR D;  4GA5 A;  1YNJ D;  1HD5 A;  1OA9 A;  3QWZ A;  4CRY G;  4FG2 A;  5C1B A;  1PYU B;  3CF2 A;  3GTP A;  3HU3 A;  1KQF A;  1IW7 D;  1QDN A;  2G6G A;  4FFT A;  3GTL A;  3GTO A;  3M3G A;  2PMZ A;  2EEO B;  3QC8 A;  3X2J A;  2JIO A;  4JCW A;  4RV0 A;  2JIQ A;  2R7Z A;  1G8K A;  1QCS A;  2KQA A;  1TWF A;  4C2M A;  2PJH B;  1PQF A;  3D30 A; 
#chains in the Genus database with same CATH homology
 3X2I A;  3X2K A;  4ZM7 A;  2PIC A;  5GLY A;  3X2N A;  1N10 A;  3SUJ A;  4JP7 A;  1HD5 A;  1OA9 A;  4FER A;  3SUM A;  3SUK A;  1BW4 A;  1L8F A;  4FG2 A;  3CZB A;  2ENG A;  5GLX A;  2BH0 A;  5H4U A;  2GAE A;  2PNW A;  4L48 A;  3X2H A;  4AVR A;  3X2P A;  2G6G A;  4FFT A;  1OA7 A;  3M3G A;  3ENG A;  5GM9 A;  3X2M A;  2PJJ A;  1WC2 A;  4FG4 A;  4JJO A;  4JS7 A;  3SUL A;  3X2L A;  3X2J A;  4JCW A;  2PI8 A;  2HCZ X;  2G5D A;  3X2G A;  4ENG A;  1BW3 A;  4JP6 A;  3X2O A;  2KQA A;  2AE0 X;  3D30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...