5GM9A

Crystal structure of a glycoside hydrolase in complex with cellobiose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 45 protein
total genus 69
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5gm9A00
2KQAA 4JCWA 4L48A 3X2PA 2GAEA 4JP7A 2PNWA 4JP6A 4JJOA 2PJJA 3M3GA 4FG4A 1L8FA 5H4UA 3X2JA 2HCZX 2BH0A 4FFTA 3X2LA 3D30A 1OA9A 3SULA 3X2IA 3ENGA 1N10A 5GM9A 4ENGA 4JS7A 1WC2A 4FERA 2G5DA 2PI8A 3SUJA 3X2GA 2G6GA 5GLYA 3SUKA 3X2KA 3X2MA 3X2NA 5GLXA 1BW3A 4AVRA 3SUMA 3X2OA 2AE0X 4ZM7A 1BW4A 1HD5A 3X2HA 4FG2A 2ENGA 2PICA 3CZBA 1OA7A
chains in the Genus database with same CATH superfamily
2O5JD 4L48A 2IV2X 2VPYA 2V3VA 4JJOA 1R9TA 3QQ7A 1L8FA 2PJHB 1S3SA 3GTGA 5FTKA 5H4UA 1G8JA 5T5ID 4FFTA 2JIRA 1TMOA 3D30A 1KQGA 1OA9A 2JIQA 3DMRA 1CZ5A 2JIOA 2E7ZA 3GTMA 2NAPA 2KI8A 1UHDA 2PI8A 3X2NA 4KODA 1DMSA 3ML1A 3SUMA 4AONB 2AE0X 4CRYG 4GA6A 2EEOB 4FG2A 2ENGA 4KDLA 3IR5A 3GTJA 1OA7A 3H0GA 3X2PA 3OUGA 1E18A 4KLNA 3IR6A 4JP6A 1PT0A 2JIMA 1I3QA 1PYQA 1Y1VA 2VPXA 3QQ8A 3HU2A 4AZDA 1SFOA 1EU1A 1CZ4A 5GLFA 1TWCA 1E60A 2PMZA 1KQFA 1YLEA 1E32A 1TWAA 4KDIA 4QIWA 2VPWA 1CR5A 3X2IA 3GTQA 1SIWA 3GTOA 2E2HA 4JS7A 1WC2A 3SUJA 3X2GA 3IR7A 3X2KA 2YU9A 1YNND 1BW3A 4AVRA 2E2IA 1Q16A 5DYIA 4ZM7A 2V45A 1Y4ZA 1HD5A 1AW8B 4AOKB 1Y5IA 4KO8A 2JA7A 3HKZA 4JP7A 2JA6A 4FG4A 1PQHA 3GTLA 2CW0D 1Y1WA 2JIPA 2Y0SA 2HCZX 2C45A 3CF2A 2DMRA 1UHEA 2R93A 2R92A 2BE5D 1WCMA 1R7RA 1PT1A 1YNJD 5C18A 1H0HA 1N10A 1SMYD 5GM9A 1PPYA 2A68D 4ENGA 4AAYA 4FERA 1IW7D 3X2MA 2G6GA 3QWZA 5GLYA 3SUKA 1ZYRD 3HU3A 1FDIA 1PQEA 4RV0A 5GLXA 4CRZA 2JA5A 4D7ZB 3QC8A 4AYBA 4C2MA 1BW4A 2VUMA 1AA6A 2A6ED 2PICA 3CZBA 5FTJA 3TIWA 1DMRA 2KQAA 4JCWA 5C1BA 2GAEA 1ZC1A 2VPZA 2A6HD 2PNWA 3O5AA 1G8KA 1PYUB 2PJJA 3M3GA 2B63A 2NVXA 3CQZA 5B6CA 2A69D 1PQFA 1TWGA 1R27A 3X2JA 2YUJA 2WB1A 5FTNA 5FTLA 2BH0A 2WAQA 4DMRA 1I50A 1TWHA 5FTMA 3X2LA 1QDNA 2NVYA 1E61A 1QCSA 3SULA 3ENGA 5DYGA 5EPPA 2R7ZA 3GTPA 5T5MD 3HU1A 1FDOA 3GTKA 1TWFA 2G5DA 1H5NA 4NOHA 3TM7B 1WLFA 1OGYA 1E5VA 3X2OA 1VC3B 2NYAA 4CS0A 1K83A 3FKIA 4GA5A 3X2HA 3PLXB
chains in the Genus database with same CATH topology
2KQAA 4JCWA 4L48A 3X2PA 2GAEA 4JP7A 2PNWA 4JP6A 4JJOA 2PJJA 3M3GA 4FG4A 1L8FA 5H4UA 3X2JA 2HCZX 2BH0A 4FFTA 3X2LA 3D30A 1OA9A 3SULA 3X2IA 3ENGA 1N10A 5GM9A 4ENGA 4JS7A 1WC2A 4FERA 2G5DA 2PI8A 3SUJA 3X2GA 2G6GA 5GLYA 3SUKA 3X2KA 3X2MA 3X2NA 5GLXA 1BW3A 4AVRA 3SUMA 3X2OA 2AE0X 4ZM7A 1BW4A 1HD5A 3X2HA 4FG2A 2ENGA 2PICA 3CZBA 1OA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQA A;  4JCW A;  4L48 A;  3X2P A;  2GAE A;  4JP7 A;  2PNW A;  4JP6 A;  4JJO A;  2PJJ A;  3M3G A;  4FG4 A;  1L8F A;  5H4U A;  3X2J A;  2HCZ X;  2BH0 A;  4FFT A;  3X2L A;  3D30 A;  1OA9 A;  3SUL A;  3X2I A;  3ENG A;  1N10 A;  5GM9 A;  4ENG A;  4JS7 A;  1WC2 A;  4FER A;  2G5D A;  2PI8 A;  3SUJ A;  3X2G A;  2G6G A;  5GLY A;  3SUK A;  3X2K A;  3X2M A;  3X2N A;  5GLX A;  1BW3 A;  4AVR A;  3SUM A;  3X2O A;  2AE0 X;  4ZM7 A;  1BW4 A;  1HD5 A;  3X2H A;  4FG2 A;  2ENG A;  2PIC A;  3CZB A;  1OA7 A; 
#chains in the Genus database with same CATH topology
 2O5J D;  4L48 A;  2IV2 X;  2VPY A;  2V3V A;  4JJO A;  1R9T A;  3QQ7 A;  1L8F A;  2PJH B;  1S3S A;  3GTG A;  5FTK A;  5H4U A;  1G8J A;  5T5I D;  4FFT A;  2JIR A;  1TMO A;  3D30 A;  1KQG A;  1OA9 A;  2JIQ A;  3DMR A;  1CZ5 A;  2JIO A;  2E7Z A;  3GTM A;  2NAP A;  2KI8 A;  1UHD A;  2PI8 A;  3X2N A;  4KOD A;  1DMS A;  3ML1 A;  3SUM A;  4AON B;  2AE0 X;  4CRY G;  4GA6 A;  2EEO B;  4FG2 A;  2ENG A;  4KDL A;  3IR5 A;  3GTJ A;  1OA7 A;  3H0G A;  3X2P A;  3OUG A;  1E18 A;  4KLN A;  3IR6 A;  4JP6 A;  1PT0 A;  2JIM A;  1I3Q A;  1PYQ A;  1Y1V A;  2VPX A;  3QQ8 A;  3HU2 A;  4AZD A;  1SFO A;  1EU1 A;  1CZ4 A;  5GLF A;  1TWC A;  1E60 A;  2PMZ A;  1KQF A;  1YLE A;  1E32 A;  1TWA A;  4KDI A;  4QIW A;  2VPW A;  1CR5 A;  3X2I A;  3GTQ A;  1SIW A;  3GTO A;  2E2H A;  4JS7 A;  1WC2 A;  3SUJ A;  3X2G A;  3IR7 A;  3X2K A;  2YU9 A;  1YNN D;  1BW3 A;  4AVR A;  2E2I A;  1Q16 A;  5DYI A;  4ZM7 A;  2V45 A;  1Y4Z A;  1HD5 A;  1AW8 B;  4AOK B;  1Y5I A;  4KO8 A;  2JA7 A;  3HKZ A;  4JP7 A;  2JA6 A;  4FG4 A;  1PQH A;  3GTL A;  2CW0 D;  1Y1W A;  2JIP A;  2Y0S A;  2HCZ X;  2C45 A;  3CF2 A;  2DMR A;  1UHE A;  2R93 A;  2R92 A;  2BE5 D;  1WCM A;  1R7R A;  1PT1 A;  1YNJ D;  5C18 A;  1H0H A;  1N10 A;  1SMY D;  5GM9 A;  1PPY A;  2A68 D;  4ENG A;  4AAY A;  4FER A;  1IW7 D;  3X2M A;  2G6G A;  3QWZ A;  5GLY A;  3SUK A;  1ZYR D;  3HU3 A;  1FDI A;  1PQE A;  4RV0 A;  5GLX A;  4CRZ A;  2JA5 A;  4D7Z B;  3QC8 A;  4AYB A;  4C2M A;  1BW4 A;  2VUM A;  1AA6 A;  2A6E D;  2PIC A;  3CZB A;  5FTJ A;  3TIW A;  1DMR A;  2KQA A;  4JCW A;  5C1B A;  2GAE A;  1ZC1 A;  2VPZ A;  2A6H D;  2PNW A;  3O5A A;  1G8K A;  1PYU B;  2PJJ A;  3M3G A;  2B63 A;  2NVX A;  3CQZ A;  5B6C A;  2A69 D;  1PQF A;  1TWG A;  1R27 A;  3X2J A;  2YUJ A;  2WB1 A;  5FTN A;  5FTL A;  2BH0 A;  2WAQ A;  4DMR A;  1I50 A;  1TWH A;  5FTM A;  3X2L A;  1QDN A;  2NVY A;  1E61 A;  1QCS A;  3SUL A;  3ENG A;  5DYG A;  5EPP A;  2R7Z A;  3GTP A;  5T5M D;  3HU1 A;  1FDO A;  3GTK A;  1TWF A;  2G5D A;  1H5N A;  4NOH A;  3TM7 B;  1WLF A;  1OGY A;  1E5V A;  3X2O A;  1VC3 B;  2NYA A;  4CS0 A;  1K83 A;  3FKI A;  4GA5 A;  3X2H A;  3PLX B; 
#chains in the Genus database with same CATH homology
 2KQA A;  4JCW A;  4L48 A;  3X2P A;  2GAE A;  4JP7 A;  2PNW A;  4JP6 A;  4JJO A;  2PJJ A;  3M3G A;  4FG4 A;  1L8F A;  5H4U A;  3X2J A;  2HCZ X;  2BH0 A;  4FFT A;  3X2L A;  3D30 A;  1OA9 A;  3SUL A;  3X2I A;  3ENG A;  1N10 A;  5GM9 A;  4ENG A;  4JS7 A;  1WC2 A;  4FER A;  2G5D A;  2PI8 A;  3SUJ A;  3X2G A;  2G6G A;  5GLY A;  3SUK A;  3X2K A;  3X2M A;  3X2N A;  5GLX A;  1BW3 A;  4AVR A;  3SUM A;  3X2O A;  2AE0 X;  4ZM7 A;  1BW4 A;  1HD5 A;  3X2H A;  4FG2 A;  2ENG A;  2PIC A;  3CZB A;  1OA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...