5GM9A

Crystal structure of a glycoside hydrolase in complex with cellobiose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 45 protein
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
molecule tags Hydrolase
total genus 69
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5gm9A00
2ENGA 1N10A 2HCZX 4FG2A 1OA7A 3X2KA 3X2OA 3SUMA 4L48A 4JP7A 3SUKA 3SUJA 3ENGA 4ENGA 2BH0A 5H4UA 4FFTA 3X2PA 3M3GA 1HD5A 3CZBA 2G6GA 1BW3A 4FG4A 2PI8A 4JCWA 4ZM7A 2PNWA 1L8FA 2PJJA 2PICA 4AVRA 2AE0X 3X2LA 5GLYA 5GM9A 3X2GA 3X2HA 5GLXA 3SULA 3X2NA 3X2JA 4JP6A 3X2IA 2GAEA 3D30A 4FERA 4JJOA 1BW4A 1OA9A 1WC2A 4JS7A 2KQAA 3X2MA 2G5DA
chains in the Genus database with same CATH superfamily
2IV2X 1E5VA 1AW8B 1DMRA 1PQEA 1OA7A 4FG2A 2YUJA 3X2OA 3GTMA 1Y5IA 4GA5A 4KDIA 2R93A 1KQGA 1CR5A 3ENGA 2BH0A 3GTGA 3PLXB 1TWAA 3X2PA 1TMOA 3M3GA 2V3VA 1AA6A 4KLNA 1BW3A 1PPYA 2PI8A 5FTMA 2PNWA 2C45A 4CRZA 2PICA 4AVRA 1Y1WA 1R7RA 2NYAA 1I3QA 2E7ZA 3SULA 1TWFA 3X2NA 1H5NA 1OGYA 2JIRA 1TWGA 1TWCA 5FTNA 4JP6A 3X2JA 2JA7A 1UHEA 2GAEA 3D30A 2JIOA 2PJHB 1WC2A 2VPXA 3DMRA 2KQAA 1QCSA 3IR7A 4CS0A 1CZ4A 1N10A 1PYQA 2V45A 3X2KA 3GTJA 3O5AA 4L48A 2EEOB 4JP7A 1YNJD 3HU3A 5B6CA 2JA6A 3TIWA 1KQFA 2R7ZA 5H4UA 1R27A 3CZBA 3FKIA 1WLFA 1E60A 5FTKA 2JA5A 2WB1A 4JCWA 4ZM7A 4D7ZB 3GTOA 3X2GA 3HU1A 2B63A 1TWHA 4KODA 5T5MD 1SIWA 2VPZA 1SMYD 2YU9A 4JJOA 1PQFA 3QC8A 4GA6A 3GTQA 1SFOA 1DMSA 2A69D 2A6ED 3HKZA 4JS7A 2Y0SA 4DMRA 4FG4A 4AYBA 2ENGA 2HCZX 2JIMA 2JIQA 2E2IA 3IR6A 2CW0D 2R92A 3OUGA 3SUMA 4NOHA 3SUKA 2PMZA 1G8KA 1E18A 3SUJA 4ENGA 1I50A 2NAPA 1Q16A 2NVYA 1HD5A 1FDIA 5DYIA 1G8JA 1PT0A 4C2MA 1PYUB 2PJJA 2AE0X 3X2LA 1QDNA 5GLYA 3X2HA 3TM7B 1R9TA 4AOKB 5GLXA 1PT1A 5EPPA 1E61A 1WCMA 5C18A 2VUMA 3QQ7A 2WAQA 4CRYG 3GTPA 2O5JD 3HU2A 3H0GA 4FERA 2VPYA 1S3SA 2A68D 3IR5A 3GTLA 1CZ5A 1ZC1A 1Y4ZA 3GTKA 2G5DA 4AZDA 5T5ID 1FDOA 5DYGA 1EU1A 1E32A 5C1BA 2DMRA 3ML1A 4AONB 4QIWA 4RV0A 4FFTA 1Y1VA 2G6GA 1IW7D 4KO8A 1PQHA 1H0HA 1L8FA 3QWZA 1K83A 1YNND 2JIPA 5GM9A 1UHDA 2E2HA 2KI8A 1YLEA 3CF2A 5FTLA 1VC3B 2VPWA 5FTJA 4KDLA 3X2IA 4AAYA 1BW4A 2NVXA 1OA9A 5GLFA 3CQZA 2BE5D 3QQ8A 2A6HD 3X2MA 1ZYRD
chains in the Genus database with same CATH topology
2ENGA 1N10A 2HCZX 4FG2A 1OA7A 3X2KA 3X2OA 3SUMA 4L48A 4JP7A 3SUKA 3SUJA 3ENGA 4ENGA 2BH0A 5H4UA 4FFTA 3X2PA 3M3GA 1HD5A 3CZBA 2G6GA 1BW3A 4FG4A 2PI8A 4JCWA 4ZM7A 2PNWA 1L8FA 2PJJA 2PICA 4AVRA 2AE0X 3X2LA 5GLYA 5GM9A 3X2GA 3X2HA 5GLXA 3SULA 3X2NA 3X2JA 4JP6A 3X2IA 2GAEA 3D30A 4FERA 4JJOA 1BW4A 1OA9A 1WC2A 4JS7A 2KQAA 3X2MA 2G5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENG A;  1N10 A;  2HCZ X;  4FG2 A;  1OA7 A;  3X2K A;  3X2O A;  3SUM A;  4L48 A;  4JP7 A;  3SUK A;  3SUJ A;  3ENG A;  4ENG A;  2BH0 A;  5H4U A;  4FFT A;  3X2P A;  3M3G A;  1HD5 A;  3CZB A;  2G6G A;  1BW3 A;  4FG4 A;  2PI8 A;  4JCW A;  4ZM7 A;  2PNW A;  1L8F A;  2PJJ A;  2PIC A;  4AVR A;  2AE0 X;  3X2L A;  5GLY A;  5GM9 A;  3X2G A;  3X2H A;  5GLX A;  3SUL A;  3X2N A;  3X2J A;  4JP6 A;  3X2I A;  2GAE A;  3D30 A;  4FER A;  4JJO A;  1BW4 A;  1OA9 A;  1WC2 A;  4JS7 A;  2KQA A;  3X2M A;  2G5D A; 
#chains in the Genus database with same CATH topology
 2IV2 X;  1E5V A;  1AW8 B;  1DMR A;  1PQE A;  1OA7 A;  4FG2 A;  2YUJ A;  3X2O A;  3GTM A;  1Y5I A;  4GA5 A;  4KDI A;  2R93 A;  1KQG A;  1CR5 A;  3ENG A;  2BH0 A;  3GTG A;  3PLX B;  1TWA A;  3X2P A;  1TMO A;  3M3G A;  2V3V A;  1AA6 A;  4KLN A;  1BW3 A;  1PPY A;  2PI8 A;  5FTM A;  2PNW A;  2C45 A;  4CRZ A;  2PIC A;  4AVR A;  1Y1W A;  1R7R A;  2NYA A;  1I3Q A;  2E7Z A;  3SUL A;  1TWF A;  3X2N A;  1H5N A;  1OGY A;  2JIR A;  1TWG A;  1TWC A;  5FTN A;  4JP6 A;  3X2J A;  2JA7 A;  1UHE A;  2GAE A;  3D30 A;  2JIO A;  2PJH B;  1WC2 A;  2VPX A;  3DMR A;  2KQA A;  1QCS A;  3IR7 A;  4CS0 A;  1CZ4 A;  1N10 A;  1PYQ A;  2V45 A;  3X2K A;  3GTJ A;  3O5A A;  4L48 A;  2EEO B;  4JP7 A;  1YNJ D;  3HU3 A;  5B6C A;  2JA6 A;  3TIW A;  1KQF A;  2R7Z A;  5H4U A;  1R27 A;  3CZB A;  3FKI A;  1WLF A;  1E60 A;  5FTK A;  2JA5 A;  2WB1 A;  4JCW A;  4ZM7 A;  4D7Z B;  3GTO A;  3X2G A;  3HU1 A;  2B63 A;  1TWH A;  4KOD A;  5T5M D;  1SIW A;  2VPZ A;  1SMY D;  2YU9 A;  4JJO A;  1PQF A;  3QC8 A;  4GA6 A;  3GTQ A;  1SFO A;  1DMS A;  2A69 D;  2A6E D;  3HKZ A;  4JS7 A;  2Y0S A;  4DMR A;  4FG4 A;  4AYB A;  2ENG A;  2HCZ X;  2JIM A;  2JIQ A;  2E2I A;  3IR6 A;  2CW0 D;  2R92 A;  3OUG A;  3SUM A;  4NOH A;  3SUK A;  2PMZ A;  1G8K A;  1E18 A;  3SUJ A;  4ENG A;  1I50 A;  2NAP A;  1Q16 A;  2NVY A;  1HD5 A;  1FDI A;  5DYI A;  1G8J A;  1PT0 A;  4C2M A;  1PYU B;  2PJJ A;  2AE0 X;  3X2L A;  1QDN A;  5GLY A;  3X2H A;  3TM7 B;  1R9T A;  4AOK B;  5GLX A;  1PT1 A;  5EPP A;  1E61 A;  1WCM A;  5C18 A;  2VUM A;  3QQ7 A;  2WAQ A;  4CRY G;  3GTP A;  2O5J D;  3HU2 A;  3H0G A;  4FER A;  2VPY A;  1S3S A;  2A68 D;  3IR5 A;  3GTL A;  1CZ5 A;  1ZC1 A;  1Y4Z A;  3GTK A;  2G5D A;  4AZD A;  5T5I D;  1FDO A;  5DYG A;  1EU1 A;  1E32 A;  5C1B A;  2DMR A;  3ML1 A;  4AON B;  4QIW A;  4RV0 A;  4FFT A;  1Y1V A;  2G6G A;  1IW7 D;  4KO8 A;  1PQH A;  1H0H A;  1L8F A;  3QWZ A;  1K83 A;  1YNN D;  2JIP A;  5GM9 A;  1UHD A;  2E2H A;  2KI8 A;  1YLE A;  3CF2 A;  5FTL A;  1VC3 B;  2VPW A;  5FTJ A;  4KDL A;  3X2I A;  4AAY A;  1BW4 A;  2NVX A;  1OA9 A;  5GLF A;  3CQZ A;  2BE5 D;  3QQ8 A;  2A6H D;  3X2M A;  1ZYR D; 
#chains in the Genus database with same CATH homology
 2ENG A;  1N10 A;  2HCZ X;  4FG2 A;  1OA7 A;  3X2K A;  3X2O A;  3SUM A;  4L48 A;  4JP7 A;  3SUK A;  3SUJ A;  3ENG A;  4ENG A;  2BH0 A;  5H4U A;  4FFT A;  3X2P A;  3M3G A;  1HD5 A;  3CZB A;  2G6G A;  1BW3 A;  4FG4 A;  2PI8 A;  4JCW A;  4ZM7 A;  2PNW A;  1L8F A;  2PJJ A;  2PIC A;  4AVR A;  2AE0 X;  3X2L A;  5GLY A;  5GM9 A;  3X2G A;  3X2H A;  5GLX A;  3SUL A;  3X2N A;  3X2J A;  4JP6 A;  3X2I A;  2GAE A;  3D30 A;  4FER A;  4JJO A;  1BW4 A;  1OA9 A;  1WC2 A;  4JS7 A;  2KQA A;  3X2M A;  2G5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...