5GM9A

Crystal structure of a glycoside hydrolase in complex with cellobiose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 45 protein
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
molecule tags Hydrolase
total genus 69
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5gm9A00
2PI8A 4FFTA 5GM9A 5GLYA 1L8FA 3D30A 2PJJA 4JJOA 3X2OA 3M3GA 5GLXA 4AVRA 4FG2A 3SUKA 4ZM7A 2G5DA 1BW3A 3CZBA 2ENGA 4ENGA 3X2JA 4L48A 2GAEA 1OA9A 1HD5A 2AE0X 3SUMA 3X2MA 2PNWA 5H4UA 1BW4A 2HCZX 3X2LA 1WC2A 4FG4A 2G6GA 3SULA 3X2KA 4JP6A 3X2IA 3X2NA 3X2PA 2KQAA 2PICA 3ENGA 4JCWA 4JS7A 4JP7A 3X2GA 4FERA 3X2HA 2BH0A 1OA7A 1N10A 3SUJA
chains in the Genus database with same CATH superfamily
2VPWA 1ZYRD 1IW7D 5GM9A 5GLYA 1WCMA 1TWAA 2PJJA 1SFOA 4CS0A 1E32A 4KDLA 4AVRA 2R92A 2A6ED 4ZM7A 1TWFA 5T5MD 2IV2X 3X2JA 3DMRA 4L48A 2WAQA 1DMRA 2AE0X 4AZDA 2VPXA 2A69D 5C18A 1PQFA 1K83A 2EEOB 1R9TA 3X2LA 3GTOA 1PT1A 1I3QA 1S3SA 1Q16A 1PYQA 2PJHB 1R7RA 3X2PA 2JA6A 5FTLA 5T5ID 4JS7A 3IR5A 2BH0A 5GLFA 1N10A 2E2IA 2V45A 1TMOA 2VPYA 4FFTA 3GTKA 3QWZA 3OUGA 5FTMA 4KODA 2NVYA 3X2OA 1AA6A 4QIWA 1QDNA 2JIRA 1PQEA 1E60A 3CZBA 2A6HD 2JIQA 3HU2A 4AYBA 5EPPA 2ENGA 4ENGA 1CZ4A 1Y4ZA 1SMYD 3H0GA 3X2MA 1UHDA 2DMRA 1G8JA 5H4UA 2BE5D 5FTNA 3GTLA 4C2MA 1TWGA 3HKZA 3GTQA 2VUMA 1QCSA 2NAPA 4GA5A 5FTJA 1Y1WA 4RV0A 1Y5IA 2JA5A 3TIWA 2JIMA 1I50A 1H5NA 1PT0A 1FDOA 1AW8B 2KI8A 1TWHA 4KDIA 1PYUB 2JIPA 2JIOA 2PI8A 3SUJA 4D7ZB 4JJOA 2NYAA 4CRYG 1OGYA 4FG2A 1KQFA 1YLEA 1PQHA 1Y1VA 3SUKA 1BW3A 4AAYA 5DYIA 2NVXA 1G8KA 2GAEA 1OA9A 1HD5A 3CF2A 4NOHA 5FTKA 2PNWA 1FDIA 1VC3B 1PPYA 2E7ZA 3PLXB 3QC8A 3SUMA 2R93A 1YNND 3IR7A 4DMRA 3FKIA 1BW4A 3HU1A 2YUJA 1WLFA 2A68D 4FG4A 2G6GA 1ZC1A 3SULA 2Y0SA 4JP6A 3X2IA 2VPZA 2KQAA 2JA7A 2PICA 1R27A 2C45A 3O5AA 2PMZA 3IR6A 4JCWA 4JP7A 3X2GA 3GTPA 4FERA 3X2HA 2WB1A 1OA7A 3HU3A 1CR5A 3QQ8A 5C1BA 2YU9A 1L8FA 1UHEA 3D30A 3GTJA 3M3GA 3CQZA 5GLXA 4AOKB 1DMSA 4AONB 2G5DA 3GTMA 1TWCA 2E2HA 1E18A 3ML1A 2V3VA 5B6CA 2R7ZA 2B63A 4KO8A 2HCZX 1E5VA 2CW0D 3QQ7A 2O5JD 3TM7B 1CZ5A 1YNJD 1WC2A 1E61A 3X2KA 1EU1A 4KLNA 4CRZA 4GA6A 1KQGA 3X2NA 3ENGA 3GTGA 5DYGA 1SIWA 1H0HA
chains in the Genus database with same CATH topology
2PI8A 4FFTA 5GM9A 5GLYA 1L8FA 3D30A 2PJJA 4JJOA 3X2OA 3M3GA 5GLXA 4AVRA 4FG2A 3SUKA 4ZM7A 2G5DA 1BW3A 3CZBA 2ENGA 4ENGA 3X2JA 4L48A 2GAEA 1OA9A 1HD5A 2AE0X 3SUMA 3X2MA 2PNWA 5H4UA 1BW4A 2HCZX 3X2LA 1WC2A 4FG4A 2G6GA 3SULA 3X2KA 4JP6A 3X2IA 3X2NA 3X2PA 2KQAA 2PICA 3ENGA 4JCWA 4JS7A 4JP7A 3X2GA 4FERA 3X2HA 2BH0A 1OA7A 1N10A 3SUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI8 A;  4FFT A;  5GM9 A;  5GLY A;  1L8F A;  3D30 A;  2PJJ A;  4JJO A;  3X2O A;  3M3G A;  5GLX A;  4AVR A;  4FG2 A;  3SUK A;  4ZM7 A;  2G5D A;  1BW3 A;  3CZB A;  2ENG A;  4ENG A;  3X2J A;  4L48 A;  2GAE A;  1OA9 A;  1HD5 A;  2AE0 X;  3SUM A;  3X2M A;  2PNW A;  5H4U A;  1BW4 A;  2HCZ X;  3X2L A;  1WC2 A;  4FG4 A;  2G6G A;  3SUL A;  3X2K A;  4JP6 A;  3X2I A;  3X2N A;  3X2P A;  2KQA A;  2PIC A;  3ENG A;  4JCW A;  4JS7 A;  4JP7 A;  3X2G A;  4FER A;  3X2H A;  2BH0 A;  1OA7 A;  1N10 A;  3SUJ A; 
#chains in the Genus database with same CATH topology
 2VPW A;  1ZYR D;  1IW7 D;  5GM9 A;  5GLY A;  1WCM A;  1TWA A;  2PJJ A;  1SFO A;  4CS0 A;  1E32 A;  4KDL A;  4AVR A;  2R92 A;  2A6E D;  4ZM7 A;  1TWF A;  5T5M D;  2IV2 X;  3X2J A;  3DMR A;  4L48 A;  2WAQ A;  1DMR A;  2AE0 X;  4AZD A;  2VPX A;  2A69 D;  5C18 A;  1PQF A;  1K83 A;  2EEO B;  1R9T A;  3X2L A;  3GTO A;  1PT1 A;  1I3Q A;  1S3S A;  1Q16 A;  1PYQ A;  2PJH B;  1R7R A;  3X2P A;  2JA6 A;  5FTL A;  5T5I D;  4JS7 A;  3IR5 A;  2BH0 A;  5GLF A;  1N10 A;  2E2I A;  2V45 A;  1TMO A;  2VPY A;  4FFT A;  3GTK A;  3QWZ A;  3OUG A;  5FTM A;  4KOD A;  2NVY A;  3X2O A;  1AA6 A;  4QIW A;  1QDN A;  2JIR A;  1PQE A;  1E60 A;  3CZB A;  2A6H D;  2JIQ A;  3HU2 A;  4AYB A;  5EPP A;  2ENG A;  4ENG A;  1CZ4 A;  1Y4Z A;  1SMY D;  3H0G A;  3X2M A;  1UHD A;  2DMR A;  1G8J A;  5H4U A;  2BE5 D;  5FTN A;  3GTL A;  4C2M A;  1TWG A;  3HKZ A;  3GTQ A;  2VUM A;  1QCS A;  2NAP A;  4GA5 A;  5FTJ A;  1Y1W A;  4RV0 A;  1Y5I A;  2JA5 A;  3TIW A;  2JIM A;  1I50 A;  1H5N A;  1PT0 A;  1FDO A;  1AW8 B;  2KI8 A;  1TWH A;  4KDI A;  1PYU B;  2JIP A;  2JIO A;  2PI8 A;  3SUJ A;  4D7Z B;  4JJO A;  2NYA A;  4CRY G;  1OGY A;  4FG2 A;  1KQF A;  1YLE A;  1PQH A;  1Y1V A;  3SUK A;  1BW3 A;  4AAY A;  5DYI A;  2NVX A;  1G8K A;  2GAE A;  1OA9 A;  1HD5 A;  3CF2 A;  4NOH A;  5FTK A;  2PNW A;  1FDI A;  1VC3 B;  1PPY A;  2E7Z A;  3PLX B;  3QC8 A;  3SUM A;  2R93 A;  1YNN D;  3IR7 A;  4DMR A;  3FKI A;  1BW4 A;  3HU1 A;  2YUJ A;  1WLF A;  2A68 D;  4FG4 A;  2G6G A;  1ZC1 A;  3SUL A;  2Y0S A;  4JP6 A;  3X2I A;  2VPZ A;  2KQA A;  2JA7 A;  2PIC A;  1R27 A;  2C45 A;  3O5A A;  2PMZ A;  3IR6 A;  4JCW A;  4JP7 A;  3X2G A;  3GTP A;  4FER A;  3X2H A;  2WB1 A;  1OA7 A;  3HU3 A;  1CR5 A;  3QQ8 A;  5C1B A;  2YU9 A;  1L8F A;  1UHE A;  3D30 A;  3GTJ A;  3M3G A;  3CQZ A;  5GLX A;  4AOK B;  1DMS A;  4AON B;  2G5D A;  3GTM A;  1TWC A;  2E2H A;  1E18 A;  3ML1 A;  2V3V A;  5B6C A;  2R7Z A;  2B63 A;  4KO8 A;  2HCZ X;  1E5V A;  2CW0 D;  3QQ7 A;  2O5J D;  3TM7 B;  1CZ5 A;  1YNJ D;  1WC2 A;  1E61 A;  3X2K A;  1EU1 A;  4KLN A;  4CRZ A;  4GA6 A;  1KQG A;  3X2N A;  3ENG A;  3GTG A;  5DYG A;  1SIW A;  1H0H A; 
#chains in the Genus database with same CATH homology
 2PI8 A;  4FFT A;  5GM9 A;  5GLY A;  1L8F A;  3D30 A;  2PJJ A;  4JJO A;  3X2O A;  3M3G A;  5GLX A;  4AVR A;  4FG2 A;  3SUK A;  4ZM7 A;  2G5D A;  1BW3 A;  3CZB A;  2ENG A;  4ENG A;  3X2J A;  4L48 A;  2GAE A;  1OA9 A;  1HD5 A;  2AE0 X;  3SUM A;  3X2M A;  2PNW A;  5H4U A;  1BW4 A;  2HCZ X;  3X2L A;  1WC2 A;  4FG4 A;  2G6G A;  3SUL A;  3X2K A;  4JP6 A;  3X2I A;  3X2N A;  3X2P A;  2KQA A;  2PIC A;  3ENG A;  4JCW A;  4JS7 A;  4JP7 A;  3X2G A;  4FER A;  3X2H A;  2BH0 A;  1OA7 A;  1N10 A;  3SUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...