5GM9A

Crystal structure of a glycoside hydrolase in complex with cellobiose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
b'ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 45 protein
molecule tags Hydrolase
source organism Thielavia terrestris nrrl 8126
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
total genus 69
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5gm9A00
3X2KA 3M3GA 1N10A 4ZM7A 1OA9A 1HD5A 3X2NA 4JJOA 5GM9A 2KQAA 1BW4A 2G5DA 2AE0X 2BH0A 2PJJA 4L48A 4ENGA 3SUMA 2ENGA 4FFTA 2G6GA 1BW3A 3X2IA 2PNWA 3X2HA 2PI8A 3X2PA 1OA7A 4JS7A 3X2OA 5GLYA 3CZBA 4FG4A 3X2JA 3D30A 4JP6A 4FERA 5GLXA 3X2MA 1WC2A 3X2LA 3SULA 5H4UA 2PICA 4AVRA 4JP7A 3SUJA 1L8FA 3SUKA 2GAEA 3X2GA 4JCWA 3ENGA 2HCZX 4FG2A
chains in the Genus database with same CATH superfamily
1Y1VA 3GTGA 3X2KA 3GTMA 1PPYA 1DMSA 4NOHA 2Y0SA 1HD5A 1TWCA 4JJOA 5C1BA 2VUMA 3IR6A 5GM9A 2WAQA 1SFOA 5DYIA 2PJJA 2CW0D 4L48A 4D7ZB 1PQFA 4FFTA 1BW3A 2JIPA 1KQGA 3IR7A 2PNWA 3QWZA 3X2IA 3X2HA 2PI8A 4GA6A 1TWFA 4KDIA 3GTKA 3X2JA 2PMZA 3D30A 4JP6A 4FERA 1Q16A 1FDIA 1QCSA 1UHEA 1WC2A 1E61A 1PT0A 1PYQA 2EEOB 5H4UA 3SULA 3TM7B 2O5JD 4AVRA 3SUJA 1L8FA 4AOKB 1R27A 2GAEA 3CF2A 2V3VA 5DYGA 4JCWA 1TWAA 2JA5A 2BE5D 3HKZA 1PQEA 2V45A 4DMRA 1UHDA 3ENGA 3FKIA 1CZ5A 2YUJA 1CZ4A 1N10A 1YLEA 2A6ED 3ML1A 3PLXB 1I50A 3GTLA 4CS0A 2A69D 1E32A 1BW4A 1SIWA 2G5DA 5FTNA 5FTMA 4AYBA 1E18A 1IW7D 2G6GA 1TWHA 1OGYA 1TWGA 3HU2A 3X2OA 1H0HA 3CZBA 1WLFA 2KI8A 4KLNA 2PICA 4JP7A 2E7ZA 3TIWA 2A68D 1E5VA 1E60A 5GLXA 2HCZX 2VPXA 3X2NA 1PT1A 1YNND 2PJHB 2WB1A 5GLFA 2JIMA 4AZDA 4ZM7A 2VPYA 3QQ8A 5T5MD 4KDLA 2JIRA 1AA6A 3GTJA 1Y5IA 2R7ZA 2C45A 1ZC1A 1FDOA 1QDNA 2AE0X 2NYAA 2ENGA 3GTPA 2E2IA 3HU1A 3H0GA 5FTJA 5T5ID 1S3SA 3CQZA 3QQ7A 3X2PA 2NAPA 4JS7A 1KQFA 2R92A 2JIOA 3X2LA 2IV2X 4GA5A 1H5NA 1K83A 1R7RA 1DMRA 3IR5A 4CRYG 1G8KA 1Y1WA 3SUKA 4C2MA 2VPZA 2NVXA 1ZYRD 1PYUB 1Y4ZA 2B63A 2JIQA 4FG2A 3M3GA 1OA9A 4KODA 5FTKA 3QC8A 2KQAA 5B6CA 2YU9A 2BH0A 4ENGA 3SUMA 1G8JA 4RV0A 3GTOA 3GTQA 1R9TA 1OA7A 4CRZA 4AAYA 1SMYD 4QIWA 2NVYA 4FG4A 5GLYA 2JA6A 4KO8A 2JA7A 1EU1A 3X2MA 1YNJD 3HU3A 1PQHA 1I3QA 3O5AA 1AW8B 5FTLA 2A6HD 2DMRA 2VPWA 5C18A 5EPPA 2E2HA 3DMRA 1CR5A 2R93A 3X2GA 4AONB 1TMOA 3OUGA 1WCMA 1VC3B
chains in the Genus database with same CATH topology
3X2KA 3M3GA 1N10A 4ZM7A 1OA9A 1HD5A 3X2NA 4JJOA 5GM9A 2KQAA 1BW4A 2G5DA 2AE0X 2BH0A 2PJJA 4L48A 4ENGA 3SUMA 2ENGA 4FFTA 2G6GA 1BW3A 3X2IA 2PNWA 3X2HA 2PI8A 3X2PA 1OA7A 4JS7A 3X2OA 5GLYA 3CZBA 4FG4A 3X2JA 3D30A 4JP6A 4FERA 5GLXA 3X2MA 1WC2A 3X2LA 3SULA 5H4UA 2PICA 4AVRA 4JP7A 3SUJA 1L8FA 3SUKA 2GAEA 3X2GA 4JCWA 3ENGA 2HCZX 4FG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2K A;  3M3G A;  1N10 A;  4ZM7 A;  1OA9 A;  1HD5 A;  3X2N A;  4JJO A;  5GM9 A;  2KQA A;  1BW4 A;  2G5D A;  2AE0 X;  2BH0 A;  2PJJ A;  4L48 A;  4ENG A;  3SUM A;  2ENG A;  4FFT A;  2G6G A;  1BW3 A;  3X2I A;  2PNW A;  3X2H A;  2PI8 A;  3X2P A;  1OA7 A;  4JS7 A;  3X2O A;  5GLY A;  3CZB A;  4FG4 A;  3X2J A;  3D30 A;  4JP6 A;  4FER A;  5GLX A;  3X2M A;  1WC2 A;  3X2L A;  3SUL A;  5H4U A;  2PIC A;  4AVR A;  4JP7 A;  3SUJ A;  1L8F A;  3SUK A;  2GAE A;  3X2G A;  4JCW A;  3ENG A;  2HCZ X;  4FG2 A; 
#chains in the Genus database with same CATH topology
 1Y1V A;  3GTG A;  3X2K A;  3GTM A;  1PPY A;  1DMS A;  4NOH A;  2Y0S A;  1HD5 A;  1TWC A;  4JJO A;  5C1B A;  2VUM A;  3IR6 A;  5GM9 A;  2WAQ A;  1SFO A;  5DYI A;  2PJJ A;  2CW0 D;  4L48 A;  4D7Z B;  1PQF A;  4FFT A;  1BW3 A;  2JIP A;  1KQG A;  3IR7 A;  2PNW A;  3QWZ A;  3X2I A;  3X2H A;  2PI8 A;  4GA6 A;  1TWF A;  4KDI A;  3GTK A;  3X2J A;  2PMZ A;  3D30 A;  4JP6 A;  4FER A;  1Q16 A;  1FDI A;  1QCS A;  1UHE A;  1WC2 A;  1E61 A;  1PT0 A;  1PYQ A;  2EEO B;  5H4U A;  3SUL A;  3TM7 B;  2O5J D;  4AVR A;  3SUJ A;  1L8F A;  4AOK B;  1R27 A;  2GAE A;  3CF2 A;  2V3V A;  5DYG A;  4JCW A;  1TWA A;  2JA5 A;  2BE5 D;  3HKZ A;  1PQE A;  2V45 A;  4DMR A;  1UHD A;  3ENG A;  3FKI A;  1CZ5 A;  2YUJ A;  1CZ4 A;  1N10 A;  1YLE A;  2A6E D;  3ML1 A;  3PLX B;  1I50 A;  3GTL A;  4CS0 A;  2A69 D;  1E32 A;  1BW4 A;  1SIW A;  2G5D A;  5FTN A;  5FTM A;  4AYB A;  1E18 A;  1IW7 D;  2G6G A;  1TWH A;  1OGY A;  1TWG A;  3HU2 A;  3X2O A;  1H0H A;  3CZB A;  1WLF A;  2KI8 A;  4KLN A;  2PIC A;  4JP7 A;  2E7Z A;  3TIW A;  2A68 D;  1E5V A;  1E60 A;  5GLX A;  2HCZ X;  2VPX A;  3X2N A;  1PT1 A;  1YNN D;  2PJH B;  2WB1 A;  5GLF A;  2JIM A;  4AZD A;  4ZM7 A;  2VPY A;  3QQ8 A;  5T5M D;  4KDL A;  2JIR A;  1AA6 A;  3GTJ A;  1Y5I A;  2R7Z A;  2C45 A;  1ZC1 A;  1FDO A;  1QDN A;  2AE0 X;  2NYA A;  2ENG A;  3GTP A;  2E2I A;  3HU1 A;  3H0G A;  5FTJ A;  5T5I D;  1S3S A;  3CQZ A;  3QQ7 A;  3X2P A;  2NAP A;  4JS7 A;  1KQF A;  2R92 A;  2JIO A;  3X2L A;  2IV2 X;  4GA5 A;  1H5N A;  1K83 A;  1R7R A;  1DMR A;  3IR5 A;  4CRY G;  1G8K A;  1Y1W A;  3SUK A;  4C2M A;  2VPZ A;  2NVX A;  1ZYR D;  1PYU B;  1Y4Z A;  2B63 A;  2JIQ A;  4FG2 A;  3M3G A;  1OA9 A;  4KOD A;  5FTK A;  3QC8 A;  2KQA A;  5B6C A;  2YU9 A;  2BH0 A;  4ENG A;  3SUM A;  1G8J A;  4RV0 A;  3GTO A;  3GTQ A;  1R9T A;  1OA7 A;  4CRZ A;  4AAY A;  1SMY D;  4QIW A;  2NVY A;  4FG4 A;  5GLY A;  2JA6 A;  4KO8 A;  2JA7 A;  1EU1 A;  3X2M A;  1YNJ D;  3HU3 A;  1PQH A;  1I3Q A;  3O5A A;  1AW8 B;  5FTL A;  2A6H D;  2DMR A;  2VPW A;  5C18 A;  5EPP A;  2E2H A;  3DMR A;  1CR5 A;  2R93 A;  3X2G A;  4AON B;  1TMO A;  3OUG A;  1WCM A;  1VC3 B; 
#chains in the Genus database with same CATH homology
 3X2K A;  3M3G A;  1N10 A;  4ZM7 A;  1OA9 A;  1HD5 A;  3X2N A;  4JJO A;  5GM9 A;  2KQA A;  1BW4 A;  2G5D A;  2AE0 X;  2BH0 A;  2PJJ A;  4L48 A;  4ENG A;  3SUM A;  2ENG A;  4FFT A;  2G6G A;  1BW3 A;  3X2I A;  2PNW A;  3X2H A;  2PI8 A;  3X2P A;  1OA7 A;  4JS7 A;  3X2O A;  5GLY A;  3CZB A;  4FG4 A;  3X2J A;  3D30 A;  4JP6 A;  4FER A;  5GLX A;  3X2M A;  1WC2 A;  3X2L A;  3SUL A;  5H4U A;  2PIC A;  4AVR A;  4JP7 A;  3SUJ A;  1L8F A;  3SUK A;  2GAE A;  3X2G A;  4JCW A;  3ENG A;  2HCZ X;  4FG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...