5GM9A

Crystal structure of a glycoside hydrolase in complex with cellobiose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
ASGSGQSTRYWDCCKPSCAWPGKAAVSQPVYACDANFQRLSDFNVQSGCNGGSAYSCADQTPWAVNDNLAYGFAATSIAGGSESSWCCACYALTFTSGPVAGKTMVVQSTSTGGDLGSNQFDIAMPGGGVGIFNGCSSQFGGLPGAQYGGISSRDQCDSFPAPLKPGCQWRFDWFQNADNPTFTFQQVQCPAEIVARSGCKRNDDSSFPVFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and crystal structure of a thermostable glycoside hydrolase family 45 1,4-beta-endoglucanase from Thielavia terrestris
pubmed doi rcsb
source organism Thielavia terrestris nrrl 8126
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 45 protein
total genus 69
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5gm9A00
3M3GA 1OA7A 2AE0X 3X2GA 1N10A 3X2JA 4FG4A 2PNWA 4JS7A 2GAEA 2G5DA 1WC2A 2ENGA 4FERA 1HD5A 4FFTA 5GLYA 3D30A 4JP6A 1BW3A 5H4UA 5GLXA 2BH0A 2HCZX 2PICA 1L8FA 4FG2A 2KQAA 4JP7A 4JCWA 3X2NA 3SULA 3X2HA 2PJJA 3SUKA 4AVRA 4L48A 3X2IA 1BW4A 4ENGA 2G6GA 3X2OA 4JJOA 3X2KA 3X2LA 3X2MA 3CZBA 3SUMA 5GM9A 2PI8A 1OA9A 3SUJA 3X2PA 4ZM7A 3ENGA
chains in the Genus database with same CATH superfamily
5T5MD 5FTNA 2EEOB 2NAPA 2JIQA 4KDLA 1Y4ZA 2JA5A 3HU3A 1FDOA 2GAEA 3GTGA 2G5DA 1WC2A 4RV0A 4FERA 3TIWA 3GTPA 3GTKA 4NOHA 3ML1A 2JIMA 4AAYA 2VPXA 2BE5D 1SMYD 3FKIA 4GA5A 2JIRA 2KQAA 3X2NA 4JCWA 4CRZA 5B6CA 3CF2A 1E61A 3X2IA 2VPWA 4C2MA 3HU2A 2CW0D 2E2HA 5C1BA 4CS0A 1TWFA 1PPYA 1PQEA 2G6GA 3X2OA 1Q16A 5C18A 2JIOA 1TWAA 2Y0SA 3X2KA 2A6ED 1SFOA 2YUJA 4KODA 5FTLA 1PQHA 1Y1VA 1OGYA 2PI8A 3DMRA 1UHEA 5FTMA 1YNND 3X2PA 2A69D 4ZM7A 1DMSA 4AONB 2PICA 3ENGA 3X2JA 1OA7A 1R9TA 2O5JD 1PT0A 1IW7D 2V3VA 4GA6A 5DYGA 1TMOA 1Y1WA 2A6HD 1HD5A 1R27A 5T5ID 3D30A 4JP6A 1K83A 2DMRA 5H4UA 5GLXA 2HCZX 4FG2A 3X2HA 1E32A 1E18A 1PYUB 4AVRA 3OUGA 4DMRA 1PT1A 2E7ZA 3CQZA 3IR7A 1ZYRD 1KQFA 1DMRA 5GM9A 3GTMA 1PQFA 1FDIA 1TWCA 3QC8A 5GLFA 4KDIA 2PJHB 2E2IA 2NVXA 3X2GA 2AE0X 2IV2X 1R7RA 2VPZA 1E60A 1VC3B 1QCSA 4JS7A 4FFTA 1H0HA 1BW3A 2BH0A 2C45A 1YNJD 2YU9A 1EU1A 1L8FA 3SULA 2PJJA 2JIPA 3H0GA 1UHDA 2JA7A 4KO8A 1I3QA 1QDNA 5EPPA 5DYIA 4D7ZB 1KQGA 3X2LA 1I50A 3GTOA 1Y5IA 2JA6A 3PLXB 4AZDA 3QQ8A 2R7ZA 3SUMA 2NVYA 2R93A 2PMZA 2WB1A 4AYBA 4QIWA 3GTLA 1TWHA 1H5NA 2V45A 2WAQA 1CZ4A 3GTQA 1TWGA 1CR5A 3QQ7A 1AW8B 3M3GA 1N10A 4FG4A 2B63A 4AOKB 2PNWA 2NYAA 3IR6A 2A68D 1S3SA 2ENGA 3QWZA 5FTKA 5GLYA 2R92A 1SIWA 2VPYA 4KLNA 1E5VA 4JP7A 1PYQA 3SUKA 1ZC1A 4L48A 1WCMA 2VUMA 1BW4A 4ENGA 1WLFA 3HU1A 4JJOA 1G8JA 3HKZA 3IR5A 1G8KA 4CRYG 3X2MA 1YLEA 3CZBA 5FTJA 1OA9A 3SUJA 2KI8A 3O5AA 3TM7B 1CZ5A 1AA6A 3GTJA
chains in the Genus database with same CATH topology
3M3GA 1OA7A 2AE0X 3X2GA 1N10A 3X2JA 4FG4A 2PNWA 4JS7A 2GAEA 2G5DA 1WC2A 2ENGA 4FERA 1HD5A 4FFTA 5GLYA 3D30A 4JP6A 1BW3A 5H4UA 5GLXA 2BH0A 2HCZX 2PICA 1L8FA 4FG2A 2KQAA 4JP7A 4JCWA 3X2NA 3SULA 3X2HA 2PJJA 3SUKA 4AVRA 4L48A 3X2IA 1BW4A 4ENGA 2G6GA 3X2OA 4JJOA 3X2KA 3X2LA 3X2MA 3CZBA 3SUMA 5GM9A 2PI8A 1OA9A 3SUJA 3X2PA 4ZM7A 3ENGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3G A;  1OA7 A;  2AE0 X;  3X2G A;  1N10 A;  3X2J A;  4FG4 A;  2PNW A;  4JS7 A;  2GAE A;  2G5D A;  1WC2 A;  2ENG A;  4FER A;  1HD5 A;  4FFT A;  5GLY A;  3D30 A;  4JP6 A;  1BW3 A;  5H4U A;  5GLX A;  2BH0 A;  2HCZ X;  2PIC A;  1L8F A;  4FG2 A;  2KQA A;  4JP7 A;  4JCW A;  3X2N A;  3SUL A;  3X2H A;  2PJJ A;  3SUK A;  4AVR A;  4L48 A;  3X2I A;  1BW4 A;  4ENG A;  2G6G A;  3X2O A;  4JJO A;  3X2K A;  3X2L A;  3X2M A;  3CZB A;  3SUM A;  5GM9 A;  2PI8 A;  1OA9 A;  3SUJ A;  3X2P A;  4ZM7 A;  3ENG A; 
#chains in the Genus database with same CATH topology
 5T5M D;  5FTN A;  2EEO B;  2NAP A;  2JIQ A;  4KDL A;  1Y4Z A;  2JA5 A;  3HU3 A;  1FDO A;  2GAE A;  3GTG A;  2G5D A;  1WC2 A;  4RV0 A;  4FER A;  3TIW A;  3GTP A;  3GTK A;  4NOH A;  3ML1 A;  2JIM A;  4AAY A;  2VPX A;  2BE5 D;  1SMY D;  3FKI A;  4GA5 A;  2JIR A;  2KQA A;  3X2N A;  4JCW A;  4CRZ A;  5B6C A;  3CF2 A;  1E61 A;  3X2I A;  2VPW A;  4C2M A;  3HU2 A;  2CW0 D;  2E2H A;  5C1B A;  4CS0 A;  1TWF A;  1PPY A;  1PQE A;  2G6G A;  3X2O A;  1Q16 A;  5C18 A;  2JIO A;  1TWA A;  2Y0S A;  3X2K A;  2A6E D;  1SFO A;  2YUJ A;  4KOD A;  5FTL A;  1PQH A;  1Y1V A;  1OGY A;  2PI8 A;  3DMR A;  1UHE A;  5FTM A;  1YNN D;  3X2P A;  2A69 D;  4ZM7 A;  1DMS A;  4AON B;  2PIC A;  3ENG A;  3X2J A;  1OA7 A;  1R9T A;  2O5J D;  1PT0 A;  1IW7 D;  2V3V A;  4GA6 A;  5DYG A;  1TMO A;  1Y1W A;  2A6H D;  1HD5 A;  1R27 A;  5T5I D;  3D30 A;  4JP6 A;  1K83 A;  2DMR A;  5H4U A;  5GLX A;  2HCZ X;  4FG2 A;  3X2H A;  1E32 A;  1E18 A;  1PYU B;  4AVR A;  3OUG A;  4DMR A;  1PT1 A;  2E7Z A;  3CQZ A;  3IR7 A;  1ZYR D;  1KQF A;  1DMR A;  5GM9 A;  3GTM A;  1PQF A;  1FDI A;  1TWC A;  3QC8 A;  5GLF A;  4KDI A;  2PJH B;  2E2I A;  2NVX A;  3X2G A;  2AE0 X;  2IV2 X;  1R7R A;  2VPZ A;  1E60 A;  1VC3 B;  1QCS A;  4JS7 A;  4FFT A;  1H0H A;  1BW3 A;  2BH0 A;  2C45 A;  1YNJ D;  2YU9 A;  1EU1 A;  1L8F A;  3SUL A;  2PJJ A;  2JIP A;  3H0G A;  1UHD A;  2JA7 A;  4KO8 A;  1I3Q A;  1QDN A;  5EPP A;  5DYI A;  4D7Z B;  1KQG A;  3X2L A;  1I50 A;  3GTO A;  1Y5I A;  2JA6 A;  3PLX B;  4AZD A;  3QQ8 A;  2R7Z A;  3SUM A;  2NVY A;  2R93 A;  2PMZ A;  2WB1 A;  4AYB A;  4QIW A;  3GTL A;  1TWH A;  1H5N A;  2V45 A;  2WAQ A;  1CZ4 A;  3GTQ A;  1TWG A;  1CR5 A;  3QQ7 A;  1AW8 B;  3M3G A;  1N10 A;  4FG4 A;  2B63 A;  4AOK B;  2PNW A;  2NYA A;  3IR6 A;  2A68 D;  1S3S A;  2ENG A;  3QWZ A;  5FTK A;  5GLY A;  2R92 A;  1SIW A;  2VPY A;  4KLN A;  1E5V A;  4JP7 A;  1PYQ A;  3SUK A;  1ZC1 A;  4L48 A;  1WCM A;  2VUM A;  1BW4 A;  4ENG A;  1WLF A;  3HU1 A;  4JJO A;  1G8J A;  3HKZ A;  3IR5 A;  1G8K A;  4CRY G;  3X2M A;  1YLE A;  3CZB A;  5FTJ A;  1OA9 A;  3SUJ A;  2KI8 A;  3O5A A;  3TM7 B;  1CZ5 A;  1AA6 A;  3GTJ A; 
#chains in the Genus database with same CATH homology
 3M3G A;  1OA7 A;  2AE0 X;  3X2G A;  1N10 A;  3X2J A;  4FG4 A;  2PNW A;  4JS7 A;  2GAE A;  2G5D A;  1WC2 A;  2ENG A;  4FER A;  1HD5 A;  4FFT A;  5GLY A;  3D30 A;  4JP6 A;  1BW3 A;  5H4U A;  5GLX A;  2BH0 A;  2HCZ X;  2PIC A;  1L8F A;  4FG2 A;  2KQA A;  4JP7 A;  4JCW A;  3X2N A;  3SUL A;  3X2H A;  2PJJ A;  3SUK A;  4AVR A;  4L48 A;  3X2I A;  1BW4 A;  4ENG A;  2G6G A;  3X2O A;  4JJO A;  3X2K A;  3X2L A;  3X2M A;  3CZB A;  3SUM A;  5GM9 A;  2PI8 A;  1OA9 A;  3SUJ A;  3X2P A;  4ZM7 A;  3ENG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...