4AONB

Conformational dynamics of aspartate alpha-decarboxylase active site revealed by protein-ligand complexes: 1-methyl-l-aspartate complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Dynamics of Aspartate Alpha Decarboxylase Active Site Revealed by Protein-Ligand Complexes
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ASPARTATE-ALPHA-DECARBOXYLASE BETA CHAIN
total genus 23
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2012-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4aonB00
3HU3A 1E32A 3GTKA 4KO8A 2R7ZA 4QIWA 2B63A 1QCSA 5B6CA 3QC8A 1Y4ZA 3GTJA 2Y0SA 3FKIA 3QQ7A 1KQGA 1G8KA 1H5NA 2E2IA 1I3QA 3GTMA 2E7ZA 2JIPA 1TWCA 3O5AA 1VC3B 2DMRA 4AAYA 5T5ID 5C18A 4KDIA 2NVXA 1AA6A 1TWGA 3CQZA 1UHDA 1Y1VA 1PQFA 1CZ5A 2R93A 5FTLA 1E18A 3ML1A 3DMRA 2JA7A 2V3VA 4KODA 4AZDA 1DMRA 1SFOA 3GTPA 5T5MD 4AONB 4GA5A 4GA6A 1PYUB 3GTLA 2WAQA 2VPZA 3QQ8A 2VPYA 4C2MA 3H0GA 1TWHA 2NAPA 2E2HA 1E5VA 4CRYG 3HU1A 3PLXB 3OUGA 1WCMA 5DYGA 1QDNA 5DYIA 2NVYA 2WB1A 2KI8A 4KLNA 1OGYA 2VPWA 2JIOA 1R9TA 1PT1A 2PJHB 1TMOA 2IV2X 2NYAA 3GTOA 1E61A 1YLEA 2PMZA 2VPXA 2YU9A 2EEOB 1CZ4A 4KDLA 1K83A 2JA5A 1PPYA 3IR7A 2JIRA 3IR6A 4RV0A 4AOKB 1Y1WA 2JIQA 1FDOA 5GLFA 4CRZA 1DMSA 1AW8B 1TWFA 1PQEA 4AYBA 1E60A 2V45A 1R27A 3GTGA 2VUMA 3IR5A 1WLFA 1UHEA 3QWZA 1I50A 4D7ZB 5C1BA 3GTQA 1IW7D 1R7RA 1Q16A 1Y5IA 2C45A 1PT0A 5FTNA 1S3SA 3HU2A 1KQFA 1EU1A 2R92A 3TIWA 4DMRA 1H0HA 5EPPA 2JA6A 5FTMA 3HKZA 1SIWA 1CR5A 1TWAA 1FDIA 5FTJA 3CF2A 1PQHA 1G8JA 2JIMA 1PYQA 4CS0A 3TM7B 5FTKA
chains in the Genus database with same CATH superfamily
4L48A 3HU3A 1E32A 3GTKA 4KO8A 2R7ZA 4JP6A 4QIWA 2B63A 1QCSA 3CZBA 3QC8A 5B6CA 5GLYA 1Y4ZA 3GTJA 3ENGA 2Y0SA 3FKIA 3X2PA 2ENGA 3QQ7A 4AVRA 1G8KA 1H5NA 1KQGA 1I3QA 3GTMA 2E2IA 2E7ZA 2JIPA 1TWCA 3O5AA 1OA9A 1VC3B 5GM9A 2PICA 2DMRA 3X2GA 4AAYA 5T5ID 5C18A 4KDIA 2NVXA 4FFTA 1AA6A 1TWGA 2A68D 3CQZA 2O5JD 1UHDA 4JP7A 1Y1VA 4ENGA 1PQFA 1CZ5A 1ZC1A 3X2NA 2R93A 5GLXA 5FTLA 1E18A 3ML1A 3DMRA 2JA7A 2V3VA 4KODA 4AZDA 1DMRA 1SFOA 3GTPA 5T5MD 4AONB 4GA5A 2HCZX 4GA6A 1PYUB 3GTLA 3SULA 2WAQA 2VPZA 1BW3A 3QQ8A 3X2HA 2KQAA 2VPYA 4C2MA 3H0GA 1TWHA 2NAPA 2PJJA 2E2HA 1E5VA 4CRYG 3X2MA 3HU1A 3PLXB 1SMYD 3OUGA 1WCMA 3X2JA 5DYGA 1L8FA 1QDNA 5DYIA 2NVYA 2A6HD 2WB1A 2KI8A 4KLNA 1OGYA 2VPWA 2JIOA 1R9TA 1PT1A 3X2IA 4FG2A 3SUMA 2PJHB 1TMOA 2A6ED 2GAEA 2IV2X 2NYAA 3GTOA 4JCWA 1E61A 1YLEA 2AE0X 2PMZA 2VPXA 3D30A 2YU9A 1HD5A 2EEOB 1CZ4A 1YNJD 4KDLA 1K83A 1PPYA 2JA5A 3IR7A 2A69D 1OA7A 2JIRA 3IR6A 4RV0A 4AOKB 1Y1WA 2JIQA 1FDOA 5GLFA 4CRZA 1DMSA 1AW8B 1TWFA 2G6GA 1PQEA 4FERA 3SUJA 4AYBA 1E60A 2V45A 1R27A 3SUKA 4FG4A 3GTGA 1WLFA 3IR5A 1UHEA 3QWZA 1I50A 2VUMA 4D7ZB 5C1BA 3GTQA 4NOHA 1IW7D 1R7RA 2PNWA 4JJOA 1Q16A 2BE5D 2C45A 1Y5IA 1PT0A 3X2KA 5FTNA 1S3SA 1N10A 3HU2A 2CW0D 1KQFA 1EU1A 2R92A 3TIWA 2YUJA 4DMRA 4ZM7A 1YNND 1H0HA 1BW4A 5EPPA 2JA6A 5FTMA 2BH0A 1SIWA 1CR5A 1TWAA 3HKZA 2PI8A 1FDIA 3M3GA 1ZYRD 5FTJA 3CF2A 2G5DA 1PQHA 1G8JA 2JIMA 1PYQA 5H4UA 4CS0A 4JS7A 1WC2A 3X2LA 3TM7B 3X2OA 5FTKA
chains in the Genus database with same CATH topology
3HU3A 1E32A 3GTKA 4KO8A 2R7ZA 4QIWA 2B63A 1QCSA 3CZBA 3QC8A 5B6CA 1Y4ZA 3GTJA 2Y0SA 3FKIA 3QQ7A 1KQGA 1G8KA 1H5NA 2E2IA 1I3QA 3GTMA 2E7ZA 2JIPA 1TWCA 3O5AA 1VC3B 2PICA 2DMRA 4AAYA 5T5ID 5C18A 4KDIA 2NVXA 1AA6A 1TWGA 2A68D 3CQZA 1UHDA 1Y1VA 1PQFA 1CZ5A 1ZC1A 2R93A 5FTLA 1E18A 3ML1A 3DMRA 2JA7A 2V3VA 4KODA 4AZDA 1DMRA 1SFOA 3GTPA 5T5MD 4AONB 4GA5A 4GA6A 1PYUB 3GTLA 2WAQA 2VPZA 3QQ8A 2VPYA 4C2MA 3H0GA 1TWHA 2NAPA 2PJJA 2E2HA 1E5VA 4CRYG 3HU1A 3PLXB 1SMYD 3OUGA 1WCMA 5DYGA 1QDNA 5DYIA 2NVYA 2A6HD 2WB1A 2KI8A 4KLNA 1OGYA 2VPWA 2JIOA 1R9TA 1PT1A 2PJHB 1TMOA 2A6ED 2GAEA 2IV2X 2NYAA 3GTOA 1E61A 1YLEA 2AE0X 2PMZA 2VPXA 2YU9A 2EEOB 1CZ4A 1YNJD 4KDLA 1K83A 1PPYA 2JA5A 3IR7A 2A69D 2JIRA 3IR6A 4RV0A 4AOKB 1Y1WA 2JIQA 1FDOA 5GLFA 4CRZA 1DMSA 1AW8B 1TWFA 2G6GA 1PQEA 4AYBA 2O5JD 1E60A 2V45A 1R27A 3GTGA 2VUMA 1WLFA 3IR5A 1UHEA 3QWZA 1I50A 4D7ZB 5C1BA 3GTQA 4NOHA 1IW7D 1R7RA 2PNWA 1Q16A 2BE5D 2C45A 1Y5IA 1PT0A 5FTNA 1S3SA 3HU2A 2CW0D 1KQFA 1EU1A 2R92A 3TIWA 2YUJA 4DMRA 1YNND 1H0HA 5EPPA 2JA6A 5FTMA 3HKZA 1SIWA 1CR5A 1TWAA 2PI8A 1FDIA 1ZYRD 5FTJA 3CF2A 2G5DA 1PQHA 1G8JA 2JIMA 1PYQA 4CS0A 3TM7B 5FTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HU3 A;  1E32 A;  3GTK A;  4KO8 A;  2R7Z A;  4QIW A;  2B63 A;  1QCS A;  5B6C A;  3QC8 A;  1Y4Z A;  3GTJ A;  2Y0S A;  3FKI A;  3QQ7 A;  1KQG A;  1G8K A;  1H5N A;  2E2I A;  1I3Q A;  3GTM A;  2E7Z A;  2JIP A;  1TWC A;  3O5A A;  1VC3 B;  2DMR A;  4AAY A;  5T5I D;  5C18 A;  4KDI A;  2NVX A;  1AA6 A;  1TWG A;  3CQZ A;  1UHD A;  1Y1V A;  1PQF A;  1CZ5 A;  2R93 A;  5FTL A;  1E18 A;  3ML1 A;  3DMR A;  2JA7 A;  2V3V A;  4KOD A;  4AZD A;  1DMR A;  1SFO A;  3GTP A;  5T5M D;  4AON B;  4GA5 A;  4GA6 A;  1PYU B;  3GTL A;  2WAQ A;  2VPZ A;  3QQ8 A;  2VPY A;  4C2M A;  3H0G A;  1TWH A;  2NAP A;  2E2H A;  1E5V A;  4CRY G;  3HU1 A;  3PLX B;  3OUG A;  1WCM A;  5DYG A;  1QDN A;  5DYI A;  2NVY A;  2WB1 A;  2KI8 A;  4KLN A;  1OGY A;  2VPW A;  2JIO A;  1R9T A;  1PT1 A;  2PJH B;  1TMO A;  2IV2 X;  2NYA A;  3GTO A;  1E61 A;  1YLE A;  2PMZ A;  2VPX A;  2YU9 A;  2EEO B;  1CZ4 A;  4KDL A;  1K83 A;  2JA5 A;  1PPY A;  3IR7 A;  2JIR A;  3IR6 A;  4RV0 A;  4AOK B;  1Y1W A;  2JIQ A;  1FDO A;  5GLF A;  4CRZ A;  1DMS A;  1AW8 B;  1TWF A;  1PQE A;  4AYB A;  1E60 A;  2V45 A;  1R27 A;  3GTG A;  2VUM A;  3IR5 A;  1WLF A;  1UHE A;  3QWZ A;  1I50 A;  4D7Z B;  5C1B A;  3GTQ A;  1IW7 D;  1R7R A;  1Q16 A;  1Y5I A;  2C45 A;  1PT0 A;  5FTN A;  1S3S A;  3HU2 A;  1KQF A;  1EU1 A;  2R92 A;  3TIW A;  4DMR A;  1H0H A;  5EPP A;  2JA6 A;  5FTM A;  3HKZ A;  1SIW A;  1CR5 A;  1TWA A;  1FDI A;  5FTJ A;  3CF2 A;  1PQH A;  1G8J A;  2JIM A;  1PYQ A;  4CS0 A;  3TM7 B;  5FTK A; 
#chains in the Genus database with same CATH topology
 4L48 A;  3HU3 A;  1E32 A;  3GTK A;  4KO8 A;  2R7Z A;  4JP6 A;  4QIW A;  2B63 A;  1QCS A;  3CZB A;  3QC8 A;  5B6C A;  5GLY A;  1Y4Z A;  3GTJ A;  3ENG A;  2Y0S A;  3FKI A;  3X2P A;  2ENG A;  3QQ7 A;  4AVR A;  1G8K A;  1H5N A;  1KQG A;  1I3Q A;  3GTM A;  2E2I A;  2E7Z A;  2JIP A;  1TWC A;  3O5A A;  1OA9 A;  1VC3 B;  5GM9 A;  2PIC A;  2DMR A;  3X2G A;  4AAY A;  5T5I D;  5C18 A;  4KDI A;  2NVX A;  4FFT A;  1AA6 A;  1TWG A;  2A68 D;  3CQZ A;  2O5J D;  1UHD A;  4JP7 A;  1Y1V A;  4ENG A;  1PQF A;  1CZ5 A;  1ZC1 A;  3X2N A;  2R93 A;  5GLX A;  5FTL A;  1E18 A;  3ML1 A;  3DMR A;  2JA7 A;  2V3V A;  4KOD A;  4AZD A;  1DMR A;  1SFO A;  3GTP A;  5T5M D;  4AON B;  4GA5 A;  2HCZ X;  4GA6 A;  1PYU B;  3GTL A;  3SUL A;  2WAQ A;  2VPZ A;  1BW3 A;  3QQ8 A;  3X2H A;  2KQA A;  2VPY A;  4C2M A;  3H0G A;  1TWH A;  2NAP A;  2PJJ A;  2E2H A;  1E5V A;  4CRY G;  3X2M A;  3HU1 A;  3PLX B;  1SMY D;  3OUG A;  1WCM A;  3X2J A;  5DYG A;  1L8F A;  1QDN A;  5DYI A;  2NVY A;  2A6H D;  2WB1 A;  2KI8 A;  4KLN A;  1OGY A;  2VPW A;  2JIO A;  1R9T A;  1PT1 A;  3X2I A;  4FG2 A;  3SUM A;  2PJH B;  1TMO A;  2A6E D;  2GAE A;  2IV2 X;  2NYA A;  3GTO A;  4JCW A;  1E61 A;  1YLE A;  2AE0 X;  2PMZ A;  2VPX A;  3D30 A;  2YU9 A;  1HD5 A;  2EEO B;  1CZ4 A;  1YNJ D;  4KDL A;  1K83 A;  1PPY A;  2JA5 A;  3IR7 A;  2A69 D;  1OA7 A;  2JIR A;  3IR6 A;  4RV0 A;  4AOK B;  1Y1W A;  2JIQ A;  1FDO A;  5GLF A;  4CRZ A;  1DMS A;  1AW8 B;  1TWF A;  2G6G A;  1PQE A;  4FER A;  3SUJ A;  4AYB A;  1E60 A;  2V45 A;  1R27 A;  3SUK A;  4FG4 A;  3GTG A;  1WLF A;  3IR5 A;  1UHE A;  3QWZ A;  1I50 A;  2VUM A;  4D7Z B;  5C1B A;  3GTQ A;  4NOH A;  1IW7 D;  1R7R A;  2PNW A;  4JJO A;  1Q16 A;  2BE5 D;  2C45 A;  1Y5I A;  1PT0 A;  3X2K A;  5FTN A;  1S3S A;  1N10 A;  3HU2 A;  2CW0 D;  1KQF A;  1EU1 A;  2R92 A;  3TIW A;  2YUJ A;  4DMR A;  4ZM7 A;  1YNN D;  1H0H A;  1BW4 A;  5EPP A;  2JA6 A;  5FTM A;  2BH0 A;  1SIW A;  1CR5 A;  1TWA A;  3HKZ A;  2PI8 A;  1FDI A;  3M3G A;  1ZYR D;  5FTJ A;  3CF2 A;  2G5D A;  1PQH A;  1G8J A;  2JIM A;  1PYQ A;  5H4U A;  4CS0 A;  4JS7 A;  1WC2 A;  3X2L A;  3TM7 B;  3X2O A;  5FTK A; 
#chains in the Genus database with same CATH homology
 3HU3 A;  1E32 A;  3GTK A;  4KO8 A;  2R7Z A;  4QIW A;  2B63 A;  1QCS A;  3CZB A;  3QC8 A;  5B6C A;  1Y4Z A;  3GTJ A;  2Y0S A;  3FKI A;  3QQ7 A;  1KQG A;  1G8K A;  1H5N A;  2E2I A;  1I3Q A;  3GTM A;  2E7Z A;  2JIP A;  1TWC A;  3O5A A;  1VC3 B;  2PIC A;  2DMR A;  4AAY A;  5T5I D;  5C18 A;  4KDI A;  2NVX A;  1AA6 A;  1TWG A;  2A68 D;  3CQZ A;  1UHD A;  1Y1V A;  1PQF A;  1CZ5 A;  1ZC1 A;  2R93 A;  5FTL A;  1E18 A;  3ML1 A;  3DMR A;  2JA7 A;  2V3V A;  4KOD A;  4AZD A;  1DMR A;  1SFO A;  3GTP A;  5T5M D;  4AON B;  4GA5 A;  4GA6 A;  1PYU B;  3GTL A;  2WAQ A;  2VPZ A;  3QQ8 A;  2VPY A;  4C2M A;  3H0G A;  1TWH A;  2NAP A;  2PJJ A;  2E2H A;  1E5V A;  4CRY G;  3HU1 A;  3PLX B;  1SMY D;  3OUG A;  1WCM A;  5DYG A;  1QDN A;  5DYI A;  2NVY A;  2A6H D;  2WB1 A;  2KI8 A;  4KLN A;  1OGY A;  2VPW A;  2JIO A;  1R9T A;  1PT1 A;  2PJH B;  1TMO A;  2A6E D;  2GAE A;  2IV2 X;  2NYA A;  3GTO A;  1E61 A;  1YLE A;  2AE0 X;  2PMZ A;  2VPX A;  2YU9 A;  2EEO B;  1CZ4 A;  1YNJ D;  4KDL A;  1K83 A;  1PPY A;  2JA5 A;  3IR7 A;  2A69 D;  2JIR A;  3IR6 A;  4RV0 A;  4AOK B;  1Y1W A;  2JIQ A;  1FDO A;  5GLF A;  4CRZ A;  1DMS A;  1AW8 B;  1TWF A;  2G6G A;  1PQE A;  4AYB A;  2O5J D;  1E60 A;  2V45 A;  1R27 A;  3GTG A;  2VUM A;  1WLF A;  3IR5 A;  1UHE A;  3QWZ A;  1I50 A;  4D7Z B;  5C1B A;  3GTQ A;  4NOH A;  1IW7 D;  1R7R A;  2PNW A;  1Q16 A;  2BE5 D;  2C45 A;  1Y5I A;  1PT0 A;  5FTN A;  1S3S A;  3HU2 A;  2CW0 D;  1KQF A;  1EU1 A;  2R92 A;  3TIW A;  2YUJ A;  4DMR A;  1YNN D;  1H0H A;  5EPP A;  2JA6 A;  5FTM A;  3HKZ A;  1SIW A;  1CR5 A;  1TWA A;  2PI8 A;  1FDI A;  1ZYR D;  5FTJ A;  3CF2 A;  2G5D A;  1PQH A;  1G8J A;  2JIM A;  1PYQ A;  4CS0 A;  3TM7 B;  5FTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...