4AONB

Conformational dynamics of aspartate alpha-decarboxylase active site revealed by protein-ligand complexes: 1-methyl-l-aspartate complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
b'CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE-ALPHA-DECARBOXYLASE BETA CHAIN
molecule tags Hydrolase
source organism Escherichia coli
publication title Conformational Dynamics of Aspartate Alpha Decarboxylase Active Site Revealed by Protein-Ligand Complexes
rcsb
total genus 23
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2012-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4aonB00
2KI8A 1H0HA 5B6CA 5FTMA 1WCMA 4C2MA 1Q16A 2WAQA 2JIPA 2JIOA 3IR7A 3H0GA 1PQEA 3FKIA 3GTOA 1CZ5A 1H5NA 3GTPA 4QIWA 1G8JA 1I3QA 1Y4ZA 4AZDA 2JA5A 1DMSA 3IR5A 1FDOA 2JA6A 3TM7B 1S3SA 1K83A 1PT0A 4KO8A 5FTNA 1WLFA 1E32A 5EPPA 5DYGA 2EEOB 4GA6A 3HKZA 1TWCA 2IV2X 2R93A 2NAPA 1TWFA 3QWZA 3GTKA 5FTKA 4KDIA 2Y0SA 4KODA 3HU2A 1Y1VA 1KQGA 5T5MD 5T5ID 1TWHA 1R27A 1Y5IA 1E5VA 1E18A 2E7ZA 1SFOA 1YLEA 2PMZA 3GTQA 1CZ4A 1QDNA 1UHEA 2JIQA 2VPWA 2JIMA 2R92A 2R7ZA 3DMRA 2NYAA 3GTMA 2DMRA 1PPYA 3PLXB 2V3VA 1TMOA 1PT1A 1PYUB 3IR6A 5FTJA 1R7RA 2B63A 1QCSA 3GTJA 4AONB 3GTGA 1E60A 3HU1A 1TWAA 2NVXA 4CS0A 1FDIA 1R9TA 4AYBA 4DMRA 3CQZA 5C1BA 1CR5A 3HU3A 3TIWA 2YU9A 2V45A 2VPZA 4GA5A 4AAYA 1KQFA 5GLFA 1UHDA 3CF2A 1PQFA 4RV0A 1VC3B 2E2IA 1Y1WA 3QQ7A 3GTLA 1PYQA 5C18A 1AW8B 1PQHA 2JIRA 2E2HA 1G8KA 2C45A 4KLNA 3O5AA 1I50A 5FTLA 2PJHB 2VPYA 5DYIA 4AOKB 2JA7A 3OUGA 4CRYG 3ML1A 1AA6A 2WB1A 1IW7D 4CRZA 1SIWA 2VPXA 4D7ZB 1DMRA 1E61A 3QQ8A 4KDLA 1EU1A 1TWGA 3QC8A 2VUMA 1OGYA 2NVYA
chains in the Genus database with same CATH superfamily
2KI8A 1H0HA 5B6CA 5FTMA 1WCMA 4C2MA 1Q16A 2WAQA 2JIPA 2JIOA 3IR7A 3H0GA 1PQEA 3FKIA 3GTOA 3SUJA 1CZ5A 1H5NA 3GTPA 4QIWA 1G8JA 1SMYD 1I3QA 1Y4ZA 4FG2A 4AZDA 2JA5A 1DMSA 3IR5A 1FDOA 2JA6A 3TM7B 2A69D 1YNJD 3X2HA 1S3SA 1K83A 4L48A 1PT0A 2BE5D 4KO8A 5FTNA 1WLFA 1N10A 1E32A 1WC2A 5EPPA 1YNND 5DYGA 2EEOB 4GA6A 3HKZA 1TWCA 2IV2X 2R93A 2NAPA 1TWFA 2G6GA 1OA7A 3QWZA 5FTKA 4JP7A 4KDIA 5GLYA 3X2GA 3GTKA 1BW4A 2Y0SA 4KODA 2YUJA 3HU2A 1Y1VA 1KQGA 5T5MD 5T5ID 1TWHA 2A6HD 1R27A 4JP6A 1Y5IA 3ENGA 1E5VA 1E18A 2E7ZA 2AE0X 1SFOA 1YLEA 2PMZA 2BH0A 3X2OA 3GTQA 1ZC1A 2A68D 1CZ4A 1QDNA 1UHEA 2JIQA 4ENGA 2A6ED 2VPWA 2JIMA 3X2MA 2R92A 3DMRA 2R7ZA 2NYAA 5H4UA 3GTMA 2DMRA 1PPYA 3PLXB 2V3VA 1TMOA 1PT1A 1PYUB 3IR6A 5FTJA 4ZM7A 2HCZX 1R7RA 2B63A 4FFTA 1QCSA 2GAEA 3GTJA 4AONB 3GTGA 1E60A 3HU1A 1TWAA 3X2IA 2NVXA 2PJJA 4CS0A 1FDIA 1ZYRD 1R9TA 2KQAA 4AYBA 4DMRA 3CQZA 5C1BA 1CR5A 3HU3A 3TIWA 2YU9A 4NOHA 2V45A 2VPZA 4GA5A 4AAYA 2ENGA 1KQFA 5GLFA 1UHDA 3CF2A 2PNWA 3X2NA 1PQFA 3M3GA 4RV0A 3SULA 2G5DA 1VC3B 2E2IA 1Y1WA 3QQ7A 3GTLA 1PYQA 3D30A 5C18A 1AW8B 1PQHA 2JIRA 2E2HA 1G8KA 4JCWA 4JJOA 2C45A 3X2JA 2PI8A 4JS7A 3X2KA 4KLNA 3O5AA 1I50A 3CZBA 4AVRA 5FTLA 2PJHB 2VPYA 3X2LA 2PICA 4FERA 5DYIA 3SUKA 4AOKB 2JA7A 1L8FA 3OUGA 3SUMA 4CRYG 5GM9A 3ML1A 4FG4A 5GLXA 1AA6A 2WB1A 1IW7D 4CRZA 1SIWA 2CW0D 2VPXA 1OA9A 1HD5A 4D7ZB 1DMRA 1E61A 3QQ8A 4KDLA 1EU1A 1TWGA 3QC8A 1BW3A 2VUMA 3X2PA 1OGYA 2NVYA 2O5JD
chains in the Genus database with same CATH topology
2KI8A 1H0HA 5B6CA 5FTMA 1WCMA 4C2MA 1Q16A 2WAQA 2JIPA 2JIOA 3IR7A 3H0GA 1PQEA 3FKIA 3GTOA 1CZ5A 1H5NA 3GTPA 4QIWA 1G8JA 1SMYD 1I3QA 1Y4ZA 4AZDA 2JA5A 1DMSA 3IR5A 1FDOA 2JA6A 3TM7B 2A69D 1YNJD 1S3SA 1K83A 1PT0A 2BE5D 4KO8A 5FTNA 1WLFA 1E32A 5EPPA 1YNND 5DYGA 2EEOB 4GA6A 3HKZA 1TWCA 2IV2X 2R93A 2NAPA 1TWFA 2G6GA 3QWZA 5FTKA 3GTKA 4KDIA 2Y0SA 4KODA 2YUJA 3HU2A 1Y1VA 1KQGA 5T5MD 5T5ID 1TWHA 2A6HD 1R27A 1Y5IA 1E5VA 1E18A 2E7ZA 2AE0X 1SFOA 1YLEA 2PMZA 3GTQA 1ZC1A 2A68D 1CZ4A 1QDNA 1UHEA 2JIQA 2A6ED 2VPWA 2JIMA 2R92A 2R7ZA 3DMRA 2NYAA 3GTMA 2DMRA 1PPYA 3PLXB 2V3VA 1TMOA 1PT1A 1PYUB 3IR6A 5FTJA 1R7RA 2B63A 1QCSA 2GAEA 3GTJA 4AONB 3GTGA 1E60A 3HU1A 1TWAA 2NVXA 2PJJA 4CS0A 1FDIA 1ZYRD 1R9TA 4AYBA 4DMRA 3CQZA 5C1BA 1CR5A 3HU3A 3TIWA 2YU9A 4NOHA 2V45A 2VPZA 4GA5A 4AAYA 1KQFA 5GLFA 1UHDA 3CF2A 2PNWA 1PQFA 4RV0A 2G5DA 1VC3B 2E2IA 1Y1WA 3QQ7A 3GTLA 1PYQA 5C18A 1AW8B 1PQHA 2JIRA 2E2HA 1G8KA 2C45A 2PI8A 4KLNA 3O5AA 1I50A 3CZBA 5FTLA 2PJHB 2VPYA 2PICA 5DYIA 4AOKB 2JA7A 3OUGA 4CRYG 3ML1A 1AA6A 2WB1A 1IW7D 4CRZA 1SIWA 2CW0D 2VPXA 4D7ZB 1DMRA 1E61A 3QQ8A 4KDLA 1EU1A 1TWGA 3QC8A 2VUMA 1OGYA 2NVYA 2O5JD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI8 A;  1H0H A;  5B6C A;  5FTM A;  1WCM A;  4C2M A;  1Q16 A;  2WAQ A;  2JIP A;  2JIO A;  3IR7 A;  3H0G A;  1PQE A;  3FKI A;  3GTO A;  1CZ5 A;  1H5N A;  3GTP A;  4QIW A;  1G8J A;  1I3Q A;  1Y4Z A;  4AZD A;  2JA5 A;  1DMS A;  3IR5 A;  1FDO A;  2JA6 A;  3TM7 B;  1S3S A;  1K83 A;  1PT0 A;  4KO8 A;  5FTN A;  1WLF A;  1E32 A;  5EPP A;  5DYG A;  2EEO B;  4GA6 A;  3HKZ A;  1TWC A;  2IV2 X;  2R93 A;  2NAP A;  1TWF A;  3QWZ A;  3GTK A;  5FTK A;  4KDI A;  2Y0S A;  4KOD A;  3HU2 A;  1Y1V A;  1KQG A;  5T5M D;  5T5I D;  1TWH A;  1R27 A;  1Y5I A;  1E5V A;  1E18 A;  2E7Z A;  1SFO A;  1YLE A;  2PMZ A;  3GTQ A;  1CZ4 A;  1QDN A;  1UHE A;  2JIQ A;  2VPW A;  2JIM A;  2R92 A;  2R7Z A;  3DMR A;  2NYA A;  3GTM A;  2DMR A;  1PPY A;  3PLX B;  2V3V A;  1TMO A;  1PT1 A;  1PYU B;  3IR6 A;  5FTJ A;  1R7R A;  2B63 A;  1QCS A;  3GTJ A;  4AON B;  3GTG A;  1E60 A;  3HU1 A;  1TWA A;  2NVX A;  4CS0 A;  1FDI A;  1R9T A;  4AYB A;  4DMR A;  3CQZ A;  5C1B A;  1CR5 A;  3HU3 A;  3TIW A;  2YU9 A;  2V45 A;  2VPZ A;  4GA5 A;  4AAY A;  1KQF A;  5GLF A;  1UHD A;  3CF2 A;  1PQF A;  4RV0 A;  1VC3 B;  2E2I A;  1Y1W A;  3QQ7 A;  3GTL A;  1PYQ A;  5C18 A;  1AW8 B;  1PQH A;  2JIR A;  2E2H A;  1G8K A;  2C45 A;  4KLN A;  3O5A A;  1I50 A;  5FTL A;  2PJH B;  2VPY A;  5DYI A;  4AOK B;  2JA7 A;  3OUG A;  4CRY G;  3ML1 A;  1AA6 A;  2WB1 A;  1IW7 D;  4CRZ A;  1SIW A;  2VPX A;  4D7Z B;  1DMR A;  1E61 A;  3QQ8 A;  4KDL A;  1EU1 A;  1TWG A;  3QC8 A;  2VUM A;  1OGY A;  2NVY A; 
#chains in the Genus database with same CATH topology
 2KI8 A;  1H0H A;  5B6C A;  5FTM A;  1WCM A;  4C2M A;  1Q16 A;  2WAQ A;  2JIP A;  2JIO A;  3IR7 A;  3H0G A;  1PQE A;  3FKI A;  3GTO A;  3SUJ A;  1CZ5 A;  1H5N A;  3GTP A;  4QIW A;  1G8J A;  1SMY D;  1I3Q A;  1Y4Z A;  4FG2 A;  4AZD A;  2JA5 A;  1DMS A;  3IR5 A;  1FDO A;  2JA6 A;  3TM7 B;  2A69 D;  1YNJ D;  3X2H A;  1S3S A;  1K83 A;  4L48 A;  1PT0 A;  2BE5 D;  4KO8 A;  5FTN A;  1WLF A;  1N10 A;  1E32 A;  1WC2 A;  5EPP A;  1YNN D;  5DYG A;  2EEO B;  4GA6 A;  3HKZ A;  1TWC A;  2IV2 X;  2R93 A;  2NAP A;  1TWF A;  2G6G A;  1OA7 A;  3QWZ A;  5FTK A;  4JP7 A;  4KDI A;  5GLY A;  3X2G A;  3GTK A;  1BW4 A;  2Y0S A;  4KOD A;  2YUJ A;  3HU2 A;  1Y1V A;  1KQG A;  5T5M D;  5T5I D;  1TWH A;  2A6H D;  1R27 A;  4JP6 A;  1Y5I A;  3ENG A;  1E5V A;  1E18 A;  2E7Z A;  2AE0 X;  1SFO A;  1YLE A;  2PMZ A;  2BH0 A;  3X2O A;  3GTQ A;  1ZC1 A;  2A68 D;  1CZ4 A;  1QDN A;  1UHE A;  2JIQ A;  4ENG A;  2A6E D;  2VPW A;  2JIM A;  3X2M A;  2R92 A;  3DMR A;  2R7Z A;  2NYA A;  5H4U A;  3GTM A;  2DMR A;  1PPY A;  3PLX B;  2V3V A;  1TMO A;  1PT1 A;  1PYU B;  3IR6 A;  5FTJ A;  4ZM7 A;  2HCZ X;  1R7R A;  2B63 A;  4FFT A;  1QCS A;  2GAE A;  3GTJ A;  4AON B;  3GTG A;  1E60 A;  3HU1 A;  1TWA A;  3X2I A;  2NVX A;  2PJJ A;  4CS0 A;  1FDI A;  1ZYR D;  1R9T A;  2KQA A;  4AYB A;  4DMR A;  3CQZ A;  5C1B A;  1CR5 A;  3HU3 A;  3TIW A;  2YU9 A;  4NOH A;  2V45 A;  2VPZ A;  4GA5 A;  4AAY A;  2ENG A;  1KQF A;  5GLF A;  1UHD A;  3CF2 A;  2PNW A;  3X2N A;  1PQF A;  3M3G A;  4RV0 A;  3SUL A;  2G5D A;  1VC3 B;  2E2I A;  1Y1W A;  3QQ7 A;  3GTL A;  1PYQ A;  3D30 A;  5C18 A;  1AW8 B;  1PQH A;  2JIR A;  2E2H A;  1G8K A;  4JCW A;  4JJO A;  2C45 A;  3X2J A;  2PI8 A;  4JS7 A;  3X2K A;  4KLN A;  3O5A A;  1I50 A;  3CZB A;  4AVR A;  5FTL A;  2PJH B;  2VPY A;  3X2L A;  2PIC A;  4FER A;  5DYI A;  3SUK A;  4AOK B;  2JA7 A;  1L8F A;  3OUG A;  3SUM A;  4CRY G;  5GM9 A;  3ML1 A;  4FG4 A;  5GLX A;  1AA6 A;  2WB1 A;  1IW7 D;  4CRZ A;  1SIW A;  2CW0 D;  2VPX A;  1OA9 A;  1HD5 A;  4D7Z B;  1DMR A;  1E61 A;  3QQ8 A;  4KDL A;  1EU1 A;  1TWG A;  3QC8 A;  1BW3 A;  2VUM A;  3X2P A;  1OGY A;  2NVY A;  2O5J D; 
#chains in the Genus database with same CATH homology
 2KI8 A;  1H0H A;  5B6C A;  5FTM A;  1WCM A;  4C2M A;  1Q16 A;  2WAQ A;  2JIP A;  2JIO A;  3IR7 A;  3H0G A;  1PQE A;  3FKI A;  3GTO A;  1CZ5 A;  1H5N A;  3GTP A;  4QIW A;  1G8J A;  1SMY D;  1I3Q A;  1Y4Z A;  4AZD A;  2JA5 A;  1DMS A;  3IR5 A;  1FDO A;  2JA6 A;  3TM7 B;  2A69 D;  1YNJ D;  1S3S A;  1K83 A;  1PT0 A;  2BE5 D;  4KO8 A;  5FTN A;  1WLF A;  1E32 A;  5EPP A;  1YNN D;  5DYG A;  2EEO B;  4GA6 A;  3HKZ A;  1TWC A;  2IV2 X;  2R93 A;  2NAP A;  1TWF A;  2G6G A;  3QWZ A;  5FTK A;  3GTK A;  4KDI A;  2Y0S A;  4KOD A;  2YUJ A;  3HU2 A;  1Y1V A;  1KQG A;  5T5M D;  5T5I D;  1TWH A;  2A6H D;  1R27 A;  1Y5I A;  1E5V A;  1E18 A;  2E7Z A;  2AE0 X;  1SFO A;  1YLE A;  2PMZ A;  3GTQ A;  1ZC1 A;  2A68 D;  1CZ4 A;  1QDN A;  1UHE A;  2JIQ A;  2A6E D;  2VPW A;  2JIM A;  2R92 A;  2R7Z A;  3DMR A;  2NYA A;  3GTM A;  2DMR A;  1PPY A;  3PLX B;  2V3V A;  1TMO A;  1PT1 A;  1PYU B;  3IR6 A;  5FTJ A;  1R7R A;  2B63 A;  1QCS A;  2GAE A;  3GTJ A;  4AON B;  3GTG A;  1E60 A;  3HU1 A;  1TWA A;  2NVX A;  2PJJ A;  4CS0 A;  1FDI A;  1ZYR D;  1R9T A;  4AYB A;  4DMR A;  3CQZ A;  5C1B A;  1CR5 A;  3HU3 A;  3TIW A;  2YU9 A;  4NOH A;  2V45 A;  2VPZ A;  4GA5 A;  4AAY A;  1KQF A;  5GLF A;  1UHD A;  3CF2 A;  2PNW A;  1PQF A;  4RV0 A;  2G5D A;  1VC3 B;  2E2I A;  1Y1W A;  3QQ7 A;  3GTL A;  1PYQ A;  5C18 A;  1AW8 B;  1PQH A;  2JIR A;  2E2H A;  1G8K A;  2C45 A;  2PI8 A;  4KLN A;  3O5A A;  1I50 A;  3CZB A;  5FTL A;  2PJH B;  2VPY A;  2PIC A;  5DYI A;  4AOK B;  2JA7 A;  3OUG A;  4CRY G;  3ML1 A;  1AA6 A;  2WB1 A;  1IW7 D;  4CRZ A;  1SIW A;  2CW0 D;  2VPX A;  4D7Z B;  1DMR A;  1E61 A;  3QQ8 A;  4KDL A;  1EU1 A;  1TWG A;  3QC8 A;  2VUM A;  1OGY A;  2NVY A;  2O5J D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...