4AONB

Conformational dynamics of aspartate alpha-decarboxylase active site revealed by protein-ligand complexes: 1-methyl-l-aspartate complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE-ALPHA-DECARBOXYLASE BETA CHAIN
publication title Conformational Dynamics of Aspartate Alpha Decarboxylase Active Site Revealed by Protein-Ligand Complexes
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 23
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2012-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4aonB00
1AA6A 1AW8B 2E2IA 1CZ5A 2VPZA 3CF2A 2IV2X 4AOKB 1CZ4A 2R92A 2JIRA 3TM7B 3O5AA 2E7ZA 3IR6A 5T5ID 1TMOA 3HU1A 3H0GA 3QQ7A 3QWZA 5DYIA 1R9TA 2JA5A 2YU9A 3QC8A 4QIWA 2V3VA 5T5MD 2VPYA 4GA6A 3GTLA 1PYUB 3GTOA 1E32A 4AONB 3ML1A 2B63A 5FTKA 4AZDA 5B6CA 3QQ8A 1Y1VA 3PLXB 1OGYA 2DMRA 2JIMA 1KQGA 3GTPA 3HKZA 1E5VA 1PPYA 1Y1WA 4AYBA 5DYGA 2JA6A 5C1BA 1H5NA 1S3SA 2V45A 1FDOA 2NVXA 1VC3B 1PQHA 4KODA 5C18A 4KDLA 1QCSA 2VPXA 1K83A 4DMRA 1YLEA 3CQZA 2JIOA 1G8KA 1TWGA 1G8JA 5EPPA 1PQFA 1PQEA 3IR7A 2E2HA 1TWHA 3FKIA 4C2MA 4CS0A 1Y4ZA 1UHDA 5FTMA 2PMZA 4KO8A 1Y5IA 3HU2A 1EU1A 2VUMA 1R7RA 1KQFA 3TIWA 1SFOA 3GTMA 1WCMA 3GTQA 3DMRA 2NYAA 1PT1A 1E61A 1QDNA 1PT0A 3GTGA 2R93A 4GA5A 3IR5A 1TWAA 4CRZA 3GTKA 5FTNA 2NAPA 1I3QA 1IW7D 1FDIA 4KLNA 5FTJA 1TWCA 1SIWA 2Y0SA 1R27A 4RV0A 2KI8A 2C45A 1I50A 4CRYG 2EEOB 2NVYA 1WLFA 1UHEA 4AAYA 2JIPA 1E60A 5FTLA 3GTJA 1DMRA 2R7ZA 2WB1A 2WAQA 3OUGA 4D7ZB 1Q16A 3HU3A 1CR5A 2VPWA 2JA7A 4KDIA 1E18A 1H0HA 5GLFA 1DMSA 2PJHB 2JIQA 1PYQA 1TWFA
chains in the Genus database with same CATH superfamily
1AA6A 1AW8B 2PICA 2E2IA 1CZ5A 4AVRA 2VPZA 3CF2A 2PI8A 2IV2X 4AOKB 1CZ4A 2R92A 2JIRA 3X2OA 5H4UA 3TM7B 3O5AA 1YNJD 2BH0A 2E7ZA 3IR6A 4FFTA 5T5ID 1TMOA 3HU1A 3H0GA 4JP6A 2KQAA 3QQ7A 3QWZA 5DYIA 1R9TA 2JA5A 1BW4A 2YU9A 3QC8A 4QIWA 3SULA 2V3VA 5T5MD 2VPYA 4GA6A 3GTLA 1PYUB 4FG4A 3GTOA 1E32A 4AONB 2PNWA 3ML1A 4FERA 2B63A 1ZC1A 5FTKA 4AZDA 5B6CA 2A6ED 3QQ8A 1Y1VA 2A6HD 3PLXB 3SUMA 1BW3A 1OGYA 2DMRA 2G6GA 2JIMA 1KQGA 3GTPA 3HKZA 2G5DA 4JS7A 1E5VA 1PPYA 1Y1WA 4AYBA 5DYGA 2JA6A 5C1BA 1H5NA 1S3SA 2V45A 1FDOA 2NVXA 3D30A 2O5JD 1VC3B 1PQHA 4KODA 5C18A 4KDLA 1QCSA 2VPXA 1K83A 5GLYA 4DMRA 1YLEA 3CQZA 2JIOA 2YUJA 3X2NA 1G8KA 1TWGA 1G8JA 1WC2A 5EPPA 3X2KA 1PQFA 1PQEA 3IR7A 2E2HA 3X2JA 1TWHA 3FKIA 4C2MA 4CS0A 2A69D 1Y4ZA 1UHDA 5FTMA 2AE0X 2PMZA 4KO8A 1YNND 1Y5IA 3HU2A 3X2PA 1EU1A 2VUMA 1R7RA 1KQFA 1OA7A 2CW0D 5GM9A 2PJJA 3TIWA 4JCWA 3X2IA 2GAEA 3SUKA 2JIQA 1SFOA 4FG2A 4JP7A 3GTMA 1WCMA 1OA9A 1ZYRD 4ENGA 3DMRA 3X2LA 3GTQA 2NYAA 1PT1A 1E61A 1QDNA 1PT0A 3GTGA 4JJOA 4GA5A 2R93A 1HD5A 3IR5A 1N10A 3X2HA 4L48A 1TWAA 1SMYD 4CRZA 4ZM7A 4NOHA 3GTKA 5FTNA 2NAPA 1I3QA 2A68D 1IW7D 1FDIA 4KLNA 3CZBA 5FTJA 1TWCA 1SIWA 2BE5D 2Y0SA 1R27A 4RV0A 2KI8A 2C45A 1I50A 2HCZX 3ENGA 2EEOB 2NVYA 1WLFA 4AAYA 4CRYG 2JIPA 3X2MA 1E60A 5FTLA 3GTJA 1DMRA 2R7ZA 2ENGA 2WB1A 2WAQA 3OUGA 3SUJA 4D7ZB 1Q16A 3HU3A 1CR5A 2VPWA 2JA7A 4KDIA 3X2GA 1E18A 1H0HA 3M3GA 5GLFA 5GLXA 1DMSA 2PJHB 1UHEA 1PYQA 1L8FA 1TWFA
chains in the Genus database with same CATH topology
1AA6A 1AW8B 2PICA 2E2IA 1CZ5A 2VPZA 3CF2A 2PI8A 2IV2X 4AOKB 1CZ4A 2R92A 2JIRA 3TM7B 3O5AA 1YNJD 2E7ZA 3IR6A 5T5ID 1TMOA 3HU1A 3H0GA 3QQ7A 3QWZA 5DYIA 1R9TA 2JA5A 2YU9A 3QC8A 4QIWA 2V3VA 5T5MD 2VPYA 4GA6A 3GTLA 1PYUB 3GTOA 1E32A 4AONB 2PNWA 3ML1A 2B63A 1ZC1A 5FTKA 4AZDA 5B6CA 2A6ED 3QQ8A 1Y1VA 2A6HD 3PLXB 1OGYA 2DMRA 2G6GA 2JIMA 1KQGA 3GTPA 3HKZA 2G5DA 1E5VA 1PPYA 1Y1WA 4AYBA 5DYGA 2JA6A 5C1BA 1H5NA 1S3SA 2V45A 1FDOA 2NVXA 2O5JD 1VC3B 1PQHA 4KODA 5C18A 4KDLA 1QCSA 2VPXA 1K83A 4DMRA 1YLEA 3CQZA 2JIOA 2YUJA 1G8KA 1TWGA 1G8JA 5EPPA 1PQFA 1PQEA 3IR7A 2E2HA 1TWHA 3FKIA 4C2MA 4CS0A 2A69D 1Y4ZA 1UHDA 5FTMA 2AE0X 2PMZA 4KO8A 1YNND 1Y5IA 3HU2A 1EU1A 2VUMA 1R7RA 1KQFA 2CW0D 2PJJA 3TIWA 2GAEA 1SFOA 3GTMA 1WCMA 1ZYRD 3GTQA 3DMRA 2NYAA 1PT1A 1E61A 1QDNA 1PT0A 3GTGA 2R93A 4GA5A 3IR5A 1TWAA 1SMYD 4CRZA 4NOHA 3GTKA 5FTNA 2NAPA 1I3QA 2A68D 1IW7D 1FDIA 4KLNA 3CZBA 5FTJA 1TWCA 1SIWA 2BE5D 2Y0SA 1R27A 4RV0A 2KI8A 2C45A 1I50A 4CRYG 2EEOB 1UHEA 1WLFA 2NVYA 4AAYA 2JIPA 1E60A 5FTLA 3GTJA 1DMRA 2R7ZA 2WB1A 2WAQA 3OUGA 4D7ZB 1Q16A 3HU3A 1CR5A 2VPWA 2JA7A 4KDIA 1E18A 1H0HA 5GLFA 1DMSA 2PJHB 2JIQA 1PYQA 1TWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AA6 A;  1AW8 B;  2E2I A;  1CZ5 A;  2VPZ A;  3CF2 A;  2IV2 X;  4AOK B;  1CZ4 A;  2R92 A;  2JIR A;  3TM7 B;  3O5A A;  2E7Z A;  3IR6 A;  5T5I D;  1TMO A;  3HU1 A;  3H0G A;  3QQ7 A;  3QWZ A;  5DYI A;  1R9T A;  2JA5 A;  2YU9 A;  3QC8 A;  4QIW A;  2V3V A;  5T5M D;  2VPY A;  4GA6 A;  3GTL A;  1PYU B;  3GTO A;  1E32 A;  4AON B;  3ML1 A;  2B63 A;  5FTK A;  4AZD A;  5B6C A;  3QQ8 A;  1Y1V A;  3PLX B;  1OGY A;  2DMR A;  2JIM A;  1KQG A;  3GTP A;  3HKZ A;  1E5V A;  1PPY A;  1Y1W A;  4AYB A;  5DYG A;  2JA6 A;  5C1B A;  1H5N A;  1S3S A;  2V45 A;  1FDO A;  2NVX A;  1VC3 B;  1PQH A;  4KOD A;  5C18 A;  4KDL A;  1QCS A;  2VPX A;  1K83 A;  4DMR A;  1YLE A;  3CQZ A;  2JIO A;  1G8K A;  1TWG A;  1G8J A;  5EPP A;  1PQF A;  1PQE A;  3IR7 A;  2E2H A;  1TWH A;  3FKI A;  4C2M A;  4CS0 A;  1Y4Z A;  1UHD A;  5FTM A;  2PMZ A;  4KO8 A;  1Y5I A;  3HU2 A;  1EU1 A;  2VUM A;  1R7R A;  1KQF A;  3TIW A;  1SFO A;  3GTM A;  1WCM A;  3GTQ A;  3DMR A;  2NYA A;  1PT1 A;  1E61 A;  1QDN A;  1PT0 A;  3GTG A;  2R93 A;  4GA5 A;  3IR5 A;  1TWA A;  4CRZ A;  3GTK A;  5FTN A;  2NAP A;  1I3Q A;  1IW7 D;  1FDI A;  4KLN A;  5FTJ A;  1TWC A;  1SIW A;  2Y0S A;  1R27 A;  4RV0 A;  2KI8 A;  2C45 A;  1I50 A;  4CRY G;  2EEO B;  2NVY A;  1WLF A;  1UHE A;  4AAY A;  2JIP A;  1E60 A;  5FTL A;  3GTJ A;  1DMR A;  2R7Z A;  2WB1 A;  2WAQ A;  3OUG A;  4D7Z B;  1Q16 A;  3HU3 A;  1CR5 A;  2VPW A;  2JA7 A;  4KDI A;  1E18 A;  1H0H A;  5GLF A;  1DMS A;  2PJH B;  2JIQ A;  1PYQ A;  1TWF A; 
#chains in the Genus database with same CATH topology
 1AA6 A;  1AW8 B;  2PIC A;  2E2I A;  1CZ5 A;  4AVR A;  2VPZ A;  3CF2 A;  2PI8 A;  2IV2 X;  4AOK B;  1CZ4 A;  2R92 A;  2JIR A;  3X2O A;  5H4U A;  3TM7 B;  3O5A A;  1YNJ D;  2BH0 A;  2E7Z A;  3IR6 A;  4FFT A;  5T5I D;  1TMO A;  3HU1 A;  3H0G A;  4JP6 A;  2KQA A;  3QQ7 A;  3QWZ A;  5DYI A;  1R9T A;  2JA5 A;  1BW4 A;  2YU9 A;  3QC8 A;  4QIW A;  3SUL A;  2V3V A;  5T5M D;  2VPY A;  4GA6 A;  3GTL A;  1PYU B;  4FG4 A;  3GTO A;  1E32 A;  4AON B;  2PNW A;  3ML1 A;  4FER A;  2B63 A;  1ZC1 A;  5FTK A;  4AZD A;  5B6C A;  2A6E D;  3QQ8 A;  1Y1V A;  2A6H D;  3PLX B;  3SUM A;  1BW3 A;  1OGY A;  2DMR A;  2G6G A;  2JIM A;  1KQG A;  3GTP A;  3HKZ A;  2G5D A;  4JS7 A;  1E5V A;  1PPY A;  1Y1W A;  4AYB A;  5DYG A;  2JA6 A;  5C1B A;  1H5N A;  1S3S A;  2V45 A;  1FDO A;  2NVX A;  3D30 A;  2O5J D;  1VC3 B;  1PQH A;  4KOD A;  5C18 A;  4KDL A;  1QCS A;  2VPX A;  1K83 A;  5GLY A;  4DMR A;  1YLE A;  3CQZ A;  2JIO A;  2YUJ A;  3X2N A;  1G8K A;  1TWG A;  1G8J A;  1WC2 A;  5EPP A;  3X2K A;  1PQF A;  1PQE A;  3IR7 A;  2E2H A;  3X2J A;  1TWH A;  3FKI A;  4C2M A;  4CS0 A;  2A69 D;  1Y4Z A;  1UHD A;  5FTM A;  2AE0 X;  2PMZ A;  4KO8 A;  1YNN D;  1Y5I A;  3HU2 A;  3X2P A;  1EU1 A;  2VUM A;  1R7R A;  1KQF A;  1OA7 A;  2CW0 D;  5GM9 A;  2PJJ A;  3TIW A;  4JCW A;  3X2I A;  2GAE A;  3SUK A;  2JIQ A;  1SFO A;  4FG2 A;  4JP7 A;  3GTM A;  1WCM A;  1OA9 A;  1ZYR D;  4ENG A;  3DMR A;  3X2L A;  3GTQ A;  2NYA A;  1PT1 A;  1E61 A;  1QDN A;  1PT0 A;  3GTG A;  4JJO A;  4GA5 A;  2R93 A;  1HD5 A;  3IR5 A;  1N10 A;  3X2H A;  4L48 A;  1TWA A;  1SMY D;  4CRZ A;  4ZM7 A;  4NOH A;  3GTK A;  5FTN A;  2NAP A;  1I3Q A;  2A68 D;  1IW7 D;  1FDI A;  4KLN A;  3CZB A;  5FTJ A;  1TWC A;  1SIW A;  2BE5 D;  2Y0S A;  1R27 A;  4RV0 A;  2KI8 A;  2C45 A;  1I50 A;  2HCZ X;  3ENG A;  2EEO B;  2NVY A;  1WLF A;  4AAY A;  4CRY G;  2JIP A;  3X2M A;  1E60 A;  5FTL A;  3GTJ A;  1DMR A;  2R7Z A;  2ENG A;  2WB1 A;  2WAQ A;  3OUG A;  3SUJ A;  4D7Z B;  1Q16 A;  3HU3 A;  1CR5 A;  2VPW A;  2JA7 A;  4KDI A;  3X2G A;  1E18 A;  1H0H A;  3M3G A;  5GLF A;  5GLX A;  1DMS A;  2PJH B;  1UHE A;  1PYQ A;  1L8F A;  1TWF A; 
#chains in the Genus database with same CATH homology
 1AA6 A;  1AW8 B;  2PIC A;  2E2I A;  1CZ5 A;  2VPZ A;  3CF2 A;  2PI8 A;  2IV2 X;  4AOK B;  1CZ4 A;  2R92 A;  2JIR A;  3TM7 B;  3O5A A;  1YNJ D;  2E7Z A;  3IR6 A;  5T5I D;  1TMO A;  3HU1 A;  3H0G A;  3QQ7 A;  3QWZ A;  5DYI A;  1R9T A;  2JA5 A;  2YU9 A;  3QC8 A;  4QIW A;  2V3V A;  5T5M D;  2VPY A;  4GA6 A;  3GTL A;  1PYU B;  3GTO A;  1E32 A;  4AON B;  2PNW A;  3ML1 A;  2B63 A;  1ZC1 A;  5FTK A;  4AZD A;  5B6C A;  2A6E D;  3QQ8 A;  1Y1V A;  2A6H D;  3PLX B;  1OGY A;  2DMR A;  2G6G A;  2JIM A;  1KQG A;  3GTP A;  3HKZ A;  2G5D A;  1E5V A;  1PPY A;  1Y1W A;  4AYB A;  5DYG A;  2JA6 A;  5C1B A;  1H5N A;  1S3S A;  2V45 A;  1FDO A;  2NVX A;  2O5J D;  1VC3 B;  1PQH A;  4KOD A;  5C18 A;  4KDL A;  1QCS A;  2VPX A;  1K83 A;  4DMR A;  1YLE A;  3CQZ A;  2JIO A;  2YUJ A;  1G8K A;  1TWG A;  1G8J A;  5EPP A;  1PQF A;  1PQE A;  3IR7 A;  2E2H A;  1TWH A;  3FKI A;  4C2M A;  4CS0 A;  2A69 D;  1Y4Z A;  1UHD A;  5FTM A;  2AE0 X;  2PMZ A;  4KO8 A;  1YNN D;  1Y5I A;  3HU2 A;  1EU1 A;  2VUM A;  1R7R A;  1KQF A;  2CW0 D;  2PJJ A;  3TIW A;  2GAE A;  1SFO A;  3GTM A;  1WCM A;  1ZYR D;  3GTQ A;  3DMR A;  2NYA A;  1PT1 A;  1E61 A;  1QDN A;  1PT0 A;  3GTG A;  2R93 A;  4GA5 A;  3IR5 A;  1TWA A;  1SMY D;  4CRZ A;  4NOH A;  3GTK A;  5FTN A;  2NAP A;  1I3Q A;  2A68 D;  1IW7 D;  1FDI A;  4KLN A;  3CZB A;  5FTJ A;  1TWC A;  1SIW A;  2BE5 D;  2Y0S A;  1R27 A;  4RV0 A;  2KI8 A;  2C45 A;  1I50 A;  4CRY G;  2EEO B;  1UHE A;  1WLF A;  2NVY A;  4AAY A;  2JIP A;  1E60 A;  5FTL A;  3GTJ A;  1DMR A;  2R7Z A;  2WB1 A;  2WAQ A;  3OUG A;  4D7Z B;  1Q16 A;  3HU3 A;  1CR5 A;  2VPW A;  2JA7 A;  4KDI A;  1E18 A;  1H0H A;  5GLF A;  1DMS A;  2PJH B;  2JIQ A;  1PYQ A;  1TWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...