4AONB

Conformational dynamics of aspartate alpha-decarboxylase active site revealed by protein-ligand complexes: 1-methyl-l-aspartate complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE-ALPHA-DECARBOXYLASE BETA CHAIN
publication title Conformational Dynamics of Aspartate Alpha Decarboxylase Active Site Revealed by Protein-Ligand Complexes
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 23
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2012-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4aonB00
4D7ZB 4C2MA 1E18A 2R7ZA 1SFOA 2DMRA 2YU9A 1TWFA 1R7RA 3PLXB 1KQFA 1TWHA 2JA7A 4DMRA 1QCSA 3IR5A 1PT0A 5FTLA 1Y4ZA 1PQFA 5GLFA 1PT1A 3GTMA 3GTGA 2KI8A 3GTKA 1VC3B 2JIPA 2E2HA 2Y0SA 1FDOA 5EPPA 1Q16A 3O5AA 1E5VA 2E2IA 4KODA 1WCMA 2VPXA 3QWZA 1TWAA 2NVXA 1Y5IA 2PJHB 2PMZA 3OUGA 2WAQA 1E61A 5DYGA 2JIMA 3FKIA 3TM7B 4QIWA 2NYAA 1R27A 5FTKA 1PQHA 2VPZA 2IV2X 1TWCA 5B6CA 2B63A 4AYBA 4KLNA 2EEOB 3CQZA 1OGYA 4KDIA 2NVYA 4KDLA 1CZ5A 1PQEA 1TWGA 3TIWA 3DMRA 5T5MD 1R9TA 2NAPA 2V3VA 2WB1A 5DYIA 1H0HA 1FDIA 3IR7A 1I3QA 1IW7D 4AOKB 1Y1VA 2V45A 1AA6A 2E7ZA 1KQGA 2JIQA 2R93A 1E60A 1H5NA 1PYUB 2VPWA 3QC8A 1G8JA 3GTPA 4GA5A 2R92A 1E32A 1DMSA 1S3SA 1YLEA 3CF2A 3HU3A 4RV0A 1CZ4A 2JIOA 5C1BA 3GTQA 2JA6A 5FTMA 3HU2A 1Y1WA 4AAYA 1SIWA 1PPYA 1UHEA 5T5ID 2JA5A 3ML1A 2C45A 4GA6A 1TMOA 3HU1A 3GTLA 5FTNA 2VPYA 4CRYG 1WLFA 1EU1A 3GTOA 1QDNA 3QQ7A 4CS0A 5C18A 2VUMA 3IR6A 1G8KA 4AZDA 1DMRA 3GTJA 1K83A 2JIRA 1UHDA 3HKZA 1CR5A 3QQ8A 5FTJA 4AONB 1AW8B 3H0GA 1I50A 4KO8A 1PYQA 4CRZA
chains in the Genus database with same CATH superfamily
1HD5A 4JP7A 2A6ED 4D7ZB 4C2MA 1E18A 2R7ZA 2HCZX 1SFOA 2DMRA 2YU9A 1TWFA 1R7RA 2G6GA 3PLXB 4JS7A 4JP6A 1KQFA 3X2PA 1TWHA 2JA7A 3X2MA 4DMRA 1QCSA 3IR5A 1PT0A 4FG4A 1Y4ZA 3X2LA 5FTLA 3SULA 1PQFA 2PJJA 3ENGA 5GLFA 1PT1A 3GTMA 3GTGA 2KI8A 3GTKA 1VC3B 3X2GA 2JIPA 2A6HD 2E2HA 1BW3A 2Y0SA 5GLYA 1FDOA 5EPPA 3SUJA 1Q16A 3O5AA 1E5VA 3D30A 1SMYD 2E2IA 3X2IA 4KODA 2ENGA 1WCMA 2VPXA 3QWZA 1TWAA 3X2HA 2GAEA 2PICA 1Y5IA 2PJHB 2PMZA 3OUGA 2WAQA 1E61A 5DYGA 2NVXA 2JIMA 3FKIA 3TM7B 2A68D 4AVRA 4QIWA 2G5DA 2NYAA 5H4UA 1R27A 5FTKA 1PQHA 2VPZA 2IV2X 1TWCA 4JCWA 3SUMA 5B6CA 3SUKA 2B63A 2PNWA 4AYBA 1ZC1A 4KLNA 4JJOA 2EEOB 3CQZA 1OGYA 4KDIA 2NVYA 4NOHA 4KDLA 4FFTA 1CZ5A 1YNND 3X2JA 1PQEA 1TWGA 3TIWA 3DMRA 5T5MD 1R9TA 2NAPA 3X2NA 2V3VA 2WB1A 5DYIA 1H0HA 1FDIA 3IR7A 1OA7A 1I3QA 1IW7D 4AOKB 3X2OA 1Y1VA 2BE5D 2V45A 2O5JD 1AA6A 2BH0A 1L8FA 1OA9A 2E7ZA 1KQGA 2JIQA 2R93A 1E60A 1H5NA 1PYUB 2VPWA 3QC8A 3M3GA 3X2KA 1G8JA 1BW4A 2AE0X 4GA5A 3GTPA 2R92A 1E32A 4ZM7A 2YUJA 2CW0D 3CZBA 1DMSA 1S3SA 1YLEA 3CF2A 3HU3A 4RV0A 1CZ4A 2JIOA 4ENGA 5C1BA 3GTQA 2JA6A 5FTMA 3HU2A 1Y1WA 4AAYA 4L48A 1SIWA 1PPYA 1UHEA 5T5ID 1ZYRD 2PI8A 2JA5A 3ML1A 2C45A 4GA6A 5GLXA 1TMOA 1N10A 3HU1A 1WC2A 3GTLA 5FTNA 2VPYA 4CRYG 1WLFA 1EU1A 4FERA 4FG2A 3GTOA 1QDNA 3QQ7A 4CS0A 5C18A 2VUMA 3IR6A 1G8KA 4AZDA 1DMRA 3GTJA 1K83A 1YNJD 2JIRA 5GM9A 1UHDA 3HKZA 1CR5A 2A69D 2KQAA 3QQ8A 5FTJA 1AW8B 3H0GA 4AONB 1I50A 4KO8A 1PYQA 4CRZA
chains in the Genus database with same CATH topology
2A6ED 4D7ZB 4C2MA 1E18A 2R7ZA 1SFOA 2DMRA 2YU9A 1TWFA 1R7RA 2G6GA 3PLXB 1KQFA 1TWHA 2JA7A 4DMRA 1QCSA 3IR5A 1PT0A 5FTLA 1Y4ZA 1PQFA 2PJJA 5GLFA 1PT1A 3GTMA 3GTGA 2KI8A 3GTKA 1VC3B 2JIPA 2A6HD 2E2HA 2Y0SA 1FDOA 5EPPA 1Q16A 3O5AA 1E5VA 1SMYD 2E2IA 4KODA 1WCMA 2VPXA 3QWZA 1TWAA 2GAEA 2PICA 1Y5IA 2PJHB 2PMZA 3OUGA 2WAQA 1E61A 5DYGA 2NVXA 2JIMA 3FKIA 3TM7B 2A68D 4QIWA 2G5DA 2NYAA 1R27A 5FTKA 1PQHA 2VPZA 2IV2X 1TWCA 5B6CA 2B63A 2PNWA 4AYBA 1ZC1A 4KLNA 2EEOB 3CQZA 1OGYA 4KDIA 2NVYA 4NOHA 4KDLA 1CZ5A 1YNND 1PQEA 1TWGA 3TIWA 3DMRA 5T5MD 1R9TA 2NAPA 2V3VA 2WB1A 5DYIA 1H0HA 1FDIA 3IR7A 1I3QA 1IW7D 4AOKB 1Y1VA 2BE5D 2V45A 2O5JD 1AA6A 2E7ZA 1KQGA 2JIQA 2R93A 1E60A 1H5NA 1PYUB 2VPWA 3QC8A 1G8JA 2AE0X 4GA5A 3GTPA 2R92A 1E32A 2YUJA 2CW0D 3CZBA 1DMSA 1S3SA 1YLEA 3CF2A 3HU3A 4RV0A 1CZ4A 2JIOA 5C1BA 3GTQA 2JA6A 5FTMA 3HU2A 1Y1WA 4AAYA 1SIWA 1PPYA 1UHEA 5T5ID 1ZYRD 2PI8A 2JA5A 3ML1A 2C45A 4GA6A 1TMOA 3HU1A 3GTLA 5FTNA 2VPYA 4CRYG 1WLFA 1EU1A 3GTOA 1QDNA 3QQ7A 4CS0A 5C18A 2VUMA 3IR6A 1G8KA 4AZDA 1DMRA 3GTJA 1K83A 1YNJD 2JIRA 1UHDA 3HKZA 1CR5A 2A69D 3QQ8A 5FTJA 4AONB 1AW8B 3H0GA 1I50A 4KO8A 1PYQA 4CRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D7Z B;  4C2M A;  1E18 A;  2R7Z A;  1SFO A;  2DMR A;  2YU9 A;  1TWF A;  1R7R A;  3PLX B;  1KQF A;  1TWH A;  2JA7 A;  4DMR A;  1QCS A;  3IR5 A;  1PT0 A;  5FTL A;  1Y4Z A;  1PQF A;  5GLF A;  1PT1 A;  3GTM A;  3GTG A;  2KI8 A;  3GTK A;  1VC3 B;  2JIP A;  2E2H A;  2Y0S A;  1FDO A;  5EPP A;  1Q16 A;  3O5A A;  1E5V A;  2E2I A;  4KOD A;  1WCM A;  2VPX A;  3QWZ A;  1TWA A;  2NVX A;  1Y5I A;  2PJH B;  2PMZ A;  3OUG A;  2WAQ A;  1E61 A;  5DYG A;  2JIM A;  3FKI A;  3TM7 B;  4QIW A;  2NYA A;  1R27 A;  5FTK A;  1PQH A;  2VPZ A;  2IV2 X;  1TWC A;  5B6C A;  2B63 A;  4AYB A;  4KLN A;  2EEO B;  3CQZ A;  1OGY A;  4KDI A;  2NVY A;  4KDL A;  1CZ5 A;  1PQE A;  1TWG A;  3TIW A;  3DMR A;  5T5M D;  1R9T A;  2NAP A;  2V3V A;  2WB1 A;  5DYI A;  1H0H A;  1FDI A;  3IR7 A;  1I3Q A;  1IW7 D;  4AOK B;  1Y1V A;  2V45 A;  1AA6 A;  2E7Z A;  1KQG A;  2JIQ A;  2R93 A;  1E60 A;  1H5N A;  1PYU B;  2VPW A;  3QC8 A;  1G8J A;  3GTP A;  4GA5 A;  2R92 A;  1E32 A;  1DMS A;  1S3S A;  1YLE A;  3CF2 A;  3HU3 A;  4RV0 A;  1CZ4 A;  2JIO A;  5C1B A;  3GTQ A;  2JA6 A;  5FTM A;  3HU2 A;  1Y1W A;  4AAY A;  1SIW A;  1PPY A;  1UHE A;  5T5I D;  2JA5 A;  3ML1 A;  2C45 A;  4GA6 A;  1TMO A;  3HU1 A;  3GTL A;  5FTN A;  2VPY A;  4CRY G;  1WLF A;  1EU1 A;  3GTO A;  1QDN A;  3QQ7 A;  4CS0 A;  5C18 A;  2VUM A;  3IR6 A;  1G8K A;  4AZD A;  1DMR A;  3GTJ A;  1K83 A;  2JIR A;  1UHD A;  3HKZ A;  1CR5 A;  3QQ8 A;  5FTJ A;  4AON B;  1AW8 B;  3H0G A;  1I50 A;  4KO8 A;  1PYQ A;  4CRZ A; 
#chains in the Genus database with same CATH topology
 1HD5 A;  4JP7 A;  2A6E D;  4D7Z B;  4C2M A;  1E18 A;  2R7Z A;  2HCZ X;  1SFO A;  2DMR A;  2YU9 A;  1TWF A;  1R7R A;  2G6G A;  3PLX B;  4JS7 A;  4JP6 A;  1KQF A;  3X2P A;  1TWH A;  2JA7 A;  3X2M A;  4DMR A;  1QCS A;  3IR5 A;  1PT0 A;  4FG4 A;  1Y4Z A;  3X2L A;  5FTL A;  3SUL A;  1PQF A;  2PJJ A;  3ENG A;  5GLF A;  1PT1 A;  3GTM A;  3GTG A;  2KI8 A;  3GTK A;  1VC3 B;  3X2G A;  2JIP A;  2A6H D;  2E2H A;  1BW3 A;  2Y0S A;  5GLY A;  1FDO A;  5EPP A;  3SUJ A;  1Q16 A;  3O5A A;  1E5V A;  3D30 A;  1SMY D;  2E2I A;  3X2I A;  4KOD A;  2ENG A;  1WCM A;  2VPX A;  3QWZ A;  1TWA A;  3X2H A;  2GAE A;  2PIC A;  1Y5I A;  2PJH B;  2PMZ A;  3OUG A;  2WAQ A;  1E61 A;  5DYG A;  2NVX A;  2JIM A;  3FKI A;  3TM7 B;  2A68 D;  4AVR A;  4QIW A;  2G5D A;  2NYA A;  5H4U A;  1R27 A;  5FTK A;  1PQH A;  2VPZ A;  2IV2 X;  1TWC A;  4JCW A;  3SUM A;  5B6C A;  3SUK A;  2B63 A;  2PNW A;  4AYB A;  1ZC1 A;  4KLN A;  4JJO A;  2EEO B;  3CQZ A;  1OGY A;  4KDI A;  2NVY A;  4NOH A;  4KDL A;  4FFT A;  1CZ5 A;  1YNN D;  3X2J A;  1PQE A;  1TWG A;  3TIW A;  3DMR A;  5T5M D;  1R9T A;  2NAP A;  3X2N A;  2V3V A;  2WB1 A;  5DYI A;  1H0H A;  1FDI A;  3IR7 A;  1OA7 A;  1I3Q A;  1IW7 D;  4AOK B;  3X2O A;  1Y1V A;  2BE5 D;  2V45 A;  2O5J D;  1AA6 A;  2BH0 A;  1L8F A;  1OA9 A;  2E7Z A;  1KQG A;  2JIQ A;  2R93 A;  1E60 A;  1H5N A;  1PYU B;  2VPW A;  3QC8 A;  3M3G A;  3X2K A;  1G8J A;  1BW4 A;  2AE0 X;  4GA5 A;  3GTP A;  2R92 A;  1E32 A;  4ZM7 A;  2YUJ A;  2CW0 D;  3CZB A;  1DMS A;  1S3S A;  1YLE A;  3CF2 A;  3HU3 A;  4RV0 A;  1CZ4 A;  2JIO A;  4ENG A;  5C1B A;  3GTQ A;  2JA6 A;  5FTM A;  3HU2 A;  1Y1W A;  4AAY A;  4L48 A;  1SIW A;  1PPY A;  1UHE A;  5T5I D;  1ZYR D;  2PI8 A;  2JA5 A;  3ML1 A;  2C45 A;  4GA6 A;  5GLX A;  1TMO A;  1N10 A;  3HU1 A;  1WC2 A;  3GTL A;  5FTN A;  2VPY A;  4CRY G;  1WLF A;  1EU1 A;  4FER A;  4FG2 A;  3GTO A;  1QDN A;  3QQ7 A;  4CS0 A;  5C18 A;  2VUM A;  3IR6 A;  1G8K A;  4AZD A;  1DMR A;  3GTJ A;  1K83 A;  1YNJ D;  2JIR A;  5GM9 A;  1UHD A;  3HKZ A;  1CR5 A;  2A69 D;  2KQA A;  3QQ8 A;  5FTJ A;  1AW8 B;  3H0G A;  4AON B;  1I50 A;  4KO8 A;  1PYQ A;  4CRZ A; 
#chains in the Genus database with same CATH homology
 2A6E D;  4D7Z B;  4C2M A;  1E18 A;  2R7Z A;  1SFO A;  2DMR A;  2YU9 A;  1TWF A;  1R7R A;  2G6G A;  3PLX B;  1KQF A;  1TWH A;  2JA7 A;  4DMR A;  1QCS A;  3IR5 A;  1PT0 A;  5FTL A;  1Y4Z A;  1PQF A;  2PJJ A;  5GLF A;  1PT1 A;  3GTM A;  3GTG A;  2KI8 A;  3GTK A;  1VC3 B;  2JIP A;  2A6H D;  2E2H A;  2Y0S A;  1FDO A;  5EPP A;  1Q16 A;  3O5A A;  1E5V A;  1SMY D;  2E2I A;  4KOD A;  1WCM A;  2VPX A;  3QWZ A;  1TWA A;  2GAE A;  2PIC A;  1Y5I A;  2PJH B;  2PMZ A;  3OUG A;  2WAQ A;  1E61 A;  5DYG A;  2NVX A;  2JIM A;  3FKI A;  3TM7 B;  2A68 D;  4QIW A;  2G5D A;  2NYA A;  1R27 A;  5FTK A;  1PQH A;  2VPZ A;  2IV2 X;  1TWC A;  5B6C A;  2B63 A;  2PNW A;  4AYB A;  1ZC1 A;  4KLN A;  2EEO B;  3CQZ A;  1OGY A;  4KDI A;  2NVY A;  4NOH A;  4KDL A;  1CZ5 A;  1YNN D;  1PQE A;  1TWG A;  3TIW A;  3DMR A;  5T5M D;  1R9T A;  2NAP A;  2V3V A;  2WB1 A;  5DYI A;  1H0H A;  1FDI A;  3IR7 A;  1I3Q A;  1IW7 D;  4AOK B;  1Y1V A;  2BE5 D;  2V45 A;  2O5J D;  1AA6 A;  2E7Z A;  1KQG A;  2JIQ A;  2R93 A;  1E60 A;  1H5N A;  1PYU B;  2VPW A;  3QC8 A;  1G8J A;  2AE0 X;  4GA5 A;  3GTP A;  2R92 A;  1E32 A;  2YUJ A;  2CW0 D;  3CZB A;  1DMS A;  1S3S A;  1YLE A;  3CF2 A;  3HU3 A;  4RV0 A;  1CZ4 A;  2JIO A;  5C1B A;  3GTQ A;  2JA6 A;  5FTM A;  3HU2 A;  1Y1W A;  4AAY A;  1SIW A;  1PPY A;  1UHE A;  5T5I D;  1ZYR D;  2PI8 A;  2JA5 A;  3ML1 A;  2C45 A;  4GA6 A;  1TMO A;  3HU1 A;  3GTL A;  5FTN A;  2VPY A;  4CRY G;  1WLF A;  1EU1 A;  3GTO A;  1QDN A;  3QQ7 A;  4CS0 A;  5C18 A;  2VUM A;  3IR6 A;  1G8K A;  4AZD A;  1DMR A;  3GTJ A;  1K83 A;  1YNJ D;  2JIR A;  1UHD A;  3HKZ A;  1CR5 A;  2A69 D;  3QQ8 A;  5FTJ A;  4AON B;  1AW8 B;  3H0G A;  1I50 A;  4KO8 A;  1PYQ A;  4CRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...