5H4UA

Crystal structure of cellulase from antarctic springtail, cryptopygus antarcticus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
208
Chain Sequence
b'LTSGSGVTTRYWDCCKPSCSWGGKASVTKPVRTCKANGNTTIDSNTQSGCNGGSSYVCNDQQPFTQGNVGYGFAAASISGQPESQTCCACYEMTFTNTAISGQKMIVQVTNTGSDLNGNHFDLMIPGGGVGIFNGCQSQWGAPSNGWGQRYGGISSQSECNQLPTSLRAGCNWRFGWFKNADNPSMKFTQVRCPTILTQKSQCVRTPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-beta-1,4-glucanase
molecule tags Hydrolase
source organism Cryptopygus antarcticus
publication title Genetic and Structural Characterization of a Thermo-Tolerant, Cold-Active, and Acidic Endo-beta-1,4-glucanase from Antarctic Springtail, Cryptopygus antarcticus.
pubmed doi rcsb
total genus 65
structure length 208
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5h4uA00
1N10A 2AE0X 3M3GA 1BW4A 3D30A 2PI8A 5GM9A 4FG4A 4FG2A 3ENGA 4FFTA 2G5DA 5GLYA 2GAEA 3X2OA 2PJJA 3CZBA 4JP7A 1BW3A 2G6GA 1L8FA 2ENGA 4JCWA 3SUMA 3X2IA 2BH0A 1WC2A 3X2MA 3X2PA 2HCZX 5GLXA 1HD5A 3SULA 4FERA 3X2KA 2PNWA 1OA7A 3X2JA 3X2GA 2KQAA 5H4UA 4JP6A 4ZM7A 3SUJA 3X2LA 4AVRA 4L48A 2PICA 4JS7A 3X2NA 3SUKA 4JJOA 4ENGA 3X2HA 1OA9A
chains in the Genus database with same CATH superfamily
2AE0X 5FTJA 1R27A 2R92A 3HKZA 1PYUB 2YU9A 4FG2A 2YUJA 5DYIA 2G5DA 1YNND 1YLEA 3TM7B 2A6HD 4AOKB 5T5ID 5FTNA 2ENGA 3X2IA 2PJHB 1DMRA 2V3VA 3X2MA 4AZDA 5C18A 2EEOB 5DYGA 1SFOA 1PQFA 3SULA 1E5VA 5B6CA 2JA5A 3X2JA 3HU2A 3X2GA 3O5AA 1SIWA 2E2HA 1CZ4A 1G8JA 1PYQA 1FDIA 1AW8B 1CR5A 2C45A 1OGYA 4JJOA 1E18A 1KQGA 4GA5A 3M3GA 2PMZA 2PI8A 4NOHA 2NVYA 2WB1A 1ZC1A 3QQ7A 3ENGA 4FFTA 5GLYA 3QWZA 5T5MD 2IV2X 1Q16A 1ZYRD 3X2OA 1R7RA 3CZBA 1UHDA 3GTGA 1BW3A 1L8FA 1YNJD 3QC8A 2Y0SA 4JCWA 3SUMA 3GTJA 2BH0A 3X2PA 2E7ZA 4CRZA 1PT0A 2V45A 1R9TA 4AONB 4CRYG 2VPXA 1QDNA 4KO8A 2JA7A 1CZ5A 1VC3B 2JIQA 4AYBA 2O5JD 2JA6A 4GA6A 3X2LA 1Y1VA 4JS7A 4D7ZB 3SUKA 2E2IA 2R93A 1WLFA 1E60A 1TWHA 3TIWA 1KQFA 1TWFA 3GTLA 3GTKA 5C1BA 3HU3A 1K83A 5GM9A 3X2HA 4RV0A 4FG4A 5FTMA 3H0GA 3ML1A 4AAYA 2NVXA 4KODA 2A68D 1I50A 1TMOA 3CQZA 1PQHA 1IW7D 3GTPA 5EPPA 2GAEA 4DMRA 4JP7A 2G6GA 4KDIA 1H5NA 1PQEA 1WC2A 3OUGA 2JIRA 3IR5A 2KI8A 2BE5D 4CS0A 1PPYA 2CW0D 4FERA 3IR6A 3GTOA 3X2KA 1OA7A 2PNWA 1DMSA 2KQAA 2JIPA 4JP6A 5H4UA 1WCMA 3GTMA 4QIWA 1AA6A 1H0HA 3X2NA 1UHEA 2B63A 1E61A 1FDOA 4ENGA 1OA9A 1N10A 1BW4A 3QQ8A 3D30A 2VUMA 1Y1WA 1EU1A 2NYAA 2WAQA 1TWAA 2JIMA 1I3QA 3DMRA 1PT1A 2VPZA 4KDLA 1S3SA 2PJJA 2R7ZA 1SMYD 5FTKA 1QCSA 1Y4ZA 1TWCA 3CF2A 3FKIA 2A6ED 2A69D 2VPWA 2VPYA 5FTLA 2HCZX 5GLXA 1HD5A 1E32A 1G8KA 3PLXB 3HU1A 5GLFA 1TWGA 4ZM7A 3SUJA 4C2MA 4AVRA 2DMRA 3GTQA 2PICA 1Y5IA 4KLNA 2JIOA 2NAPA 3IR7A 4L48A
chains in the Genus database with same CATH topology
1N10A 2AE0X 3M3GA 1BW4A 3D30A 2PI8A 5GM9A 4FG4A 4FG2A 3ENGA 4FFTA 2G5DA 5GLYA 2GAEA 3X2OA 2PJJA 3CZBA 4JP7A 1BW3A 2G6GA 1L8FA 2ENGA 4JCWA 3SUMA 3X2IA 2BH0A 1WC2A 3X2MA 3X2PA 2HCZX 5GLXA 1HD5A 3SULA 4FERA 3X2KA 2PNWA 1OA7A 3X2JA 3X2GA 2KQAA 5H4UA 4JP6A 4ZM7A 3SUJA 3X2LA 4AVRA 4L48A 2PICA 4JS7A 3X2NA 3SUKA 4JJOA 4ENGA 3X2HA 1OA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N10 A;  2AE0 X;  3M3G A;  1BW4 A;  3D30 A;  2PI8 A;  5GM9 A;  4FG4 A;  4FG2 A;  3ENG A;  4FFT A;  2G5D A;  5GLY A;  2GAE A;  3X2O A;  2PJJ A;  3CZB A;  4JP7 A;  1BW3 A;  2G6G A;  1L8F A;  2ENG A;  4JCW A;  3SUM A;  3X2I A;  2BH0 A;  1WC2 A;  3X2M A;  3X2P A;  2HCZ X;  5GLX A;  1HD5 A;  3SUL A;  4FER A;  3X2K A;  2PNW A;  1OA7 A;  3X2J A;  3X2G A;  2KQA A;  5H4U A;  4JP6 A;  4ZM7 A;  3SUJ A;  3X2L A;  4AVR A;  4L48 A;  2PIC A;  4JS7 A;  3X2N A;  3SUK A;  4JJO A;  4ENG A;  3X2H A;  1OA9 A; 
#chains in the Genus database with same CATH topology
 2AE0 X;  5FTJ A;  1R27 A;  2R92 A;  3HKZ A;  1PYU B;  2YU9 A;  4FG2 A;  2YUJ A;  5DYI A;  2G5D A;  1YNN D;  1YLE A;  3TM7 B;  2A6H D;  4AOK B;  5T5I D;  5FTN A;  2ENG A;  3X2I A;  2PJH B;  1DMR A;  2V3V A;  3X2M A;  4AZD A;  5C18 A;  2EEO B;  5DYG A;  1SFO A;  1PQF A;  3SUL A;  1E5V A;  5B6C A;  2JA5 A;  3X2J A;  3HU2 A;  3X2G A;  3O5A A;  1SIW A;  2E2H A;  1CZ4 A;  1G8J A;  1PYQ A;  1FDI A;  1AW8 B;  1CR5 A;  2C45 A;  1OGY A;  4JJO A;  1E18 A;  1KQG A;  4GA5 A;  3M3G A;  2PMZ A;  2PI8 A;  4NOH A;  2NVY A;  2WB1 A;  1ZC1 A;  3QQ7 A;  3ENG A;  4FFT A;  5GLY A;  3QWZ A;  5T5M D;  2IV2 X;  1Q16 A;  1ZYR D;  3X2O A;  1R7R A;  3CZB A;  1UHD A;  3GTG A;  1BW3 A;  1L8F A;  1YNJ D;  3QC8 A;  2Y0S A;  4JCW A;  3SUM A;  3GTJ A;  2BH0 A;  3X2P A;  2E7Z A;  4CRZ A;  1PT0 A;  2V45 A;  1R9T A;  4AON B;  4CRY G;  2VPX A;  1QDN A;  4KO8 A;  2JA7 A;  1CZ5 A;  1VC3 B;  2JIQ A;  4AYB A;  2O5J D;  2JA6 A;  4GA6 A;  3X2L A;  1Y1V A;  4JS7 A;  4D7Z B;  3SUK A;  2E2I A;  2R93 A;  1WLF A;  1E60 A;  1TWH A;  3TIW A;  1KQF A;  1TWF A;  3GTL A;  3GTK A;  5C1B A;  3HU3 A;  1K83 A;  5GM9 A;  3X2H A;  4RV0 A;  4FG4 A;  5FTM A;  3H0G A;  3ML1 A;  4AAY A;  2NVX A;  4KOD A;  2A68 D;  1I50 A;  1TMO A;  3CQZ A;  1PQH A;  1IW7 D;  3GTP A;  5EPP A;  2GAE A;  4DMR A;  4JP7 A;  2G6G A;  4KDI A;  1H5N A;  1PQE A;  1WC2 A;  3OUG A;  2JIR A;  3IR5 A;  2KI8 A;  2BE5 D;  4CS0 A;  1PPY A;  2CW0 D;  4FER A;  3IR6 A;  3GTO A;  3X2K A;  1OA7 A;  2PNW A;  1DMS A;  2KQA A;  2JIP A;  4JP6 A;  5H4U A;  1WCM A;  3GTM A;  4QIW A;  1AA6 A;  1H0H A;  3X2N A;  1UHE A;  2B63 A;  1E61 A;  1FDO A;  4ENG A;  1OA9 A;  1N10 A;  1BW4 A;  3QQ8 A;  3D30 A;  2VUM A;  1Y1W A;  1EU1 A;  2NYA A;  2WAQ A;  1TWA A;  2JIM A;  1I3Q A;  3DMR A;  1PT1 A;  2VPZ A;  4KDL A;  1S3S A;  2PJJ A;  2R7Z A;  1SMY D;  5FTK A;  1QCS A;  1Y4Z A;  1TWC A;  3CF2 A;  3FKI A;  2A6E D;  2A69 D;  2VPW A;  2VPY A;  5FTL A;  2HCZ X;  5GLX A;  1HD5 A;  1E32 A;  1G8K A;  3PLX B;  3HU1 A;  5GLF A;  1TWG A;  4ZM7 A;  3SUJ A;  4C2M A;  4AVR A;  2DMR A;  3GTQ A;  2PIC A;  1Y5I A;  4KLN A;  2JIO A;  2NAP A;  3IR7 A;  4L48 A; 
#chains in the Genus database with same CATH homology
 1N10 A;  2AE0 X;  3M3G A;  1BW4 A;  3D30 A;  2PI8 A;  5GM9 A;  4FG4 A;  4FG2 A;  3ENG A;  4FFT A;  2G5D A;  5GLY A;  2GAE A;  3X2O A;  2PJJ A;  3CZB A;  4JP7 A;  1BW3 A;  2G6G A;  1L8F A;  2ENG A;  4JCW A;  3SUM A;  3X2I A;  2BH0 A;  1WC2 A;  3X2M A;  3X2P A;  2HCZ X;  5GLX A;  1HD5 A;  3SUL A;  4FER A;  3X2K A;  2PNW A;  1OA7 A;  3X2J A;  3X2G A;  2KQA A;  5H4U A;  4JP6 A;  4ZM7 A;  3SUJ A;  3X2L A;  4AVR A;  4L48 A;  2PIC A;  4JS7 A;  3X2N A;  3SUK A;  4JJO A;  4ENG A;  3X2H A;  1OA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...