5H4UA

Crystal structure of cellulase from antarctic springtail, cryptopygus antarcticus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
208
Chain Sequence
LTSGSGVTTRYWDCCKPSCSWGGKASVTKPVRTCKANGNTTIDSNTQSGCNGGSSYVCNDQQPFTQGNVGYGFAAASISGQPESQTCCACYEMTFTNTAISGQKMIVQVTNTGSDLNGNHFDLMIPGGGVGIFNGCQSQWGAPSNGWGQRYGGISSQSECNQLPTSLRAGCNWRFGWFKNADNPSMKFTQVRCPTILTQKSQCVRTPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-beta-1,4-glucanase
publication title Genetic and Structural Characterization of a Thermo-Tolerant, Cold-Active, and Acidic Endo-beta-1,4-glucanase from Antarctic Springtail, Cryptopygus antarcticus.
pubmed doi rcsb
source organism Cryptopygus antarcticus
molecule tags Hydrolase
total genus 65
structure length 208
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 5h4uA00
1L8FA 3SUKA 5GM9A 3X2OA 3SULA 4AVRA 3X2HA 5H4UA 2ENGA 2PI8A 3D30A 3ENGA 3CZBA 3SUJA 4FG2A 2PJJA 2G6GA 5GLXA 1HD5A 3X2GA 4FG4A 4JS7A 3X2IA 4FERA 4JP6A 3X2JA 4ENGA 1WC2A 4L48A 3M3GA 1BW3A 2G5DA 4JP7A 4JJOA 3X2PA 3SUMA 2HCZX 1OA9A 5GLYA 2AE0X 4JCWA 1BW4A 2BH0A 3X2MA 2GAEA 3X2NA 3X2KA 4FFTA 4ZM7A 1N10A 3X2LA 2KQAA 2PICA 2PNWA 1OA7A
chains in the Genus database with same CATH superfamily
1KQFA 3CF2A 5GM9A 2R93A 4CS0A 4CRZA 5H4UA 1FDOA 2KI8A 1TMOA 1SIWA 3CZBA 1UHEA 2V3VA 4GA6A 1KQGA 2YU9A 4QIWA 1UHDA 1WCMA 5FTNA 1K83A 2JIMA 3GTQA 3X2JA 2B63A 1BW3A 1E32A 1QDNA 4JP7A 4JJOA 4AZDA 2E2IA 3IR5A 1R7RA 3QQ7A 3HU3A 1G8JA 3X2MA 5FTKA 3GTKA 1E61A 1R27A 2WB1A 2WAQA 1Y1VA 3SUKA 2PJHB 2JIQA 3SULA 4KLNA 3X2HA 3SUJA 1WLFA 3O5AA 2PJJA 4AYBA 1DMRA 5GLXA 4GA5A 1Y4ZA 3X2GA 2NYAA 3QC8A 2O5JD 2E7ZA 1VC3B 2JIRA 4FG4A 5FTMA 3X2IA 3TIWA 5C1BA 4FERA 1PT0A 1PYUB 4JP6A 3GTMA 1CZ5A 1YLEA 1WC2A 2CW0D 4L48A 1TWHA 2VPWA 5B6CA 1PT1A 2YUJA 1OGYA 2AE0X 1PPYA 2A69D 2IV2X 4KDIA 1SFOA 2E2HA 1R9TA 3X2NA 3HKZA 1I50A 1Y1WA 2V45A 2DMRA 3TM7B 2A68D 3GTOA 1E5VA 5T5MD 1PQEA 2R7ZA 4KO8A 5FTJA 3PLXB 4AVRA 1ZC1A 3GTGA 3ENGA 2PI8A 5DYIA 2VUMA 1PQFA 1YNND 2A6ED 2NVYA 4FG2A 1TWAA 1E60A 2NVXA 2JIPA 4D7ZB 1Y5IA 1H0HA 1Q16A 4DMRA 1E18A 2VPZA 4ENGA 4AOKB 4KODA 3M3GA 1H5NA 3OUGA 2R92A 3X2PA 1SMYD 1OA9A 5GLYA 2Y0SA 3QWZA 2BH0A 1CR5A 2GAEA 2PMZA 1I3QA 3H0GA 1AA6A 2VPXA 4FFTA 1N10A 4ZM7A 3HU2A 3X2LA 4C2MA 1EU1A 2A6HD 2PNWA 2JA5A 1OA7A 1CZ4A 1L8FA 2JA6A 1DMSA 3X2OA 2JA7A 4CRYG 4AAYA 3DMRA 3CQZA 2C45A 1YNJD 2ENGA 3D30A 3ML1A 4RV0A 2G6GA 2BE5D 1FDIA 3GTLA 1HD5A 1IW7D 5FTLA 4JS7A 2VPYA 1G8KA 5GLFA 1QCSA 3GTPA 4KDLA 1PQHA 1TWCA 1ZYRD 5EPPA 2G5DA 3QQ8A 3IR7A 3FKIA 3GTJA 3SUMA 2HCZX 2NAPA 4AONB 4JCWA 1PYQA 3HU1A 2JIOA 4NOHA 5C18A 1BW4A 2EEOB 5T5ID 1S3SA 1TWGA 3X2KA 1TWFA 3IR6A 5DYGA 2KQAA 2PICA 1AW8B
chains in the Genus database with same CATH topology
1L8FA 3SUKA 5GM9A 3X2OA 3SULA 4AVRA 3X2HA 5H4UA 2ENGA 2PI8A 3D30A 3ENGA 3CZBA 3SUJA 4FG2A 2PJJA 2G6GA 5GLXA 1HD5A 3X2GA 4FG4A 4JS7A 3X2IA 4FERA 4JP6A 3X2JA 4ENGA 1WC2A 4L48A 3M3GA 1BW3A 2G5DA 4JP7A 4JJOA 3X2PA 3SUMA 2HCZX 1OA9A 5GLYA 2AE0X 4JCWA 1BW4A 2BH0A 3X2MA 2GAEA 3X2NA 3X2KA 4FFTA 4ZM7A 1N10A 3X2LA 2KQAA 2PICA 2PNWA 1OA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L8F A;  3SUK A;  5GM9 A;  3X2O A;  3SUL A;  4AVR A;  3X2H A;  5H4U A;  2ENG A;  2PI8 A;  3D30 A;  3ENG A;  3CZB A;  3SUJ A;  4FG2 A;  2PJJ A;  2G6G A;  5GLX A;  1HD5 A;  3X2G A;  4FG4 A;  4JS7 A;  3X2I A;  4FER A;  4JP6 A;  3X2J A;  4ENG A;  1WC2 A;  4L48 A;  3M3G A;  1BW3 A;  2G5D A;  4JP7 A;  4JJO A;  3X2P A;  3SUM A;  2HCZ X;  1OA9 A;  5GLY A;  2AE0 X;  4JCW A;  1BW4 A;  2BH0 A;  3X2M A;  2GAE A;  3X2N A;  3X2K A;  4FFT A;  4ZM7 A;  1N10 A;  3X2L A;  2KQA A;  2PIC A;  2PNW A;  1OA7 A; 
#chains in the Genus database with same CATH topology
 1KQF A;  3CF2 A;  5GM9 A;  2R93 A;  4CS0 A;  4CRZ A;  5H4U A;  1FDO A;  2KI8 A;  1TMO A;  1SIW A;  3CZB A;  1UHE A;  2V3V A;  4GA6 A;  1KQG A;  2YU9 A;  4QIW A;  1UHD A;  1WCM A;  5FTN A;  1K83 A;  2JIM A;  3GTQ A;  3X2J A;  2B63 A;  1BW3 A;  1E32 A;  1QDN A;  4JP7 A;  4JJO A;  4AZD A;  2E2I A;  3IR5 A;  1R7R A;  3QQ7 A;  3HU3 A;  1G8J A;  3X2M A;  5FTK A;  3GTK A;  1E61 A;  1R27 A;  2WB1 A;  2WAQ A;  1Y1V A;  3SUK A;  2PJH B;  2JIQ A;  3SUL A;  4KLN A;  3X2H A;  3SUJ A;  1WLF A;  3O5A A;  2PJJ A;  4AYB A;  1DMR A;  5GLX A;  4GA5 A;  1Y4Z A;  3X2G A;  2NYA A;  3QC8 A;  2O5J D;  2E7Z A;  1VC3 B;  2JIR A;  4FG4 A;  5FTM A;  3X2I A;  3TIW A;  5C1B A;  4FER A;  1PT0 A;  1PYU B;  4JP6 A;  3GTM A;  1CZ5 A;  1YLE A;  1WC2 A;  2CW0 D;  4L48 A;  1TWH A;  2VPW A;  5B6C A;  1PT1 A;  2YUJ A;  1OGY A;  2AE0 X;  1PPY A;  2A69 D;  2IV2 X;  4KDI A;  1SFO A;  2E2H A;  1R9T A;  3X2N A;  3HKZ A;  1I50 A;  1Y1W A;  2V45 A;  2DMR A;  3TM7 B;  2A68 D;  3GTO A;  1E5V A;  5T5M D;  1PQE A;  2R7Z A;  4KO8 A;  5FTJ A;  3PLX B;  4AVR A;  1ZC1 A;  3GTG A;  3ENG A;  2PI8 A;  5DYI A;  2VUM A;  1PQF A;  1YNN D;  2A6E D;  2NVY A;  4FG2 A;  1TWA A;  1E60 A;  2NVX A;  2JIP A;  4D7Z B;  1Y5I A;  1H0H A;  1Q16 A;  4DMR A;  1E18 A;  2VPZ A;  4ENG A;  4AOK B;  4KOD A;  3M3G A;  1H5N A;  3OUG A;  2R92 A;  3X2P A;  1SMY D;  1OA9 A;  5GLY A;  2Y0S A;  3QWZ A;  2BH0 A;  1CR5 A;  2GAE A;  2PMZ A;  1I3Q A;  3H0G A;  1AA6 A;  2VPX A;  4FFT A;  1N10 A;  4ZM7 A;  3HU2 A;  3X2L A;  4C2M A;  1EU1 A;  2A6H D;  2PNW A;  2JA5 A;  1OA7 A;  1CZ4 A;  1L8F A;  2JA6 A;  1DMS A;  3X2O A;  2JA7 A;  4CRY G;  4AAY A;  3DMR A;  3CQZ A;  2C45 A;  1YNJ D;  2ENG A;  3D30 A;  3ML1 A;  4RV0 A;  2G6G A;  2BE5 D;  1FDI A;  3GTL A;  1HD5 A;  1IW7 D;  5FTL A;  4JS7 A;  2VPY A;  1G8K A;  5GLF A;  1QCS A;  3GTP A;  4KDL A;  1PQH A;  1TWC A;  1ZYR D;  5EPP A;  2G5D A;  3QQ8 A;  3IR7 A;  3FKI A;  3GTJ A;  3SUM A;  2HCZ X;  2NAP A;  4AON B;  4JCW A;  1PYQ A;  3HU1 A;  2JIO A;  4NOH A;  5C18 A;  1BW4 A;  2EEO B;  5T5I D;  1S3S A;  1TWG A;  3X2K A;  1TWF A;  3IR6 A;  5DYG A;  2KQA A;  2PIC A;  1AW8 B; 
#chains in the Genus database with same CATH homology
 1L8F A;  3SUK A;  5GM9 A;  3X2O A;  3SUL A;  4AVR A;  3X2H A;  5H4U A;  2ENG A;  2PI8 A;  3D30 A;  3ENG A;  3CZB A;  3SUJ A;  4FG2 A;  2PJJ A;  2G6G A;  5GLX A;  1HD5 A;  3X2G A;  4FG4 A;  4JS7 A;  3X2I A;  4FER A;  4JP6 A;  3X2J A;  4ENG A;  1WC2 A;  4L48 A;  3M3G A;  1BW3 A;  2G5D A;  4JP7 A;  4JJO A;  3X2P A;  3SUM A;  2HCZ X;  1OA9 A;  5GLY A;  2AE0 X;  4JCW A;  1BW4 A;  2BH0 A;  3X2M A;  2GAE A;  3X2N A;  3X2K A;  4FFT A;  4ZM7 A;  1N10 A;  3X2L A;  2KQA A;  2PIC A;  2PNW A;  1OA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...