3SUMA

Crystal structure of cerato-platanin 5 from m. perniciosa (mpcp5)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
NWLIKWDDKFQNDTLSISEFKCSAALAKLGPDPKHPPTKLGEVLNFPHFVAAPEAQTECGSCWKLRYKGNHAFVTVVDRVEEANLFVGGTDLVKNLTTFNGAPEGYDWGTAQLFSAYQVDGSCCQQNTGKQCGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerato-platanin-like protein
publication title Functional diversification of cerato-platanins in Moniliophthora perniciosa as seen by differential expression and protein function specialization.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Unknown function
total genus 39
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07249 Cerato-platanin Cerato-platanin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3sumA00
3D30A 1BW3A 3X2IA 3SUKA 3M3GA 3X2KA 4JS7A 3X2PA 1N10A 2PNWA 2PI8A 4AVRA 1HD5A 3X2LA 1OA7A 5GLYA 1OA9A 4JJOA 3SUMA 3X2GA 2KQAA 3X2HA 2G6GA 4JP7A 2AE0X 2HCZX 3X2MA 4ZM7A 1L8FA 2PICA 4FG2A 3X2JA 2PJJA 2G5DA 4L48A 2GAEA 4JP6A 2BH0A 5GM9A 4FFTA 2ENGA 5H4UA 3CZBA 4JCWA 3X2OA 4FERA 4FG4A 1BW4A 3SUJA 3ENGA 4ENGA 5GLXA 3SULA 3X2NA 1WC2A
chains in the Genus database with same CATH superfamily
3GTJA 2E2HA 3TIWA 3HU2A 3M3GA 3X2PA 1G8JA 5FTKA 1CZ4A 5B6CA 1R7RA 2PI8A 2IV2X 3GTLA 2JIOA 1OA7A 4JJOA 4AYBA 4RV0A 5DYGA 2JA5A 1Y1VA 4KDLA 2R7ZA 4ZM7A 1L8FA 1AA6A 3HU1A 2E2IA 4JP6A 1PYUB 2PMZA 2YUJA 1TWFA 3QQ8A 1PPYA 1Q16A 5GM9A 4CS0A 2KI8A 5C1BA 2A6ED 4NOHA 3CQZA 4FFTA 2ENGA 3GTOA 3CZBA 1E60A 1E5VA 3GTKA 2JIQA 3ML1A 3X2OA 2B63A 4FERA 4KLNA 5T5MD 3OUGA 2JA6A 1H5NA 2V3VA 1YNND 4ENGA 1EU1A 1WC2A 3SUMA 3QQ7A 3D30A 4AOKB 1BW3A 1Y5IA 1AW8B 5T5ID 3SUKA 4KDIA 1FDOA 1UHEA 1Y4ZA 2PNWA 3QC8A 2VUMA 2VPYA 1HD5A 3X2LA 4CRYG 1I50A 3GTGA 1ZYRD 2V45A 1TMOA 1DMSA 4JP7A 2AE0X 4KODA 1I3QA 1E32A 1SFOA 1SIWA 1YNJD 2A68D 3GTPA 2EEOB 2NYAA 3QWZA 4L48A 2A6HD 1PQFA 1TWHA 2NVYA 1PQEA 5H4UA 1G8KA 1DMRA 3ENGA 1ZC1A 2VPZA 1IW7D 2YU9A 5FTNA 5FTJA 3H0GA 1WLFA 5GLFA 3PLXB 3X2KA 2E7ZA 2JIMA 1OGYA 2JIRA 4AAYA 2C45A 2CW0D 1KQGA 4DMRA 2WAQA 1OA9A 1QDNA 4QIWA 2KQAA 4CRZA 3X2HA 2G6GA 2WB1A 5DYIA 2DMRA 4AZDA 3X2MA 2O5JD 1VC3B 2VPWA 1K83A 2PICA 3O5AA 3X2JA 2PJJA 3IR7A 2NVXA 2GAEA 3IR6A 1Y1WA 3TM7B 1UHDA 3IR5A 1FDIA 3DMRA 1PT1A 1WCMA 2PJHB 2R92A 2BE5D 4FG4A 4KO8A 1BW4A 3SUJA 4AONB 5GLXA 3SULA 3X2NA 3X2IA 4D7ZB 3GTQA 2VPXA 4GA5A 5FTMA 3FKIA 4JS7A 3HKZA 2Y0SA 1CR5A 1N10A 5EPPA 1R27A 4AVRA 5C18A 3CF2A 1SMYD 5GLYA 1PQHA 1PYQA 1YLEA 2HCZX 2NAPA 1KQFA 1E18A 4FG2A 1E61A 2G5DA 3GTMA 1TWGA 2JIPA 1S3SA 1QCSA 1TWAA 2A69D 2BH0A 3HU3A 1TWCA 4GA6A 1H0HA 4JCWA 1PT0A 4C2MA 2R93A 5FTLA 2JA7A 1CZ5A 1R9TA 3X2GA
chains in the Genus database with same CATH topology
3D30A 1BW3A 3X2IA 3SUKA 3M3GA 3X2KA 4JS7A 3X2PA 1N10A 2PNWA 2PI8A 4AVRA 1HD5A 3X2LA 1OA7A 5GLYA 1OA9A 4JJOA 3SUMA 3X2GA 2KQAA 3X2HA 2G6GA 4JP7A 2AE0X 2HCZX 3X2MA 4ZM7A 1L8FA 2PICA 4FG2A 3X2JA 2PJJA 2G5DA 4L48A 2GAEA 4JP6A 2BH0A 5GM9A 4FFTA 2ENGA 5H4UA 3CZBA 4JCWA 3X2OA 4FERA 4FG4A 1BW4A 3SUJA 3ENGA 4ENGA 5GLXA 3SULA 3X2NA 1WC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D30 A;  1BW3 A;  3X2I A;  3SUK A;  3M3G A;  3X2K A;  4JS7 A;  3X2P A;  1N10 A;  2PNW A;  2PI8 A;  4AVR A;  1HD5 A;  3X2L A;  1OA7 A;  5GLY A;  1OA9 A;  4JJO A;  3SUM A;  3X2G A;  2KQA A;  3X2H A;  2G6G A;  4JP7 A;  2AE0 X;  2HCZ X;  3X2M A;  4ZM7 A;  1L8F A;  2PIC A;  4FG2 A;  3X2J A;  2PJJ A;  2G5D A;  4L48 A;  2GAE A;  4JP6 A;  2BH0 A;  5GM9 A;  4FFT A;  2ENG A;  5H4U A;  3CZB A;  4JCW A;  3X2O A;  4FER A;  4FG4 A;  1BW4 A;  3SUJ A;  3ENG A;  4ENG A;  5GLX A;  3SUL A;  3X2N A;  1WC2 A; 
#chains in the Genus database with same CATH topology
 3GTJ A;  2E2H A;  3TIW A;  3HU2 A;  3M3G A;  3X2P A;  1G8J A;  5FTK A;  1CZ4 A;  5B6C A;  1R7R A;  2PI8 A;  2IV2 X;  3GTL A;  2JIO A;  1OA7 A;  4JJO A;  4AYB A;  4RV0 A;  5DYG A;  2JA5 A;  1Y1V A;  4KDL A;  2R7Z A;  4ZM7 A;  1L8F A;  1AA6 A;  3HU1 A;  2E2I A;  4JP6 A;  1PYU B;  2PMZ A;  2YUJ A;  1TWF A;  3QQ8 A;  1PPY A;  1Q16 A;  5GM9 A;  4CS0 A;  2KI8 A;  5C1B A;  2A6E D;  4NOH A;  3CQZ A;  4FFT A;  2ENG A;  3GTO A;  3CZB A;  1E60 A;  1E5V A;  3GTK A;  2JIQ A;  3ML1 A;  3X2O A;  2B63 A;  4FER A;  4KLN A;  5T5M D;  3OUG A;  2JA6 A;  1H5N A;  2V3V A;  1YNN D;  4ENG A;  1EU1 A;  1WC2 A;  3SUM A;  3QQ7 A;  3D30 A;  4AOK B;  1BW3 A;  1Y5I A;  1AW8 B;  5T5I D;  3SUK A;  4KDI A;  1FDO A;  1UHE A;  1Y4Z A;  2PNW A;  3QC8 A;  2VUM A;  2VPY A;  1HD5 A;  3X2L A;  4CRY G;  1I50 A;  3GTG A;  1ZYR D;  2V45 A;  1TMO A;  1DMS A;  4JP7 A;  2AE0 X;  4KOD A;  1I3Q A;  1E32 A;  1SFO A;  1SIW A;  1YNJ D;  2A68 D;  3GTP A;  2EEO B;  2NYA A;  3QWZ A;  4L48 A;  2A6H D;  1PQF A;  1TWH A;  2NVY A;  1PQE A;  5H4U A;  1G8K A;  1DMR A;  3ENG A;  1ZC1 A;  2VPZ A;  1IW7 D;  2YU9 A;  5FTN A;  5FTJ A;  3H0G A;  1WLF A;  5GLF A;  3PLX B;  3X2K A;  2E7Z A;  2JIM A;  1OGY A;  2JIR A;  4AAY A;  2C45 A;  2CW0 D;  1KQG A;  4DMR A;  2WAQ A;  1OA9 A;  1QDN A;  4QIW A;  2KQA A;  4CRZ A;  3X2H A;  2G6G A;  2WB1 A;  5DYI A;  2DMR A;  4AZD A;  3X2M A;  2O5J D;  1VC3 B;  2VPW A;  1K83 A;  2PIC A;  3O5A A;  3X2J A;  2PJJ A;  3IR7 A;  2NVX A;  2GAE A;  3IR6 A;  1Y1W A;  3TM7 B;  1UHD A;  3IR5 A;  1FDI A;  3DMR A;  1PT1 A;  1WCM A;  2PJH B;  2R92 A;  2BE5 D;  4FG4 A;  4KO8 A;  1BW4 A;  3SUJ A;  4AON B;  5GLX A;  3SUL A;  3X2N A;  3X2I A;  4D7Z B;  3GTQ A;  2VPX A;  4GA5 A;  5FTM A;  3FKI A;  4JS7 A;  3HKZ A;  2Y0S A;  1CR5 A;  1N10 A;  5EPP A;  1R27 A;  4AVR A;  5C18 A;  3CF2 A;  1SMY D;  5GLY A;  1PQH A;  1PYQ A;  1YLE A;  2HCZ X;  2NAP A;  1KQF A;  1E18 A;  4FG2 A;  1E61 A;  2G5D A;  3GTM A;  1TWG A;  2JIP A;  1S3S A;  1QCS A;  1TWA A;  2A69 D;  2BH0 A;  3HU3 A;  1TWC A;  4GA6 A;  1H0H A;  4JCW A;  1PT0 A;  4C2M A;  2R93 A;  5FTL A;  2JA7 A;  1CZ5 A;  1R9T A;  3X2G A; 
#chains in the Genus database with same CATH homology
 3D30 A;  1BW3 A;  3X2I A;  3SUK A;  3M3G A;  3X2K A;  4JS7 A;  3X2P A;  1N10 A;  2PNW A;  2PI8 A;  4AVR A;  1HD5 A;  3X2L A;  1OA7 A;  5GLY A;  1OA9 A;  4JJO A;  3SUM A;  3X2G A;  2KQA A;  3X2H A;  2G6G A;  4JP7 A;  2AE0 X;  2HCZ X;  3X2M A;  4ZM7 A;  1L8F A;  2PIC A;  4FG2 A;  3X2J A;  2PJJ A;  2G5D A;  4L48 A;  2GAE A;  4JP6 A;  2BH0 A;  5GM9 A;  4FFT A;  2ENG A;  5H4U A;  3CZB A;  4JCW A;  3X2O A;  4FER A;  4FG4 A;  1BW4 A;  3SUJ A;  3ENG A;  4ENG A;  5GLX A;  3SUL A;  3X2N A;  1WC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...