3TM7B

Processed aspartate decarboxylase mutant with asn72 mutated to ala
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVAGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Structure of Escherichia coli aspartate alpha-decarboxylase Asn72Ala: probing the role of Asn72 in pyruvoyl cofactor formation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 22
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2011-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3tm7B00
1OGYA 2E2IA 3GTGA 4KLNA 1DMSA 1H0HA 1KQFA 2B63A 4KDLA 4RV0A 1CZ5A 2JIQA 1PQFA 2NVXA 1SFOA 2JIMA 3H0GA 2JA7A 4D7ZB 3GTOA 2JIPA 1K83A 1PPYA 4KDIA 2JA6A 3TIWA 1WLFA 1G8JA 3GTKA 1Y1WA 1FDOA 1TWCA 5FTJA 5DYIA 3GTLA 1H5NA 1WCMA 1PYUB 1IW7D 4KODA 2VPZA 5DYGA 3HKZA 5C1BA 2WAQA 1E18A 2V45A 2R7ZA 2NVYA 3QQ7A 5C18A 4AZDA 2EEOB 2VPXA 1G8KA 3IR6A 2KI8A 1R9TA 1AW8B 2JIRA 4GA6A 1TWAA 1TWGA 3O5AA 2IV2X 2E2HA 2C45A 1R27A 2R92A 2VPWA 3HU3A 1SIWA 1PT0A 1I50A 1CZ4A 1Q16A 4KO8A 2YU9A 3CF2A 4CRYG 3PLXB 5GLFA 5B6CA 3GTMA 2VUMA 1Y5IA 4AOKB 3ML1A 3DMRA 1CR5A 1PQEA 3GTPA 5T5ID 3GTQA 1Y4ZA 5FTNA 1TWFA 1EU1A 1QDNA 4DMRA 3QQ8A 1TMOA 5T5MD 1UHEA 2PMZA 2Y0SA 1E60A 3TM7B 3FKIA 3IR7A 5FTLA 3IR5A 1PYQA 1PQHA 1Y1VA 2WB1A 1VC3B 3GTJA 1R7RA 4AONB 4GA5A 3HU2A 5EPPA 3QWZA 1PT1A 3OUGA 2JA5A 1YLEA 1UHDA 1E61A 2NYAA 3QC8A 1KQGA 1I3QA 2PJHB 3HU1A 5FTMA 1QCSA 4CRZA 1FDIA 1E32A 2E7ZA 1DMRA 4CS0A 2V3VA 2R93A 4AAYA 3CQZA 2NAPA 1S3SA 1AA6A 2VPYA 4C2MA 2DMRA 4QIWA 1E5VA 4AYBA 2JIOA 5FTKA 1TWHA
chains in the Genus database with same CATH superfamily
1OGYA 2JIOA 2ENGA 2E2IA 3GTGA 3CZBA 1DMSA 4KLNA 1H0HA 1KQFA 2B63A 1BW3A 4KDLA 4RV0A 1CZ5A 2JIQA 1PQFA 2G5DA 2NVXA 3SUMA 4L48A 1SFOA 2JIMA 3H0GA 2JA7A 4D7ZB 3GTOA 2BE5D 3X2GA 2JIPA 5GM9A 1K83A 4JS7A 1PPYA 4KDIA 2JA6A 3TIWA 1WLFA 2G6GA 1BW4A 5GLYA 1G8JA 3GTKA 1Y1WA 1FDOA 2HCZX 1TWCA 4FERA 1ZC1A 5FTJA 5DYIA 3GTLA 1H5NA 1WCMA 1PYUB 1OA9A 1IW7D 4KODA 2KQAA 2VPZA 2PICA 5GLXA 1OA7A 5DYGA 3HKZA 5C1BA 2WAQA 1E18A 2V45A 2R7ZA 2PNWA 2NVYA 3QQ7A 5C18A 4AZDA 2EEOB 3SULA 2VPXA 1G8KA 3IR6A 2KI8A 1R9TA 1AW8B 2JIRA 4GA6A 2GAEA 4JP6A 2YUJA 1TWGA 3SUJA 1SMYD 3O5AA 2IV2X 3X2IA 2E2HA 2C45A 1R27A 2R92A 4NOHA 5H4UA 2VPWA 3HU3A 1SIWA 3X2JA 1PT0A 1I50A 1CZ4A 1Q16A 2A6ED 4KO8A 2YU9A 3CF2A 4CRYG 3PLXB 5GLFA 5B6CA 3GTMA 2VUMA 1L8FA 1Y5IA 4FG2A 3ML1A 3X2OA 3DMRA 4AOKB 1CR5A 1PQEA 1YNJD 3GTPA 5T5ID 3GTQA 1Y4ZA 2A69D 5FTNA 1TWFA 3X2MA 1EU1A 1QDNA 3X2NA 4DMRA 3QQ8A 1TMOA 5T5MD 1UHEA 2PMZA 2Y0SA 1E60A 3TM7B 3FKIA 3IR7A 1ZYRD 5FTLA 3IR5A 1N10A 1PQHA 1PYQA 1Y1VA 2WB1A 1VC3B 3M3GA 3GTJA 1R7RA 4AONB 4GA5A 3HU2A 3X2KA 5EPPA 3QWZA 2O5JD 1PT1A 3OUGA 4JJOA 1YLEA 3X2LA 1UHDA 2A6HD 3X2HA 2JA5A 2BH0A 1E61A 2NYAA 3QC8A 2CW0D 1KQGA 1I3QA 2PJHB 1YNND 3ENGA 3HU1A 5FTMA 1QCSA 4CRZA 2AE0X 3D30A 1FDIA 4JP7A 2A68D 1E32A 1WC2A 2E7ZA 1DMRA 4CS0A 2V3VA 2R93A 4AAYA 3CQZA 2NAPA 4JCWA 4FFTA 1S3SA 1AA6A 2VPYA 4C2MA 3X2PA 2DMRA 4ENGA 4QIWA 1E5VA 2PI8A 4ZM7A 4FG4A 3SUKA 1HD5A 4AYBA 2PJJA 4AVRA 1TWAA 5FTKA 1TWHA
chains in the Genus database with same CATH topology
1OGYA 2E2IA 3GTGA 3CZBA 1DMSA 4KLNA 1H0HA 1KQFA 2B63A 4KDLA 4RV0A 1CZ5A 2JIQA 1PQFA 2G5DA 2NVXA 1SFOA 2JIMA 3H0GA 2JA7A 4D7ZB 3GTOA 2BE5D 2JIPA 1K83A 1PPYA 4KDIA 2JA6A 3TIWA 1WLFA 2G6GA 1G8JA 3GTKA 1Y1WA 1FDOA 1TWCA 5FTJA 1ZC1A 5DYIA 3GTLA 1H5NA 1WCMA 1PYUB 1IW7D 4KODA 2VPZA 2PICA 5DYGA 3HKZA 5C1BA 2WAQA 1E18A 2V45A 2R7ZA 2PNWA 2NVYA 3QQ7A 5C18A 4AZDA 2EEOB 2VPXA 1G8KA 3IR6A 2KI8A 1R9TA 1AW8B 2JIRA 4GA6A 2GAEA 2YUJA 1TWAA 1TWGA 1SMYD 3O5AA 2IV2X 2E2HA 2C45A 1R27A 2R92A 4NOHA 2VPWA 3HU3A 1SIWA 1PT0A 1I50A 1CZ4A 1Q16A 2A6ED 4KO8A 2YU9A 3CF2A 4CRYG 3PLXB 5GLFA 5B6CA 3GTMA 2VUMA 1Y5IA 4AOKB 3ML1A 3DMRA 1CR5A 1PQEA 1YNJD 3GTPA 5T5ID 3GTQA 1Y4ZA 2A69D 5FTNA 1TWFA 1EU1A 1QDNA 4DMRA 3QQ8A 1TMOA 5T5MD 1UHEA 2PMZA 2Y0SA 1E60A 3TM7B 3FKIA 3IR7A 1ZYRD 5FTLA 3IR5A 1PYQA 1PQHA 1Y1VA 2WB1A 1VC3B 3GTJA 1R7RA 4AONB 4GA5A 3HU2A 5EPPA 3QWZA 2O5JD 1PT1A 3OUGA 2JA5A 1YLEA 1UHDA 2A6HD 1E61A 2NYAA 3QC8A 2CW0D 1KQGA 1I3QA 2PJHB 1YNND 3HU1A 5FTMA 1QCSA 4CRZA 2AE0X 1FDIA 2A68D 1E32A 2E7ZA 1DMRA 4CS0A 2V3VA 2R93A 4AAYA 3CQZA 2NAPA 1S3SA 1AA6A 2VPYA 4C2MA 2DMRA 4QIWA 1E5VA 2PI8A 4AYBA 2PJJA 2JIOA 5FTKA 1TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGY A;  2E2I A;  3GTG A;  4KLN A;  1DMS A;  1H0H A;  1KQF A;  2B63 A;  4KDL A;  4RV0 A;  1CZ5 A;  2JIQ A;  1PQF A;  2NVX A;  1SFO A;  2JIM A;  3H0G A;  2JA7 A;  4D7Z B;  3GTO A;  2JIP A;  1K83 A;  1PPY A;  4KDI A;  2JA6 A;  3TIW A;  1WLF A;  1G8J A;  3GTK A;  1Y1W A;  1FDO A;  1TWC A;  5FTJ A;  5DYI A;  3GTL A;  1H5N A;  1WCM A;  1PYU B;  1IW7 D;  4KOD A;  2VPZ A;  5DYG A;  3HKZ A;  5C1B A;  2WAQ A;  1E18 A;  2V45 A;  2R7Z A;  2NVY A;  3QQ7 A;  5C18 A;  4AZD A;  2EEO B;  2VPX A;  1G8K A;  3IR6 A;  2KI8 A;  1R9T A;  1AW8 B;  2JIR A;  4GA6 A;  1TWA A;  1TWG A;  3O5A A;  2IV2 X;  2E2H A;  2C45 A;  1R27 A;  2R92 A;  2VPW A;  3HU3 A;  1SIW A;  1PT0 A;  1I50 A;  1CZ4 A;  1Q16 A;  4KO8 A;  2YU9 A;  3CF2 A;  4CRY G;  3PLX B;  5GLF A;  5B6C A;  3GTM A;  2VUM A;  1Y5I A;  4AOK B;  3ML1 A;  3DMR A;  1CR5 A;  1PQE A;  3GTP A;  5T5I D;  3GTQ A;  1Y4Z A;  5FTN A;  1TWF A;  1EU1 A;  1QDN A;  4DMR A;  3QQ8 A;  1TMO A;  5T5M D;  1UHE A;  2PMZ A;  2Y0S A;  1E60 A;  3TM7 B;  3FKI A;  3IR7 A;  5FTL A;  3IR5 A;  1PYQ A;  1PQH A;  1Y1V A;  2WB1 A;  1VC3 B;  3GTJ A;  1R7R A;  4AON B;  4GA5 A;  3HU2 A;  5EPP A;  3QWZ A;  1PT1 A;  3OUG A;  2JA5 A;  1YLE A;  1UHD A;  1E61 A;  2NYA A;  3QC8 A;  1KQG A;  1I3Q A;  2PJH B;  3HU1 A;  5FTM A;  1QCS A;  4CRZ A;  1FDI A;  1E32 A;  2E7Z A;  1DMR A;  4CS0 A;  2V3V A;  2R93 A;  4AAY A;  3CQZ A;  2NAP A;  1S3S A;  1AA6 A;  2VPY A;  4C2M A;  2DMR A;  4QIW A;  1E5V A;  4AYB A;  2JIO A;  5FTK A;  1TWH A; 
#chains in the Genus database with same CATH topology
 1OGY A;  2JIO A;  2ENG A;  2E2I A;  3GTG A;  3CZB A;  1DMS A;  4KLN A;  1H0H A;  1KQF A;  2B63 A;  1BW3 A;  4KDL A;  4RV0 A;  1CZ5 A;  2JIQ A;  1PQF A;  2G5D A;  2NVX A;  3SUM A;  4L48 A;  1SFO A;  2JIM A;  3H0G A;  2JA7 A;  4D7Z B;  3GTO A;  2BE5 D;  3X2G A;  2JIP A;  5GM9 A;  1K83 A;  4JS7 A;  1PPY A;  4KDI A;  2JA6 A;  3TIW A;  1WLF A;  2G6G A;  1BW4 A;  5GLY A;  1G8J A;  3GTK A;  1Y1W A;  1FDO A;  2HCZ X;  1TWC A;  4FER A;  1ZC1 A;  5FTJ A;  5DYI A;  3GTL A;  1H5N A;  1WCM A;  1PYU B;  1OA9 A;  1IW7 D;  4KOD A;  2KQA A;  2VPZ A;  2PIC A;  5GLX A;  1OA7 A;  5DYG A;  3HKZ A;  5C1B A;  2WAQ A;  1E18 A;  2V45 A;  2R7Z A;  2PNW A;  2NVY A;  3QQ7 A;  5C18 A;  4AZD A;  2EEO B;  3SUL A;  2VPX A;  1G8K A;  3IR6 A;  2KI8 A;  1R9T A;  1AW8 B;  2JIR A;  4GA6 A;  2GAE A;  4JP6 A;  2YUJ A;  1TWG A;  3SUJ A;  1SMY D;  3O5A A;  2IV2 X;  3X2I A;  2E2H A;  2C45 A;  1R27 A;  2R92 A;  4NOH A;  5H4U A;  2VPW A;  3HU3 A;  1SIW A;  3X2J A;  1PT0 A;  1I50 A;  1CZ4 A;  1Q16 A;  2A6E D;  4KO8 A;  2YU9 A;  3CF2 A;  4CRY G;  3PLX B;  5GLF A;  5B6C A;  3GTM A;  2VUM A;  1L8F A;  1Y5I A;  4FG2 A;  3ML1 A;  3X2O A;  3DMR A;  4AOK B;  1CR5 A;  1PQE A;  1YNJ D;  3GTP A;  5T5I D;  3GTQ A;  1Y4Z A;  2A69 D;  5FTN A;  1TWF A;  3X2M A;  1EU1 A;  1QDN A;  3X2N A;  4DMR A;  3QQ8 A;  1TMO A;  5T5M D;  1UHE A;  2PMZ A;  2Y0S A;  1E60 A;  3TM7 B;  3FKI A;  3IR7 A;  1ZYR D;  5FTL A;  3IR5 A;  1N10 A;  1PQH A;  1PYQ A;  1Y1V A;  2WB1 A;  1VC3 B;  3M3G A;  3GTJ A;  1R7R A;  4AON B;  4GA5 A;  3HU2 A;  3X2K A;  5EPP A;  3QWZ A;  2O5J D;  1PT1 A;  3OUG A;  4JJO A;  1YLE A;  3X2L A;  1UHD A;  2A6H D;  3X2H A;  2JA5 A;  2BH0 A;  1E61 A;  2NYA A;  3QC8 A;  2CW0 D;  1KQG A;  1I3Q A;  2PJH B;  1YNN D;  3ENG A;  3HU1 A;  5FTM A;  1QCS A;  4CRZ A;  2AE0 X;  3D30 A;  1FDI A;  4JP7 A;  2A68 D;  1E32 A;  1WC2 A;  2E7Z A;  1DMR A;  4CS0 A;  2V3V A;  2R93 A;  4AAY A;  3CQZ A;  2NAP A;  4JCW A;  4FFT A;  1S3S A;  1AA6 A;  2VPY A;  4C2M A;  3X2P A;  2DMR A;  4ENG A;  4QIW A;  1E5V A;  2PI8 A;  4ZM7 A;  4FG4 A;  3SUK A;  1HD5 A;  4AYB A;  2PJJ A;  4AVR A;  1TWA A;  5FTK A;  1TWH A; 
#chains in the Genus database with same CATH homology
 1OGY A;  2E2I A;  3GTG A;  3CZB A;  1DMS A;  4KLN A;  1H0H A;  1KQF A;  2B63 A;  4KDL A;  4RV0 A;  1CZ5 A;  2JIQ A;  1PQF A;  2G5D A;  2NVX A;  1SFO A;  2JIM A;  3H0G A;  2JA7 A;  4D7Z B;  3GTO A;  2BE5 D;  2JIP A;  1K83 A;  1PPY A;  4KDI A;  2JA6 A;  3TIW A;  1WLF A;  2G6G A;  1G8J A;  3GTK A;  1Y1W A;  1FDO A;  1TWC A;  5FTJ A;  1ZC1 A;  5DYI A;  3GTL A;  1H5N A;  1WCM A;  1PYU B;  1IW7 D;  4KOD A;  2VPZ A;  2PIC A;  5DYG A;  3HKZ A;  5C1B A;  2WAQ A;  1E18 A;  2V45 A;  2R7Z A;  2PNW A;  2NVY A;  3QQ7 A;  5C18 A;  4AZD A;  2EEO B;  2VPX A;  1G8K A;  3IR6 A;  2KI8 A;  1R9T A;  1AW8 B;  2JIR A;  4GA6 A;  2GAE A;  2YUJ A;  1TWA A;  1TWG A;  1SMY D;  3O5A A;  2IV2 X;  2E2H A;  2C45 A;  1R27 A;  2R92 A;  4NOH A;  2VPW A;  3HU3 A;  1SIW A;  1PT0 A;  1I50 A;  1CZ4 A;  1Q16 A;  2A6E D;  4KO8 A;  2YU9 A;  3CF2 A;  4CRY G;  3PLX B;  5GLF A;  5B6C A;  3GTM A;  2VUM A;  1Y5I A;  4AOK B;  3ML1 A;  3DMR A;  1CR5 A;  1PQE A;  1YNJ D;  3GTP A;  5T5I D;  3GTQ A;  1Y4Z A;  2A69 D;  5FTN A;  1TWF A;  1EU1 A;  1QDN A;  4DMR A;  3QQ8 A;  1TMO A;  5T5M D;  1UHE A;  2PMZ A;  2Y0S A;  1E60 A;  3TM7 B;  3FKI A;  3IR7 A;  1ZYR D;  5FTL A;  3IR5 A;  1PYQ A;  1PQH A;  1Y1V A;  2WB1 A;  1VC3 B;  3GTJ A;  1R7R A;  4AON B;  4GA5 A;  3HU2 A;  5EPP A;  3QWZ A;  2O5J D;  1PT1 A;  3OUG A;  2JA5 A;  1YLE A;  1UHD A;  2A6H D;  1E61 A;  2NYA A;  3QC8 A;  2CW0 D;  1KQG A;  1I3Q A;  2PJH B;  1YNN D;  3HU1 A;  5FTM A;  1QCS A;  4CRZ A;  2AE0 X;  1FDI A;  2A68 D;  1E32 A;  2E7Z A;  1DMR A;  4CS0 A;  2V3V A;  2R93 A;  4AAY A;  3CQZ A;  2NAP A;  1S3S A;  1AA6 A;  2VPY A;  4C2M A;  2DMR A;  4QIW A;  1E5V A;  2PI8 A;  4AYB A;  2PJJ A;  2JIO A;  5FTK A;  1TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...