3TM7B

Processed aspartate decarboxylase mutant with asn72 mutated to ala
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVAGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli aspartate alpha-decarboxylase Asn72Ala: probing the role of Asn72 in pyruvoyl cofactor formation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase beta chain
total genus 22
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2011-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3tm7B00
3TIWA 1G8JA 1R27A 3HU2A 1PPYA 4CRYG 4GA6A 4KO8A 1I50A 1TWAA 1H0HA 4C2MA 1Y4ZA 3GTLA 5FTNA 1FDOA 2WB1A 1QDNA 1E61A 2JIRA 3HU1A 4D7ZB 3GTOA 1CZ4A 2WAQA 1SFOA 4KODA 5C1BA 3QQ7A 2KI8A 2VUMA 5T5ID 1E5VA 2JA5A 2C45A 5EPPA 3TM7B 1FDIA 2PJHB 3PLXB 3GTJA 4AAYA 2VPWA 2JIMA 1PQHA 1TMOA 1PQEA 5FTLA 2JA7A 2VPZA 1H5NA 2NVXA 1AA6A 4AOKB 1Y1WA 2V45A 3OUGA 1SIWA 2Y0SA 4QIWA 4CS0A 1Y1VA 2JA6A 2JIPA 2NYAA 5B6CA 5FTJA 3ML1A 3HU3A 3QC8A 1IW7D 2VPYA 1G8KA 5DYGA 2JIOA 5FTKA 3IR7A 3GTGA 1OGYA 4KLNA 4AONB 3O5AA 1PYQA 4CRZA 3DMRA 5T5MD 2E2IA 4DMRA 1CR5A 2E2HA 2R93A 1TWGA 1KQFA 2YU9A 3FKIA 2IV2X 1E60A 1UHEA 5GLFA 2DMRA 1KQGA 1PYUB 1S3SA 3H0GA 2E7ZA 1K83A 1TWFA 1DMSA 3QQ8A 1R9TA 1E18A 5DYIA 3QWZA 5C18A 1YLEA 4GA5A 1R7RA 1DMRA 1PT1A 2NVYA 1TWCA 2JIQA 2NAPA 1WLFA 1PT0A 4KDIA 1AW8B 1Y5IA 1E32A 3GTKA 4KDLA 1VC3B 2EEOB 1WCMA 1PQFA 2R7ZA 3IR5A 1TWHA 3GTMA 3HKZA 4RV0A 4AYBA 1Q16A 2PMZA 2B63A 1I3QA 1CZ5A 1EU1A 1QCSA 3CF2A 3GTPA 1UHDA 3IR6A 4AZDA 2R92A 3CQZA 5FTMA 2VPXA 3GTQA 2V3VA
chains in the Genus database with same CATH superfamily
1YNJD 3TIWA 1G8JA 1R27A 1ZYRD 3HU2A 1PPYA 2PI8A 4JJOA 4GA6A 4CRYG 4KO8A 3SUKA 1I50A 1TWAA 1H0HA 4C2MA 1Y4ZA 2PJJA 3GTLA 5FTNA 1FDOA 2WB1A 1QDNA 1E61A 3X2GA 2JIRA 3HU1A 4D7ZB 3GTOA 1CZ4A 2WAQA 1SFOA 4KODA 3X2LA 5C1BA 3QQ7A 1HD5A 3SUJA 2KI8A 4L48A 2VUMA 1BW3A 4NOHA 2GAEA 5T5ID 1E5VA 3X2PA 2C45A 5EPPA 4JP7A 3TM7B 3X2NA 1FDIA 2JA5A 2PJHB 4JP6A 3PLXB 3GTJA 4AAYA 2VPWA 3X2HA 2JIMA 1PQHA 1TMOA 2PICA 1PQEA 3CZBA 5FTLA 2JA7A 1YNND 2VPZA 1H5NA 1SMYD 4FFTA 1AA6A 2NVXA 2KQAA 4AOKB 1Y1WA 2V45A 3OUGA 1SIWA 2Y0SA 4ZM7A 2A6ED 2PNWA 3X2KA 4QIWA 4CS0A 1Y1VA 2JA6A 2JIPA 2NYAA 5B6CA 5FTJA 4ENGA 3ML1A 3HU3A 3QC8A 1IW7D 2A6HD 4JS7A 2VPYA 2G6GA 1G8KA 5DYGA 2JIOA 5FTKA 3IR7A 3GTGA 4AVRA 1OGYA 4KLNA 4AONB 3O5AA 2BH0A 1PYQA 4CRZA 3DMRA 5T5MD 2E2IA 1L8FA 4DMRA 1CR5A 2E2HA 3X2MA 2YUJA 2R93A 1TWGA 1KQFA 1WC2A 2YU9A 3FKIA 4FERA 2IV2X 1E60A 1UHEA 5GLFA 2DMRA 1KQGA 1PYUB 1S3SA 3H0GA 2E7ZA 1K83A 2O5JD 3X2JA 1TWFA 2A68D 1DMSA 3QQ8A 1R9TA 1E18A 5DYIA 3QWZA 5C18A 1YLEA 4GA5A 1R7RA 4JCWA 1DMRA 2G5DA 5H4UA 1PT1A 2NVYA 1TWCA 2JIQA 2NAPA 1WLFA 1PT0A 5GM9A 4KDIA 1AW8B 3X2OA 1Y5IA 1E32A 4FG4A 3GTKA 3D30A 2HCZX 3ENGA 4KDLA 2A69D 2AE0X 1VC3B 2EEOB 1WCMA 5GLYA 1PQFA 2R7ZA 3IR5A 1TWHA 3GTMA 1OA7A 4FG2A 1ZC1A 3HKZA 4RV0A 3SULA 4AYBA 1Q16A 2ENGA 2PMZA 2B63A 5GLXA 1I3QA 1CZ5A 1EU1A 1OA9A 1QCSA 3CF2A 3GTPA 1UHDA 3IR6A 3SUMA 4AZDA 2R92A 2BE5D 3CQZA 5FTMA 2CW0D 1N10A 3M3GA 2VPXA 3GTQA 1BW4A 3X2IA 2V3VA
chains in the Genus database with same CATH topology
1YNJD 3TIWA 1G8JA 1R27A 1ZYRD 3HU2A 1PPYA 2PI8A 4CRYG 4GA6A 4KO8A 1I50A 1TWAA 1H0HA 4C2MA 1Y4ZA 2PJJA 3GTLA 5FTNA 1FDOA 2WB1A 1QDNA 1E61A 2JIRA 3HU1A 4D7ZB 3GTOA 1CZ4A 2WAQA 1SFOA 4KODA 5C1BA 3QQ7A 2KI8A 2VUMA 4NOHA 2GAEA 5T5ID 1E5VA 2JA5A 2C45A 5EPPA 3TM7B 1FDIA 2PJHB 3PLXB 3GTJA 4AAYA 2VPWA 2JIMA 1PQHA 1TMOA 2PICA 1PQEA 3CZBA 5FTLA 2JA7A 1YNND 2VPZA 1H5NA 1SMYD 2NVXA 1AA6A 4AOKB 1Y1WA 2V45A 3OUGA 1SIWA 2Y0SA 2A6ED 2PNWA 4QIWA 4CS0A 1Y1VA 2JA6A 2JIPA 2NYAA 5B6CA 5FTJA 3ML1A 3HU3A 3QC8A 1IW7D 2A6HD 2VPYA 2G6GA 1G8KA 5DYGA 2JIOA 5FTKA 3IR7A 3GTGA 1OGYA 4KLNA 4AONB 3O5AA 1PYQA 4CRZA 3DMRA 5T5MD 2E2IA 4DMRA 1CR5A 2E2HA 2YUJA 2R93A 1TWGA 1KQFA 2YU9A 3FKIA 2IV2X 1E60A 1UHEA 5GLFA 2DMRA 1KQGA 1PYUB 1S3SA 3H0GA 2E7ZA 1K83A 2O5JD 1TWFA 2A68D 1DMSA 3QQ8A 1R9TA 1E18A 5DYIA 3QWZA 5C18A 1YLEA 4GA5A 1R7RA 1DMRA 2G5DA 1PT1A 2NVYA 1TWCA 2JIQA 2NAPA 1WLFA 1PT0A 4KDIA 1AW8B 1Y5IA 1E32A 3GTKA 4KDLA 2A69D 2AE0X 1VC3B 2EEOB 1WCMA 1PQFA 2R7ZA 3IR5A 1TWHA 3GTMA 1ZC1A 3HKZA 4RV0A 4AYBA 1Q16A 2PMZA 2B63A 1I3QA 1CZ5A 1EU1A 1QCSA 3CF2A 3GTPA 1UHDA 3IR6A 4AZDA 2R92A 2BE5D 3CQZA 5FTMA 2CW0D 2VPXA 3GTQA 2V3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TIW A;  1G8J A;  1R27 A;  3HU2 A;  1PPY A;  4CRY G;  4GA6 A;  4KO8 A;  1I50 A;  1TWA A;  1H0H A;  4C2M A;  1Y4Z A;  3GTL A;  5FTN A;  1FDO A;  2WB1 A;  1QDN A;  1E61 A;  2JIR A;  3HU1 A;  4D7Z B;  3GTO A;  1CZ4 A;  2WAQ A;  1SFO A;  4KOD A;  5C1B A;  3QQ7 A;  2KI8 A;  2VUM A;  5T5I D;  1E5V A;  2JA5 A;  2C45 A;  5EPP A;  3TM7 B;  1FDI A;  2PJH B;  3PLX B;  3GTJ A;  4AAY A;  2VPW A;  2JIM A;  1PQH A;  1TMO A;  1PQE A;  5FTL A;  2JA7 A;  2VPZ A;  1H5N A;  2NVX A;  1AA6 A;  4AOK B;  1Y1W A;  2V45 A;  3OUG A;  1SIW A;  2Y0S A;  4QIW A;  4CS0 A;  1Y1V A;  2JA6 A;  2JIP A;  2NYA A;  5B6C A;  5FTJ A;  3ML1 A;  3HU3 A;  3QC8 A;  1IW7 D;  2VPY A;  1G8K A;  5DYG A;  2JIO A;  5FTK A;  3IR7 A;  3GTG A;  1OGY A;  4KLN A;  4AON B;  3O5A A;  1PYQ A;  4CRZ A;  3DMR A;  5T5M D;  2E2I A;  4DMR A;  1CR5 A;  2E2H A;  2R93 A;  1TWG A;  1KQF A;  2YU9 A;  3FKI A;  2IV2 X;  1E60 A;  1UHE A;  5GLF A;  2DMR A;  1KQG A;  1PYU B;  1S3S A;  3H0G A;  2E7Z A;  1K83 A;  1TWF A;  1DMS A;  3QQ8 A;  1R9T A;  1E18 A;  5DYI A;  3QWZ A;  5C18 A;  1YLE A;  4GA5 A;  1R7R A;  1DMR A;  1PT1 A;  2NVY A;  1TWC A;  2JIQ A;  2NAP A;  1WLF A;  1PT0 A;  4KDI A;  1AW8 B;  1Y5I A;  1E32 A;  3GTK A;  4KDL A;  1VC3 B;  2EEO B;  1WCM A;  1PQF A;  2R7Z A;  3IR5 A;  1TWH A;  3GTM A;  3HKZ A;  4RV0 A;  4AYB A;  1Q16 A;  2PMZ A;  2B63 A;  1I3Q A;  1CZ5 A;  1EU1 A;  1QCS A;  3CF2 A;  3GTP A;  1UHD A;  3IR6 A;  4AZD A;  2R92 A;  3CQZ A;  5FTM A;  2VPX A;  3GTQ A;  2V3V A; 
#chains in the Genus database with same CATH topology
 1YNJ D;  3TIW A;  1G8J A;  1R27 A;  1ZYR D;  3HU2 A;  1PPY A;  2PI8 A;  4JJO A;  4GA6 A;  4CRY G;  4KO8 A;  3SUK A;  1I50 A;  1TWA A;  1H0H A;  4C2M A;  1Y4Z A;  2PJJ A;  3GTL A;  5FTN A;  1FDO A;  2WB1 A;  1QDN A;  1E61 A;  3X2G A;  2JIR A;  3HU1 A;  4D7Z B;  3GTO A;  1CZ4 A;  2WAQ A;  1SFO A;  4KOD A;  3X2L A;  5C1B A;  3QQ7 A;  1HD5 A;  3SUJ A;  2KI8 A;  4L48 A;  2VUM A;  1BW3 A;  4NOH A;  2GAE A;  5T5I D;  1E5V A;  3X2P A;  2C45 A;  5EPP A;  4JP7 A;  3TM7 B;  3X2N A;  1FDI A;  2JA5 A;  2PJH B;  4JP6 A;  3PLX B;  3GTJ A;  4AAY A;  2VPW A;  3X2H A;  2JIM A;  1PQH A;  1TMO A;  2PIC A;  1PQE A;  3CZB A;  5FTL A;  2JA7 A;  1YNN D;  2VPZ A;  1H5N A;  1SMY D;  4FFT A;  1AA6 A;  2NVX A;  2KQA A;  4AOK B;  1Y1W A;  2V45 A;  3OUG A;  1SIW A;  2Y0S A;  4ZM7 A;  2A6E D;  2PNW A;  3X2K A;  4QIW A;  4CS0 A;  1Y1V A;  2JA6 A;  2JIP A;  2NYA A;  5B6C A;  5FTJ A;  4ENG A;  3ML1 A;  3HU3 A;  3QC8 A;  1IW7 D;  2A6H D;  4JS7 A;  2VPY A;  2G6G A;  1G8K A;  5DYG A;  2JIO A;  5FTK A;  3IR7 A;  3GTG A;  4AVR A;  1OGY A;  4KLN A;  4AON B;  3O5A A;  2BH0 A;  1PYQ A;  4CRZ A;  3DMR A;  5T5M D;  2E2I A;  1L8F A;  4DMR A;  1CR5 A;  2E2H A;  3X2M A;  2YUJ A;  2R93 A;  1TWG A;  1KQF A;  1WC2 A;  2YU9 A;  3FKI A;  4FER A;  2IV2 X;  1E60 A;  1UHE A;  5GLF A;  2DMR A;  1KQG A;  1PYU B;  1S3S A;  3H0G A;  2E7Z A;  1K83 A;  2O5J D;  3X2J A;  1TWF A;  2A68 D;  1DMS A;  3QQ8 A;  1R9T A;  1E18 A;  5DYI A;  3QWZ A;  5C18 A;  1YLE A;  4GA5 A;  1R7R A;  4JCW A;  1DMR A;  2G5D A;  5H4U A;  1PT1 A;  2NVY A;  1TWC A;  2JIQ A;  2NAP A;  1WLF A;  1PT0 A;  5GM9 A;  4KDI A;  1AW8 B;  3X2O A;  1Y5I A;  1E32 A;  4FG4 A;  3GTK A;  3D30 A;  2HCZ X;  3ENG A;  4KDL A;  2A69 D;  2AE0 X;  1VC3 B;  2EEO B;  1WCM A;  5GLY A;  1PQF A;  2R7Z A;  3IR5 A;  1TWH A;  3GTM A;  1OA7 A;  4FG2 A;  1ZC1 A;  3HKZ A;  4RV0 A;  3SUL A;  4AYB A;  1Q16 A;  2ENG A;  2PMZ A;  2B63 A;  5GLX A;  1I3Q A;  1CZ5 A;  1EU1 A;  1OA9 A;  1QCS A;  3CF2 A;  3GTP A;  1UHD A;  3IR6 A;  3SUM A;  4AZD A;  2R92 A;  2BE5 D;  3CQZ A;  5FTM A;  2CW0 D;  1N10 A;  3M3G A;  2VPX A;  3GTQ A;  1BW4 A;  3X2I A;  2V3V A; 
#chains in the Genus database with same CATH homology
 1YNJ D;  3TIW A;  1G8J A;  1R27 A;  1ZYR D;  3HU2 A;  1PPY A;  2PI8 A;  4CRY G;  4GA6 A;  4KO8 A;  1I50 A;  1TWA A;  1H0H A;  4C2M A;  1Y4Z A;  2PJJ A;  3GTL A;  5FTN A;  1FDO A;  2WB1 A;  1QDN A;  1E61 A;  2JIR A;  3HU1 A;  4D7Z B;  3GTO A;  1CZ4 A;  2WAQ A;  1SFO A;  4KOD A;  5C1B A;  3QQ7 A;  2KI8 A;  2VUM A;  4NOH A;  2GAE A;  5T5I D;  1E5V A;  2JA5 A;  2C45 A;  5EPP A;  3TM7 B;  1FDI A;  2PJH B;  3PLX B;  3GTJ A;  4AAY A;  2VPW A;  2JIM A;  1PQH A;  1TMO A;  2PIC A;  1PQE A;  3CZB A;  5FTL A;  2JA7 A;  1YNN D;  2VPZ A;  1H5N A;  1SMY D;  2NVX A;  1AA6 A;  4AOK B;  1Y1W A;  2V45 A;  3OUG A;  1SIW A;  2Y0S A;  2A6E D;  2PNW A;  4QIW A;  4CS0 A;  1Y1V A;  2JA6 A;  2JIP A;  2NYA A;  5B6C A;  5FTJ A;  3ML1 A;  3HU3 A;  3QC8 A;  1IW7 D;  2A6H D;  2VPY A;  2G6G A;  1G8K A;  5DYG A;  2JIO A;  5FTK A;  3IR7 A;  3GTG A;  1OGY A;  4KLN A;  4AON B;  3O5A A;  1PYQ A;  4CRZ A;  3DMR A;  5T5M D;  2E2I A;  4DMR A;  1CR5 A;  2E2H A;  2YUJ A;  2R93 A;  1TWG A;  1KQF A;  2YU9 A;  3FKI A;  2IV2 X;  1E60 A;  1UHE A;  5GLF A;  2DMR A;  1KQG A;  1PYU B;  1S3S A;  3H0G A;  2E7Z A;  1K83 A;  2O5J D;  1TWF A;  2A68 D;  1DMS A;  3QQ8 A;  1R9T A;  1E18 A;  5DYI A;  3QWZ A;  5C18 A;  1YLE A;  4GA5 A;  1R7R A;  1DMR A;  2G5D A;  1PT1 A;  2NVY A;  1TWC A;  2JIQ A;  2NAP A;  1WLF A;  1PT0 A;  4KDI A;  1AW8 B;  1Y5I A;  1E32 A;  3GTK A;  4KDL A;  2A69 D;  2AE0 X;  1VC3 B;  2EEO B;  1WCM A;  1PQF A;  2R7Z A;  3IR5 A;  1TWH A;  3GTM A;  1ZC1 A;  3HKZ A;  4RV0 A;  4AYB A;  1Q16 A;  2PMZ A;  2B63 A;  1I3Q A;  1CZ5 A;  1EU1 A;  1QCS A;  3CF2 A;  3GTP A;  1UHD A;  3IR6 A;  4AZD A;  2R92 A;  2BE5 D;  3CQZ A;  5FTM A;  2CW0 D;  2VPX A;  3GTQ A;  2V3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...