3TM7B

Processed aspartate decarboxylase mutant with asn72 mutated to ala
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVAGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Structure of Escherichia coli aspartate alpha-decarboxylase Asn72Ala: probing the role of Asn72 in pyruvoyl cofactor formation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 22
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2011-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3tm7B00
4KODA 3GTJA 4AOKB 2JIMA 1Y4ZA 5DYGA 3ML1A 2E2IA 2B63A 3IR5A 3GTQA 1I50A 1R7RA 1TWHA 1PPYA 2PJHB 3O5AA 1WCMA 2R7ZA 1CZ5A 1FDOA 1AW8B 3HKZA 2JIPA 1TMOA 1KQFA 2R92A 1E18A 2PMZA 1YLEA 3IR6A 2WAQA 2E2HA 1G8JA 4AAYA 4CS0A 3DMRA 3CQZA 1E5VA 2JA7A 3GTOA 1QCSA 2NYAA 1Q16A 1TWAA 2JA6A 1CZ4A 2DMRA 1PYUB 5FTKA 2NAPA 2VPYA 3PLXB 3QQ8A 1TWCA 1R27A 1EU1A 5C18A 5EPPA 1DMSA 5FTLA 1TWFA 5T5ID 4KO8A 1Y5IA 1K83A 4RV0A 2Y0SA 3GTLA 1H5NA 4AONB 4QIWA 2JIRA 1FDIA 1PYQA 5T5MD 4KDLA 1G8KA 1PQEA 3GTKA 3IR7A 3TM7B 1Y1WA 1E60A 2JA5A 1PQHA 4KLNA 4AZDA 1I3QA 1R9TA 2C45A 1PT1A 1WLFA 1VC3B 1AA6A 2WB1A 1PQFA 1E32A 1Y1VA 2KI8A 5DYIA 5FTNA 1S3SA 1PT0A 2VPZA 2V3VA 5C1BA 4AYBA 1E61A 2E7ZA 1KQGA 3CF2A 3HU1A 1H0HA 3H0GA 1CR5A 5GLFA 5B6CA 2IV2X 1OGYA 2VPWA 2JIOA 4C2MA 2YU9A 2JIQA 1SFOA 3QWZA 3GTGA 4GA5A 3FKIA 3OUGA 4GA6A 4KDIA 2V45A 3QQ7A 1IW7D 1UHDA 1TWGA 3QC8A 4CRYG 2NVYA 2VPXA 2R93A 3GTPA 1QDNA 5FTMA 5FTJA 4DMRA 2VUMA 3HU2A 3HU3A 3TIWA 1SIWA 1DMRA 4CRZA 4D7ZB 3GTMA 1UHEA 2NVXA 2EEOB
chains in the Genus database with same CATH superfamily
4KODA 3GTJA 4AOKB 2JIMA 3M3GA 1BW4A 1Y4ZA 5DYGA 3ML1A 2E2IA 2B63A 3IR5A 3GTQA 4FG2A 1I50A 1R7RA 1TWHA 1PPYA 1YNND 2BH0A 2GAEA 2PJHB 1WCMA 3O5AA 5GLXA 2PJJA 2R7ZA 1CZ5A 1FDOA 1AW8B 1OA9A 2A6HD 3HKZA 3X2OA 2JIPA 4JCWA 1TMOA 3X2MA 1KQFA 2R92A 1E18A 1ZC1A 2HCZX 1YLEA 2PMZA 2WAQA 3IR6A 1G8JA 2E2HA 4AAYA 4CS0A 3DMRA 3CQZA 1WC2A 1E5VA 2JA7A 3GTOA 1QCSA 2NYAA 1Q16A 1TWAA 3CZBA 2JA6A 1CZ4A 2DMRA 1PYUB 5FTKA 2NAPA 2VPYA 3PLXB 3QQ8A 1TWCA 1R27A 3X2NA 1EU1A 5C18A 3X2JA 5EPPA 1DMSA 5FTLA 3X2GA 1TWFA 4ZM7A 5T5ID 2PI8A 4KO8A 2YUJA 2PNWA 2BE5D 1Y5IA 2G5DA 5H4UA 4ENGA 3X2LA 1K83A 4RV0A 2Y0SA 3GTLA 1H5NA 4AONB 4QIWA 2JIRA 1FDIA 1PYQA 5T5MD 1HD5A 4KDLA 1G8KA 2AE0X 3SUKA 1PQEA 2O5JD 3GTKA 3IR7A 4AVRA 4JP7A 3TM7B 3D30A 1Y1WA 1E60A 2JA5A 1PQHA 4KLNA 4AZDA 1I3QA 1R9TA 4NOHA 2C45A 1PT1A 4L48A 4FG4A 1WLFA 3ENGA 3X2PA 1VC3B 1AA6A 2WB1A 1PQFA 1L8FA 1BW3A 1E32A 1N10A 1Y1VA 1ZYRD 2KI8A 5DYIA 2ENGA 5FTNA 1S3SA 4JP6A 1PT0A 2VPZA 2V3VA 3X2IA 1OA7A 4AYBA 1E61A 2E7ZA 2PICA 5C1BA 5GM9A 1KQGA 1YNJD 3CF2A 3HU1A 2A6ED 1H0HA 3X2KA 3H0GA 1CR5A 1SMYD 5GLFA 3X2HA 5B6CA 4JS7A 5GLYA 3SULA 2IV2X 1OGYA 2VPWA 2JIOA 4C2MA 2YU9A 2JIQA 1SFOA 3QWZA 3GTGA 4GA5A 3FKIA 3OUGA 4GA6A 4KDIA 2G6GA 2V45A 3QQ7A 1IW7D 1UHDA 4FFTA 3SUMA 1TWGA 2CW0D 3QC8A 4FERA 4CRYG 2NVYA 2VPXA 2R93A 3GTPA 2A69D 1QDNA 5FTMA 2A68D 5FTJA 4JJOA 2KQAA 4DMRA 2VUMA 3HU2A 3HU3A 3TIWA 1SIWA 3SUJA 1DMRA 4CRZA 4D7ZB 3GTMA 1UHEA 2NVXA 2EEOB
chains in the Genus database with same CATH topology
4KODA 3GTJA 4AOKB 2JIMA 1Y4ZA 5DYGA 3ML1A 2E2IA 2B63A 3IR5A 3GTQA 1I50A 1R7RA 1TWHA 1PPYA 1YNND 2GAEA 2PJHB 3O5AA 1WCMA 2PJJA 2R7ZA 1CZ5A 1FDOA 1AW8B 2A6HD 3HKZA 2JIPA 1TMOA 1KQFA 2R92A 1E18A 1ZC1A 2PMZA 1YLEA 3IR6A 2WAQA 2E2HA 1G8JA 4AAYA 4CS0A 3DMRA 3CQZA 1E5VA 2JA7A 3GTOA 1QCSA 2NYAA 1Q16A 1TWAA 3CZBA 2JA6A 1CZ4A 2DMRA 1PYUB 5FTKA 2NAPA 2VPYA 3PLXB 3QQ8A 1TWCA 1R27A 1EU1A 5C18A 5EPPA 1DMSA 5FTLA 1TWFA 5T5ID 2PI8A 4KO8A 2YUJA 2PNWA 2BE5D 1Y5IA 2G5DA 1K83A 4RV0A 2Y0SA 3GTLA 1H5NA 4AONB 4QIWA 2JIRA 1FDIA 1PYQA 5T5MD 4KDLA 1G8KA 2AE0X 1PQEA 2O5JD 3GTKA 3IR7A 3TM7B 1Y1WA 1E60A 2JA5A 1PQHA 4KLNA 4AZDA 1I3QA 1R9TA 4NOHA 2C45A 1PT1A 1WLFA 1VC3B 1AA6A 2WB1A 1PQFA 1E32A 1Y1VA 1ZYRD 2KI8A 5DYIA 5FTNA 1S3SA 1PT0A 2VPZA 2V3VA 5C1BA 4AYBA 1E61A 2E7ZA 2PICA 1KQGA 1YNJD 3CF2A 3HU1A 2A6ED 1H0HA 3H0GA 1CR5A 1SMYD 5GLFA 5B6CA 2IV2X 1OGYA 2VPWA 2JIOA 4C2MA 2YU9A 2JIQA 1SFOA 3QWZA 3GTGA 4GA5A 3FKIA 3OUGA 4GA6A 4KDIA 2G6GA 2V45A 3QQ7A 1IW7D 1UHDA 1TWGA 2CW0D 3QC8A 4CRYG 2NVYA 2VPXA 2R93A 3GTPA 2A69D 1QDNA 5FTMA 2A68D 5FTJA 4DMRA 2VUMA 3HU2A 3HU3A 3TIWA 1SIWA 1DMRA 4CRZA 4D7ZB 3GTMA 1UHEA 2NVXA 2EEOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOD A;  3GTJ A;  4AOK B;  2JIM A;  1Y4Z A;  5DYG A;  3ML1 A;  2E2I A;  2B63 A;  3IR5 A;  3GTQ A;  1I50 A;  1R7R A;  1TWH A;  1PPY A;  2PJH B;  3O5A A;  1WCM A;  2R7Z A;  1CZ5 A;  1FDO A;  1AW8 B;  3HKZ A;  2JIP A;  1TMO A;  1KQF A;  2R92 A;  1E18 A;  2PMZ A;  1YLE A;  3IR6 A;  2WAQ A;  2E2H A;  1G8J A;  4AAY A;  4CS0 A;  3DMR A;  3CQZ A;  1E5V A;  2JA7 A;  3GTO A;  1QCS A;  2NYA A;  1Q16 A;  1TWA A;  2JA6 A;  1CZ4 A;  2DMR A;  1PYU B;  5FTK A;  2NAP A;  2VPY A;  3PLX B;  3QQ8 A;  1TWC A;  1R27 A;  1EU1 A;  5C18 A;  5EPP A;  1DMS A;  5FTL A;  1TWF A;  5T5I D;  4KO8 A;  1Y5I A;  1K83 A;  4RV0 A;  2Y0S A;  3GTL A;  1H5N A;  4AON B;  4QIW A;  2JIR A;  1FDI A;  1PYQ A;  5T5M D;  4KDL A;  1G8K A;  1PQE A;  3GTK A;  3IR7 A;  3TM7 B;  1Y1W A;  1E60 A;  2JA5 A;  1PQH A;  4KLN A;  4AZD A;  1I3Q A;  1R9T A;  2C45 A;  1PT1 A;  1WLF A;  1VC3 B;  1AA6 A;  2WB1 A;  1PQF A;  1E32 A;  1Y1V A;  2KI8 A;  5DYI A;  5FTN A;  1S3S A;  1PT0 A;  2VPZ A;  2V3V A;  5C1B A;  4AYB A;  1E61 A;  2E7Z A;  1KQG A;  3CF2 A;  3HU1 A;  1H0H A;  3H0G A;  1CR5 A;  5GLF A;  5B6C A;  2IV2 X;  1OGY A;  2VPW A;  2JIO A;  4C2M A;  2YU9 A;  2JIQ A;  1SFO A;  3QWZ A;  3GTG A;  4GA5 A;  3FKI A;  3OUG A;  4GA6 A;  4KDI A;  2V45 A;  3QQ7 A;  1IW7 D;  1UHD A;  1TWG A;  3QC8 A;  4CRY G;  2NVY A;  2VPX A;  2R93 A;  3GTP A;  1QDN A;  5FTM A;  5FTJ A;  4DMR A;  2VUM A;  3HU2 A;  3HU3 A;  3TIW A;  1SIW A;  1DMR A;  4CRZ A;  4D7Z B;  3GTM A;  1UHE A;  2NVX A;  2EEO B; 
#chains in the Genus database with same CATH topology
 4KOD A;  3GTJ A;  4AOK B;  2JIM A;  3M3G A;  1BW4 A;  1Y4Z A;  5DYG A;  3ML1 A;  2E2I A;  2B63 A;  3IR5 A;  3GTQ A;  4FG2 A;  1I50 A;  1R7R A;  1TWH A;  1PPY A;  1YNN D;  2BH0 A;  2GAE A;  2PJH B;  1WCM A;  3O5A A;  5GLX A;  2PJJ A;  2R7Z A;  1CZ5 A;  1FDO A;  1AW8 B;  1OA9 A;  2A6H D;  3HKZ A;  3X2O A;  2JIP A;  4JCW A;  1TMO A;  3X2M A;  1KQF A;  2R92 A;  1E18 A;  1ZC1 A;  2HCZ X;  1YLE A;  2PMZ A;  2WAQ A;  3IR6 A;  1G8J A;  2E2H A;  4AAY A;  4CS0 A;  3DMR A;  3CQZ A;  1WC2 A;  1E5V A;  2JA7 A;  3GTO A;  1QCS A;  2NYA A;  1Q16 A;  1TWA A;  3CZB A;  2JA6 A;  1CZ4 A;  2DMR A;  1PYU B;  5FTK A;  2NAP A;  2VPY A;  3PLX B;  3QQ8 A;  1TWC A;  1R27 A;  3X2N A;  1EU1 A;  5C18 A;  3X2J A;  5EPP A;  1DMS A;  5FTL A;  3X2G A;  1TWF A;  4ZM7 A;  5T5I D;  2PI8 A;  4KO8 A;  2YUJ A;  2PNW A;  2BE5 D;  1Y5I A;  2G5D A;  5H4U A;  4ENG A;  3X2L A;  1K83 A;  4RV0 A;  2Y0S A;  3GTL A;  1H5N A;  4AON B;  4QIW A;  2JIR A;  1FDI A;  1PYQ A;  5T5M D;  1HD5 A;  4KDL A;  1G8K A;  2AE0 X;  3SUK A;  1PQE A;  2O5J D;  3GTK A;  3IR7 A;  4AVR A;  4JP7 A;  3TM7 B;  3D30 A;  1Y1W A;  1E60 A;  2JA5 A;  1PQH A;  4KLN A;  4AZD A;  1I3Q A;  1R9T A;  4NOH A;  2C45 A;  1PT1 A;  4L48 A;  4FG4 A;  1WLF A;  3ENG A;  3X2P A;  1VC3 B;  1AA6 A;  2WB1 A;  1PQF A;  1L8F A;  1BW3 A;  1E32 A;  1N10 A;  1Y1V A;  1ZYR D;  2KI8 A;  5DYI A;  2ENG A;  5FTN A;  1S3S A;  4JP6 A;  1PT0 A;  2VPZ A;  2V3V A;  3X2I A;  1OA7 A;  4AYB A;  1E61 A;  2E7Z A;  2PIC A;  5C1B A;  5GM9 A;  1KQG A;  1YNJ D;  3CF2 A;  3HU1 A;  2A6E D;  1H0H A;  3X2K A;  3H0G A;  1CR5 A;  1SMY D;  5GLF A;  3X2H A;  5B6C A;  4JS7 A;  5GLY A;  3SUL A;  2IV2 X;  1OGY A;  2VPW A;  2JIO A;  4C2M A;  2YU9 A;  2JIQ A;  1SFO A;  3QWZ A;  3GTG A;  4GA5 A;  3FKI A;  3OUG A;  4GA6 A;  4KDI A;  2G6G A;  2V45 A;  3QQ7 A;  1IW7 D;  1UHD A;  4FFT A;  3SUM A;  1TWG A;  2CW0 D;  3QC8 A;  4FER A;  4CRY G;  2NVY A;  2VPX A;  2R93 A;  3GTP A;  2A69 D;  1QDN A;  5FTM A;  2A68 D;  5FTJ A;  4JJO A;  2KQA A;  4DMR A;  2VUM A;  3HU2 A;  3HU3 A;  3TIW A;  1SIW A;  3SUJ A;  1DMR A;  4CRZ A;  4D7Z B;  3GTM A;  1UHE A;  2NVX A;  2EEO B; 
#chains in the Genus database with same CATH homology
 4KOD A;  3GTJ A;  4AOK B;  2JIM A;  1Y4Z A;  5DYG A;  3ML1 A;  2E2I A;  2B63 A;  3IR5 A;  3GTQ A;  1I50 A;  1R7R A;  1TWH A;  1PPY A;  1YNN D;  2GAE A;  2PJH B;  3O5A A;  1WCM A;  2PJJ A;  2R7Z A;  1CZ5 A;  1FDO A;  1AW8 B;  2A6H D;  3HKZ A;  2JIP A;  1TMO A;  1KQF A;  2R92 A;  1E18 A;  1ZC1 A;  2PMZ A;  1YLE A;  3IR6 A;  2WAQ A;  2E2H A;  1G8J A;  4AAY A;  4CS0 A;  3DMR A;  3CQZ A;  1E5V A;  2JA7 A;  3GTO A;  1QCS A;  2NYA A;  1Q16 A;  1TWA A;  3CZB A;  2JA6 A;  1CZ4 A;  2DMR A;  1PYU B;  5FTK A;  2NAP A;  2VPY A;  3PLX B;  3QQ8 A;  1TWC A;  1R27 A;  1EU1 A;  5C18 A;  5EPP A;  1DMS A;  5FTL A;  1TWF A;  5T5I D;  2PI8 A;  4KO8 A;  2YUJ A;  2PNW A;  2BE5 D;  1Y5I A;  2G5D A;  1K83 A;  4RV0 A;  2Y0S A;  3GTL A;  1H5N A;  4AON B;  4QIW A;  2JIR A;  1FDI A;  1PYQ A;  5T5M D;  4KDL A;  1G8K A;  2AE0 X;  1PQE A;  2O5J D;  3GTK A;  3IR7 A;  3TM7 B;  1Y1W A;  1E60 A;  2JA5 A;  1PQH A;  4KLN A;  4AZD A;  1I3Q A;  1R9T A;  4NOH A;  2C45 A;  1PT1 A;  1WLF A;  1VC3 B;  1AA6 A;  2WB1 A;  1PQF A;  1E32 A;  1Y1V A;  1ZYR D;  2KI8 A;  5DYI A;  5FTN A;  1S3S A;  1PT0 A;  2VPZ A;  2V3V A;  5C1B A;  4AYB A;  1E61 A;  2E7Z A;  2PIC A;  1KQG A;  1YNJ D;  3CF2 A;  3HU1 A;  2A6E D;  1H0H A;  3H0G A;  1CR5 A;  1SMY D;  5GLF A;  5B6C A;  2IV2 X;  1OGY A;  2VPW A;  2JIO A;  4C2M A;  2YU9 A;  2JIQ A;  1SFO A;  3QWZ A;  3GTG A;  4GA5 A;  3FKI A;  3OUG A;  4GA6 A;  4KDI A;  2G6G A;  2V45 A;  3QQ7 A;  1IW7 D;  1UHD A;  1TWG A;  2CW0 D;  3QC8 A;  4CRY G;  2NVY A;  2VPX A;  2R93 A;  3GTP A;  2A69 D;  1QDN A;  5FTM A;  2A68 D;  5FTJ A;  4DMR A;  2VUM A;  3HU2 A;  3HU3 A;  3TIW A;  1SIW A;  1DMR A;  4CRZ A;  4D7Z B;  3GTM A;  1UHE A;  2NVX A;  2EEO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...