3TM7B

Processed aspartate decarboxylase mutant with asn72 mutated to ala
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVAGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Structure of Escherichia coli aspartate alpha-decarboxylase Asn72Ala: probing the role of Asn72 in pyruvoyl cofactor formation
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2011-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3tm7B00
1PYQA 1R27A 3HU2A 1G8KA 2R93A 3FKIA 3OUGA 1PYUB 1SIWA 1UHDA 1KQFA 5EPPA 2VPYA 5GLFA 1SFOA 4CS0A 4RV0A 2VPXA 1R9TA 1FDIA 1AW8B 2PJHB 4GA5A 4KO8A 4D7ZB 1VC3B 4AZDA 3CQZA 5FTMA 1TMOA 4KDLA 3QC8A 1R7RA 2E2HA 3HU3A 1Y4ZA 1I3QA 2WB1A 1Q16A 3O5AA 2C45A 1PT0A 2R7ZA 2VPZA 1QCSA 2NYAA 4KDIA 2KI8A 4CRYG 1IW7D 4GA6A 1KQGA 2DMRA 3GTKA 1TWCA 1DMRA 3CF2A 3GTQA 2PMZA 3IR6A 3H0GA 1H5NA 2V45A 4QIWA 1WLFA 4CRZA 1E32A 2JIRA 2NVYA 2VUMA 1YLEA 1EU1A 3QQ7A 2EEOB 2JIOA 5FTLA 2YU9A 5DYIA 3TM7B 1DMSA 1OGYA 4AONB 5C18A 3HU1A 2E2IA 1AA6A 1PQHA 1QDNA 4AOKB 1CZ5A 3DMRA 1H0HA 1WCMA 2JA5A 1G8JA 3GTPA 1UHEA 1I50A 3HKZA 4C2MA 2R92A 1TWFA 3PLXB 1E5VA 1K83A 1E61A 2JIMA 4AYBA 2B63A 1TWHA 3GTJA 2JA6A 1PPYA 3QQ8A 5FTJA 1E60A 3GTMA 3GTOA 3QWZA 2VPWA 2NVXA 1TWGA 5FTNA 3TIWA 2WAQA 2E7ZA 3IR5A 4DMRA 2V3VA 1TWAA 3GTLA 3GTGA 1FDOA 2IV2X 5DYGA 1CR5A 4AAYA 2Y0SA 5T5ID 5B6CA 2NAPA 2JIQA 1PT1A 2JIPA 3ML1A 3IR7A 2JA7A 1S3SA 1E18A 1PQEA 5T5MD 5C1BA 1CZ4A 4KODA 1Y1WA 1Y5IA 1PQFA 5FTKA 4KLNA 1Y1VA
chains in the Genus database with same CATH superfamily
1PYQA 1R27A 3HU2A 1G8KA 2G5DA 2R93A 2G6GA 3FKIA 3X2MA 2O5JD 3OUGA 3X2KA 1PYUB 1SIWA 4FG4A 1UHDA 1KQFA 4AVRA 5EPPA 4JS7A 2VPYA 5GLFA 1SFOA 4CS0A 4RV0A 1YNND 3SUKA 2VPXA 1R9TA 1FDIA 1AW8B 4FERA 5GLYA 1OA9A 2PJHB 4GA5A 4KO8A 4D7ZB 1VC3B 3CZBA 4AZDA 1BW3A 3CQZA 3SULA 5FTMA 1TMOA 4KDLA 3QC8A 1R7RA 1ZC1A 2E2HA 5GLXA 4L48A 1OA7A 3HU3A 1Y4ZA 1L8FA 1I3QA 2WB1A 1Q16A 3O5AA 2C45A 1PT0A 2R7ZA 4JP7A 2VPZA 1QCSA 2NYAA 4KDIA 2KI8A 4CRYG 1IW7D 4GA6A 1KQGA 2DMRA 3GTKA 1TWCA 1DMRA 2AE0X 3CF2A 3GTQA 2PMZA 3IR6A 3H0GA 3X2JA 1H5NA 2V45A 4QIWA 1WLFA 2PNWA 1E32A 2JIRA 4CRZA 2NVYA 2VUMA 1YLEA 1EU1A 3M3GA 1WC2A 2EEOB 2JIOA 3QQ7A 5FTLA 2YU9A 5DYIA 4JP6A 1DMSA 1ZYRD 3TM7B 1OGYA 4AONB 3X2HA 3HU1A 5C18A 2E2IA 2A68D 1AA6A 1PQHA 2ENGA 1QDNA 4AOKB 1CZ5A 3DMRA 1H0HA 2CW0D 1WCMA 2JA5A 1BW4A 3SUMA 2A6ED 1G8JA 3GTPA 1UHEA 1I50A 3HKZA 2KQAA 3X2OA 4C2MA 2YUJA 2R92A 2BE5D 1TWFA 3X2IA 3PLXB 2BH0A 1E5VA 1K83A 1E61A 2JIMA 4AYBA 2A69D 4ZM7A 2B63A 1TWHA 3GTJA 2JA6A 1PPYA 3QQ8A 5FTJA 1E60A 3GTMA 3GTOA 2A6HD 3QWZA 2VPWA 2NVXA 2PICA 5GM9A 4ENGA 1TWGA 5FTNA 3TIWA 4JCWA 2PJJA 3X2LA 3X2NA 3X2GA 2PI8A 2WAQA 2E7ZA 4JJOA 1N10A 3IR5A 2V3VA 3SUJA 3X2PA 1TWAA 4DMRA 3GTLA 3GTGA 1FDOA 2IV2X 4FFTA 5DYGA 1CR5A 4AAYA 2Y0SA 5H4UA 5T5ID 2HCZX 1YNJD 3D30A 5B6CA 2NAPA 2JIQA 1PT1A 1SMYD 1HD5A 2JIPA 3ML1A 3IR7A 1S3SA 1E18A 2JA7A 2GAEA 1PQEA 5T5MD 5C1BA 1CZ4A 4KODA 4FG2A 4NOHA 1Y5IA 1Y1WA 1PQFA 5FTKA 3ENGA 4KLNA 1Y1VA
chains in the Genus database with same CATH topology
1PYQA 1R27A 3HU2A 1G8KA 2G5DA 2R93A 2G6GA 3FKIA 2O5JD 3OUGA 1PYUB 1SIWA 1UHDA 1KQFA 5EPPA 2VPYA 5GLFA 1SFOA 4CS0A 4RV0A 1YNND 2VPXA 1R9TA 1FDIA 1AW8B 2PJHB 4GA5A 4KO8A 4D7ZB 1VC3B 3CZBA 4AZDA 3CQZA 5FTMA 1TMOA 4KDLA 3QC8A 1R7RA 1ZC1A 2E2HA 3HU3A 1Y4ZA 1I3QA 2WB1A 1Q16A 3O5AA 2C45A 1PT0A 2R7ZA 2VPZA 1QCSA 2NYAA 4KDIA 2KI8A 4CRYG 1IW7D 4GA6A 1KQGA 2DMRA 3GTKA 1TWCA 1DMRA 2AE0X 3CF2A 3GTQA 2PMZA 3IR6A 3H0GA 1H5NA 2V45A 4QIWA 1WLFA 2PNWA 1E32A 2JIRA 4CRZA 2NVYA 2VUMA 1YLEA 1EU1A 3QQ7A 2EEOB 2JIOA 5FTLA 2YU9A 5DYIA 3TM7B 1DMSA 1ZYRD 1OGYA 4AONB 5C18A 3HU1A 2E2IA 2A68D 1AA6A 1PQHA 1QDNA 4AOKB 1CZ5A 3DMRA 1H0HA 2CW0D 1WCMA 2JA5A 2A6ED 1G8JA 3GTPA 1UHEA 1I50A 3HKZA 4C2MA 2YUJA 2R92A 2BE5D 1TWFA 3PLXB 1E5VA 1K83A 1E61A 2JIMA 4AYBA 2A69D 2B63A 1TWHA 3GTJA 2JA6A 1PPYA 3QQ8A 5FTJA 1E60A 3GTMA 3GTOA 2A6HD 3QWZA 2VPWA 2NVXA 2PICA 1TWGA 5FTNA 3TIWA 2PJJA 2PI8A 2WAQA 2E7ZA 3IR5A 4DMRA 2V3VA 1TWAA 3GTLA 3GTGA 1FDOA 2IV2X 5DYGA 1CR5A 4AAYA 2Y0SA 5T5ID 1YNJD 5B6CA 2NAPA 2JIQA 1PT1A 1SMYD 2JIPA 3ML1A 3IR7A 2JA7A 1S3SA 1E18A 2GAEA 1PQEA 5T5MD 5C1BA 1CZ4A 4KODA 4NOHA 1Y1WA 1Y5IA 1PQFA 5FTKA 4KLNA 1Y1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYQ A;  1R27 A;  3HU2 A;  1G8K A;  2R93 A;  3FKI A;  3OUG A;  1PYU B;  1SIW A;  1UHD A;  1KQF A;  5EPP A;  2VPY A;  5GLF A;  1SFO A;  4CS0 A;  4RV0 A;  2VPX A;  1R9T A;  1FDI A;  1AW8 B;  2PJH B;  4GA5 A;  4KO8 A;  4D7Z B;  1VC3 B;  4AZD A;  3CQZ A;  5FTM A;  1TMO A;  4KDL A;  3QC8 A;  1R7R A;  2E2H A;  3HU3 A;  1Y4Z A;  1I3Q A;  2WB1 A;  1Q16 A;  3O5A A;  2C45 A;  1PT0 A;  2R7Z A;  2VPZ A;  1QCS A;  2NYA A;  4KDI A;  2KI8 A;  4CRY G;  1IW7 D;  4GA6 A;  1KQG A;  2DMR A;  3GTK A;  1TWC A;  1DMR A;  3CF2 A;  3GTQ A;  2PMZ A;  3IR6 A;  3H0G A;  1H5N A;  2V45 A;  4QIW A;  1WLF A;  4CRZ A;  1E32 A;  2JIR A;  2NVY A;  2VUM A;  1YLE A;  1EU1 A;  3QQ7 A;  2EEO B;  2JIO A;  5FTL A;  2YU9 A;  5DYI A;  3TM7 B;  1DMS A;  1OGY A;  4AON B;  5C18 A;  3HU1 A;  2E2I A;  1AA6 A;  1PQH A;  1QDN A;  4AOK B;  1CZ5 A;  3DMR A;  1H0H A;  1WCM A;  2JA5 A;  1G8J A;  3GTP A;  1UHE A;  1I50 A;  3HKZ A;  4C2M A;  2R92 A;  1TWF A;  3PLX B;  1E5V A;  1K83 A;  1E61 A;  2JIM A;  4AYB A;  2B63 A;  1TWH A;  3GTJ A;  2JA6 A;  1PPY A;  3QQ8 A;  5FTJ A;  1E60 A;  3GTM A;  3GTO A;  3QWZ A;  2VPW A;  2NVX A;  1TWG A;  5FTN A;  3TIW A;  2WAQ A;  2E7Z A;  3IR5 A;  4DMR A;  2V3V A;  1TWA A;  3GTL A;  3GTG A;  1FDO A;  2IV2 X;  5DYG A;  1CR5 A;  4AAY A;  2Y0S A;  5T5I D;  5B6C A;  2NAP A;  2JIQ A;  1PT1 A;  2JIP A;  3ML1 A;  3IR7 A;  2JA7 A;  1S3S A;  1E18 A;  1PQE A;  5T5M D;  5C1B A;  1CZ4 A;  4KOD A;  1Y1W A;  1Y5I A;  1PQF A;  5FTK A;  4KLN A;  1Y1V A; 
#chains in the Genus database with same CATH topology
 1PYQ A;  1R27 A;  3HU2 A;  1G8K A;  2G5D A;  2R93 A;  2G6G A;  3FKI A;  3X2M A;  2O5J D;  3OUG A;  3X2K A;  1PYU B;  1SIW A;  4FG4 A;  1UHD A;  1KQF A;  4AVR A;  5EPP A;  4JS7 A;  2VPY A;  5GLF A;  1SFO A;  4CS0 A;  4RV0 A;  1YNN D;  3SUK A;  2VPX A;  1R9T A;  1FDI A;  1AW8 B;  4FER A;  5GLY A;  1OA9 A;  2PJH B;  4GA5 A;  4KO8 A;  4D7Z B;  1VC3 B;  3CZB A;  4AZD A;  1BW3 A;  3CQZ A;  3SUL A;  5FTM A;  1TMO A;  4KDL A;  3QC8 A;  1R7R A;  1ZC1 A;  2E2H A;  5GLX A;  4L48 A;  1OA7 A;  3HU3 A;  1Y4Z A;  1L8F A;  1I3Q A;  2WB1 A;  1Q16 A;  3O5A A;  2C45 A;  1PT0 A;  2R7Z A;  4JP7 A;  2VPZ A;  1QCS A;  2NYA A;  4KDI A;  2KI8 A;  4CRY G;  1IW7 D;  4GA6 A;  1KQG A;  2DMR A;  3GTK A;  1TWC A;  1DMR A;  2AE0 X;  3CF2 A;  3GTQ A;  2PMZ A;  3IR6 A;  3H0G A;  3X2J A;  1H5N A;  2V45 A;  4QIW A;  1WLF A;  2PNW A;  1E32 A;  2JIR A;  4CRZ A;  2NVY A;  2VUM A;  1YLE A;  1EU1 A;  3M3G A;  1WC2 A;  2EEO B;  2JIO A;  3QQ7 A;  5FTL A;  2YU9 A;  5DYI A;  4JP6 A;  1DMS A;  1ZYR D;  3TM7 B;  1OGY A;  4AON B;  3X2H A;  3HU1 A;  5C18 A;  2E2I A;  2A68 D;  1AA6 A;  1PQH A;  2ENG A;  1QDN A;  4AOK B;  1CZ5 A;  3DMR A;  1H0H A;  2CW0 D;  1WCM A;  2JA5 A;  1BW4 A;  3SUM A;  2A6E D;  1G8J A;  3GTP A;  1UHE A;  1I50 A;  3HKZ A;  2KQA A;  3X2O A;  4C2M A;  2YUJ A;  2R92 A;  2BE5 D;  1TWF A;  3X2I A;  3PLX B;  2BH0 A;  1E5V A;  1K83 A;  1E61 A;  2JIM A;  4AYB A;  2A69 D;  4ZM7 A;  2B63 A;  1TWH A;  3GTJ A;  2JA6 A;  1PPY A;  3QQ8 A;  5FTJ A;  1E60 A;  3GTM A;  3GTO A;  2A6H D;  3QWZ A;  2VPW A;  2NVX A;  2PIC A;  5GM9 A;  4ENG A;  1TWG A;  5FTN A;  3TIW A;  4JCW A;  2PJJ A;  3X2L A;  3X2N A;  3X2G A;  2PI8 A;  2WAQ A;  2E7Z A;  4JJO A;  1N10 A;  3IR5 A;  2V3V A;  3SUJ A;  3X2P A;  1TWA A;  4DMR A;  3GTL A;  3GTG A;  1FDO A;  2IV2 X;  4FFT A;  5DYG A;  1CR5 A;  4AAY A;  2Y0S A;  5H4U A;  5T5I D;  2HCZ X;  1YNJ D;  3D30 A;  5B6C A;  2NAP A;  2JIQ A;  1PT1 A;  1SMY D;  1HD5 A;  2JIP A;  3ML1 A;  3IR7 A;  1S3S A;  1E18 A;  2JA7 A;  2GAE A;  1PQE A;  5T5M D;  5C1B A;  1CZ4 A;  4KOD A;  4FG2 A;  4NOH A;  1Y5I A;  1Y1W A;  1PQF A;  5FTK A;  3ENG A;  4KLN A;  1Y1V A; 
#chains in the Genus database with same CATH homology
 1PYQ A;  1R27 A;  3HU2 A;  1G8K A;  2G5D A;  2R93 A;  2G6G A;  3FKI A;  2O5J D;  3OUG A;  1PYU B;  1SIW A;  1UHD A;  1KQF A;  5EPP A;  2VPY A;  5GLF A;  1SFO A;  4CS0 A;  4RV0 A;  1YNN D;  2VPX A;  1R9T A;  1FDI A;  1AW8 B;  2PJH B;  4GA5 A;  4KO8 A;  4D7Z B;  1VC3 B;  3CZB A;  4AZD A;  3CQZ A;  5FTM A;  1TMO A;  4KDL A;  3QC8 A;  1R7R A;  1ZC1 A;  2E2H A;  3HU3 A;  1Y4Z A;  1I3Q A;  2WB1 A;  1Q16 A;  3O5A A;  2C45 A;  1PT0 A;  2R7Z A;  2VPZ A;  1QCS A;  2NYA A;  4KDI A;  2KI8 A;  4CRY G;  1IW7 D;  4GA6 A;  1KQG A;  2DMR A;  3GTK A;  1TWC A;  1DMR A;  2AE0 X;  3CF2 A;  3GTQ A;  2PMZ A;  3IR6 A;  3H0G A;  1H5N A;  2V45 A;  4QIW A;  1WLF A;  2PNW A;  1E32 A;  2JIR A;  4CRZ A;  2NVY A;  2VUM A;  1YLE A;  1EU1 A;  3QQ7 A;  2EEO B;  2JIO A;  5FTL A;  2YU9 A;  5DYI A;  3TM7 B;  1DMS A;  1ZYR D;  1OGY A;  4AON B;  5C18 A;  3HU1 A;  2E2I A;  2A68 D;  1AA6 A;  1PQH A;  1QDN A;  4AOK B;  1CZ5 A;  3DMR A;  1H0H A;  2CW0 D;  1WCM A;  2JA5 A;  2A6E D;  1G8J A;  3GTP A;  1UHE A;  1I50 A;  3HKZ A;  4C2M A;  2YUJ A;  2R92 A;  2BE5 D;  1TWF A;  3PLX B;  1E5V A;  1K83 A;  1E61 A;  2JIM A;  4AYB A;  2A69 D;  2B63 A;  1TWH A;  3GTJ A;  2JA6 A;  1PPY A;  3QQ8 A;  5FTJ A;  1E60 A;  3GTM A;  3GTO A;  2A6H D;  3QWZ A;  2VPW A;  2NVX A;  2PIC A;  1TWG A;  5FTN A;  3TIW A;  2PJJ A;  2PI8 A;  2WAQ A;  2E7Z A;  3IR5 A;  4DMR A;  2V3V A;  1TWA A;  3GTL A;  3GTG A;  1FDO A;  2IV2 X;  5DYG A;  1CR5 A;  4AAY A;  2Y0S A;  5T5I D;  1YNJ D;  5B6C A;  2NAP A;  2JIQ A;  1PT1 A;  1SMY D;  2JIP A;  3ML1 A;  3IR7 A;  2JA7 A;  1S3S A;  1E18 A;  2GAE A;  1PQE A;  5T5M D;  5C1B A;  1CZ4 A;  4KOD A;  4NOH A;  1Y1W A;  1Y5I A;  1PQF A;  5FTK A;  4KLN A;  1Y1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...