1UHDA

Crystal structure of aspartate decarboxylase, pyruvoly group bound form
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
pubmed doi rcsb
source organism Helicobacter pylori
total genus 17
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1uhdA00
1S3SA 1DMSA 5DYGA 4KDLA 4AZDA 2JA6A 3QC8A 1H0HA 1TWAA 4KLNA 3GTQA 1QDNA 4KDIA 2VPYA 5C1BA 2NVYA 1CZ4A 3PLXB 4AOKB 1KQGA 5C18A 2EEOB 3QQ7A 2E7ZA 4RV0A 1TWGA 1PYUB 1R9TA 1IW7D 3QQ8A 3GTMA 2C45A 4C2MA 3HU3A 1FDIA 3TM7B 3GTJA 1VC3B 2NVXA 1G8KA 1AW8B 3GTPA 2JIRA 3FKIA 1E32A 1K83A 1TWCA 2KI8A 1UHEA 5FTJA 2V3VA 1OGYA 2JIMA 1YLEA 5FTLA 3CQZA 1PPYA 2IV2X 1I50A 1SFOA 1Y4ZA 5DYIA 3GTKA 1Y1WA 3IR7A 5T5MD 2E2IA 4CRYG 3GTGA 1PQEA 2VPXA 5FTNA 1TWFA 1EU1A 2R93A 2WAQA 2PMZA 1WLFA 2WB1A 2NAPA 4AONB 1QCSA 2VPWA 1G8JA 2VPZA 1FDOA 3TIWA 2JIPA 1WCMA 1KQFA 5FTKA 1E61A 3HU2A 4AYBA 1PT1A 1E5VA 4KO8A 1AA6A 1TWHA 4CS0A 1Y5IA 4D7ZB 1DMRA 2V45A 3O5AA 1I3QA 1CR5A 1UHDA 1PT0A 3H0GA 5B6CA 5EPPA 3GTLA 5FTMA 2JIOA 1PQFA 2JIQA 1E18A 1SIWA 5T5ID 2JA5A 2DMRA 5GLFA 2R92A 1H5NA 3GTOA 3QWZA 4CRZA 2E2HA 1PQHA 1CZ5A 4KODA 3HU1A 2VUMA 4QIWA 2PJHB 3HKZA 2B63A 1Y1VA 1R7RA 3DMRA 3ML1A 2Y0SA 2R7ZA 3IR6A 4AAYA 2JA7A 3IR5A 2YU9A 3OUGA 4GA5A 4DMRA 1R27A 1TMOA 4GA6A 1PYQA 2NYAA 3CF2A 1E60A 1Q16A
chains in the Genus database with same CATH superfamily
1S3SA 1DMSA 1SMYD 5DYGA 2CW0D 4KDLA 4AZDA 2JA6A 3QC8A 1H0HA 3D30A 1TWAA 4KLNA 2KQAA 3GTQA 1QDNA 2PJJA 2VPYA 4KDIA 2NVYA 1CZ4A 2YUJA 1L8FA 3PLXB 4AOKB 1KQGA 5C18A 2EEOB 5H4UA 3QQ7A 1HD5A 2PICA 2E7ZA 2G5DA 4RV0A 1YNND 1TWGA 3X2LA 1OA9A 1PYUB 3X2OA 1R9TA 5GLYA 1IW7D 3QQ8A 3GTMA 1ZC1A 2C45A 4C2MA 3HU3A 2ENGA 4AVRA 1FDIA 3TM7B 2AE0X 3GTJA 1VC3B 2O5JD 2NVXA 4ENGA 1BW4A 1G8KA 3SULA 2BH0A 1AW8B 4NOHA 3GTPA 2A6HD 3SUKA 2JIRA 4FG2A 2PNWA 3FKIA 1E32A 1K83A 1TWCA 2KI8A 1UHEA 4FG4A 2HCZX 5FTJA 3SUMA 2V3VA 4JP7A 3M3GA 1OGYA 2JIMA 4JP6A 1YLEA 1ZYRD 5FTLA 3CQZA 5GLXA 1PPYA 2IV2X 3X2KA 1I50A 1SFOA 4JJOA 2G6GA 1Y4ZA 5DYIA 3GTKA 2A68D 3IR7A 1Y1WA 5T5MD 2E2IA 3ENGA 4CRYG 3GTGA 1PQEA 2VPXA 3SUJA 5FTNA 1TWFA 1EU1A 2R93A 4JS7A 2WAQA 2PMZA 1WLFA 2WB1A 2NAPA 5GM9A 4AONB 1QCSA 2VPWA 1G8JA 2VPZA 1FDOA 3TIWA 2JIPA 1WCMA 1KQFA 3X2JA 5FTKA 1E61A 4ZM7A 3HU2A 4AYBA 3X2GA 1PT1A 1E5VA 4KO8A 1AA6A 1TWHA 4CS0A 1Y5IA 4D7ZB 2A69D 1DMRA 2V45A 3O5AA 3X2MA 1I3QA 4JCWA 1CR5A 1UHDA 1PT0A 3H0GA 3X2PA 5B6CA 4FERA 5EPPA 3GTLA 5FTMA 2JIOA 1OA7A 1PQFA 1E18A 1SIWA 2JIQA 2PI8A 5T5ID 2JA5A 1N10A 2DMRA 5GLFA 2R92A 1H5NA 3GTOA 3QWZA 4CRZA 2E2HA 1PQHA 1CZ5A 2BE5D 4KODA 3X2NA 3HU1A 4L48A 2VUMA 2GAEA 4QIWA 2A6ED 2PJHB 3X2IA 3HKZA 2B63A 1Y1VA 1R7RA 3DMRA 3ML1A 2Y0SA 2R7ZA 3IR6A 1WC2A 4FFTA 4AAYA 2JA7A 3IR5A 2YU9A 3OUGA 4GA5A 4DMRA 1R27A 3X2HA 1BW3A 1TMOA 1YNJD 5C1BA 3CZBA 4GA6A 1PYQA 2NYAA 3CF2A 1E60A 1Q16A
chains in the Genus database with same CATH topology
1S3SA 1DMSA 1SMYD 5DYGA 2CW0D 4KDLA 4AZDA 2JA6A 3QC8A 1H0HA 1TWAA 4KLNA 3GTQA 1QDNA 2PJJA 2VPYA 4KDIA 2NVYA 1CZ4A 2YUJA 3PLXB 5C1BA 4AOKB 1KQGA 5C18A 2EEOB 3QQ7A 2PICA 2E7ZA 2G5DA 4RV0A 1YNND 1TWGA 1PYUB 1R9TA 1IW7D 3QQ8A 3GTMA 1ZC1A 2C45A 4C2MA 3HU3A 1FDIA 3TM7B 2AE0X 3GTJA 1VC3B 2O5JD 2NVXA 1G8KA 4NOHA 1AW8B 3GTPA 2A6HD 2JIRA 2PNWA 3FKIA 1E32A 1K83A 1TWCA 2KI8A 1UHEA 5FTJA 2V3VA 1OGYA 2JIMA 1YLEA 1ZYRD 5FTLA 3CQZA 1PPYA 2IV2X 1I50A 1SFOA 2G6GA 1Y4ZA 5DYIA 3GTKA 2A68D 3IR7A 1Y1WA 5T5MD 2E2IA 4CRYG 3GTGA 1PQEA 2VPXA 5FTNA 1TWFA 1EU1A 2R93A 2WAQA 2PMZA 1WLFA 2WB1A 2NAPA 4AONB 1QCSA 2VPWA 1G8JA 2VPZA 1FDOA 3TIWA 2JIPA 1WCMA 1KQFA 5FTKA 1E61A 3HU2A 4AYBA 1PT1A 1E5VA 4KO8A 1AA6A 1TWHA 4CS0A 1Y5IA 4D7ZB 2A69D 1DMRA 2V45A 3O5AA 1I3QA 1CR5A 1UHDA 1PT0A 3H0GA 5B6CA 5EPPA 3GTLA 5FTMA 2JIOA 1PQFA 2JIQA 1E18A 1SIWA 2PI8A 5T5ID 2JA5A 2DMRA 5GLFA 2R92A 1H5NA 3GTOA 3QWZA 4CRZA 2E2HA 1PQHA 1CZ5A 2BE5D 4KODA 3HU1A 2VUMA 2GAEA 4QIWA 2A6ED 2PJHB 3HKZA 2B63A 1Y1VA 1R7RA 3DMRA 3ML1A 2Y0SA 2R7ZA 3IR6A 4AAYA 2JA7A 3IR5A 2YU9A 3OUGA 4GA5A 4DMRA 1R27A 1TMOA 1YNJD 3CZBA 4GA6A 1PYQA 2NYAA 3CF2A 1E60A 1Q16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3S A;  1DMS A;  5DYG A;  4KDL A;  4AZD A;  2JA6 A;  3QC8 A;  1H0H A;  1TWA A;  4KLN A;  3GTQ A;  1QDN A;  4KDI A;  2VPY A;  5C1B A;  2NVY A;  1CZ4 A;  3PLX B;  4AOK B;  1KQG A;  5C18 A;  2EEO B;  3QQ7 A;  2E7Z A;  4RV0 A;  1TWG A;  1PYU B;  1R9T A;  1IW7 D;  3QQ8 A;  3GTM A;  2C45 A;  4C2M A;  3HU3 A;  1FDI A;  3TM7 B;  3GTJ A;  1VC3 B;  2NVX A;  1G8K A;  1AW8 B;  3GTP A;  2JIR A;  3FKI A;  1E32 A;  1K83 A;  1TWC A;  2KI8 A;  1UHE A;  5FTJ A;  2V3V A;  1OGY A;  2JIM A;  1YLE A;  5FTL A;  3CQZ A;  1PPY A;  2IV2 X;  1I50 A;  1SFO A;  1Y4Z A;  5DYI A;  3GTK A;  1Y1W A;  3IR7 A;  5T5M D;  2E2I A;  4CRY G;  3GTG A;  1PQE A;  2VPX A;  5FTN A;  1TWF A;  1EU1 A;  2R93 A;  2WAQ A;  2PMZ A;  1WLF A;  2WB1 A;  2NAP A;  4AON B;  1QCS A;  2VPW A;  1G8J A;  2VPZ A;  1FDO A;  3TIW A;  2JIP A;  1WCM A;  1KQF A;  5FTK A;  1E61 A;  3HU2 A;  4AYB A;  1PT1 A;  1E5V A;  4KO8 A;  1AA6 A;  1TWH A;  4CS0 A;  1Y5I A;  4D7Z B;  1DMR A;  2V45 A;  3O5A A;  1I3Q A;  1CR5 A;  1UHD A;  1PT0 A;  3H0G A;  5B6C A;  5EPP A;  3GTL A;  5FTM A;  2JIO A;  1PQF A;  2JIQ A;  1E18 A;  1SIW A;  5T5I D;  2JA5 A;  2DMR A;  5GLF A;  2R92 A;  1H5N A;  3GTO A;  3QWZ A;  4CRZ A;  2E2H A;  1PQH A;  1CZ5 A;  4KOD A;  3HU1 A;  2VUM A;  4QIW A;  2PJH B;  3HKZ A;  2B63 A;  1Y1V A;  1R7R A;  3DMR A;  3ML1 A;  2Y0S A;  2R7Z A;  3IR6 A;  4AAY A;  2JA7 A;  3IR5 A;  2YU9 A;  3OUG A;  4GA5 A;  4DMR A;  1R27 A;  1TMO A;  4GA6 A;  1PYQ A;  2NYA A;  3CF2 A;  1E60 A;  1Q16 A; 
#chains in the Genus database with same CATH topology
 1S3S A;  1DMS A;  1SMY D;  5DYG A;  2CW0 D;  4KDL A;  4AZD A;  2JA6 A;  3QC8 A;  1H0H A;  3D30 A;  1TWA A;  4KLN A;  2KQA A;  3GTQ A;  1QDN A;  2PJJ A;  2VPY A;  4KDI A;  2NVY A;  1CZ4 A;  2YUJ A;  1L8F A;  3PLX B;  4AOK B;  1KQG A;  5C18 A;  2EEO B;  5H4U A;  3QQ7 A;  1HD5 A;  2PIC A;  2E7Z A;  2G5D A;  4RV0 A;  1YNN D;  1TWG A;  3X2L A;  1OA9 A;  1PYU B;  3X2O A;  1R9T A;  5GLY A;  1IW7 D;  3QQ8 A;  3GTM A;  1ZC1 A;  2C45 A;  4C2M A;  3HU3 A;  2ENG A;  4AVR A;  1FDI A;  3TM7 B;  2AE0 X;  3GTJ A;  1VC3 B;  2O5J D;  2NVX A;  4ENG A;  1BW4 A;  1G8K A;  3SUL A;  2BH0 A;  1AW8 B;  4NOH A;  3GTP A;  2A6H D;  3SUK A;  2JIR A;  4FG2 A;  2PNW A;  3FKI A;  1E32 A;  1K83 A;  1TWC A;  2KI8 A;  1UHE A;  4FG4 A;  2HCZ X;  5FTJ A;  3SUM A;  2V3V A;  4JP7 A;  3M3G A;  1OGY A;  2JIM A;  4JP6 A;  1YLE A;  1ZYR D;  5FTL A;  3CQZ A;  5GLX A;  1PPY A;  2IV2 X;  3X2K A;  1I50 A;  1SFO A;  4JJO A;  2G6G A;  1Y4Z A;  5DYI A;  3GTK A;  2A68 D;  3IR7 A;  1Y1W A;  5T5M D;  2E2I A;  3ENG A;  4CRY G;  3GTG A;  1PQE A;  2VPX A;  3SUJ A;  5FTN A;  1TWF A;  1EU1 A;  2R93 A;  4JS7 A;  2WAQ A;  2PMZ A;  1WLF A;  2WB1 A;  2NAP A;  5GM9 A;  4AON B;  1QCS A;  2VPW A;  1G8J A;  2VPZ A;  1FDO A;  3TIW A;  2JIP A;  1WCM A;  1KQF A;  3X2J A;  5FTK A;  1E61 A;  4ZM7 A;  3HU2 A;  4AYB A;  3X2G A;  1PT1 A;  1E5V A;  4KO8 A;  1AA6 A;  1TWH A;  4CS0 A;  1Y5I A;  4D7Z B;  2A69 D;  1DMR A;  2V45 A;  3O5A A;  3X2M A;  1I3Q A;  4JCW A;  1CR5 A;  1UHD A;  1PT0 A;  3H0G A;  3X2P A;  5B6C A;  4FER A;  5EPP A;  3GTL A;  5FTM A;  2JIO A;  1OA7 A;  1PQF A;  1E18 A;  1SIW A;  2JIQ A;  2PI8 A;  5T5I D;  2JA5 A;  1N10 A;  2DMR A;  5GLF A;  2R92 A;  1H5N A;  3GTO A;  3QWZ A;  4CRZ A;  2E2H A;  1PQH A;  1CZ5 A;  2BE5 D;  4KOD A;  3X2N A;  3HU1 A;  4L48 A;  2VUM A;  2GAE A;  4QIW A;  2A6E D;  2PJH B;  3X2I A;  3HKZ A;  2B63 A;  1Y1V A;  1R7R A;  3DMR A;  3ML1 A;  2Y0S A;  2R7Z A;  3IR6 A;  1WC2 A;  4FFT A;  4AAY A;  2JA7 A;  3IR5 A;  2YU9 A;  3OUG A;  4GA5 A;  4DMR A;  1R27 A;  3X2H A;  1BW3 A;  1TMO A;  1YNJ D;  5C1B A;  3CZB A;  4GA6 A;  1PYQ A;  2NYA A;  3CF2 A;  1E60 A;  1Q16 A; 
#chains in the Genus database with same CATH homology
 1S3S A;  1DMS A;  1SMY D;  5DYG A;  2CW0 D;  4KDL A;  4AZD A;  2JA6 A;  3QC8 A;  1H0H A;  1TWA A;  4KLN A;  3GTQ A;  1QDN A;  2PJJ A;  2VPY A;  4KDI A;  2NVY A;  1CZ4 A;  2YUJ A;  3PLX B;  5C1B A;  4AOK B;  1KQG A;  5C18 A;  2EEO B;  3QQ7 A;  2PIC A;  2E7Z A;  2G5D A;  4RV0 A;  1YNN D;  1TWG A;  1PYU B;  1R9T A;  1IW7 D;  3QQ8 A;  3GTM A;  1ZC1 A;  2C45 A;  4C2M A;  3HU3 A;  1FDI A;  3TM7 B;  2AE0 X;  3GTJ A;  1VC3 B;  2O5J D;  2NVX A;  1G8K A;  4NOH A;  1AW8 B;  3GTP A;  2A6H D;  2JIR A;  2PNW A;  3FKI A;  1E32 A;  1K83 A;  1TWC A;  2KI8 A;  1UHE A;  5FTJ A;  2V3V A;  1OGY A;  2JIM A;  1YLE A;  1ZYR D;  5FTL A;  3CQZ A;  1PPY A;  2IV2 X;  1I50 A;  1SFO A;  2G6G A;  1Y4Z A;  5DYI A;  3GTK A;  2A68 D;  3IR7 A;  1Y1W A;  5T5M D;  2E2I A;  4CRY G;  3GTG A;  1PQE A;  2VPX A;  5FTN A;  1TWF A;  1EU1 A;  2R93 A;  2WAQ A;  2PMZ A;  1WLF A;  2WB1 A;  2NAP A;  4AON B;  1QCS A;  2VPW A;  1G8J A;  2VPZ A;  1FDO A;  3TIW A;  2JIP A;  1WCM A;  1KQF A;  5FTK A;  1E61 A;  3HU2 A;  4AYB A;  1PT1 A;  1E5V A;  4KO8 A;  1AA6 A;  1TWH A;  4CS0 A;  1Y5I A;  4D7Z B;  2A69 D;  1DMR A;  2V45 A;  3O5A A;  1I3Q A;  1CR5 A;  1UHD A;  1PT0 A;  3H0G A;  5B6C A;  5EPP A;  3GTL A;  5FTM A;  2JIO A;  1PQF A;  2JIQ A;  1E18 A;  1SIW A;  2PI8 A;  5T5I D;  2JA5 A;  2DMR A;  5GLF A;  2R92 A;  1H5N A;  3GTO A;  3QWZ A;  4CRZ A;  2E2H A;  1PQH A;  1CZ5 A;  2BE5 D;  4KOD A;  3HU1 A;  2VUM A;  2GAE A;  4QIW A;  2A6E D;  2PJH B;  3HKZ A;  2B63 A;  1Y1V A;  1R7R A;  3DMR A;  3ML1 A;  2Y0S A;  2R7Z A;  3IR6 A;  4AAY A;  2JA7 A;  3IR5 A;  2YU9 A;  3OUG A;  4GA5 A;  4DMR A;  1R27 A;  1TMO A;  1YNJ D;  3CZB A;  4GA6 A;  1PYQ A;  2NYA A;  3CF2 A;  1E60 A;  1Q16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...