1UHDA

Crystal structure of aspartate decarboxylase, pyruvoly group bound form
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase beta chain
publication title Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 17
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1uhdA00
1Y4ZA 3IR6A 1PQEA 5FTMA 1WLFA 3GTGA 1Y5IA 4KO8A 4CRZA 2VPYA 5EPPA 4AZDA 3GTMA 3GTQA 2DMRA 2JIPA 2NAPA 2NYAA 1PQFA 2C45A 1Y1VA 2E7ZA 2JA5A 2VPWA 1PYQA 1E5VA 2R92A 1YLEA 1QDNA 4AONB 3GTOA 1TWGA 4CRYG 1AW8B 2WB1A 1FDOA 2EEOB 4KODA 4C2MA 1CZ5A 2VPZA 2Y0SA 4GA6A 5FTLA 3IR7A 5FTJA 4KLNA 3QWZA 4AAYA 1H0HA 5FTKA 1PT0A 4DMRA 1SIWA 4CS0A 2E2IA 3DMRA 1UHDA 4RV0A 2JA6A 1OGYA 3GTJA 1K83A 2JIRA 2V45A 1PYUB 1PQHA 2NVYA 2YU9A 3HU2A 1DMSA 3QQ8A 1Y1WA 2WAQA 1TWAA 1DMRA 4GA5A 2JIQA 5GLFA 2R7ZA 4QIWA 2VPXA 1CR5A 1PT1A 1UHEA 1TWCA 1R7RA 3CF2A 2V3VA 1I3QA 3HKZA 1E18A 1PPYA 2KI8A 5C18A 3QQ7A 3CQZA 1R27A 1QCSA 4KDIA 3HU3A 3PLXB 5T5ID 4D7ZB 1E61A 5B6CA 1CZ4A 1TWHA 1R9TA 1KQFA 3GTKA 1WCMA 1TWFA 3TIWA 1Q16A 3QC8A 1G8KA 2B63A 1G8JA 4AYBA 3O5AA 3OUGA 2NVXA 1IW7D 5T5MD 5DYIA 5C1BA 1EU1A 1SFOA 1FDIA 1AA6A 2JA7A 4KDLA 1S3SA 2PMZA 1KQGA 2VUMA 2IV2X 3HU1A 1TMOA 2JIOA 3IR5A 3FKIA 5DYGA 1I50A 1E60A 1H5NA 5FTNA 3ML1A 2PJHB 3GTPA 1VC3B 2E2HA 2R93A 3TM7B 4AOKB 3GTLA 1E32A 3H0GA 2JIMA
chains in the Genus database with same CATH superfamily
1OA7A 1Y4ZA 3IR6A 1PQEA 5FTMA 1WLFA 3GTGA 4JS7A 2BH0A 1OA9A 1Y5IA 5H4UA 4KO8A 4CRZA 2ENGA 2G5DA 2VPYA 5EPPA 3SUKA 2CW0D 3X2KA 4AZDA 3GTMA 2PNWA 3X2HA 3GTQA 2DMRA 2JIPA 2A6ED 2YUJA 2NAPA 2NYAA 1PQFA 2C45A 1Y1VA 4JJOA 2E7ZA 4AVRA 2JA5A 3X2GA 2VPWA 1BW3A 1PYQA 1E5VA 2KQAA 2R92A 1YLEA 1QDNA 4AONB 2BE5D 3GTOA 1TWGA 4CRYG 1AW8B 1FDOA 2G6GA 2WB1A 2AE0X 2GAEA 2EEOB 4KODA 4C2MA 4ZM7A 1CZ5A 2VPZA 2Y0SA 4GA6A 1YNND 1BW4A 1HD5A 5FTLA 3IR7A 5FTJA 4KLNA 3SUMA 3QWZA 4AAYA 1H0HA 5FTKA 1PT0A 2A69D 4JP7A 1SIWA 4DMRA 4CS0A 2E2IA 2HCZX 3DMRA 1UHDA 4RV0A 2JA6A 1WC2A 1OGYA 3GTJA 3SUJA 4FG2A 1K83A 2A6HD 2JIRA 2V45A 1PYUB 1PQHA 4JP6A 2NVYA 3SULA 2YU9A 3HU2A 1DMSA 3D30A 3X2NA 3QQ8A 1Y1WA 2WAQA 2PI8A 1TWAA 1DMRA 4GA5A 2JIQA 5GLFA 3X2PA 2O5JD 4QIWA 2R7ZA 2VPXA 1CR5A 1PT1A 1UHEA 1TWCA 1R7RA 1N10A 3CF2A 2V3VA 3X2JA 1I3QA 3HKZA 1E18A 1PPYA 2KI8A 5C18A 4NOHA 3QQ7A 3CQZA 4FFTA 3X2IA 1R27A 4JCWA 2A68D 1QCSA 4L48A 4KDIA 3X2OA 4ENGA 3HU3A 3PLXB 4FERA 5T5ID 5GLYA 4D7ZB 1E61A 5B6CA 1CZ4A 5GM9A 3M3GA 1TWHA 1R9TA 1KQFA 3GTKA 2PICA 1WCMA 1TWFA 1L8FA 3TIWA 1Q16A 3QC8A 1G8KA 2B63A 1G8JA 4AYBA 3O5AA 3OUGA 2NVXA 1IW7D 5T5MD 5DYIA 3X2LA 5C1BA 1EU1A 1SFOA 1ZYRD 2PJJA 1FDIA 1YNJD 1AA6A 2JA7A 4KDLA 1S3SA 2PMZA 3ENGA 1KQGA 2VUMA 2IV2X 3HU1A 1SMYD 1TMOA 2JIOA 3CZBA 3IR5A 3FKIA 5DYGA 1I50A 1E60A 1H5NA 5FTNA 3ML1A 2PJHB 3GTPA 1VC3B 2E2HA 2R93A 3TM7B 4AOKB 1ZC1A 1E32A 3H0GA 3X2MA 3GTLA 2JIMA 4FG4A 5GLXA
chains in the Genus database with same CATH topology
1Y4ZA 3IR6A 1PQEA 5FTMA 1WLFA 3GTGA 1Y5IA 4KO8A 4CRZA 2G5DA 2VPYA 5EPPA 4AZDA 2CW0D 3GTMA 2PNWA 3GTQA 2DMRA 2JIPA 2A6ED 2YUJA 2NAPA 2NYAA 1PQFA 2C45A 1Y1VA 2E7ZA 2JA5A 2VPWA 1PYQA 1E5VA 2R92A 1YLEA 1QDNA 4AONB 2BE5D 3GTOA 1TWGA 4CRYG 1AW8B 1FDOA 2G6GA 2WB1A 2AE0X 2GAEA 2EEOB 4KODA 4C2MA 1CZ5A 2VPZA 2Y0SA 4GA6A 1YNND 5FTLA 3IR7A 5FTJA 4KLNA 3QWZA 4AAYA 1H0HA 5FTKA 1PT0A 2A69D 4DMRA 1SIWA 4CS0A 2E2IA 3DMRA 1UHDA 4RV0A 2JA6A 1OGYA 3GTJA 1K83A 2A6HD 2JIRA 2V45A 1PYUB 1PQHA 2NVYA 2YU9A 3HU2A 1DMSA 3QQ8A 1Y1WA 2WAQA 2PI8A 1TWAA 1DMRA 4GA5A 2JIQA 5GLFA 2O5JD 2R7ZA 4QIWA 2VPXA 1CR5A 1PT1A 1UHEA 1TWCA 1R7RA 3CF2A 2V3VA 1I3QA 3HKZA 1E18A 1PPYA 2KI8A 5C18A 4NOHA 3QQ7A 3CQZA 1R27A 2A68D 1QCSA 4KDIA 3HU3A 3PLXB 5T5ID 4D7ZB 1E61A 5B6CA 1CZ4A 1TWHA 1R9TA 1KQFA 3GTKA 2PICA 1WCMA 1TWFA 3TIWA 1Q16A 3QC8A 1G8KA 2B63A 1G8JA 4AYBA 3O5AA 3OUGA 2NVXA 1IW7D 5T5MD 5DYIA 5C1BA 1EU1A 1SFOA 1ZYRD 2PJJA 1FDIA 1YNJD 1AA6A 2JA7A 4KDLA 1S3SA 2PMZA 1KQGA 2VUMA 2IV2X 3HU1A 1SMYD 1TMOA 2JIOA 3CZBA 3IR5A 3FKIA 5DYGA 1I50A 1E60A 1H5NA 5FTNA 3ML1A 2PJHB 3GTPA 1VC3B 2E2HA 2R93A 3TM7B 4AOKB 1ZC1A 1E32A 3H0GA 3GTLA 2JIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4Z A;  3IR6 A;  1PQE A;  5FTM A;  1WLF A;  3GTG A;  1Y5I A;  4KO8 A;  4CRZ A;  2VPY A;  5EPP A;  4AZD A;  3GTM A;  3GTQ A;  2DMR A;  2JIP A;  2NAP A;  2NYA A;  1PQF A;  2C45 A;  1Y1V A;  2E7Z A;  2JA5 A;  2VPW A;  1PYQ A;  1E5V A;  2R92 A;  1YLE A;  1QDN A;  4AON B;  3GTO A;  1TWG A;  4CRY G;  1AW8 B;  2WB1 A;  1FDO A;  2EEO B;  4KOD A;  4C2M A;  1CZ5 A;  2VPZ A;  2Y0S A;  4GA6 A;  5FTL A;  3IR7 A;  5FTJ A;  4KLN A;  3QWZ A;  4AAY A;  1H0H A;  5FTK A;  1PT0 A;  4DMR A;  1SIW A;  4CS0 A;  2E2I A;  3DMR A;  1UHD A;  4RV0 A;  2JA6 A;  1OGY A;  3GTJ A;  1K83 A;  2JIR A;  2V45 A;  1PYU B;  1PQH A;  2NVY A;  2YU9 A;  3HU2 A;  1DMS A;  3QQ8 A;  1Y1W A;  2WAQ A;  1TWA A;  1DMR A;  4GA5 A;  2JIQ A;  5GLF A;  2R7Z A;  4QIW A;  2VPX A;  1CR5 A;  1PT1 A;  1UHE A;  1TWC A;  1R7R A;  3CF2 A;  2V3V A;  1I3Q A;  3HKZ A;  1E18 A;  1PPY A;  2KI8 A;  5C18 A;  3QQ7 A;  3CQZ A;  1R27 A;  1QCS A;  4KDI A;  3HU3 A;  3PLX B;  5T5I D;  4D7Z B;  1E61 A;  5B6C A;  1CZ4 A;  1TWH A;  1R9T A;  1KQF A;  3GTK A;  1WCM A;  1TWF A;  3TIW A;  1Q16 A;  3QC8 A;  1G8K A;  2B63 A;  1G8J A;  4AYB A;  3O5A A;  3OUG A;  2NVX A;  1IW7 D;  5T5M D;  5DYI A;  5C1B A;  1EU1 A;  1SFO A;  1FDI A;  1AA6 A;  2JA7 A;  4KDL A;  1S3S A;  2PMZ A;  1KQG A;  2VUM A;  2IV2 X;  3HU1 A;  1TMO A;  2JIO A;  3IR5 A;  3FKI A;  5DYG A;  1I50 A;  1E60 A;  1H5N A;  5FTN A;  3ML1 A;  2PJH B;  3GTP A;  1VC3 B;  2E2H A;  2R93 A;  3TM7 B;  4AOK B;  3GTL A;  1E32 A;  3H0G A;  2JIM A; 
#chains in the Genus database with same CATH topology
 1OA7 A;  1Y4Z A;  3IR6 A;  1PQE A;  5FTM A;  1WLF A;  3GTG A;  4JS7 A;  2BH0 A;  1OA9 A;  1Y5I A;  5H4U A;  4KO8 A;  4CRZ A;  2ENG A;  2G5D A;  2VPY A;  5EPP A;  3SUK A;  2CW0 D;  3X2K A;  4AZD A;  3GTM A;  2PNW A;  3X2H A;  3GTQ A;  2DMR A;  2JIP A;  2A6E D;  2YUJ A;  2NAP A;  2NYA A;  1PQF A;  2C45 A;  1Y1V A;  4JJO A;  2E7Z A;  4AVR A;  2JA5 A;  3X2G A;  2VPW A;  1BW3 A;  1PYQ A;  1E5V A;  2KQA A;  2R92 A;  1YLE A;  1QDN A;  4AON B;  2BE5 D;  3GTO A;  1TWG A;  4CRY G;  1AW8 B;  1FDO A;  2G6G A;  2WB1 A;  2AE0 X;  2GAE A;  2EEO B;  4KOD A;  4C2M A;  4ZM7 A;  1CZ5 A;  2VPZ A;  2Y0S A;  4GA6 A;  1YNN D;  1BW4 A;  1HD5 A;  5FTL A;  3IR7 A;  5FTJ A;  4KLN A;  3SUM A;  3QWZ A;  4AAY A;  1H0H A;  5FTK A;  1PT0 A;  2A69 D;  4JP7 A;  1SIW A;  4DMR A;  4CS0 A;  2E2I A;  2HCZ X;  3DMR A;  1UHD A;  4RV0 A;  2JA6 A;  1WC2 A;  1OGY A;  3GTJ A;  3SUJ A;  4FG2 A;  1K83 A;  2A6H D;  2JIR A;  2V45 A;  1PYU B;  1PQH A;  4JP6 A;  2NVY A;  3SUL A;  2YU9 A;  3HU2 A;  1DMS A;  3D30 A;  3X2N A;  3QQ8 A;  1Y1W A;  2WAQ A;  2PI8 A;  1TWA A;  1DMR A;  4GA5 A;  2JIQ A;  5GLF A;  3X2P A;  2O5J D;  4QIW A;  2R7Z A;  2VPX A;  1CR5 A;  1PT1 A;  1UHE A;  1TWC A;  1R7R A;  1N10 A;  3CF2 A;  2V3V A;  3X2J A;  1I3Q A;  3HKZ A;  1E18 A;  1PPY A;  2KI8 A;  5C18 A;  4NOH A;  3QQ7 A;  3CQZ A;  4FFT A;  3X2I A;  1R27 A;  4JCW A;  2A68 D;  1QCS A;  4L48 A;  4KDI A;  3X2O A;  4ENG A;  3HU3 A;  3PLX B;  4FER A;  5T5I D;  5GLY A;  4D7Z B;  1E61 A;  5B6C A;  1CZ4 A;  5GM9 A;  3M3G A;  1TWH A;  1R9T A;  1KQF A;  3GTK A;  2PIC A;  1WCM A;  1TWF A;  1L8F A;  3TIW A;  1Q16 A;  3QC8 A;  1G8K A;  2B63 A;  1G8J A;  4AYB A;  3O5A A;  3OUG A;  2NVX A;  1IW7 D;  5T5M D;  5DYI A;  3X2L A;  5C1B A;  1EU1 A;  1SFO A;  1ZYR D;  2PJJ A;  1FDI A;  1YNJ D;  1AA6 A;  2JA7 A;  4KDL A;  1S3S A;  2PMZ A;  3ENG A;  1KQG A;  2VUM A;  2IV2 X;  3HU1 A;  1SMY D;  1TMO A;  2JIO A;  3CZB A;  3IR5 A;  3FKI A;  5DYG A;  1I50 A;  1E60 A;  1H5N A;  5FTN A;  3ML1 A;  2PJH B;  3GTP A;  1VC3 B;  2E2H A;  2R93 A;  3TM7 B;  4AOK B;  1ZC1 A;  1E32 A;  3H0G A;  3X2M A;  3GTL A;  2JIM A;  4FG4 A;  5GLX A; 
#chains in the Genus database with same CATH homology
 1Y4Z A;  3IR6 A;  1PQE A;  5FTM A;  1WLF A;  3GTG A;  1Y5I A;  4KO8 A;  4CRZ A;  2G5D A;  2VPY A;  5EPP A;  4AZD A;  2CW0 D;  3GTM A;  2PNW A;  3GTQ A;  2DMR A;  2JIP A;  2A6E D;  2YUJ A;  2NAP A;  2NYA A;  1PQF A;  2C45 A;  1Y1V A;  2E7Z A;  2JA5 A;  2VPW A;  1PYQ A;  1E5V A;  2R92 A;  1YLE A;  1QDN A;  4AON B;  2BE5 D;  3GTO A;  1TWG A;  4CRY G;  1AW8 B;  1FDO A;  2G6G A;  2WB1 A;  2AE0 X;  2GAE A;  2EEO B;  4KOD A;  4C2M A;  1CZ5 A;  2VPZ A;  2Y0S A;  4GA6 A;  1YNN D;  5FTL A;  3IR7 A;  5FTJ A;  4KLN A;  3QWZ A;  4AAY A;  1H0H A;  5FTK A;  1PT0 A;  2A69 D;  4DMR A;  1SIW A;  4CS0 A;  2E2I A;  3DMR A;  1UHD A;  4RV0 A;  2JA6 A;  1OGY A;  3GTJ A;  1K83 A;  2A6H D;  2JIR A;  2V45 A;  1PYU B;  1PQH A;  2NVY A;  2YU9 A;  3HU2 A;  1DMS A;  3QQ8 A;  1Y1W A;  2WAQ A;  2PI8 A;  1TWA A;  1DMR A;  4GA5 A;  2JIQ A;  5GLF A;  2O5J D;  2R7Z A;  4QIW A;  2VPX A;  1CR5 A;  1PT1 A;  1UHE A;  1TWC A;  1R7R A;  3CF2 A;  2V3V A;  1I3Q A;  3HKZ A;  1E18 A;  1PPY A;  2KI8 A;  5C18 A;  4NOH A;  3QQ7 A;  3CQZ A;  1R27 A;  2A68 D;  1QCS A;  4KDI A;  3HU3 A;  3PLX B;  5T5I D;  4D7Z B;  1E61 A;  5B6C A;  1CZ4 A;  1TWH A;  1R9T A;  1KQF A;  3GTK A;  2PIC A;  1WCM A;  1TWF A;  3TIW A;  1Q16 A;  3QC8 A;  1G8K A;  2B63 A;  1G8J A;  4AYB A;  3O5A A;  3OUG A;  2NVX A;  1IW7 D;  5T5M D;  5DYI A;  5C1B A;  1EU1 A;  1SFO A;  1ZYR D;  2PJJ A;  1FDI A;  1YNJ D;  1AA6 A;  2JA7 A;  4KDL A;  1S3S A;  2PMZ A;  1KQG A;  2VUM A;  2IV2 X;  3HU1 A;  1SMY D;  1TMO A;  2JIO A;  3CZB A;  3IR5 A;  3FKI A;  5DYG A;  1I50 A;  1E60 A;  1H5N A;  5FTN A;  3ML1 A;  2PJH B;  3GTP A;  1VC3 B;  2E2H A;  2R93 A;  3TM7 B;  4AOK B;  1ZC1 A;  1E32 A;  3H0G A;  3GTL A;  2JIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...