1UHDA

Crystal structure of aspartate decarboxylase, pyruvoly group bound form
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKGLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate 1-decarboxylase beta chain
molecule tags Lyase
source organism Helicobacter pylori
publication title Crystal structure of the schiff base intermediate prior to decarboxylation in the catalytic cycle of aspartate alpha-decarboxylase
pubmed doi rcsb
total genus 17
structure length 95
sequence length 95
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2003-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1uhdA00
3O5AA 2VPZA 1CR5A 3CF2A 5B6CA 1DMSA 2R93A 5C1BA 2KI8A 1PPYA 3IR6A 1VC3B 3GTMA 3IR5A 2NVXA 4AYBA 2E7ZA 3GTOA 4KODA 1TMOA 3GTPA 1SIWA 1PQEA 5GLFA 3HU2A 3CQZA 1AA6A 1Q16A 1PYQA 4KDIA 5C18A 2JA5A 1TWHA 2PMZA 1SFOA 3GTQA 1KQGA 2JIOA 1AW8B 1QDNA 4GA5A 1I50A 5FTNA 1E5VA 4KDLA 1Y4ZA 2WAQA 3FKIA 2NYAA 4QIWA 1EU1A 2JA6A 2E2IA 2E2HA 1E61A 1S3SA 2V45A 4CRYG 2NAPA 4AOKB 1H0HA 3GTJA 4AONB 4AAYA 1FDOA 4AZDA 1TWGA 2IV2X 2V3VA 2VPYA 3TIWA 5FTLA 1PYUB 1H5NA 4GA6A 1G8KA 4KLNA 3PLXB 3QQ7A 2PJHB 5FTKA 1E32A 1WLFA 2R7ZA 3GTGA 1CZ4A 1TWFA 2WB1A 2JIPA 4C2MA 1YLEA 3TM7B 2JIRA 4KO8A 3GTLA 4CRZA 5EPPA 2B63A 1UHDA 5T5ID 1PT0A 1Y1VA 3HU3A 5FTMA 1Y5IA 1WCMA 1R9TA 4RV0A 4CS0A 2VUMA 2VPWA 2YU9A 1PT1A 1R27A 2DMRA 3QC8A 5DYGA 2VPXA 1CZ5A 1UHEA 1IW7D 3GTKA 1DMRA 2R92A 2Y0SA 1OGYA 1G8JA 1R7RA 1QCSA 3HU1A 2NVYA 1TWAA 3ML1A 3HKZA 2JIQA 3OUGA 1K83A 2JIMA 1E18A 1E60A 1TWCA 2JA7A 1KQFA 1PQFA 3H0GA 5DYIA 5FTJA 1I3QA 3QQ8A 1PQHA 1FDIA 3DMRA 2C45A 3QWZA 1Y1WA 3IR7A 4D7ZB 2EEOB 5T5MD 4DMRA
chains in the Genus database with same CATH superfamily
1OA9A 3O5AA 3X2IA 4FG2A 2VPZA 1CR5A 3CF2A 2CW0D 1DMSA 5B6CA 2R93A 4JP6A 5C1BA 3X2OA 5GLYA 2KI8A 1PPYA 3IR6A 1VC3B 3GTMA 3IR5A 3X2NA 2NVXA 4AYBA 2E7ZA 3X2JA 3GTOA 4KODA 1TMOA 3GTPA 1SIWA 3X2GA 1N10A 1PQEA 5GLFA 3HU2A 5H4UA 3CQZA 1AA6A 1Q16A 1PYQA 4KDIA 5C18A 2JA5A 1TWHA 2PMZA 1SFOA 3GTQA 1KQGA 4FG4A 3X2HA 2JIOA 1AW8B 1QDNA 4GA5A 1I50A 5FTNA 1E5VA 4KDLA 2GAEA 4NOHA 2A69D 1Y4ZA 2WAQA 3SUMA 3FKIA 4JS7A 2NYAA 4QIWA 1EU1A 2JA6A 2E2IA 2PNWA 3M3GA 2ENGA 2A6ED 1OA7A 2E2HA 1E61A 1S3SA 4FFTA 2O5JD 1ZC1A 2V45A 4ZM7A 4CRYG 2NAPA 3D30A 4AOKB 1H0HA 1YNJD 2YUJA 3GTJA 4AONB 4AAYA 1BW3A 1FDOA 2PJJA 4AZDA 1TWGA 4FERA 2IV2X 2A6HD 2V3VA 2G5DA 2VPYA 1BW4A 2PI8A 1WC2A 3TIWA 5FTLA 3SUJA 1PYUB 1H5NA 4GA6A 1G8KA 4KLNA 3PLXB 2AE0X 3QQ7A 2G6GA 2PJHB 5FTKA 1E32A 1WLFA 2R7ZA 3GTGA 1CZ4A 1TWFA 2WB1A 3X2LA 2JIPA 4C2MA 1YLEA 3TM7B 4ENGA 2JIRA 4KO8A 3GTLA 4CRZA 5EPPA 2B63A 1UHDA 5T5ID 1PT0A 1Y1VA 3HU3A 5FTMA 1Y5IA 1WCMA 2BE5D 1R9TA 4RV0A 4CS0A 1ZYRD 2VUMA 2VPWA 2YU9A 1PT1A 1R27A 2DMRA 3QC8A 5DYGA 2VPXA 2A68D 1CZ5A 1UHEA 1IW7D 5GLXA 3SUKA 3CZBA 4AVRA 3GTKA 3X2PA 1DMRA 1SMYD 2Y0SA 1OGYA 4JCWA 3SULA 2R92A 1G8JA 1R7RA 1YNND 1QCSA 3HU1A 5GM9A 1L8FA 2NVYA 1TWAA 3ML1A 3HKZA 2JIQA 3OUGA 3X2KA 1K83A 2JIMA 1E18A 1E60A 1TWCA 2HCZX 3ENGA 2JA7A 1KQFA 4L48A 1PQFA 3H0GA 5DYIA 2PICA 5FTJA 1I3QA 3QQ8A 1PQHA 2KQAA 1FDIA 3DMRA 2C45A 3X2MA 1HD5A 3QWZA 1Y1WA 3IR7A 4JP7A 4JJOA 4D7ZB 2BH0A 2EEOB 5T5MD 4DMRA
chains in the Genus database with same CATH topology
3O5AA 2VPZA 1CR5A 3CF2A 2CW0D 1DMSA 5B6CA 2R93A 5C1BA 2KI8A 1PPYA 3IR6A 1VC3B 3GTMA 3IR5A 2NVXA 4AYBA 2E7ZA 3GTOA 4KODA 1TMOA 3GTPA 1SIWA 1PQEA 5GLFA 3HU2A 3CQZA 1AA6A 1Q16A 1PYQA 4KDIA 5C18A 2JA5A 1TWHA 2PMZA 1SFOA 3GTQA 1KQGA 2JIOA 1AW8B 1QDNA 4GA5A 1I50A 5FTNA 1E5VA 4KDLA 2GAEA 4NOHA 2A69D 1Y4ZA 2WAQA 3FKIA 2NYAA 4QIWA 1EU1A 2JA6A 2E2IA 2PNWA 2A6ED 2E2HA 1E61A 1S3SA 2O5JD 1ZC1A 2V45A 4CRYG 2NAPA 4AOKB 1H0HA 1YNJD 2YUJA 3GTJA 4AONB 4AAYA 1FDOA 2PJJA 4AZDA 1TWGA 2IV2X 2A6HD 2V3VA 2G5DA 2VPYA 2PI8A 3TIWA 5FTLA 1PYUB 1H5NA 4GA6A 1G8KA 4KLNA 3PLXB 2AE0X 3QQ7A 2G6GA 2PJHB 5FTKA 1E32A 1WLFA 2R7ZA 3GTGA 1CZ4A 1TWFA 2WB1A 2JIPA 4C2MA 1YLEA 3TM7B 2JIRA 4KO8A 3GTLA 4CRZA 5EPPA 2B63A 1UHDA 5T5ID 1PT0A 1Y1VA 3HU3A 5FTMA 1Y5IA 1WCMA 2BE5D 1R9TA 4RV0A 4CS0A 1ZYRD 2VUMA 2VPWA 2YU9A 1PT1A 1R27A 2DMRA 3QC8A 5DYGA 2VPXA 2A68D 1CZ5A 1UHEA 1IW7D 3CZBA 3GTKA 1DMRA 1SMYD 2Y0SA 1OGYA 2R92A 1G8JA 1R7RA 1YNND 1QCSA 3HU1A 2NVYA 1TWAA 3ML1A 3HKZA 2JIQA 3OUGA 1K83A 2JIMA 1E18A 1E60A 1TWCA 2JA7A 1KQFA 1PQFA 3H0GA 5DYIA 2PICA 5FTJA 1I3QA 3QQ8A 1PQHA 1FDIA 3DMRA 2C45A 3QWZA 1Y1WA 3IR7A 4D7ZB 2EEOB 5T5MD 4DMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5A A;  2VPZ A;  1CR5 A;  3CF2 A;  5B6C A;  1DMS A;  2R93 A;  5C1B A;  2KI8 A;  1PPY A;  3IR6 A;  1VC3 B;  3GTM A;  3IR5 A;  2NVX A;  4AYB A;  2E7Z A;  3GTO A;  4KOD A;  1TMO A;  3GTP A;  1SIW A;  1PQE A;  5GLF A;  3HU2 A;  3CQZ A;  1AA6 A;  1Q16 A;  1PYQ A;  4KDI A;  5C18 A;  2JA5 A;  1TWH A;  2PMZ A;  1SFO A;  3GTQ A;  1KQG A;  2JIO A;  1AW8 B;  1QDN A;  4GA5 A;  1I50 A;  5FTN A;  1E5V A;  4KDL A;  1Y4Z A;  2WAQ A;  3FKI A;  2NYA A;  4QIW A;  1EU1 A;  2JA6 A;  2E2I A;  2E2H A;  1E61 A;  1S3S A;  2V45 A;  4CRY G;  2NAP A;  4AOK B;  1H0H A;  3GTJ A;  4AON B;  4AAY A;  1FDO A;  4AZD A;  1TWG A;  2IV2 X;  2V3V A;  2VPY A;  3TIW A;  5FTL A;  1PYU B;  1H5N A;  4GA6 A;  1G8K A;  4KLN A;  3PLX B;  3QQ7 A;  2PJH B;  5FTK A;  1E32 A;  1WLF A;  2R7Z A;  3GTG A;  1CZ4 A;  1TWF A;  2WB1 A;  2JIP A;  4C2M A;  1YLE A;  3TM7 B;  2JIR A;  4KO8 A;  3GTL A;  4CRZ A;  5EPP A;  2B63 A;  1UHD A;  5T5I D;  1PT0 A;  1Y1V A;  3HU3 A;  5FTM A;  1Y5I A;  1WCM A;  1R9T A;  4RV0 A;  4CS0 A;  2VUM A;  2VPW A;  2YU9 A;  1PT1 A;  1R27 A;  2DMR A;  3QC8 A;  5DYG A;  2VPX A;  1CZ5 A;  1UHE A;  1IW7 D;  3GTK A;  1DMR A;  2R92 A;  2Y0S A;  1OGY A;  1G8J A;  1R7R A;  1QCS A;  3HU1 A;  2NVY A;  1TWA A;  3ML1 A;  3HKZ A;  2JIQ A;  3OUG A;  1K83 A;  2JIM A;  1E18 A;  1E60 A;  1TWC A;  2JA7 A;  1KQF A;  1PQF A;  3H0G A;  5DYI A;  5FTJ A;  1I3Q A;  3QQ8 A;  1PQH A;  1FDI A;  3DMR A;  2C45 A;  3QWZ A;  1Y1W A;  3IR7 A;  4D7Z B;  2EEO B;  5T5M D;  4DMR A; 
#chains in the Genus database with same CATH topology
 1OA9 A;  3O5A A;  3X2I A;  4FG2 A;  2VPZ A;  1CR5 A;  3CF2 A;  2CW0 D;  1DMS A;  5B6C A;  2R93 A;  4JP6 A;  5C1B A;  3X2O A;  5GLY A;  2KI8 A;  1PPY A;  3IR6 A;  1VC3 B;  3GTM A;  3IR5 A;  3X2N A;  2NVX A;  4AYB A;  2E7Z A;  3X2J A;  3GTO A;  4KOD A;  1TMO A;  3GTP A;  1SIW A;  3X2G A;  1N10 A;  1PQE A;  5GLF A;  3HU2 A;  5H4U A;  3CQZ A;  1AA6 A;  1Q16 A;  1PYQ A;  4KDI A;  5C18 A;  2JA5 A;  1TWH A;  2PMZ A;  1SFO A;  3GTQ A;  1KQG A;  4FG4 A;  3X2H A;  2JIO A;  1AW8 B;  1QDN A;  4GA5 A;  1I50 A;  5FTN A;  1E5V A;  4KDL A;  2GAE A;  4NOH A;  2A69 D;  1Y4Z A;  2WAQ A;  3SUM A;  3FKI A;  4JS7 A;  2NYA A;  4QIW A;  1EU1 A;  2JA6 A;  2E2I A;  2PNW A;  3M3G A;  2ENG A;  2A6E D;  1OA7 A;  2E2H A;  1E61 A;  1S3S A;  4FFT A;  2O5J D;  1ZC1 A;  2V45 A;  4ZM7 A;  4CRY G;  2NAP A;  3D30 A;  4AOK B;  1H0H A;  1YNJ D;  2YUJ A;  3GTJ A;  4AON B;  4AAY A;  1BW3 A;  1FDO A;  2PJJ A;  4AZD A;  1TWG A;  4FER A;  2IV2 X;  2A6H D;  2V3V A;  2G5D A;  2VPY A;  1BW4 A;  2PI8 A;  1WC2 A;  3TIW A;  5FTL A;  3SUJ A;  1PYU B;  1H5N A;  4GA6 A;  1G8K A;  4KLN A;  3PLX B;  2AE0 X;  3QQ7 A;  2G6G A;  2PJH B;  5FTK A;  1E32 A;  1WLF A;  2R7Z A;  3GTG A;  1CZ4 A;  1TWF A;  2WB1 A;  3X2L A;  2JIP A;  4C2M A;  1YLE A;  3TM7 B;  4ENG A;  2JIR A;  4KO8 A;  3GTL A;  4CRZ A;  5EPP A;  2B63 A;  1UHD A;  5T5I D;  1PT0 A;  1Y1V A;  3HU3 A;  5FTM A;  1Y5I A;  1WCM A;  2BE5 D;  1R9T A;  4RV0 A;  4CS0 A;  1ZYR D;  2VUM A;  2VPW A;  2YU9 A;  1PT1 A;  1R27 A;  2DMR A;  3QC8 A;  5DYG A;  2VPX A;  2A68 D;  1CZ5 A;  1UHE A;  1IW7 D;  5GLX A;  3SUK A;  3CZB A;  4AVR A;  3GTK A;  3X2P A;  1DMR A;  1SMY D;  2Y0S A;  1OGY A;  4JCW A;  3SUL A;  2R92 A;  1G8J A;  1R7R A;  1YNN D;  1QCS A;  3HU1 A;  5GM9 A;  1L8F A;  2NVY A;  1TWA A;  3ML1 A;  3HKZ A;  2JIQ A;  3OUG A;  3X2K A;  1K83 A;  2JIM A;  1E18 A;  1E60 A;  1TWC A;  2HCZ X;  3ENG A;  2JA7 A;  1KQF A;  4L48 A;  1PQF A;  3H0G A;  5DYI A;  2PIC A;  5FTJ A;  1I3Q A;  3QQ8 A;  1PQH A;  2KQA A;  1FDI A;  3DMR A;  2C45 A;  3X2M A;  1HD5 A;  3QWZ A;  1Y1W A;  3IR7 A;  4JP7 A;  4JJO A;  4D7Z B;  2BH0 A;  2EEO B;  5T5M D;  4DMR A; 
#chains in the Genus database with same CATH homology
 3O5A A;  2VPZ A;  1CR5 A;  3CF2 A;  2CW0 D;  1DMS A;  5B6C A;  2R93 A;  5C1B A;  2KI8 A;  1PPY A;  3IR6 A;  1VC3 B;  3GTM A;  3IR5 A;  2NVX A;  4AYB A;  2E7Z A;  3GTO A;  4KOD A;  1TMO A;  3GTP A;  1SIW A;  1PQE A;  5GLF A;  3HU2 A;  3CQZ A;  1AA6 A;  1Q16 A;  1PYQ A;  4KDI A;  5C18 A;  2JA5 A;  1TWH A;  2PMZ A;  1SFO A;  3GTQ A;  1KQG A;  2JIO A;  1AW8 B;  1QDN A;  4GA5 A;  1I50 A;  5FTN A;  1E5V A;  4KDL A;  2GAE A;  4NOH A;  2A69 D;  1Y4Z A;  2WAQ A;  3FKI A;  2NYA A;  4QIW A;  1EU1 A;  2JA6 A;  2E2I A;  2PNW A;  2A6E D;  2E2H A;  1E61 A;  1S3S A;  2O5J D;  1ZC1 A;  2V45 A;  4CRY G;  2NAP A;  4AOK B;  1H0H A;  1YNJ D;  2YUJ A;  3GTJ A;  4AON B;  4AAY A;  1FDO A;  2PJJ A;  4AZD A;  1TWG A;  2IV2 X;  2A6H D;  2V3V A;  2G5D A;  2VPY A;  2PI8 A;  3TIW A;  5FTL A;  1PYU B;  1H5N A;  4GA6 A;  1G8K A;  4KLN A;  3PLX B;  2AE0 X;  3QQ7 A;  2G6G A;  2PJH B;  5FTK A;  1E32 A;  1WLF A;  2R7Z A;  3GTG A;  1CZ4 A;  1TWF A;  2WB1 A;  2JIP A;  4C2M A;  1YLE A;  3TM7 B;  2JIR A;  4KO8 A;  3GTL A;  4CRZ A;  5EPP A;  2B63 A;  1UHD A;  5T5I D;  1PT0 A;  1Y1V A;  3HU3 A;  5FTM A;  1Y5I A;  1WCM A;  2BE5 D;  1R9T A;  4RV0 A;  4CS0 A;  1ZYR D;  2VUM A;  2VPW A;  2YU9 A;  1PT1 A;  1R27 A;  2DMR A;  3QC8 A;  5DYG A;  2VPX A;  2A68 D;  1CZ5 A;  1UHE A;  1IW7 D;  3CZB A;  3GTK A;  1DMR A;  1SMY D;  2Y0S A;  1OGY A;  2R92 A;  1G8J A;  1R7R A;  1YNN D;  1QCS A;  3HU1 A;  2NVY A;  1TWA A;  3ML1 A;  3HKZ A;  2JIQ A;  3OUG A;  1K83 A;  2JIM A;  1E18 A;  1E60 A;  1TWC A;  2JA7 A;  1KQF A;  1PQF A;  3H0G A;  5DYI A;  2PIC A;  5FTJ A;  1I3Q A;  3QQ8 A;  1PQH A;  1FDI A;  3DMR A;  2C45 A;  3QWZ A;  1Y1W A;  3IR7 A;  4D7Z B;  2EEO B;  5T5M D;  4DMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...