2KI8A

Solution nmr structure of tungsten formylmethanofuran dehydrogenase subunit d from archaeoglobus fulgidus, northeast structural genomics consortium target att7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
MGSSHHHHHHSSGRENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPMGPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of tungsten formylmethanofuran dehydrogenase subunit D from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords Tungsten formylmethanofuran dehydrogenase, subunit D (FwdD-2
total genus 28
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2ki8A01
3DMRA 3GTLA 1Y4ZA 4CS0A 1G8KA 1Q16A 1I3QA 1WLFA 1TWHA 5T5ID 1VC3B 2NVYA 1I50A 2VPXA 1PQHA 5C1BA 4GA6A 3GTGA 2VPWA 3HU1A 2Y0SA 4KLNA 2NYAA 4AOKB 3IR5A 1R27A 5FTNA 3TM7B 1Y1WA 4KDLA 1TMOA 3HKZA 2IV2X 3QQ8A 1CR5A 2JIRA 3ML1A 5T5MD 1PT1A 1TWFA 2JIQA 4KDIA 2VPYA 2WAQA 1KQFA 5C18A 4KODA 1IW7D 5EPPA 2WB1A 3IR6A 1K83A 2E2IA 1AW8B 2C45A 2PJHB 4RV0A 1G8JA 1QCSA 4QIWA 5FTJA 1E60A 4C2MA 2R7ZA 2KI8A 1YLEA 3QC8A 1PQEA 3H0GA 1E18A 5DYGA 3GTMA 1PPYA 1PYQA 2YU9A 4AAYA 1AA6A 2JIOA 4D7ZB 1H0HA 2PMZA 3GTQA 3GTPA 3HU2A 1R7RA 4CRZA 5FTLA 5B6CA 3TIWA 1QDNA 3O5AA 2DMRA 2NAPA 2E2HA 1CZ5A 2R93A 3HU3A 2JA7A 1R9TA 3OUGA 3IR7A 1CZ4A 1TWGA 1UHDA 2NVXA 1E32A 1Y1VA 1PYUB 1WCMA 2R92A 3QWZA 1FDIA 4KO8A 5FTMA 2JA5A 2VUMA 1DMSA 1SIWA 4CRYG 4AONB 1TWAA 2JIMA 2B63A 3QQ7A 1E61A 1DMRA 2VPZA 1PT0A 3GTOA 3PLXB 2V3VA 5DYIA 1OGYA 3FKIA 3GTKA 1FDOA 1SFOA 4AZDA 4AYBA 1E5VA 2E7ZA 1H5NA 1PQFA 2EEOB 1KQGA 3CF2A 2V45A 5GLFA 1S3SA 3CQZA 1UHEA 1TWCA 3GTJA 1EU1A 2JA6A 5FTKA 1Y5IA 4GA5A 4DMRA 2JIPA
chains in the Genus database with same CATH superfamily
3DMRA 4JJOA 3X2MA 3GTLA 1Y4ZA 4CS0A 1HD5A 1G8KA 1Q16A 1I3QA 1WLFA 1TWHA 5T5ID 2A6HD 1VC3B 2NVYA 1I50A 2VPXA 1L8FA 1PQHA 4JCWA 2GAEA 5C1BA 4GA6A 3SUKA 4JP7A 4JP6A 3GTGA 3M3GA 2VPWA 3HU1A 2Y0SA 4KLNA 5GM9A 1ZC1A 1YNJD 2NYAA 4AOKB 3IR5A 1R27A 5FTNA 3X2GA 2AE0X 3TM7B 1Y1WA 4L48A 4KDLA 3X2PA 1TMOA 3HKZA 2IV2X 3QQ8A 1CR5A 1BW3A 2JIRA 3ML1A 5T5MD 4AVRA 2JIQA 1PT1A 1TWFA 4KDIA 2VPYA 2WAQA 3X2JA 1KQFA 5C18A 2YUJA 4KODA 1BW4A 1IW7D 5EPPA 2WB1A 3IR6A 1K83A 2BE5D 2E2IA 1AW8B 1OA7A 1ZYRD 2C45A 2PI8A 2PJHB 4RV0A 1G8JA 1QCSA 4QIWA 5FTJA 1E60A 4C2MA 2R7ZA 2KI8A 1YLEA 3QC8A 2A69D 1PQEA 3SUJA 3H0GA 1E18A 5DYGA 3GTMA 1PPYA 1PYQA 2YU9A 4AAYA 1AA6A 2JIOA 5GLYA 5H4UA 4D7ZB 1H0HA 2PMZA 3SUMA 3X2LA 4FFTA 3GTQA 1SMYD 3GTPA 3HU2A 1R7RA 4CRZA 5FTLA 5B6CA 3TIWA 1QDNA 2CW0D 2DMRA 2NAPA 3O5AA 1WC2A 3CZBA 2E2HA 4ZM7A 1YNND 1CZ5A 2PJJA 2A6ED 2R93A 3HU3A 3X2KA 2G5DA 2JA7A 2BH0A 2ENGA 1R9TA 3OUGA 3X2NA 3IR7A 1CZ4A 1TWGA 1OA9A 1UHDA 2NVXA 1E32A 1Y1VA 1PYUB 1WCMA 5GLXA 4ENGA 3SULA 3X2OA 4NOHA 3QWZA 1FDIA 4KO8A 5FTMA 2R92A 2JA5A 2VUMA 1DMSA 1SIWA 4CRYG 4AONB 4FG2A 1N10A 2JIMA 1TWAA 2PICA 2B63A 4JS7A 3QQ7A 2A68D 1E61A 3ENGA 1DMRA 2VPZA 1PT0A 3GTOA 3PLXB 2V3VA 5DYIA 1OGYA 3FKIA 3GTKA 1FDOA 1SFOA 2G6GA 3X2IA 4AZDA 2O5JD 3D30A 4AYBA 1E5VA 2E7ZA 3X2HA 1H5NA 1PQFA 2EEOB 1KQGA 4FG4A 2HCZX 3CF2A 2PNWA 2V45A 5GLFA 1S3SA 2KQAA 3CQZA 1UHEA 1TWCA 3GTJA 1EU1A 2JA6A 5FTKA 4FERA 1Y5IA 4GA5A 4DMRA 2JIPA
chains in the Genus database with same CATH topology
3DMRA 3GTLA 1Y4ZA 4CS0A 1G8KA 1Q16A 1I3QA 1WLFA 1TWHA 5T5ID 2A6HD 1VC3B 2NVYA 1I50A 2VPXA 1PQHA 2GAEA 5C1BA 4GA6A 3GTGA 2VPWA 3HU1A 2Y0SA 4KLNA 2NYAA 1ZC1A 1YNJD 4AOKB 3IR5A 1R27A 5FTNA 2AE0X 3TM7B 1Y1WA 4KDLA 1TMOA 3HKZA 2IV2X 3QQ8A 1CR5A 2JIRA 3ML1A 5T5MD 2JIQA 1PT1A 1TWFA 4KDIA 2VPYA 2WAQA 1KQFA 5C18A 2YUJA 4KODA 1IW7D 5EPPA 2WB1A 3IR6A 1K83A 2BE5D 2E2IA 1AW8B 1ZYRD 2C45A 2PI8A 2PJHB 4RV0A 1G8JA 1QCSA 4QIWA 5FTJA 1E60A 4C2MA 2R7ZA 2KI8A 1YLEA 3QC8A 2A69D 1PQEA 3H0GA 1E18A 5DYGA 3GTMA 1PPYA 1PYQA 2YU9A 4AAYA 1AA6A 2JIOA 4D7ZB 1H0HA 2PMZA 3GTQA 3GTPA 1SMYD 3HU2A 1R7RA 4CRZA 5FTLA 5B6CA 3TIWA 1QDNA 2CW0D 2DMRA 2NAPA 3O5AA 3CZBA 2E2HA 1YNND 1CZ5A 2PJJA 2A6ED 2R93A 3HU3A 2G5DA 2JA7A 1R9TA 3OUGA 3IR7A 1CZ4A 1TWGA 1UHDA 2NVXA 1E32A 1Y1VA 1PYUB 1WCMA 2R92A 4NOHA 3QWZA 1FDIA 4KO8A 5FTMA 2JA5A 2VUMA 1DMSA 1SIWA 4CRYG 4AONB 1TWAA 2JIMA 2B63A 2PICA 3QQ7A 2A68D 1E61A 1DMRA 2VPZA 1PT0A 3GTOA 3PLXB 2V3VA 5DYIA 1OGYA 3FKIA 3GTKA 1FDOA 1SFOA 2G6GA 4AZDA 2O5JD 4AYBA 1E5VA 2E7ZA 1H5NA 1PQFA 2EEOB 1KQGA 3CF2A 2PNWA 2V45A 5GLFA 1S3SA 3CQZA 1UHEA 1TWCA 3GTJA 1EU1A 2JA6A 5FTKA 1Y5IA 4GA5A 4DMRA 2JIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMR A;  3GTL A;  1Y4Z A;  4CS0 A;  1G8K A;  1Q16 A;  1I3Q A;  1WLF A;  1TWH A;  5T5I D;  1VC3 B;  2NVY A;  1I50 A;  2VPX A;  1PQH A;  5C1B A;  4GA6 A;  3GTG A;  2VPW A;  3HU1 A;  2Y0S A;  4KLN A;  2NYA A;  4AOK B;  3IR5 A;  1R27 A;  5FTN A;  3TM7 B;  1Y1W A;  4KDL A;  1TMO A;  3HKZ A;  2IV2 X;  3QQ8 A;  1CR5 A;  2JIR A;  3ML1 A;  5T5M D;  1PT1 A;  1TWF A;  2JIQ A;  4KDI A;  2VPY A;  2WAQ A;  1KQF A;  5C18 A;  4KOD A;  1IW7 D;  5EPP A;  2WB1 A;  3IR6 A;  1K83 A;  2E2I A;  1AW8 B;  2C45 A;  2PJH B;  4RV0 A;  1G8J A;  1QCS A;  4QIW A;  5FTJ A;  1E60 A;  4C2M A;  2R7Z A;  2KI8 A;  1YLE A;  3QC8 A;  1PQE A;  3H0G A;  1E18 A;  5DYG A;  3GTM A;  1PPY A;  1PYQ A;  2YU9 A;  4AAY A;  1AA6 A;  2JIO A;  4D7Z B;  1H0H A;  2PMZ A;  3GTQ A;  3GTP A;  3HU2 A;  1R7R A;  4CRZ A;  5FTL A;  5B6C A;  3TIW A;  1QDN A;  3O5A A;  2DMR A;  2NAP A;  2E2H A;  1CZ5 A;  2R93 A;  3HU3 A;  2JA7 A;  1R9T A;  3OUG A;  3IR7 A;  1CZ4 A;  1TWG A;  1UHD A;  2NVX A;  1E32 A;  1Y1V A;  1PYU B;  1WCM A;  2R92 A;  3QWZ A;  1FDI A;  4KO8 A;  5FTM A;  2JA5 A;  2VUM A;  1DMS A;  1SIW A;  4CRY G;  4AON B;  1TWA A;  2JIM A;  2B63 A;  3QQ7 A;  1E61 A;  1DMR A;  2VPZ A;  1PT0 A;  3GTO A;  3PLX B;  2V3V A;  5DYI A;  1OGY A;  3FKI A;  3GTK A;  1FDO A;  1SFO A;  4AZD A;  4AYB A;  1E5V A;  2E7Z A;  1H5N A;  1PQF A;  2EEO B;  1KQG A;  3CF2 A;  2V45 A;  5GLF A;  1S3S A;  3CQZ A;  1UHE A;  1TWC A;  3GTJ A;  1EU1 A;  2JA6 A;  5FTK A;  1Y5I A;  4GA5 A;  4DMR A;  2JIP A; 
#chains in the Genus database with same CATH topology
 3DMR A;  4JJO A;  3X2M A;  3GTL A;  1Y4Z A;  4CS0 A;  1HD5 A;  1G8K A;  1Q16 A;  1I3Q A;  1WLF A;  1TWH A;  5T5I D;  2A6H D;  1VC3 B;  2NVY A;  1I50 A;  2VPX A;  1L8F A;  1PQH A;  4JCW A;  2GAE A;  5C1B A;  4GA6 A;  3SUK A;  4JP7 A;  4JP6 A;  3GTG A;  3M3G A;  2VPW A;  3HU1 A;  2Y0S A;  4KLN A;  5GM9 A;  1ZC1 A;  1YNJ D;  2NYA A;  4AOK B;  3IR5 A;  1R27 A;  5FTN A;  3X2G A;  2AE0 X;  3TM7 B;  1Y1W A;  4L48 A;  4KDL A;  3X2P A;  1TMO A;  3HKZ A;  2IV2 X;  3QQ8 A;  1CR5 A;  1BW3 A;  2JIR A;  3ML1 A;  5T5M D;  4AVR A;  2JIQ A;  1PT1 A;  1TWF A;  4KDI A;  2VPY A;  2WAQ A;  3X2J A;  1KQF A;  5C18 A;  2YUJ A;  4KOD A;  1BW4 A;  1IW7 D;  5EPP A;  2WB1 A;  3IR6 A;  1K83 A;  2BE5 D;  2E2I A;  1AW8 B;  1OA7 A;  1ZYR D;  2C45 A;  2PI8 A;  2PJH B;  4RV0 A;  1G8J A;  1QCS A;  4QIW A;  5FTJ A;  1E60 A;  4C2M A;  2R7Z A;  2KI8 A;  1YLE A;  3QC8 A;  2A69 D;  1PQE A;  3SUJ A;  3H0G A;  1E18 A;  5DYG A;  3GTM A;  1PPY A;  1PYQ A;  2YU9 A;  4AAY A;  1AA6 A;  2JIO A;  5GLY A;  5H4U A;  4D7Z B;  1H0H A;  2PMZ A;  3SUM A;  3X2L A;  4FFT A;  3GTQ A;  1SMY D;  3GTP A;  3HU2 A;  1R7R A;  4CRZ A;  5FTL A;  5B6C A;  3TIW A;  1QDN A;  2CW0 D;  2DMR A;  2NAP A;  3O5A A;  1WC2 A;  3CZB A;  2E2H A;  4ZM7 A;  1YNN D;  1CZ5 A;  2PJJ A;  2A6E D;  2R93 A;  3HU3 A;  3X2K A;  2G5D A;  2JA7 A;  2BH0 A;  2ENG A;  1R9T A;  3OUG A;  3X2N A;  3IR7 A;  1CZ4 A;  1TWG A;  1OA9 A;  1UHD A;  2NVX A;  1E32 A;  1Y1V A;  1PYU B;  1WCM A;  5GLX A;  4ENG A;  3SUL A;  3X2O A;  4NOH A;  3QWZ A;  1FDI A;  4KO8 A;  5FTM A;  2R92 A;  2JA5 A;  2VUM A;  1DMS A;  1SIW A;  4CRY G;  4AON B;  4FG2 A;  1N10 A;  2JIM A;  1TWA A;  2PIC A;  2B63 A;  4JS7 A;  3QQ7 A;  2A68 D;  1E61 A;  3ENG A;  1DMR A;  2VPZ A;  1PT0 A;  3GTO A;  3PLX B;  2V3V A;  5DYI A;  1OGY A;  3FKI A;  3GTK A;  1FDO A;  1SFO A;  2G6G A;  3X2I A;  4AZD A;  2O5J D;  3D30 A;  4AYB A;  1E5V A;  2E7Z A;  3X2H A;  1H5N A;  1PQF A;  2EEO B;  1KQG A;  4FG4 A;  2HCZ X;  3CF2 A;  2PNW A;  2V45 A;  5GLF A;  1S3S A;  2KQA A;  3CQZ A;  1UHE A;  1TWC A;  3GTJ A;  1EU1 A;  2JA6 A;  5FTK A;  4FER A;  1Y5I A;  4GA5 A;  4DMR A;  2JIP A; 
#chains in the Genus database with same CATH homology
 3DMR A;  3GTL A;  1Y4Z A;  4CS0 A;  1G8K A;  1Q16 A;  1I3Q A;  1WLF A;  1TWH A;  5T5I D;  2A6H D;  1VC3 B;  2NVY A;  1I50 A;  2VPX A;  1PQH A;  2GAE A;  5C1B A;  4GA6 A;  3GTG A;  2VPW A;  3HU1 A;  2Y0S A;  4KLN A;  2NYA A;  1ZC1 A;  1YNJ D;  4AOK B;  3IR5 A;  1R27 A;  5FTN A;  2AE0 X;  3TM7 B;  1Y1W A;  4KDL A;  1TMO A;  3HKZ A;  2IV2 X;  3QQ8 A;  1CR5 A;  2JIR A;  3ML1 A;  5T5M D;  2JIQ A;  1PT1 A;  1TWF A;  4KDI A;  2VPY A;  2WAQ A;  1KQF A;  5C18 A;  2YUJ A;  4KOD A;  1IW7 D;  5EPP A;  2WB1 A;  3IR6 A;  1K83 A;  2BE5 D;  2E2I A;  1AW8 B;  1ZYR D;  2C45 A;  2PI8 A;  2PJH B;  4RV0 A;  1G8J A;  1QCS A;  4QIW A;  5FTJ A;  1E60 A;  4C2M A;  2R7Z A;  2KI8 A;  1YLE A;  3QC8 A;  2A69 D;  1PQE A;  3H0G A;  1E18 A;  5DYG A;  3GTM A;  1PPY A;  1PYQ A;  2YU9 A;  4AAY A;  1AA6 A;  2JIO A;  4D7Z B;  1H0H A;  2PMZ A;  3GTQ A;  3GTP A;  1SMY D;  3HU2 A;  1R7R A;  4CRZ A;  5FTL A;  5B6C A;  3TIW A;  1QDN A;  2CW0 D;  2DMR A;  2NAP A;  3O5A A;  3CZB A;  2E2H A;  1YNN D;  1CZ5 A;  2PJJ A;  2A6E D;  2R93 A;  3HU3 A;  2G5D A;  2JA7 A;  1R9T A;  3OUG A;  3IR7 A;  1CZ4 A;  1TWG A;  1UHD A;  2NVX A;  1E32 A;  1Y1V A;  1PYU B;  1WCM A;  2R92 A;  4NOH A;  3QWZ A;  1FDI A;  4KO8 A;  5FTM A;  2JA5 A;  2VUM A;  1DMS A;  1SIW A;  4CRY G;  4AON B;  1TWA A;  2JIM A;  2B63 A;  2PIC A;  3QQ7 A;  2A68 D;  1E61 A;  1DMR A;  2VPZ A;  1PT0 A;  3GTO A;  3PLX B;  2V3V A;  5DYI A;  1OGY A;  3FKI A;  3GTK A;  1FDO A;  1SFO A;  2G6G A;  4AZD A;  2O5J D;  4AYB A;  1E5V A;  2E7Z A;  1H5N A;  1PQF A;  2EEO B;  1KQG A;  3CF2 A;  2PNW A;  2V45 A;  5GLF A;  1S3S A;  3CQZ A;  1UHE A;  1TWC A;  3GTJ A;  1EU1 A;  2JA6 A;  5FTK A;  1Y5I A;  4GA5 A;  4DMR A;  2JIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...