2KI8A

Solution nmr structure of tungsten formylmethanofuran dehydrogenase subunit d from archaeoglobus fulgidus, northeast structural genomics consortium target att7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
MGSSHHHHHHSSGRENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPMGPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of tungsten formylmethanofuran dehydrogenase subunit D from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords Tungsten formylmethanofuran dehydrogenase, subunit D (FwdD-2
total genus 28
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 2ki8A01
3ML1A 2JIQA 1QDNA 4GA6A 1PQHA 1FDOA 2WAQA 4KO8A 4AZDA 4CS0A 2VPXA 2NVXA 1CZ5A 1TMOA 1Y5IA 5FTKA 1TWCA 5C1BA 3QQ7A 1IW7D 2V45A 4KLNA 2KI8A 3DMRA 1I3QA 3GTJA 1G8KA 2NVYA 2V3VA 3OUGA 1R9TA 1YLEA 2VPYA 2VUMA 4QIWA 5T5MD 1FDIA 4CRZA 1EU1A 1Y4ZA 3QWZA 1K83A 4RV0A 3GTQA 4KDIA 1AA6A 3GTGA 2JA7A 4GA5A 1PQFA 2VPWA 5FTLA 4CRYG 1AW8B 1PYQA 3GTPA 2YU9A 1Q16A 1TWFA 2R7ZA 1TWGA 1OGYA 5B6CA 2JA6A 5FTNA 5FTMA 2JIOA 3FKIA 1E60A 1SIWA 1TWAA 1CR5A 2R93A 4AAYA 1PQEA 3CQZA 2WB1A 1E61A 1Y1WA 3QQ8A 4AONB 5DYIA 1TWHA 2PMZA 2E2HA 2IV2X 4C2MA 1I50A 2NYAA 1WCMA 1KQGA 2JIPA 1G8JA 3IR7A 3GTLA 3QC8A 2DMRA 1E32A 3GTKA 3HU3A 1WLFA 4DMRA 1DMSA 5GLFA 1VC3B 3HU1A 3TM7B 2VPZA 5EPPA 1R7RA 3GTMA 1PT1A 2JA5A 1QCSA 5C18A 1KQFA 1R27A 2Y0SA 4D7ZB 3IR6A 1Y1VA 4KDLA 1E5VA 3TIWA 3GTOA 5T5ID 1SFOA 4AYBA 1H0HA 1CZ4A 2PJHB 2E7ZA 2B63A 1UHEA 2NAPA 3HU2A 1S3SA 1PPYA 1DMRA 1PYUB 2C45A 2JIRA 5FTJA 4KODA 1E18A 3CF2A 1UHDA 3H0GA 1PT0A 3IR5A 4AOKB 2E2IA 3PLXB 2R92A 1H5NA 2JIMA 3HKZA 3O5AA 2EEOB 5DYGA
chains in the Genus database with same CATH superfamily
3ML1A 2JIQA 3X2KA 1QDNA 4GA6A 1PQHA 1FDOA 2WAQA 4KO8A 4AZDA 4CS0A 2VPXA 2NVXA 1CZ5A 1TMOA 1Y5IA 5FTKA 1WC2A 1TWCA 5C1BA 3QQ7A 1IW7D 2V45A 4KLNA 2KI8A 3CZBA 3DMRA 3X2JA 1I3QA 2PNWA 1G8KA 3X2OA 3GTJA 2NVYA 2V3VA 3OUGA 1YNND 4L48A 3X2IA 1R9TA 1YLEA 2VPYA 5GM9A 2G6GA 2VUMA 2BE5D 4QIWA 2PJJA 5T5MD 1FDIA 4JP7A 4JJOA 4FFTA 4CRZA 1EU1A 3X2HA 5H4UA 1Y4ZA 3QWZA 1K83A 4RV0A 3SUKA 4ZM7A 3GTQA 3X2MA 2BH0A 4KDIA 2PICA 1AA6A 3GTGA 2JA7A 4GA5A 1PQFA 1SMYD 2VPWA 5FTLA 4CRYG 1HD5A 1AW8B 1PYQA 3GTPA 2YU9A 1Q16A 1TWFA 2R7ZA 1TWGA 1OGYA 4ENGA 1ZC1A 5B6CA 2JA6A 5FTNA 5FTMA 2JIOA 3FKIA 1E60A 1SIWA 1TWAA 1CR5A 2R93A 4JP6A 4AAYA 1PQEA 3CQZA 2WB1A 1E61A 2KQAA 1Y1WA 3QQ8A 4AONB 1ZYRD 1OA7A 2A6ED 3X2LA 5DYIA 1L8FA 1TWHA 2PMZA 2E2HA 2IV2X 2A68D 4C2MA 1I50A 2NYAA 1WCMA 2A6HD 1KQGA 2JIPA 4FG4A 3M3GA 1G8JA 4JCWA 3IR7A 2YUJA 2G5DA 3X2PA 1BW3A 3GTLA 2CW0D 4JS7A 3QC8A 2DMRA 1E32A 3GTKA 3HU3A 2ENGA 1WLFA 4DMRA 1DMSA 3SUJA 5GLFA 1VC3B 3HU1A 3TM7B 1OA9A 2O5JD 2VPZA 5EPPA 1R7RA 3GTMA 1PT1A 3X2NA 4NOHA 1N10A 4FG2A 2JA5A 2GAEA 1QCSA 3SULA 5C18A 1KQFA 1R27A 2Y0SA 4D7ZB 1Y1VA 3IR6A 4KDLA 3D30A 2A69D 1E5VA 3TIWA 3GTOA 5T5ID 1SFOA 2PI8A 4AYBA 1H0HA 2HCZX 1BW4A 1CZ4A 3SUMA 4FERA 2PJHB 2E7ZA 2B63A 2NAPA 1UHEA 3HU2A 1YNJD 1S3SA 1PPYA 2AE0X 1DMRA 1PYUB 4AVRA 2C45A 2JIRA 5FTJA 4KODA 1E18A 3CF2A 1UHDA 5GLXA 3H0GA 1PT0A 3X2GA 3IR5A 4AOKB 2E2IA 3ENGA 3PLXB 2R92A 1H5NA 2JIMA 3HKZA 3O5AA 2EEOB 5DYGA 5GLYA
chains in the Genus database with same CATH topology
3ML1A 2JIQA 1QDNA 4GA6A 1PQHA 1FDOA 2WAQA 4KO8A 4AZDA 4CS0A 2VPXA 2NVXA 1CZ5A 1TMOA 1Y5IA 5FTKA 1TWCA 5C1BA 3QQ7A 1IW7D 2V45A 4KLNA 2KI8A 3CZBA 3DMRA 1I3QA 2PNWA 1G8KA 3GTJA 2NVYA 2V3VA 3OUGA 1YNND 1R9TA 1YLEA 2VPYA 2G6GA 2VUMA 2BE5D 4QIWA 2PJJA 5T5MD 1FDIA 4CRZA 1EU1A 1Y4ZA 3QWZA 1K83A 4RV0A 3GTQA 4KDIA 2PICA 1AA6A 3GTGA 2JA7A 4GA5A 1PQFA 1SMYD 2VPWA 5FTLA 4CRYG 1AW8B 1PYQA 3GTPA 2YU9A 1Q16A 1TWFA 2R7ZA 1TWGA 1OGYA 1ZC1A 5B6CA 2JA6A 5FTNA 5FTMA 2JIOA 3FKIA 1E60A 1SIWA 1TWAA 1CR5A 2R93A 4AAYA 1PQEA 3CQZA 2WB1A 1E61A 1Y1WA 3QQ8A 4AONB 1ZYRD 2A6ED 5DYIA 1TWHA 2PMZA 2E2HA 2IV2X 2A68D 4C2MA 1I50A 2NYAA 1WCMA 2A6HD 1KQGA 2JIPA 1G8JA 3IR7A 2YUJA 2G5DA 3GTLA 2CW0D 3QC8A 2DMRA 1E32A 3GTKA 3HU3A 1WLFA 4DMRA 1DMSA 5GLFA 1VC3B 3HU1A 3TM7B 2O5JD 2VPZA 5EPPA 1R7RA 3GTMA 1PT1A 4NOHA 2JA5A 2GAEA 1QCSA 5C18A 1KQFA 1R27A 2Y0SA 4D7ZB 1Y1VA 3IR6A 4KDLA 2A69D 1E5VA 3TIWA 3GTOA 5T5ID 1SFOA 2PI8A 4AYBA 1H0HA 1CZ4A 2PJHB 2E7ZA 2B63A 1UHEA 2NAPA 3HU2A 1YNJD 1S3SA 1PPYA 2AE0X 1DMRA 1PYUB 2C45A 2JIRA 5FTJA 4KODA 1E18A 3CF2A 1UHDA 3H0GA 1PT0A 3IR5A 4AOKB 2E2IA 3PLXB 2R92A 1H5NA 2JIMA 3HKZA 3O5AA 2EEOB 5DYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML1 A;  2JIQ A;  1QDN A;  4GA6 A;  1PQH A;  1FDO A;  2WAQ A;  4KO8 A;  4AZD A;  4CS0 A;  2VPX A;  2NVX A;  1CZ5 A;  1TMO A;  1Y5I A;  5FTK A;  1TWC A;  5C1B A;  3QQ7 A;  1IW7 D;  2V45 A;  4KLN A;  2KI8 A;  3DMR A;  1I3Q A;  3GTJ A;  1G8K A;  2NVY A;  2V3V A;  3OUG A;  1R9T A;  1YLE A;  2VPY A;  2VUM A;  4QIW A;  5T5M D;  1FDI A;  4CRZ A;  1EU1 A;  1Y4Z A;  3QWZ A;  1K83 A;  4RV0 A;  3GTQ A;  4KDI A;  1AA6 A;  3GTG A;  2JA7 A;  4GA5 A;  1PQF A;  2VPW A;  5FTL A;  4CRY G;  1AW8 B;  1PYQ A;  3GTP A;  2YU9 A;  1Q16 A;  1TWF A;  2R7Z A;  1TWG A;  1OGY A;  5B6C A;  2JA6 A;  5FTN A;  5FTM A;  2JIO A;  3FKI A;  1E60 A;  1SIW A;  1TWA A;  1CR5 A;  2R93 A;  4AAY A;  1PQE A;  3CQZ A;  2WB1 A;  1E61 A;  1Y1W A;  3QQ8 A;  4AON B;  5DYI A;  1TWH A;  2PMZ A;  2E2H A;  2IV2 X;  4C2M A;  1I50 A;  2NYA A;  1WCM A;  1KQG A;  2JIP A;  1G8J A;  3IR7 A;  3GTL A;  3QC8 A;  2DMR A;  1E32 A;  3GTK A;  3HU3 A;  1WLF A;  4DMR A;  1DMS A;  5GLF A;  1VC3 B;  3HU1 A;  3TM7 B;  2VPZ A;  5EPP A;  1R7R A;  3GTM A;  1PT1 A;  2JA5 A;  1QCS A;  5C18 A;  1KQF A;  1R27 A;  2Y0S A;  4D7Z B;  3IR6 A;  1Y1V A;  4KDL A;  1E5V A;  3TIW A;  3GTO A;  5T5I D;  1SFO A;  4AYB A;  1H0H A;  1CZ4 A;  2PJH B;  2E7Z A;  2B63 A;  1UHE A;  2NAP A;  3HU2 A;  1S3S A;  1PPY A;  1DMR A;  1PYU B;  2C45 A;  2JIR A;  5FTJ A;  4KOD A;  1E18 A;  3CF2 A;  1UHD A;  3H0G A;  1PT0 A;  3IR5 A;  4AOK B;  2E2I A;  3PLX B;  2R92 A;  1H5N A;  2JIM A;  3HKZ A;  3O5A A;  2EEO B;  5DYG A; 
#chains in the Genus database with same CATH topology
 3ML1 A;  2JIQ A;  3X2K A;  1QDN A;  4GA6 A;  1PQH A;  1FDO A;  2WAQ A;  4KO8 A;  4AZD A;  4CS0 A;  2VPX A;  2NVX A;  1CZ5 A;  1TMO A;  1Y5I A;  5FTK A;  1WC2 A;  1TWC A;  5C1B A;  3QQ7 A;  1IW7 D;  2V45 A;  4KLN A;  2KI8 A;  3CZB A;  3DMR A;  3X2J A;  1I3Q A;  2PNW A;  1G8K A;  3X2O A;  3GTJ A;  2NVY A;  2V3V A;  3OUG A;  1YNN D;  4L48 A;  3X2I A;  1R9T A;  1YLE A;  2VPY A;  5GM9 A;  2G6G A;  2VUM A;  2BE5 D;  4QIW A;  2PJJ A;  5T5M D;  1FDI A;  4JP7 A;  4JJO A;  4FFT A;  4CRZ A;  1EU1 A;  3X2H A;  5H4U A;  1Y4Z A;  3QWZ A;  1K83 A;  4RV0 A;  3SUK A;  4ZM7 A;  3GTQ A;  3X2M A;  2BH0 A;  4KDI A;  2PIC A;  1AA6 A;  3GTG A;  2JA7 A;  4GA5 A;  1PQF A;  1SMY D;  2VPW A;  5FTL A;  4CRY G;  1HD5 A;  1AW8 B;  1PYQ A;  3GTP A;  2YU9 A;  1Q16 A;  1TWF A;  2R7Z A;  1TWG A;  1OGY A;  4ENG A;  1ZC1 A;  5B6C A;  2JA6 A;  5FTN A;  5FTM A;  2JIO A;  3FKI A;  1E60 A;  1SIW A;  1TWA A;  1CR5 A;  2R93 A;  4JP6 A;  4AAY A;  1PQE A;  3CQZ A;  2WB1 A;  1E61 A;  2KQA A;  1Y1W A;  3QQ8 A;  4AON B;  1ZYR D;  1OA7 A;  2A6E D;  3X2L A;  5DYI A;  1L8F A;  1TWH A;  2PMZ A;  2E2H A;  2IV2 X;  2A68 D;  4C2M A;  1I50 A;  2NYA A;  1WCM A;  2A6H D;  1KQG A;  2JIP A;  4FG4 A;  3M3G A;  1G8J A;  4JCW A;  3IR7 A;  2YUJ A;  2G5D A;  3X2P A;  1BW3 A;  3GTL A;  2CW0 D;  4JS7 A;  3QC8 A;  2DMR A;  1E32 A;  3GTK A;  3HU3 A;  2ENG A;  1WLF A;  4DMR A;  1DMS A;  3SUJ A;  5GLF A;  1VC3 B;  3HU1 A;  3TM7 B;  1OA9 A;  2O5J D;  2VPZ A;  5EPP A;  1R7R A;  3GTM A;  1PT1 A;  3X2N A;  4NOH A;  1N10 A;  4FG2 A;  2JA5 A;  2GAE A;  1QCS A;  3SUL A;  5C18 A;  1KQF A;  1R27 A;  2Y0S A;  4D7Z B;  1Y1V A;  3IR6 A;  4KDL A;  3D30 A;  2A69 D;  1E5V A;  3TIW A;  3GTO A;  5T5I D;  1SFO A;  2PI8 A;  4AYB A;  1H0H A;  2HCZ X;  1BW4 A;  1CZ4 A;  3SUM A;  4FER A;  2PJH B;  2E7Z A;  2B63 A;  2NAP A;  1UHE A;  3HU2 A;  1YNJ D;  1S3S A;  1PPY A;  2AE0 X;  1DMR A;  1PYU B;  4AVR A;  2C45 A;  2JIR A;  5FTJ A;  4KOD A;  1E18 A;  3CF2 A;  1UHD A;  5GLX A;  3H0G A;  1PT0 A;  3X2G A;  3IR5 A;  4AOK B;  2E2I A;  3ENG A;  3PLX B;  2R92 A;  1H5N A;  2JIM A;  3HKZ A;  3O5A A;  2EEO B;  5DYG A;  5GLY A; 
#chains in the Genus database with same CATH homology
 3ML1 A;  2JIQ A;  1QDN A;  4GA6 A;  1PQH A;  1FDO A;  2WAQ A;  4KO8 A;  4AZD A;  4CS0 A;  2VPX A;  2NVX A;  1CZ5 A;  1TMO A;  1Y5I A;  5FTK A;  1TWC A;  5C1B A;  3QQ7 A;  1IW7 D;  2V45 A;  4KLN A;  2KI8 A;  3CZB A;  3DMR A;  1I3Q A;  2PNW A;  1G8K A;  3GTJ A;  2NVY A;  2V3V A;  3OUG A;  1YNN D;  1R9T A;  1YLE A;  2VPY A;  2G6G A;  2VUM A;  2BE5 D;  4QIW A;  2PJJ A;  5T5M D;  1FDI A;  4CRZ A;  1EU1 A;  1Y4Z A;  3QWZ A;  1K83 A;  4RV0 A;  3GTQ A;  4KDI A;  2PIC A;  1AA6 A;  3GTG A;  2JA7 A;  4GA5 A;  1PQF A;  1SMY D;  2VPW A;  5FTL A;  4CRY G;  1AW8 B;  1PYQ A;  3GTP A;  2YU9 A;  1Q16 A;  1TWF A;  2R7Z A;  1TWG A;  1OGY A;  1ZC1 A;  5B6C A;  2JA6 A;  5FTN A;  5FTM A;  2JIO A;  3FKI A;  1E60 A;  1SIW A;  1TWA A;  1CR5 A;  2R93 A;  4AAY A;  1PQE A;  3CQZ A;  2WB1 A;  1E61 A;  1Y1W A;  3QQ8 A;  4AON B;  1ZYR D;  2A6E D;  5DYI A;  1TWH A;  2PMZ A;  2E2H A;  2IV2 X;  2A68 D;  4C2M A;  1I50 A;  2NYA A;  1WCM A;  2A6H D;  1KQG A;  2JIP A;  1G8J A;  3IR7 A;  2YUJ A;  2G5D A;  3GTL A;  2CW0 D;  3QC8 A;  2DMR A;  1E32 A;  3GTK A;  3HU3 A;  1WLF A;  4DMR A;  1DMS A;  5GLF A;  1VC3 B;  3HU1 A;  3TM7 B;  2O5J D;  2VPZ A;  5EPP A;  1R7R A;  3GTM A;  1PT1 A;  4NOH A;  2JA5 A;  2GAE A;  1QCS A;  5C18 A;  1KQF A;  1R27 A;  2Y0S A;  4D7Z B;  1Y1V A;  3IR6 A;  4KDL A;  2A69 D;  1E5V A;  3TIW A;  3GTO A;  5T5I D;  1SFO A;  2PI8 A;  4AYB A;  1H0H A;  1CZ4 A;  2PJH B;  2E7Z A;  2B63 A;  1UHE A;  2NAP A;  3HU2 A;  1YNJ D;  1S3S A;  1PPY A;  2AE0 X;  1DMR A;  1PYU B;  2C45 A;  2JIR A;  5FTJ A;  4KOD A;  1E18 A;  3CF2 A;  1UHD A;  3H0G A;  1PT0 A;  3IR5 A;  4AOK B;  2E2I A;  3PLX B;  2R92 A;  1H5N A;  2JIM A;  3HKZ A;  3O5A A;  2EEO B;  5DYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...