1FAKL

Human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
RTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of extracellular tissue factor complexed with factor VIIa inhibited with a BPTI mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords PROTEIN (BLOOD COAGULATION FACTOR VIIA)
total genus 24
structure length 108
sequence length 108
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 1998-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1fakL02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1fakL01
3LC3B 5EGMB 1XDTR 1TOZA 3FFGL 4BXWA 1HT8A 5L2YL 1DVAL 1KLJL 1LPKA 5JB8E 1FJSL 3N8YB 4Y76B 3KK6A 4D90A 2WPHE 3ENSA 3F6UL 4YT6L 2I9AA 2W3KB 2FLGA 2RA0L 2Y5FL 5E8DA 2XC4L 3LTGD 2VWLL 3LC5B 3OLUA 3NTGA 1G2LB 3ZYJB 1IQLL 2BOXA 5CKNA 3NJPC 1IQFL 4A7IA 1L3YA 1PRHA 3POYA 1IQML 1K36A 4Z6AL 2MGRA 5JBAE 1XKAL 2EI6B 3V65B 2K2TA 2VWOL 3K9XA 2WPLE 2W2NE 1SZBA 2Y82B 4RUTA 2P26A 3TGFA 3HO4A 3Q3KB 4Y71B 2P3TA 3ZYIB 4MMYB 2Y5GL 3GCXE 2FLBL 4CSYA 1MQ5L 2P93L 1FFMA 3LAQA 3U7UG 3EGFA 1DIYA 2XC5L 1P9JA 4AQTA 1V3XB 4Y6DB 1JV2B 2P94L 3HS5A 1U8CB 2J2UB 1CX2A 2Y38A 1ATAA 1IQEL 2EI8B 4ZHAB 4YT7L 1IGZA 2PHBB 2D1JB 3H5CB 3HO5A 4D0FA 1F7MA 2MHPA 3FCSB 5L2ZL 1EBVA 1ZAQA 5JBBE 2Y7ZB 4E1GA 4X8UL 1P0SL 4BXSA 2KV4A 1UZJA 1WHFA 1NFYB 3ZYGA 4CUEA 3HPTA 1HREA 5JVYA 1EPIA 4ZXXL 4G1MB 4D0EA 3KCGL 1CCFA 2XC0L 4LORA 1GK5A 1IVOC 2VWMK 2W2ME 4X8VL 1L5GB 1EPJA 1EPHA 4OTJA 1K37A 3M36L 3N8ZA 2BOUA 2FZZL 4XLWA 3TBDA 2PUQL 2VWNL 4RRWA 1C5MF 3MDLA 1HX2A 5JW1A 2P95L 1KSNB 1LMJA 3SOBB 2Y7XB 2FLRL 1TPGA 4O1ZA 2Y80B 6COXA 1BF9A 1XFEA 4XBMA 5FDQA 2BQWA 1EMOA 1OB1C 1KLOA 1I0UA 2J34B 1A3PA 1PGEA 2K2SB 4PH9A 3ASIA 2P3FL 1TLEA 4X8SL 1KLIL 1IOXA 2ADXA 1FAXL 4RRZA 1CVWL 5JVZA 3QCWA 4LMFA 1X7AL 4JZFL 1ATBA 2TGFA 3BPSE 1F0RB 4Y7AB 1UZKA 5IKRA 5IKTA 1IQJL 2VVVL 1IQGL 2NPRA 3GISX 3IJEB 1Z6CA 2KB9A 1RFNB 4XL1A 4TGFA 2RHPA 3ELAL 4CUDA 1WHEA 1IP0A 4OTYA 3SOQA 2OYUP 1Z6EL 2KL7A 1EAIC 1N1IA 2OYEP 1W8BL 2G00L 4ISHL 2W3IB 2BZ6L 4O02B 2BOHA 1YUGA 3QMOA 1CQEA 1ADXA 4M11A 5IKQA 1IQHL 2P28B 3CENL 1ATEA 2W2QE 3KQCL 3NT1A 3KL6B 5COXA 1MQ6L 1CCVA 2WG4B 1G1TA 2UWLB 2WYJB 2VJ3A 1YUKB 2BMGA 3N8WB 4RRXA 2XBYL 2J94B 1N7DA 4Y79B 1G2MB 1NT0A 1DX5I 2XBXL 5F19A 5K0HB 3QH0A 4MMZB 3N8YA 3U73A 3V64C 1DQBA 1HAEA 1IJQA 1NFXB 2YGPA 1PTHA 1NFWB 1JL9A 5JBCE 5I46L 3IITB 1MOXC 3HS6A 4ZAEB 4ZH8B 3KQBL 4BDXA 1DDXA 2B7DL 3N8XA 3HS7A 3LIWB 4NGAL 2I9BA 2VVCK 1KIGL 3Q7DA 3SOVA 1FE2A 2BO2A 3DEMA 1LPGA 4JYUL 1COUA 1B9WA 2CJIB 3BT1A 3TH3L 1AUTL 3OLTA 4JZEL 4BTIA 1EQHA 2RNLA 5KIRA 2BQ7A 3R05A 2FD6A 5KN5C 1HCGB 5CISA 1URKA 1O5DL 1NFUB 1G1SA 2W2OE 2WFTA 2JKHL 3N8WA 1F7EA 2P3FN 1IQNL 1HZ8A 2WPIE 5F1AA 5JB9E 3FBYA 1YGCL 1Q4GA 1YUFA 1CEJA 4BTUA 2AYLA 4RS0A 3TZIA 1APOA 5L30L 4ISIL 1HJ7A 2WG3C 2H9EL 3N8VA 2P3UA 4NA9L 2Y81B 5CKQA 3F1SB 2VVUL 2UWOB 4Z0KB 1PFXL 1ATDA 3P5BL 3GCWE 3LN0A 2BOKL 4BTTA 4JYVL 3C9AC 1EZQB 1W7XL 1PXXA 1EQGA 1J9CL 3KRKA 3MQEA 1FF7A 1IQKL 3PGHA 4JZDL 4COXA 1CVUA 1IGXA 3TK5B 3M37L 1IOEL 1JBUL 1FAKL 2GD4A 3CA7A 2Q1JB 2BQ6A 1UZQA 3KQDL 2EI7B 2UWPB 3LTFB 4C16A 1F0SB 5IKVA 2W2PE 1HT5A 2WPME 1APQA 4RRYA 4MMXB 1HAFA 1LPZA 4NG9L 1LQDA 4BDWA 1NPEB 3CS7L 2WFXB 4YZUB 1NZIA 1NQLB 4X8TL 1UZPA 2Y5HL 3LN1A 2WYGB 1EMNA 1QFKL 2M74A 2YGOA 3NTBA 2WPJE 2MGPA 4CUFA 3CFWA 1XKBA 2VH6B 4Z0LA 5CKMA 2WPKE 2DDUA 1FSBA 2J38B 2W86A 1YO8A 2F9BL 1M1XB 4FM5A 4ZXYL 1WU1B 1G1RA 3KQEL 3SW2A 2J4IB 2VH0B 1EGFA 2J95B 1EPGA 2XBWL 2P16L 2PR3B 1IQIL 3TK6B 3RR3A 1HRFA 1G1QA 3BT2A 4M10A 2W26B 4Y7BB 3HO3A 1U67A 2XBVL
chains in the Genus database with same CATH superfamily
3LC3B 5EGMB 1XDTR 1TOZA 3FFGL 4BXWA 1HT8A 5L2YL 1DVAL 1KLJL 1LPKA 5JB8E 1FJSL 3N8YB 4Y76B 3KK6A 4D90A 2WPHE 3ENSA 3F6UL 4YT6L 2I9AA 2W3KB 2FLGA 2RA0L 2Y5FL 5E8DA 1LK9A 2XC4L 3LTGD 2VWLL 3LC5B 2BT8A 3OLUA 3NTGA 1G2LB 3ZYJB 1IQLL 2BOXA 5CKNA 3NJPC 1IQFL 4A7IA 1L3YA 1PRHA 3POYA 1IQML 1V1IA 1K36A 4Z6AL 2H9EC 2MGRA 5JBAE 1XKAL 2EI6B 3V65B 2K2TA 2VWOL 3K9XA 2WPLE 2W2NE 1SZBA 2Y82B 4RUTA 2P26A 3TGFA 3HO4A 3Q3KB 4Y71B 2P3TA 3ZYIB 4MMYB 2Y5GL 3GCXE 2FLBL 4CSYA 1MQ5L 2P93L 1FFMA 3LAQA 3U7UG 3EGFA 1DIYA 2XC5L 1P9JA 1LMMA 4AQTA 1V3XB 4Y6DB 1JV2B 2P94L 3HS5A 2HOXA 1U8CB 2J2UB 1CX2A 2Y38A 1ATAA 1IQEL 2EI8B 4ZHAB 4YT7L 1IGZA 2PHBB 2D1JB 3H5CB 3HO5A 4D0FA 1F7MA 2MHPA 3FCSB 5L2ZL 1EBVA 1ZAQA 5JBBE 2Y7ZB 4E1GA 4X8UL 1P0SL 4BXSA 2KV4A 2WZPP 1UZJA 1WHFA 1NFYB 3ZYGA 4CUEA 3HPTA 1HREA 5JVYA 1EPIA 4ZXXL 4G1MB 4D0EA 3KCGL 1CCFA 2XC0L 4LORA 1GK5A 1IVOC 2VWMK 2W2ME 4X8VL 1L5GB 1EPJA 1EPHA 1KKEA 4OTJA 1K37A 3M36L 3N8ZA 2BOUA 2FZZL 4A94C 4XLWA 3TBDA 2PUQL 2VWNL 4RRWA 1C5MF 3MDLA 1HX2A 5JW1A 2P95L 1KSNB 1LMJA 3SOBB 2Y7XB 2FLRL 1TPGA 4O1ZA 2Y80B 6COXA 1BF9A 1XFEA 4XBMA 5FDQA 2BQWA 1EMOA 1OB1C 1KLOA 1I0UA 2J34B 2BT7A 1A3PA 1PGEA 2K2SB 4PH9A 3ASIA 2P3FL 1TLEA 4X8SL 1KLIL 1IOXA 2ADXA 1FAXL 4RRZA 1CVWL 5JVZA 3QCWA 4LMFA 1X7AL 4JZFL 1ATBA 2TGFA 3S6XA 3BPSE 1F0RB 4Y7AB 1UZKA 5IKRA 5IKTA 1IQJL 2VVVL 1IQGL 2NPRA 3GISX 3IJEB 1Z6CA 2KB9A 1RFNB 4XL1A 4TGFA 2RHPA 3ELAL 4CUDA 1WHEA 1IP0A 4OTYA 3SOQA 2OYUP 1Z6EL 2KL7A 1EAIC 1N1IA 2OYEP 1W8BL 2G00L 4ISHL 2W3IB 2BZ6L 4O02B 2YGQA 2BOHA 1YUGA 2JJLA 3QMOA 1CQEA 1ADXA 4M11A 5IKQA 1IQHL 2P28B 3CENL 1ATEA 2W2QE 3KQCL 3NT1A 3KL6B 5COXA 1MQ6L 1CCVA 2WG4B 1G1TA 2UWLB 2WYJB 2VJ3A 1YUKB 2BMGA 3N8WB 4RRXA 2XBYL 2J94B 1N7DA 4Y79B 1G2MB 2BSFA 1QIUA 1NT0A 1DX5I 2XBXL 5F19A 5K0HB 3QH0A 4MMZB 3N8YA 3U73A 3V64C 1DQBA 1HAEA 1IJQA 4GU4A 1NFXB 2YGPA 1PTHA 1NFWB 1JL9A 5JBCE 5I46L 3IITB 1MOXC 3HS6A 4ZAEB 4ZH8B 3KQBL 4BDXA 1DDXA 2B7DL 3N8XA 3HS7A 3LIWB 4NGAL 2I9BA 2VVCK 1KIGL 3Q7DA 3SOVA 1FE2A 2BO2A 3DEMA 1LPGA 4JYUL 1COUA 1B9WA 2CJIB 3BT1A 3TH3L 1AUTL 3OLTA 4JZEL 4BTIA 1EQHA 2RNLA 5KIRA 2BQ7A 3R05A 2FD6A 5KN5C 1HCGB 5CISA 1URKA 1O5DL 1NFUB 1G1SA 2W2OE 3N8WA 2JKHL 2WFTA 1F7EA 2P3FN 1IQNL 1HZ8A 2WPIE 5F1AA 5JB9E 3FBYA 1YGCL 1Q4GA 1YUFA 1CEJA 4BTUA 2AYLA 4RS0A 3TZIA 1APOA 5L30L 4ISIL 1HJ7A 2WG3C 2H9EL 3N8VA 2P3UA 4NA9L 2Y81B 5CKQA 3F1SB 2VVUL 2UWOB 4Z0KB 1PFXL 1ATDA 3P5BL 3GCWE 3LN0A 2BOKL 4BTTA 4JYVL 3C9AC 1EZQB 1W7XL 1PXXA 1EQGA 1J9CL 3KRKA 3MQEA 1FF7A 1IQKL 3PGHA 4JZDL 4COXA 1CVUA 1IGXA 3TK5B 3M37L 1IOEL 1JBUL 1FAKL 2GD4A 3CA7A 2Q1JB 2BQ6A 1UZQA 4GU3A 3KQDL 2EI7B 2UWPB 3LTFB 4C16A 1F0SB 5IKVA 2W2PE 1HT5A 2WPME 1APQA 4RRYA 4MMXB 1HAFA 1LPZA 4NG9L 1LQDA 4BDWA 1NPEB 3CS7L 2WFXB 4YZUB 1NZIA 2HORA 1NQLB 4X8TL 1UZPA 2Y5HL 3LN1A 2WYGB 1EMNA 2VRSA 1QFKL 2M74A 2YGOA 3NTBA 2WPJE 2MGPA 4CUFA 3CFWA 1XKBA 2VH6B 4Z0LA 5CKMA 2WPKE 2DDUA 1FSBA 2J38B 2W86A 1YO8A 1V1HA 2F9BL 1M1XB 4FM5A 4ZXYL 1WU1B 1G1RA 3KQEL 3SW2A 2J4IB 2VH0B 1EGFA 2J95B 1EPGA 2XBWL 2P16L 2PR3B 1IQIL 3TK6B 3RR3A 1HRFA 1G1QA 2KNIA 3BT2A 4M10A 2W26B 4Y7BB 3HO3A 1U67A 2XBVL
chains in the Genus database with same CATH topology
3LC3B 5EGMB 1XDTR 1TOZA 3FFGL 4BXWA 1HT8A 5L2YL 1DVAL 1KLJL 1LPKA 5JB8E 1FJSL 3N8YB 4Y76B 3KK6A 4D90A 2WPHE 3ENSA 3F6UL 4YT6L 2I9AA 2W3KB 2FLGA 2RA0L 2Y5FL 5E8DA 2XC4L 3LTGD 2VWLL 3LC5B 3OLUA 3NTGA 1G2LB 3ZYJB 1IQLL 2BOXA 5CKNA 3NJPC 1IQFL 4A7IA 1L3YA 1PRHA 3POYA 1IQML 1K36A 4Z6AL 2H9EC 2MGRA 5JBAE 1XKAL 2EI6B 3V65B 2K2TA 2VWOL 3K9XA 2WPLE 2W2NE 1SZBA 2Y82B 4RUTA 2P26A 3TGFA 3HO4A 3Q3KB 4Y71B 2P3TA 3ZYIB 4MMYB 2Y5GL 3GCXE 2FLBL 4CSYA 1MQ5L 2P93L 1FFMA 3LAQA 3U7UG 3EGFA 1DIYA 2XC5L 1P9JA 1LMMA 4AQTA 1V3XB 4Y6DB 1JV2B 2P94L 3HS5A 1U8CB 2J2UB 1CX2A 2Y38A 1ATAA 1IQEL 2EI8B 4ZHAB 4YT7L 1IGZA 2PHBB 2D1JB 3H5CB 3HO5A 4D0FA 1F7MA 2MHPA 3FCSB 5L2ZL 1EBVA 1ZAQA 5JBBE 2Y7ZB 4E1GA 4X8UL 1P0SL 4BXSA 2KV4A 2WZPP 1UZJA 1WHFA 1NFYB 3ZYGA 4CUEA 3HPTA 1HREA 5JVYA 1EPIA 4ZXXL 4G1MB 4D0EA 3KCGL 1CCFA 2XC0L 4LORA 1GK5A 1IVOC 2VWMK 2W2ME 4X8VL 1L5GB 1EPJA 1EPHA 4OTJA 1K37A 3M36L 3N8ZA 2BOUA 2FZZL 4A94C 4XLWA 3TBDA 2PUQL 2VWNL 4RRWA 1C5MF 3MDLA 1HX2A 5JW1A 2P95L 1KSNB 1LMJA 3SOBB 2Y7XB 2FLRL 1TPGA 4O1ZA 2Y80B 6COXA 1BF9A 1XFEA 4XBMA 5FDQA 2BQWA 1EMOA 1OB1C 1KLOA 1I0UA 2J34B 1A3PA 1PGEA 2K2SB 4PH9A 3ASIA 2P3FL 1TLEA 4X8SL 1KLIL 1IOXA 2ADXA 1FAXL 4RRZA 1CVWL 5JVZA 3QCWA 4LMFA 1X7AL 4JZFL 1ATBA 2TGFA 3S6XA 3BPSE 1F0RB 4Y7AB 1UZKA 5IKRA 5IKTA 1IQJL 2VVVL 1IQGL 2NPRA 3GISX 3IJEB 1Z6CA 2KB9A 1RFNB 4XL1A 4TGFA 2RHPA 3ELAL 4CUDA 1WHEA 1IP0A 4OTYA 3SOQA 2OYUP 1Z6EL 2KL7A 1EAIC 1N1IA 2OYEP 1W8BL 2G00L 4ISHL 2W3IB 2BZ6L 4O02B 2YGQA 2BOHA 1YUGA 3QMOA 1CQEA 1ADXA 4M11A 5IKQA 1IQHL 2P28B 3CENL 1ATEA 2W2QE 3KQCL 3NT1A 3KL6B 5COXA 1MQ6L 1CCVA 2WG4B 1G1TA 2UWLB 2WYJB 2VJ3A 1YUKB 2BMGA 3N8WB 4RRXA 2XBYL 2J94B 1N7DA 4Y79B 1G2MB 1NT0A 1DX5I 2XBXL 5F19A 5K0HB 3QH0A 4MMZB 3N8YA 3U73A 3V64C 1DQBA 1HAEA 1IJQA 1NFXB 2YGPA 1PTHA 1NFWB 1JL9A 5JBCE 5I46L 3IITB 1MOXC 3HS6A 4ZAEB 4ZH8B 3KQBL 4BDXA 1DDXA 2B7DL 3N8XA 3HS7A 3LIWB 4NGAL 2I9BA 2VVCK 1KIGL 3Q7DA 3SOVA 1FE2A 2BO2A 3DEMA 1LPGA 4JYUL 1COUA 1B9WA 2CJIB 3BT1A 3TH3L 1AUTL 3OLTA 4JZEL 4BTIA 1EQHA 2RNLA 5KIRA 2BQ7A 3R05A 2FD6A 5KN5C 1HCGB 5CISA 1URKA 1O5DL 1NFUB 1G1SA 2W2OE 2WFTA 2JKHL 3N8WA 1F7EA 2P3FN 1IQNL 1HZ8A 2WPIE 5F1AA 5JB9E 3FBYA 1YGCL 1Q4GA 1YUFA 1CEJA 4BTUA 2AYLA 4RS0A 3TZIA 1APOA 5L30L 4ISIL 1HJ7A 2WG3C 2H9EL 3N8VA 2P3UA 4NA9L 2Y81B 5CKQA 3F1SB 2VVUL 2UWOB 4Z0KB 1PFXL 1ATDA 3P5BL 3GCWE 3LN0A 2BOKL 4BTTA 4JYVL 3C9AC 1EZQB 1W7XL 1PXXA 1EQGA 1J9CL 3KRKA 3MQEA 1FF7A 1IQKL 3PGHA 4JZDL 4COXA 1CVUA 1IGXA 3TK5B 3M37L 1IOEL 1JBUL 1FAKL 2GD4A 3CA7A 2Q1JB 2BQ6A 1UZQA 3KQDL 2EI7B 2UWPB 3LTFB 4C16A 1F0SB 5IKVA 2W2PE 1HT5A 2WPME 1APQA 4RRYA 4MMXB 1HAFA 1LPZA 4NG9L 1LQDA 4BDWA 1NPEB 3CS7L 2WFXB 4YZUB 1NZIA 1NQLB 4X8TL 1UZPA 2Y5HL 3LN1A 2WYGB 1EMNA 1QFKL 2M74A 2YGOA 3NTBA 2WPJE 2MGPA 4CUFA 3CFWA 1XKBA 2VH6B 4Z0LA 5CKMA 2WPKE 2DDUA 1FSBA 2J38B 2W86A 1YO8A 2F9BL 1M1XB 4FM5A 4ZXYL 1WU1B 1G1RA 3KQEL 3SW2A 2J4IB 2VH0B 1EGFA 2J95B 1EPGA 2XBWL 2P16L 2PR3B 1IQIL 3TK6B 3RR3A 1HRFA 1G1QA 2KNIA 3BT2A 4M10A 2W26B 4Y7BB 3HO3A 1U67A 2XBVL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LC3 B;  5EGM B;  1XDT R;  1TOZ A;  3FFG L;  4BXW A;  1HT8 A;  5L2Y L;  1DVA L;  1KLJ L;  1LPK A;  5JB8 E;  1FJS L;  3N8Y B;  4Y76 B;  3KK6 A;  4D90 A;  2WPH E;  3ENS A;  3F6U L;  4YT6 L;  2I9A A;  2W3K B;  2FLG A;  2RA0 L;  2Y5F L;  5E8D A;  2XC4 L;  3LTG D;  2VWL L;  3LC5 B;  3OLU A;  3NTG A;  1G2L B;  3ZYJ B;  1IQL L;  2BOX A;  5CKN A;  3NJP C;  1IQF L;  4A7I A;  1L3Y A;  1PRH A;  3POY A;  1IQM L;  1K36 A;  4Z6A L;  2MGR A;  5JBA E;  1XKA L;  2EI6 B;  3V65 B;  2K2T A;  2VWO L;  3K9X A;  2WPL E;  2W2N E;  1SZB A;  2Y82 B;  4RUT A;  2P26 A;  3TGF A;  3HO4 A;  3Q3K B;  4Y71 B;  2P3T A;  3ZYI B;  4MMY B;  2Y5G L;  3GCX E;  2FLB L;  4CSY A;  1MQ5 L;  2P93 L;  1FFM A;  3LAQ A;  3U7U G;  3EGF A;  1DIY A;  2XC5 L;  1P9J A;  4AQT A;  1V3X B;  4Y6D B;  1JV2 B;  2P94 L;  3HS5 A;  1U8C B;  2J2U B;  1CX2 A;  2Y38 A;  1ATA A;  1IQE L;  2EI8 B;  4ZHA B;  4YT7 L;  1IGZ A;  2PHB B;  2D1J B;  3H5C B;  3HO5 A;  4D0F A;  1F7M A;  2MHP A;  3FCS B;  5L2Z L;  1EBV A;  1ZAQ A;  5JBB E;  2Y7Z B;  4E1G A;  4X8U L;  1P0S L;  4BXS A;  2KV4 A;  1UZJ A;  1WHF A;  1NFY B;  3ZYG A;  4CUE A;  3HPT A;  1HRE A;  5JVY A;  1EPI A;  4ZXX L;  4G1M B;  4D0E A;  3KCG L;  1CCF A;  2XC0 L;  4LOR A;  1GK5 A;  1IVO C;  2VWM K;  2W2M E;  4X8V L;  1L5G B;  1EPJ A;  1EPH A;  4OTJ A;  1K37 A;  3M36 L;  3N8Z A;  2BOU A;  2FZZ L;  4XLW A;  3TBD A;  2PUQ L;  2VWN L;  4RRW A;  1C5M F;  3MDL A;  1HX2 A;  5JW1 A;  2P95 L;  1KSN B;  1LMJ A;  3SOB B;  2Y7X B;  2FLR L;  1TPG A;  4O1Z A;  2Y80 B;  6COX A;  1BF9 A;  1XFE A;  4XBM A;  5FDQ A;  2BQW A;  1EMO A;  1OB1 C;  1KLO A;  1I0U A;  2J34 B;  1A3P A;  1PGE A;  2K2S B;  4PH9 A;  3ASI A;  2P3F L;  1TLE A;  4X8S L;  1KLI L;  1IOX A;  2ADX A;  1FAX L;  4RRZ A;  1CVW L;  5JVZ A;  3QCW A;  4LMF A;  1X7A L;  4JZF L;  1ATB A;  2TGF A;  3BPS E;  1F0R B;  4Y7A B;  1UZK A;  5IKR A;  5IKT A;  1IQJ L;  2VVV L;  1IQG L;  2NPR A;  3GIS X;  3IJE B;  1Z6C A;  2KB9 A;  1RFN B;  4XL1 A;  4TGF A;  2RHP A;  3ELA L;  4CUD A;  1WHE A;  1IP0 A;  4OTY A;  3SOQ A;  2OYU P;  1Z6E L;  2KL7 A;  1EAI C;  1N1I A;  2OYE P;  1W8B L;  2G00 L;  4ISH L;  2W3I B;  2BZ6 L;  4O02 B;  2BOH A;  1YUG A;  3QMO A;  1CQE A;  1ADX A;  4M11 A;  5IKQ A;  1IQH L;  2P28 B;  3CEN L;  1ATE A;  2W2Q E;  3KQC L;  3NT1 A;  3KL6 B;  5COX A;  1MQ6 L;  1CCV A;  2WG4 B;  1G1T A;  2UWL B;  2WYJ B;  2VJ3 A;  1YUK B;  2BMG A;  3N8W B;  4RRX A;  2XBY L;  2J94 B;  1N7D A;  4Y79 B;  1G2M B;  1NT0 A;  1DX5 I;  2XBX L;  5F19 A;  5K0H B;  3QH0 A;  4MMZ B;  3N8Y A;  3U73 A;  3V64 C;  1DQB A;  1HAE A;  1IJQ A;  1NFX B;  2YGP A;  1PTH A;  1NFW B;  1JL9 A;  5JBC E;  5I46 L;  3IIT B;  1MOX C;  3HS6 A;  4ZAE B;  4ZH8 B;  3KQB L;  4BDX A;  1DDX A;  2B7D L;  3N8X A;  3HS7 A;  3LIW B;  4NGA L;  2I9B A;  2VVC K;  1KIG L;  3Q7D A;  3SOV A;  1FE2 A;  2BO2 A;  3DEM A;  1LPG A;  4JYU L;  1COU A;  1B9W A;  2CJI B;  3BT1 A;  3TH3 L;  1AUT L;  3OLT A;  4JZE L;  4BTI A;  1EQH A;  2RNL A;  5KIR A;  2BQ7 A;  3R05 A;  2FD6 A;  5KN5 C;  1HCG B;  5CIS A;  1URK A;  1O5D L;  1NFU B;  1G1S A;  2W2O E;  2WFT A;  2JKH L;  3N8W A;  1F7E A;  2P3F N;  1IQN L;  1HZ8 A;  2WPI E;  5F1A A;  5JB9 E;  3FBY A;  1YGC L;  1Q4G A;  1YUF A;  1CEJ A;  4BTU A;  2AYL A;  4RS0 A;  3TZI A;  1APO A;  5L30 L;  4ISI L;  1HJ7 A;  2WG3 C;  2H9E L;  3N8V A;  2P3U A;  4NA9 L;  2Y81 B;  5CKQ A;  3F1S B;  2VVU L;  2UWO B;  4Z0K B;  1PFX L;  1ATD A;  3P5B L;  3GCW E;  3LN0 A;  2BOK L;  4BTT A;  4JYV L;  3C9A C;  1EZQ B;  1W7X L;  1PXX A;  1EQG A;  1J9C L;  3KRK A;  3MQE A;  1FF7 A;  1IQK L;  3PGH A;  4JZD L;  4COX A;  1CVU A;  1IGX A;  3TK5 B;  3M37 L;  1IOE L;  1JBU L;  1FAK L;  2GD4 A;  3CA7 A;  2Q1J B;  2BQ6 A;  1UZQ A;  3KQD L;  2EI7 B;  2UWP B;  3LTF B;  4C16 A;  1F0S B;  5IKV A;  2W2P E;  1HT5 A;  2WPM E;  1APQ A;  4RRY A;  4MMX B;  1HAF A;  1LPZ A;  4NG9 L;  1LQD A;  4BDW A;  1NPE B;  3CS7 L;  2WFX B;  4YZU B;  1NZI A;  1NQL B;  4X8T L;  1UZP A;  2Y5H L;  3LN1 A;  2WYG B;  1EMN A;  1QFK L;  2M74 A;  2YGO A;  3NTB A;  2WPJ E;  2MGP A;  4CUF A;  3CFW A;  1XKB A;  2VH6 B;  4Z0L A;  5CKM A;  2WPK E;  2DDU A;  1FSB A;  2J38 B;  2W86 A;  1YO8 A;  2F9B L;  1M1X B;  4FM5 A;  4ZXY L;  1WU1 B;  1G1R A;  3KQE L;  3SW2 A;  2J4I B;  2VH0 B;  1EGF A;  2J95 B;  1EPG A;  2XBW L;  2P16 L;  2PR3 B;  1IQI L;  3TK6 B;  3RR3 A;  1HRF A;  1G1Q A;  3BT2 A;  4M10 A;  2W26 B;  4Y7B B;  3HO3 A;  1U67 A;  2XBV L; 
#chains in the Genus database with same CATH topology
 3LC3 B;  5EGM B;  1XDT R;  1TOZ A;  3FFG L;  4BXW A;  1HT8 A;  5L2Y L;  1DVA L;  1KLJ L;  1LPK A;  5JB8 E;  1FJS L;  3N8Y B;  4Y76 B;  3KK6 A;  4D90 A;  2WPH E;  3ENS A;  3F6U L;  4YT6 L;  2I9A A;  2W3K B;  2FLG A;  2RA0 L;  2Y5F L;  5E8D A;  1LK9 A;  2XC4 L;  3LTG D;  2VWL L;  3LC5 B;  2BT8 A;  3OLU A;  3NTG A;  1G2L B;  3ZYJ B;  1IQL L;  2BOX A;  5CKN A;  3NJP C;  1IQF L;  4A7I A;  1L3Y A;  1PRH A;  3POY A;  1IQM L;  1V1I A;  1K36 A;  4Z6A L;  2H9E C;  2MGR A;  5JBA E;  1XKA L;  2EI6 B;  3V65 B;  2K2T A;  2VWO L;  3K9X A;  2WPL E;  2W2N E;  1SZB A;  2Y82 B;  4RUT A;  2P26 A;  3TGF A;  3HO4 A;  3Q3K B;  4Y71 B;  2P3T A;  3ZYI B;  4MMY B;  2Y5G L;  3GCX E;  2FLB L;  4CSY A;  1MQ5 L;  2P93 L;  1FFM A;  3LAQ A;  3U7U G;  3EGF A;  1DIY A;  2XC5 L;  1P9J A;  1LMM A;  4AQT A;  1V3X B;  4Y6D B;  1JV2 B;  2P94 L;  3HS5 A;  2HOX A;  1U8C B;  2J2U B;  1CX2 A;  2Y38 A;  1ATA A;  1IQE L;  2EI8 B;  4ZHA B;  4YT7 L;  1IGZ A;  2PHB B;  2D1J B;  3H5C B;  3HO5 A;  4D0F A;  1F7M A;  2MHP A;  3FCS B;  5L2Z L;  1EBV A;  1ZAQ A;  5JBB E;  2Y7Z B;  4E1G A;  4X8U L;  1P0S L;  4BXS A;  2KV4 A;  2WZP P;  1UZJ A;  1WHF A;  1NFY B;  3ZYG A;  4CUE A;  3HPT A;  1HRE A;  5JVY A;  1EPI A;  4ZXX L;  4G1M B;  4D0E A;  3KCG L;  1CCF A;  2XC0 L;  4LOR A;  1GK5 A;  1IVO C;  2VWM K;  2W2M E;  4X8V L;  1L5G B;  1EPJ A;  1EPH A;  1KKE A;  4OTJ A;  1K37 A;  3M36 L;  3N8Z A;  2BOU A;  2FZZ L;  4A94 C;  4XLW A;  3TBD A;  2PUQ L;  2VWN L;  4RRW A;  1C5M F;  3MDL A;  1HX2 A;  5JW1 A;  2P95 L;  1KSN B;  1LMJ A;  3SOB B;  2Y7X B;  2FLR L;  1TPG A;  4O1Z A;  2Y80 B;  6COX A;  1BF9 A;  1XFE A;  4XBM A;  5FDQ A;  2BQW A;  1EMO A;  1OB1 C;  1KLO A;  1I0U A;  2J34 B;  2BT7 A;  1A3P A;  1PGE A;  2K2S B;  4PH9 A;  3ASI A;  2P3F L;  1TLE A;  4X8S L;  1KLI L;  1IOX A;  2ADX A;  1FAX L;  4RRZ A;  1CVW L;  5JVZ A;  3QCW A;  4LMF A;  1X7A L;  4JZF L;  1ATB A;  2TGF A;  3S6X A;  3BPS E;  1F0R B;  4Y7A B;  1UZK A;  5IKR A;  5IKT A;  1IQJ L;  2VVV L;  1IQG L;  2NPR A;  3GIS X;  3IJE B;  1Z6C A;  2KB9 A;  1RFN B;  4XL1 A;  4TGF A;  2RHP A;  3ELA L;  4CUD A;  1WHE A;  1IP0 A;  4OTY A;  3SOQ A;  2OYU P;  1Z6E L;  2KL7 A;  1EAI C;  1N1I A;  2OYE P;  1W8B L;  2G00 L;  4ISH L;  2W3I B;  2BZ6 L;  4O02 B;  2YGQ A;  2BOH A;  1YUG A;  2JJL A;  3QMO A;  1CQE A;  1ADX A;  4M11 A;  5IKQ A;  1IQH L;  2P28 B;  3CEN L;  1ATE A;  2W2Q E;  3KQC L;  3NT1 A;  3KL6 B;  5COX A;  1MQ6 L;  1CCV A;  2WG4 B;  1G1T A;  2UWL B;  2WYJ B;  2VJ3 A;  1YUK B;  2BMG A;  3N8W B;  4RRX A;  2XBY L;  2J94 B;  1N7D A;  4Y79 B;  1G2M B;  2BSF A;  1QIU A;  1NT0 A;  1DX5 I;  2XBX L;  5F19 A;  5K0H B;  3QH0 A;  4MMZ B;  3N8Y A;  3U73 A;  3V64 C;  1DQB A;  1HAE A;  1IJQ A;  4GU4 A;  1NFX B;  2YGP A;  1PTH A;  1NFW B;  1JL9 A;  5JBC E;  5I46 L;  3IIT B;  1MOX C;  3HS6 A;  4ZAE B;  4ZH8 B;  3KQB L;  4BDX A;  1DDX A;  2B7D L;  3N8X A;  3HS7 A;  3LIW B;  4NGA L;  2I9B A;  2VVC K;  1KIG L;  3Q7D A;  3SOV A;  1FE2 A;  2BO2 A;  3DEM A;  1LPG A;  4JYU L;  1COU A;  1B9W A;  2CJI B;  3BT1 A;  3TH3 L;  1AUT L;  3OLT A;  4JZE L;  4BTI A;  1EQH A;  2RNL A;  5KIR A;  2BQ7 A;  3R05 A;  2FD6 A;  5KN5 C;  1HCG B;  5CIS A;  1URK A;  1O5D L;  1NFU B;  1G1S A;  2W2O E;  3N8W A;  2JKH L;  2WFT A;  1F7E A;  2P3F N;  1IQN L;  1HZ8 A;  2WPI E;  5F1A A;  5JB9 E;  3FBY A;  1YGC L;  1Q4G A;  1YUF A;  1CEJ A;  4BTU A;  2AYL A;  4RS0 A;  3TZI A;  1APO A;  5L30 L;  4ISI L;  1HJ7 A;  2WG3 C;  2H9E L;  3N8V A;  2P3U A;  4NA9 L;  2Y81 B;  5CKQ A;  3F1S B;  2VVU L;  2UWO B;  4Z0K B;  1PFX L;  1ATD A;  3P5B L;  3GCW E;  3LN0 A;  2BOK L;  4BTT A;  4JYV L;  3C9A C;  1EZQ B;  1W7X L;  1PXX A;  1EQG A;  1J9C L;  3KRK A;  3MQE A;  1FF7 A;  1IQK L;  3PGH A;  4JZD L;  4COX A;  1CVU A;  1IGX A;  3TK5 B;  3M37 L;  1IOE L;  1JBU L;  1FAK L;  2GD4 A;  3CA7 A;  2Q1J B;  2BQ6 A;  1UZQ A;  4GU3 A;  3KQD L;  2EI7 B;  2UWP B;  3LTF B;  4C16 A;  1F0S B;  5IKV A;  2W2P E;  1HT5 A;  2WPM E;  1APQ A;  4RRY A;  4MMX B;  1HAF A;  1LPZ A;  4NG9 L;  1LQD A;  4BDW A;  1NPE B;  3CS7 L;  2WFX B;  4YZU B;  1NZI A;  2HOR A;  1NQL B;  4X8T L;  1UZP A;  2Y5H L;  3LN1 A;  2WYG B;  1EMN A;  2VRS A;  1QFK L;  2M74 A;  2YGO A;  3NTB A;  2WPJ E;  2MGP A;  4CUF A;  3CFW A;  1XKB A;  2VH6 B;  4Z0L A;  5CKM A;  2WPK E;  2DDU A;  1FSB A;  2J38 B;  2W86 A;  1YO8 A;  1V1H A;  2F9B L;  1M1X B;  4FM5 A;  4ZXY L;  1WU1 B;  1G1R A;  3KQE L;  3SW2 A;  2J4I B;  2VH0 B;  1EGF A;  2J95 B;  1EPG A;  2XBW L;  2P16 L;  2PR3 B;  1IQI L;  3TK6 B;  3RR3 A;  1HRF A;  1G1Q A;  2KNI A;  3BT2 A;  4M10 A;  2W26 B;  4Y7B B;  3HO3 A;  1U67 A;  2XBV L; 
#chains in the Genus database with same CATH homology
 3LC3 B;  5EGM B;  1XDT R;  1TOZ A;  3FFG L;  4BXW A;  1HT8 A;  5L2Y L;  1DVA L;  1KLJ L;  1LPK A;  5JB8 E;  1FJS L;  3N8Y B;  4Y76 B;  3KK6 A;  4D90 A;  2WPH E;  3ENS A;  3F6U L;  4YT6 L;  2I9A A;  2W3K B;  2FLG A;  2RA0 L;  2Y5F L;  5E8D A;  2XC4 L;  3LTG D;  2VWL L;  3LC5 B;  3OLU A;  3NTG A;  1G2L B;  3ZYJ B;  1IQL L;  2BOX A;  5CKN A;  3NJP C;  1IQF L;  4A7I A;  1L3Y A;  1PRH A;  3POY A;  1IQM L;  1K36 A;  4Z6A L;  2H9E C;  2MGR A;  5JBA E;  1XKA L;  2EI6 B;  3V65 B;  2K2T A;  2VWO L;  3K9X A;  2WPL E;  2W2N E;  1SZB A;  2Y82 B;  4RUT A;  2P26 A;  3TGF A;  3HO4 A;  3Q3K B;  4Y71 B;  2P3T A;  3ZYI B;  4MMY B;  2Y5G L;  3GCX E;  2FLB L;  4CSY A;  1MQ5 L;  2P93 L;  1FFM A;  3LAQ A;  3U7U G;  3EGF A;  1DIY A;  2XC5 L;  1P9J A;  1LMM A;  4AQT A;  1V3X B;  4Y6D B;  1JV2 B;  2P94 L;  3HS5 A;  1U8C B;  2J2U B;  1CX2 A;  2Y38 A;  1ATA A;  1IQE L;  2EI8 B;  4ZHA B;  4YT7 L;  1IGZ A;  2PHB B;  2D1J B;  3H5C B;  3HO5 A;  4D0F A;  1F7M A;  2MHP A;  3FCS B;  5L2Z L;  1EBV A;  1ZAQ A;  5JBB E;  2Y7Z B;  4E1G A;  4X8U L;  1P0S L;  4BXS A;  2KV4 A;  2WZP P;  1UZJ A;  1WHF A;  1NFY B;  3ZYG A;  4CUE A;  3HPT A;  1HRE A;  5JVY A;  1EPI A;  4ZXX L;  4G1M B;  4D0E A;  3KCG L;  1CCF A;  2XC0 L;  4LOR A;  1GK5 A;  1IVO C;  2VWM K;  2W2M E;  4X8V L;  1L5G B;  1EPJ A;  1EPH A;  4OTJ A;  1K37 A;  3M36 L;  3N8Z A;  2BOU A;  2FZZ L;  4A94 C;  4XLW A;  3TBD A;  2PUQ L;  2VWN L;  4RRW A;  1C5M F;  3MDL A;  1HX2 A;  5JW1 A;  2P95 L;  1KSN B;  1LMJ A;  3SOB B;  2Y7X B;  2FLR L;  1TPG A;  4O1Z A;  2Y80 B;  6COX A;  1BF9 A;  1XFE A;  4XBM A;  5FDQ A;  2BQW A;  1EMO A;  1OB1 C;  1KLO A;  1I0U A;  2J34 B;  1A3P A;  1PGE A;  2K2S B;  4PH9 A;  3ASI A;  2P3F L;  1TLE A;  4X8S L;  1KLI L;  1IOX A;  2ADX A;  1FAX L;  4RRZ A;  1CVW L;  5JVZ A;  3QCW A;  4LMF A;  1X7A L;  4JZF L;  1ATB A;  2TGF A;  3S6X A;  3BPS E;  1F0R B;  4Y7A B;  1UZK A;  5IKR A;  5IKT A;  1IQJ L;  2VVV L;  1IQG L;  2NPR A;  3GIS X;  3IJE B;  1Z6C A;  2KB9 A;  1RFN B;  4XL1 A;  4TGF A;  2RHP A;  3ELA L;  4CUD A;  1WHE A;  1IP0 A;  4OTY A;  3SOQ A;  2OYU P;  1Z6E L;  2KL7 A;  1EAI C;  1N1I A;  2OYE P;  1W8B L;  2G00 L;  4ISH L;  2W3I B;  2BZ6 L;  4O02 B;  2YGQ A;  2BOH A;  1YUG A;  3QMO A;  1CQE A;  1ADX A;  4M11 A;  5IKQ A;  1IQH L;  2P28 B;  3CEN L;  1ATE A;  2W2Q E;  3KQC L;  3NT1 A;  3KL6 B;  5COX A;  1MQ6 L;  1CCV A;  2WG4 B;  1G1T A;  2UWL B;  2WYJ B;  2VJ3 A;  1YUK B;  2BMG A;  3N8W B;  4RRX A;  2XBY L;  2J94 B;  1N7D A;  4Y79 B;  1G2M B;  1NT0 A;  1DX5 I;  2XBX L;  5F19 A;  5K0H B;  3QH0 A;  4MMZ B;  3N8Y A;  3U73 A;  3V64 C;  1DQB A;  1HAE A;  1IJQ A;  1NFX B;  2YGP A;  1PTH A;  1NFW B;  1JL9 A;  5JBC E;  5I46 L;  3IIT B;  1MOX C;  3HS6 A;  4ZAE B;  4ZH8 B;  3KQB L;  4BDX A;  1DDX A;  2B7D L;  3N8X A;  3HS7 A;  3LIW B;  4NGA L;  2I9B A;  2VVC K;  1KIG L;  3Q7D A;  3SOV A;  1FE2 A;  2BO2 A;  3DEM A;  1LPG A;  4JYU L;  1COU A;  1B9W A;  2CJI B;  3BT1 A;  3TH3 L;  1AUT L;  3OLT A;  4JZE L;  4BTI A;  1EQH A;  2RNL A;  5KIR A;  2BQ7 A;  3R05 A;  2FD6 A;  5KN5 C;  1HCG B;  5CIS A;  1URK A;  1O5D L;  1NFU B;  1G1S A;  2W2O E;  2WFT A;  2JKH L;  3N8W A;  1F7E A;  2P3F N;  1IQN L;  1HZ8 A;  2WPI E;  5F1A A;  5JB9 E;  3FBY A;  1YGC L;  1Q4G A;  1YUF A;  1CEJ A;  4BTU A;  2AYL A;  4RS0 A;  3TZI A;  1APO A;  5L30 L;  4ISI L;  1HJ7 A;  2WG3 C;  2H9E L;  3N8V A;  2P3U A;  4NA9 L;  2Y81 B;  5CKQ A;  3F1S B;  2VVU L;  2UWO B;  4Z0K B;  1PFX L;  1ATD A;  3P5B L;  3GCW E;  3LN0 A;  2BOK L;  4BTT A;  4JYV L;  3C9A C;  1EZQ B;  1W7X L;  1PXX A;  1EQG A;  1J9C L;  3KRK A;  3MQE A;  1FF7 A;  1IQK L;  3PGH A;  4JZD L;  4COX A;  1CVU A;  1IGX A;  3TK5 B;  3M37 L;  1IOE L;  1JBU L;  1FAK L;  2GD4 A;  3CA7 A;  2Q1J B;  2BQ6 A;  1UZQ A;  3KQD L;  2EI7 B;  2UWP B;  3LTF B;  4C16 A;  1F0S B;  5IKV A;  2W2P E;  1HT5 A;  2WPM E;  1APQ A;  4RRY A;  4MMX B;  1HAF A;  1LPZ A;  4NG9 L;  1LQD A;  4BDW A;  1NPE B;  3CS7 L;  2WFX B;  4YZU B;  1NZI A;  1NQL B;  4X8T L;  1UZP A;  2Y5H L;  3LN1 A;  2WYG B;  1EMN A;  1QFK L;  2M74 A;  2YGO A;  3NTB A;  2WPJ E;  2MGP A;  4CUF A;  3CFW A;  1XKB A;  2VH6 B;  4Z0L A;  5CKM A;  2WPK E;  2DDU A;  1FSB A;  2J38 B;  2W86 A;  1YO8 A;  2F9B L;  1M1X B;  4FM5 A;  4ZXY L;  1WU1 B;  1G1R A;  3KQE L;  3SW2 A;  2J4I B;  2VH0 B;  1EGF A;  2J95 B;  1EPG A;  2XBW L;  2P16 L;  2PR3 B;  1IQI L;  3TK6 B;  3RR3 A;  1HRF A;  1G1Q A;  2KNI A;  3BT2 A;  4M10 A;  2W26 B;  4Y7B B;  3HO3 A;  1U67 A;  2XBV L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...