3ASIA

Alpha-neurexin-1 ectodomain fragment; lns5-egf3-lns6
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
395
structure length
395
Chain Sequence
b'ADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurexin-1-alpha
molecule tags Cell adhesion
source organism Bos taurus
publication title Structural Basis for Variant-Specific Neuroligin-Binding by alpha-Neurexin
pubmed doi rcsb
total genus 92
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3asiA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA01
2ZHNA 4LBNA 2KV4A 4JYUL 1GNZA 1KLOA 5HCBA 1ULFA 4FP3A 5BYNA 3LTFB 2GN7A 3LTGD 1AZDA 3T1LA 3FUOA 2ZGUA 2WPJE 1MZ5A 3N7LA 1DX5I 2EAKA 5DZGA 4ISIL 3SH4A 3V64A 1UZYA 1V6KA 2GMPA 4AGRA 1FYUA 1EPIA 1LOFC 1MS3A 3T1MA 2XBWL 1QOOA 3R4SA 1LEDA 3IJEB 1SLBA 2J95B 2D43A 4AGGA 3HPTA 2H9EL 1ADXA 4X8TL 4C1WA 3AJYA 4GXLA 1UZKA 3H5CB 3BOPA 5LK5A 1IVOC 3WG1A 1FSBA 2W68A 2VVCK 3F6UL 1CVWL 4Q27A 1Q8SA 5F9TA 2JKHL 4Y7BB 2DUPA 1W6PA 1RIRA 1MVQA 4JC1A 3OJBA 2W39A 2GD4A 1TLEA 5F5QA 3N8YB 1FAXL 2WQZC 4LORA 4YZUB 1GV9A 2VW0A 1AXYA 4C1XA 1R1ZA 4FVVA 5DG2A 1S0EA 3HS7A 1WLCA 1TEIA 2GN3A 4YW1A 4TZDA 2W08A 4CUEA 1GZCA 1V6JA 2UU8A 2DDUA 5JVYA 1LOEA 1LOGA 5JOYA 4M00A 2WFXB 2OVUA 4MMXB 5EGMB 1ZA4A 5T52A 3AFKA 1SFYA 4UW4A 2V73A 3HO5A 2MGPA 3B00A 4XYXA 4XHBA 2P3JA 1RFNB 4JZEL 1G9CA 2NMNA 1AXZA 5GM0A 1NQLB 2D44A 3RSJA 3N8WB 3TAYA 1LEMA 2CTVA 2PHFA 3KQBL 2EI6B 3SISA 1ENRA 1MQ5L 3FUQA 4Y1VA 5GZCA 4GWNA 3VUOA 5H9RA 1V3XB 3RR3A 1LCLA 1IQNL 4ZXYL 2WYJB 3O5SA 1LULA 3QLQA 1IQEL 3B69A 1JYIA 3FFZA 4M3CF 4YZ5A 3WDTA 3KM5A 1A78A 3LN1A 1QDCA 3DUIA 1WCSA 2VVUL 2P3UA 2BQPA 2J4IB 3M3OA 3WLUA 4XBNA 3I4IA 3T2TA 3WCRA 3N8YA 1SCSA 1X50A 3C9AC 2J2UB 1IQHL 1MS5A 4RUTA 1LPGA 5H9PA 2KL7A 1H30A 3KQCL 5DUXA 2WLQA 2Y81B 1VALA 2CYFA 2BQWA 2Y7ZB 1S0CA 3BPSE 3V0AA 2R49A 1A3PA 1V6LA 1DYKA 4A7IA 2R1BA 1V6NA 2BOKL 4Y1UA 3POSA 1GYKA 4Q8KA 1ATBA 1CX2A 2WT1A 2SBAA 1WU1B 5JBBE 2MGRA 3ZXEA 4RRYA 4MMZB 2BOHA 4XHXA 5FREA 2CWSA 5DZFA 3M1HA 4BLJA 4JYVL 1MQ6L 4BQ1A 2FMDA 1LGNA 2WNEA 1O4ZA 1SLAA 3AZYA 3CS7L 2R1DA 4XTMA 2XBYL 4BXWA 3FLPA 5IKTA 4RA0A 1CIWA 3D5OA 3GISX 1LODA 4YG6A 2WT0A 1Q8OA 1I3HA 3KCGL 2J34B 3TK6B 2P2KA 1ATEA 1S0DA 4ZHAB 3WUCA 1JW6A 3CNAA 4O02B 2ZGSA 4AVSA 2A6VA 2Q1JB 4MYEA 4Y7AB 2ZAAA 2BO2A 1OB1C 2W3KB 1W6QA 5H9SA 4AYUA 1MVEA 3WV6A 2A3WA 4ZXKA 2FD6A 2A7AA 3OLUA 3QMOA 1HT5A 4XDQA 2E7QA 1W0PA 2VW1A 4G1MB 1GBGA 4Y6DB 1LPKA 3LSDA 1WBFA 4P9YA 5HCFA 2RA0L 3N7MA 1WW4A 4LBQD 1I0UA 2WSVA 4NA9L 4U36A 2PHBB 1WHEA 4XJWA 5CB7A 1DDXA 3F1SB 4CUDA 1GZWA 1GICA 3HO3A 1FV2A 1EMNA 5IT6A 3GALA 2ZGTA 2P37A 1BJQA 4D0EA 1HAEA 5T55A 1I1EA 5T5OA 4XILA 4XIOA 5CAZA 1J1TA 2DUQA 3NWKA 3WCSA 2DVAA 1YIFA 1EPGA 2WJSA 4PH9A 2KM2A 3ILNA 5GLWA 5CKNA 4BDXA 3UK9A 4FPKA 4XIKA 1JN2P 1U67A 4GKXA 3LSEA 2AYHA 3ELAL 4YZ2A 3DEMA 1LOCA 2RHPA 1CQ9A 2B7DL 4GA9A 1QOTA 3ATGA 1DIYA 4XBQA 2UWOB 1CPNA 2D6OX 4DRVA 2YZ4A 1VAVA 2YROA 4NO4A 2DURA 3SOVA 3SLIA 1MS8A 3ZYJB 2BOUA 1WBLA 1ENSA 1FNZA 3JU9A 4BXSA 3HMYA 1IQIL 3POWA 3P5BL 4Q2FA 5IUQA 2DTWA 1WLDA 2DV9A 5SV8A 2V5YA 2ZBJA 5L73A 1Q4GA 1IP0A 1LHNA 4DQAA 1G2LB 1HT8A 4DRRA 1CR7A 4OTYA 2VH9A 2D6LX 4XTPA 5KXBA 3AP5A 1SBEA 2XBXL 2AYLA 4ZH8B 2G4IA 1JBCA 2ZMLA 4U2AA 4R9CA 4Q1PA 4FPEA 1IGZA 1LTEA 4Q26A 4FQZA 1NT0A 2EALA 1V6OA 1S0IA 4XBMA 2PR3B 1AX2A 1JHNA 1LOAA 1MOXC 1VLNA 3AX4A 1YGCL 3AP7A 3ZVXA 1HAFA 1URXA 1KRIA 1EPWA 1HQWA 2A3YA 4DFSA 2FLGA 2G00L 3Q3KB 1WUVA 3OBTA 3IPVA 2VWNL 3U73A 1BYHA 1IQJL 3DGTA 3TK5B 3D6EA 2VWMK 1AVBA 1V6MA 2R16A 2A5ZA 4JZDL 1LHUA 5H9QA 1ZAQA 2TGFA 1N1YA 2ARXA 3M36L 1IS6A 1CJPA 4YG3A 1OFSA 1TPGA 1LESA 1Z0HA 2JDZA 3VKOA 3IITB 1UAIA 4LBKA 4YM0A 1N7DA 5CA6A 4YW4A 2P28B 3B3QE 4YFZA 3GCWE 4PF5A 4FPFA 3V0BA 3MW2A 4CSYA 4P9WA 3FLRA 3MDLA 3RMYA 4FP2A 4PCRA 4XJUA 4O1ZA 2GNDA 3ZSJA 4K1YA 2AREA 3HO4A 4K21A 4Z0LA 3LCPA 3KK6A 3ZSKA 4FOYA 2A6WA 3Q9OA 4XJAA 4NOTA 1S0JA 2TEPA 2ENRA 2ZGRA 2ADXA 2DVGA 3N8XA 1V00A 1KDKA 1O4YA 3C2UA 4Y1YA 1GNHA 1LHOA 2JKBA 1SZBA 3AP9A 2MHPA 1BZWA 3PVEA 2FLRL 3N3HA 4YM2A 2CY6A 2VH6B 1KSNB 3IKWA 1DQBA 4YGEA 4M10A 2KB9A 2NZ9A 3FBYA 4ISHL 1W8BL 3N8ZA 2W2PE 4E1GA 1G1QA 4H55A 4XJ9A 5E88A 2P26A 2Y7XB 3IPVB 2VWLL 3ILFA 3KL6B 3RG0A 2P3IA 1UZPA 1AF9A 4TYSA 4AQTA 3ZYPA 1G1SA 2EIGA 5F19A 2NM1A 1G7YA 2E7TA 2CL2A 3TZIA 1W6NB 3NT1A 1GLHA 2E51A 1EGFA 1DQ5A 3VKFC 1U8CB 1DYPA 4Q8LA 5KIRA 1UN1A 3KQRA 1GKBA 2NYYA 3WDXA 1XDTR 1DBNA 1PTHA 1JYCA 4HANA 1YUFA 3ZYGA 5K0HB 3PGHA 2WPME 5CISA 2ZGMA 1EQHA 5IK5A 1WHFA 2DVBA 1Q8PA 1AJOA 4DPNA 3BT1A 4GKYA 1FATA 3TH3L 1S0BA 4YZ3A 1MR5A 2PHTA 1SLLA 1CPMA 4RRZA 1G8WA 4K20A 2XC0L 1CVUA 2ZABA 4GALA 4M3CA 2UURA 2D7FA 4D0FA 4UW5A 4IQPA 1VIWB 1F0SB 3TGFA 3AP6A 4PBPA 4YT7L 2ZKNA 1EMOA 4PBOA 1C57A 3AYCA 3FCSB 2FHRA 1L5GB 2UWLB 1EZQB 4BTTA 3AZXA 1IOEL 3M37L 1LECA 2ERFA 1LU1A 1S1AA 1C5MF 4P14A 1LU2A 2PELA 2ZZJA 5GJ6A 1VAMA 2YV8A 3AJZA 1KJRA 1ULEA 1YYNA 2P34A 3AYDA 3VKLA 1JOJA 1LGBA 4BMBA 2WYGB 2UWAA 5F1AA 1APOA 5DXDA 2VVVL 2SLIA 2BQ7A 3B9CA 2FZZL 1K37A 1P9JA 4ISRA 3O0VA 2ZHLA 2ZHKA 4Y20B 1SCRA 1SLIA 1X7AL 1N1VA 5E89A 4LMFA 1KDMA 4FPJA 3L2YA 3WVJA 1HREA 4NGAL 1CN1A 5JDBA 2P3FL 3SH3A 1RITA 1IKPA 5I46L 3AZZA 2CJIB 1KLIL 5DG1A 3CENL 4YW5A 2ZGPA 4Y79B 2JE9A 3N36A 5T5LA 2R0HA 1QU0A 3BODA 3BTAA 4X8UL 1JXNA 1KITA 4D90A 3AYAA 3BT2A 2PHWA 1EPJA 2EXJA 1ENQA 2GMEA 1JL9A 3AP4A 3A0KA 4DS0A 4FPHA 3H0OA 2AENA 2W3IB 1QKQA 2VW2A 2XC5L 3WG4A 2ES3A 1XQNA 4ATFA 4Z8BA 2C5DA 3FFGL 1DQ4A 1DFQA 1W6OA 2P3TA 5JB8E 2ZHMA 3CFWA 2Y5HL 3RQ0A 2GNMA 4M3CE 3I8TA 2CNAA 3BIWE 4RS0A 4KBBA 2M74A 2I9AA 1H9PA 1IOAA 1ONAA 1LMJA 2ZGNA 3WHTA 2A71A 5JOXA 1G9DA 2WPIE 3V65A 2ZACA 3N35A 1LENA 4R9DA 1NFWB 2VUAA 3VV1A 4Y20A 3WNXA 2Y5GL 2D3PA 2GMMA 4JCKA 3FLTA 3PVNA 4OZXA 2ZMKA 2BZ6L 4BLIA 3O12A 3GCXE 2Y82B 1W6PB 1N3PA 3SITA 1YUKB 1APNA 1LGCA 6COXA 1GSLA 1DQ2A 1FFMA 4SLIA 4YFWA 4FOQA 1UPSA 2OW4A 3NJPC 1IQLL 4TGFA 1UZZA 1IKQA 3A4UA 2NPRA 2P94L 2A3XA 3ZXJA 4LBOA 1G9BA 1N1SA 1PXXA 1NXD1 4Y26A 5T50A 5JW1A 2VXRA 4Y71B 3ZXLA 2EXIA 1JV2B 5KN5C 2JJ6A 1KQRA 1LOBA 3QH0A 3OY8A 1IS3A 1H9WA 1CCFA 1EPHA 4YZ4A 5E8DA 5HCAA 1QMJA 2A70A 2OUJA 3W58A 2EF6A 1GZ9A 4XL1A 1K36A 2XG3A 3TB0A 4NG9L 1MS0A 5JMCA 4BDWA 4XZPA 5E8AA 4LBJA 1DGLA 3PJQA 1HJ7A 1UX6A 2DU0A 3WOGA 1G1RA 1ZM1A 1DHKB 3ENRA 4CRQA 3MQEA 4FM5A 5GLTA 4OTJA 2UWPB 4YGCA 4W65A 4Y24A 1N3OA 2I2SA 3WDYA 4K1ZA 1G1TA 2UWBA 5GZDA 4ATEA 2EXKA 4XMAA 5T54A 1BQPA 5JBCE 3NV3A 2PHXA 5KXEA 2WPHE 1DIWA 5CKQA 2D6PA 5JOWA 4HL0A 1HX2A 4XE9A 5L2ZL 4Y76B 1JUIA 3ILRA 3NV2A 1FV3A 2DU1A 2EI7B 1P0SL 2W2QE 2JE7A 1HKDA 1IS5A 5CKMA 2OYEP 1D2SA 2WFTA 4YW2A 4AVTA 1DQ6A 1IOXA 3O0XA 3M3QA 3ZPYA 2XBVL 1QGLA 3QCWA 1WLWA 2CWMA 1PZ7A 1W6QB 1LHWA 3OY8B 2Y5FL 1RINA 4M01A 1AX1A 3ZSMA 4Y22B 1AX0A 1ULDA 2J38B 4GWMA 4Y1XA 4D69A 1URKA 2P3FN 4CTEA 1JBUL 1KLJL 3PMEA 4FPGA 3EGFA 5GZFA 1S0GA 2ZMNA 5IK4A 4ITCA 5L2YL 3NV1A 3M3EA 3V0BB 2WPKE 1MS1A 1IQKL 1LPZA 2W2NE 3NTGA 2YXSA 3LN0A 1COUA 2Z42A 4ASMB 1BKZA 4FPYA 3NTBA 3U7UG 4X8SL 3IM0A 1FNYA 5JOZA 1QF3A 4YM3A 4LBQA 3A0NA 2I9BA 4YGDA 2K2TA 1PRHA 4FPOB 1WD3A 1ULGA 3AZWA 1MACA 1HLCA 1GK5A 4XMIA 1N3QA 3N7JA 3OPZA 1N1IA 1WW6A 2D6KA 1L3YA 1DQ0A 5IKQA 5IKVA 3ZXKA 3AYEA 3HN1A 2J94B 3WDVA 5GALA 4BTIA 1OQ1A 1M1XB 4XBLA 1UL9A 1NFYB 1ATAA 4COXA 3R4UA 1B9WA 2AUYA 5IK8A 2NN8A 4YZ1A 1CONA 3HS6A 3MW3A 1GANA 5L30L 1FAYA 1PFXL 4Z0KB 1HQLA 1KIGL 1GZWB 1ULCA 1SACA 4F83A 1Z6CA 1ATDA 2AGSA 5EYYA 2D6NA 4I30A 1SBFA 4WV8A 4L8QA 3LAQA 3RS6A 1OKQA 1F31A 2YMZA 3LIWB 1LHVA 5GLUA 3W59A 1Q56A 3WG2A 3AZVA 3VKNA 2JD4A 1LJ7A 1W6OB 1DZQA 4WVWA 4ZXXL 1W6MA 2OYUP 3ZYIB 3JUUA 1Z78A 3USUB 5KXDA 2DVFA 2HYKA 2WKKA 4R9BA 1MZ6A 1G2MB 5DUUA 1YXWA 5GZGA 1F0RB 1FJSL 2D6MA 2DUOA 3N8WA 3OLTA 4LBQB 4AVVA 3V64C 4YT6L 4BOWA 2H0BA 2PHUA 3WDWA 2Y80B 3TBDA 4BTUA 2K2SB 1HCGB 4CUFA 2XC4L 1LOFA 3MEPA 4ZAEB 2LTNA 1XFEA 3POYA 1IJQA 5DUWA 3MPPG 5GLVA 1U0AA 2ZGKA 3B01A 2WPLE 5JVVA 2ZGOA 3LC5B 2GALA 1DQ1A 3Q7DA 3PVOA 2W86A 1A3KA 4AGVA 4CZSA 2PUQL 3ZSLA 4XLWA 3K9XA 1SLCA 2AR6A 2ZA9A 1YUGA 1PZ9A 3UJQA 5JBAE 1EQGA 3KQDL 5FRAA 1TOZA 2Q5TA 2DYCA 2DTYA 2E6VA 4UW6A 3ZXFA 3NV4A 1W0OA 1KJLA 3V0AB 1NFUB 1MS9A 4Y1ZA 1CVNA 3UJOA 2W52A 5GZEA 1SLTA 3M3CA 3SOQA 2FLBL 5DZEA 1Z6EL 4WZFA 5T5JA 1BXHA 2F9BL 3SW2A 1C1LA 1HRFA 4FOWA 1B09A 4XXPA 4ISQA 1O5DL 5KXCA 4FPLA 4LBMA 1XKBA 1IQML 3MW4A 1DLLA 1MS4A 1APQA 1BF9A 2EXHA 2D3SA 3RRDA 1F7MA 4YGBA 1UZJA 3OBRA 1QFKL 3RMXA 2A6ZA 2ZGQA 1SBDA 3AK0A 4R9AA 5AVAA 2GNTA 3KQEL 4JZFL 3N8VA 2GNBA 2YGOA 3ASIA 3WHUA 1Q8VA 4YLZA 1FE2A 1F5FA 2DVDA 1UMZA 4PQ9A 4FQ4A 1C1FA 2ZGLA 2W2OE 2BOXA 2A6YA 4XJ8A 4P9XA 4XXAA 3U4XA 1NZIA 2WSUA 1NFXB 3V65B 1FX5A 4FPCA 1YI7A 2VWOL 2R0FA 2A6XA 1UZQA 1HZ8A 1FAKL 1IGXA 2BQ6A 3APBA 4UW3A 1YO8A 2P16L 4YW3A 5JLVA 4AWDA 4LBLA 2D3RA 1Y7BA 2PHRA 1LQDA 1F7EA 1IQFL 1XKAL 5EYXA 1D0HA 3AXDA 2VU9A 1V6IA 3HS5A 4Y22A 1A8DA 3HR9A 1G86A 1Q8QA 1QNWA 3WG3A 1F9KA 5IKRA 3LC3B 4BMEA 3OGGA 2XB6C 1HDKA 1WW5A 5DUVA 2ARBA 4XOGA 1AJKA 1NLSA 4M11A 2BMGA 5CBLA 4MMYB 2VJ3A 3AXEA 3GNEA 1UKGA 3M2MA 3N7KA 3OYWB 3CA7A 2B7YA 2Y38A 4C16A 4YG0A 3ZYRA 5IK7A 3SH5A 3D4KA 1N1TA 4M3CB 2LALA 4XJZA 1NPEB 3INAA 3KRKA 2VH0B 2EI8B 1C4RA 1G9FA 4BPZA 2D1JB 4FOVA 1IS4A 1G9AA 2NP0A 3O0WA 3SNMA 4RRXA 4ZKTB 1N47A 1QDOA 1QOSA 1PGEA 3WDUA 3ENSA 2WT2A 4RL7A 1W6NA 5CNAA 1W7XL 1CQEA 2YGPA 2P95L 1CESA 5JB9E 3WZ1A 2W2ME 2YY1A 2P93L 1FF7A 1PZ8A 1WW7A 2VY0A 1AUTL 2E53A 2DWRA 1QNYA 2A75A 2JECA 1IQGL 1S0FA 4RRWA 4WVVA 2OUHA 5FDQA 2WG4B 2P3KA 4BM8A 1WD4A 2GDFA 3SOBB 4Q1RA 4Z6AL 1CCVA 3VKMA 3R05A 3IN9A 2NMOA 1YRZA 5EXOA 1EBVA 3IMNA 2AH2A 3WUDA 5COXA 4X8VL 1J9CL 5T5PA 2RNLA 5JVZA 2UWCA 1EAIC 1W6MB 1DVAL 4JRAA 5GLZA 3UL2A 2W26B 1AXKA 1CEJA 3OYWA 4YM1A 3USUA 2WG3C 5EWSA 2C9AA
chains in the Genus database with same CATH superfamily
3DV8A 2F4PA 2ZHNA 3NAPB 2KV4A 4LBNA 4WM8A 4AAPA 4JYUL 3FL7A 3UYJA 4B1LA 1BEV2 2XVLA 4B4PA 4OFGA 1GNZA 1K5JA 3HOBA 1KLOA 3U11A 3VDDA 2V4VA 5FPAA 1OVSA 2O14A 4V1PA 4ZZ8A 5HCBA 1QJY3 1ULFA 3AVRA 4XACA 4FP3A 2IXIA 4FFFA 2X29A 1ZA7A 5BYNA 4JQTA 4H3WA 5CYYA 5F5AA 3LTFB 3VDAA 2GN7A 1ASJ1 3LTGD 1AZDA 3ACGA 4IEOA 3T1LA 3NJVA 3ZYRA 4CPBA 1XSRA 1DDLA 2XH6A 3ZXGA 3VZJA 2RJ2A 3ALQA 1RUG2 1UF2C 1WLTA 3FUOA 2HKXA 3EYPA 2R30A 5FJKA 5FXXA 5J7MA 4K8FA 2PHDA 2ZGUA 1DP0A 3EHKA 2WPJE 1MZ5A 3IT8A 3ZLIA 3J7LA 3N7LA 4LE4A 2AEZA 5JR7B 1DX5I 4CP9B 2VTXJ 1RUG3 4KU8A 1JS9A 1TME1 1VRH1 2EAKA 2VZ1A 3JD71 4ISIL 5DZGA 3SH4A 1UZYA 3V64A 1V6KA 4BK4A 4YARA 2GMPA 3ZKUA 1C3HA 2YDEA 4AGRA 3LDRA 4BIFA 1FYUA 1RUC1 2HWD1 4DMIA 5FYVA 2RS33 1DYOA 2PAKA 2VBDA 2OIIA 2YFUA 1W06A 4JZRA 4GQ7A 1EPIA 1LOFC 1MS3A 4X6RB 3T1MA 2RMU1 2D93A 3THPA 5J98B 1RUI2 2XBWL 1BBT1 1QOOA 4BH9A 3UNPA 1S2KA 3UGHA 2W47A 3R4SA 3OD4A 4XFCA 1C8M2 1LEDA 2VD7A 5FPZA 3IJEB 1PIV3 3OOXA 1W99A 5I0TA 5BNPA 1SLBA 2Y33A 2J95B 2D43A 4L0PA 4AGGA 2ZX0A 3O7OA 1EY2A 4X6QB 3HPTA 5CA6A 2H9EL 1SHWB 1ADXA 4DZGA 3O1MA 1IPSA 4X8TL 3KS7A 5FZ9A 2WN3A 3AJYA 4C1WA 3UGGA 1REEA 1VBD2 4GXLA 4OHXA 1DGRA 1UZKA 1RUC3 4YVSC 5EIYB 3H5CB 4MLOA 3BOPA 4CDXA 4BXSV 4XETA 5LK5A 4XQWA 1ST8A 3A21A 4HT1T 1IVOC 3R4DB 4JTNA 2VZRA 4SBVA 4TLGA 2RMU3 1FSBA 2W68A 4GB32 1MQTB 1RMU2 3I54A 2VVCK 4YWAA 1EYBA 1R1A3 4N43B 4JGYB 5A7PA 3F6UL 1CVWL 5LA2A 2QQMA 4S2DA 4Q27A 5CADA 1Q8SA 5FXVA 1TE1B 3ZN4A 3HNYM 2F17A 2JKHL 4Y7BB 5F9TA 4Q0UA 2DUPA 1UU4A 1ZRDA 1W6PA 3VBUC 4AVAA 4BQ5A 1RIRA 2WQ8A 1MVQA 4L99A 3MZHA 5FYMA 3RGBA 3PL0A 3VBHA 2QCSB 3KF3A 5L9BA 4JC1A 5AC91 5JWPA 3OJBA 3BKZA 2WRAA 1AYM2 2ZOEB 4LTAA 4W8JA 4D8MA 4QKFA 1JU4A 2GD4A 2W39A 4I3PA 1TLEA 4RR3A 5IW0A 4E4DX 4MGIE 5JIUA 1YWKA 5F5QA 4JDOA 3N8YB 1FAXL 4E2QA 4CP0A 3TN92 2W1UA 1MQTC 2WQZC 3VZNA 4LHNA 3I2GA 5TSWA 4LORA 4YZUB 1GV9A 2VW0A 3EJKA 4BHPA 1AXYA 2BDRA 2VMCA 2WZR1 2ZEYA 5FUNA 4C1XA 1RB8G 5BNNC 3VB9A 1R1ZA 4FVVA 3MO4A 4J1XA 5DG2A 1S0EA 5IFPA 3HS7A 1WLCA 2HWF3 5FBZA 1TEIA 2GN3A 4YW6A 1CJDA 1OA3A 3KHBA 3VBUB 4YW1A 1OXCA 4ZY9A 4TZDA 1REFA 2W08A 4CUEA 4J25A 1GZCA 5FZCA 4BQ2A 4QWNA 3DPRB 1FT9A 4BK5A 1V6JA 3AL5A 5FMBA 2UU8A 2DDUA 1IPJA 3NAPA 1ZRCA 4JDNA 1YQ2A 5FYZA 5L7OB 1KGYA 3PMSA 5JVYA 1M06G 1EV13 5A3OA 1LOEA 1ZBA3 4XDOA 2X09A 2IXKA 1I5ZA 1BK1A 2BTVC 1RUE1 2JJLA 5FZDA 1BMV2 1NE6A 3NNJA 4BWOA 5FZFA 3O1TA 4LIUA 5IVVA 3MIGA 1LRHA 1UKRA 1LOGA 5L9VA 1NE4A 5JXGA 3OGSA 3T2PA 2Q8OA 3NNGA 5JOYA 4M00A 4XCBA 3WINE 2WFXB 4BZ4A 2OVUA 4MMXB 5EGMB 4RQPA 3SEPA 3WP3A 4RN5A 2BERA 1ZA4A 5T52A 1ULPA 4RGKA 3AFKA 4AHXA 1WMEA 1SFYA 4UW4A 2V73A 3HO5A 2P17A 1C28A 1CAXB 2XKPA 5K9YA 2MGPA 2RE9A 3B00A 2PQQA 3THCA 4XYXA 1EV11 1RL3A 1J3QA 1ZBA1 4XHBA 5D1IA 3T08A 2P3JA 3I59B 4IGQA 1RFNB 1QIQA 5C9AB 2ORZA 2ILMA 4JZEL 1GQPA 1G9CA 2NMNA 2HYXA 1AXZA 3BTXA 5GM0A 4QXKA 5ABJA 5JSRA 1NQLB 2D44A 1TNFA 2GP3A 5AFBA 3RSJA 1AR71 3N8WB 4MGKE 3BOWA 5I8SA 4CUBA 1OOPB 4I3GA 3TAYA 3JD73 3KV6A 1LEMA 3I3BA 1S55A 2CTVA 2PHFA 3KQBL 2HWF2 3J7HA 2EI6B 2K2SA 5LB6A 3SISA 2EA7A 1ENRA 3RVHA 1MQ5L 3FUQA 4Y1VA 4E4ZA 3GHMA 4QHOA 5GZCA 2R061 4GWNA 1O3QA 2WDBA 4NRPA 3RYKA 5C9AC 3JD72 4CU9A 4IL7A 5H9RA 3VUOA 1UYZA 1V3XB 3RR3A 1LCLA 3H3ZA 1IQNL 4ZXYL 4UI9L 4ARXA 2WYJB 2Q8DA 1REDA 1LULA 2Z69A 3O5SA 3QLQA 5FKBA 4Y4RA 4AQSA 5C3RA 1IQEL 3B69A 3G7DA 3I3MA 1JYIA 5ANNA 4HPKB 3FFZA 4M3CF 4BQXA 4NIDA 3HNMA 4QQHA 1MQTA 1GMMA 1HB2A 1OI6A 1OLRA 4IW3A 1WCQA 4YZ5A 3WDTA 3KM5A 4A44A 1A78A 5JI9A 3LN1A 1ASJ3 1QDCA 5FYIA 2IWGB 3DUIA 1WCSA 2ZXQA 4I0AA 3OEAA 2VVUL 3K48A 1YC61 4D94A 2P3UA 3SKVA 4XCAA 2BQPA 4JGYC 2J4IB 4JGZA 1JZ5A 4P00B 1XBFA 2IXLA 2WYFA 1RGSA 2QDRA 3M3OA 4NAOA 1H8TA 3ZN6A 1GOGA 2YU2A 4XBNA 3WLUA 1GP5A 5FLJA 3POJA 4JHZA 3ZYBA 3AC0A 3I4IA 1PVC2 3ZFGC 2JKXA 1COV2 2Y0OA 3T2TA 3WCRA 3N8YA 1SCSA 1X50A 2YBPA 2Z79A 3S5AA 3C9AC 4ASLA 1AUYA 3EXUA 3POFA 4UFIA 2J2UB 1IQHL 1MS5A 2CHHA 3CDZB 3J8F2 3LA3A 1OHFA 4RUTA 1LPGA 5H9PA 4C0HA 4Q4W2 4S2GA 1ZZCA 2KL7A 2VNOA 1H30A 3KQCL 2CU5A 2KA3A 5DUXA 4UAPA 5A3TA 3BUCA 1XYNA 2HWB1 3FHAA 3NKTA 3THTA 1S4CA 3KZ4C 2WLQA 4XAAA 2UY9A 4IEPA 2Y81B 1VALA 2JG9B 2CYFA 2QQJA 5FZ6A 2BQWA 2Y7ZB 3NNMA 4Q4V2 1S0CA 5LZ6A 3BPSE 4XUNA 4KWKA 3V0AA 4AAXA 3CLPA 4QX8A 2R49A 3AKPA 4QD2A 5DAXA 4AEJA 1A3PA 5C8CC 1V6LA 3LA2A 1I6XA 4XVHA 1DYKA 1ND3B 4A7IA 3CJIA 3O1PA 2R1BA 1HXS2 4FT8A 1SPPB 4RHV2 2GC2A 2PAMA 3J7NA 3MLLA 1V6NA 4DUWA 2BOKL 4Y1UA 1QWRA 1NA1C 3HN3A 3POSA 2VZUA 1IZ3A 1MEC1 1GYKA 1PNGA 4Q8KA 1ATBA 1R1A1 2QQLA 1CX2A 2WT1A 1QJX2 2SBAA 2VECA 2W87A 3KVBA 4N53A 3WNKA 4AVBA 1WU1B 3DN7A 2HEWF 2V09A 5LRRA 5JBBE 4IE5A 2MGRA 5BUVA 2F4LA 4RRYA 3ZXEA 4MMZB 5ACA3 5FJHA 3POEA 4CCDA 4OULA 3IZOA 3I59A 5FYSA 5A3PA 2BOHA 4HKWA 4XHXA 5FREA 2CWSA 5CFDC 5FO8B 3OUIA 5DZFA 3M1HA 1W8WA 5FZIA 4BLJA 4JYVL 5FZLA 3RDIA 1MQ6L 4BQ1A 1NXMA 2FMDA 1LGNA 1UY0A 3ZO0B 3J9SA 1JOBA 2WNEA 5EJ1B 5ABJB 1O4ZA 4CEYC 2YGQA 1SLAA 2GH8A 3AZYA 3S0MA 3CEWA 2QNKA 4CUAA 3CS7L 4OZOA 3RFRA 2R1DA 4XTMA 1TMF3 4CCOA 5FZ8A 3DXTA 2XBYL 4BXWA 4HK9A 3FLPA 5IKTA 3KWVA 4WVZA 1AR73 5FXWA 1BCXA 3JQWA 4GAZA 1QQP1 2WA3A 4IEYA 5IVYA 1X8EA 2FCTA 4OMCA 4RA0A 4Y4YA 1CIWA 2LRPA 1GQHA 4AEKA 3D5OA 3GISX 1LODA 1Q43A 2WT0A 4YG6A 2FZ2A 1J84A 3POGA 1Q8OA 5FYHA 5A32B 3W20A 2VZQA 1W8HA 1I3HA 3AKSA 4FFHA 3KCGL 2OPKA 2V72A 4RGGA 3FHQA 2J34B 3TWIA 3TK6B 1YHFA 2P2KA 5C3SA 3RWNA 3OPWA 4ZONA 5FY8A 1DGRN 1ATEA 2OZJA 1QH7A 2HLEA 3QH6A 1H2MA 1S0DA 2CGNA 2XHNA 4ZHAB 4JQRA 2VOTA 3WUCA 3K46A 3O1SA 1JW6A 3CNAA 4O02B 2ZGSA 4AVSA 4EE2A 2VZVA 2A6VA 5K0UC 1WMDA 2Q1JB 2WFPA 4MYEA 1KS5A 3NNLA 3UGFA 4Y7AB 3LPFA 4LT5A 1QY4A 3VD7A 3D0SA 2ZAAA 2EIEA 2BO2A 4JGZB 1OB1C 2W3KB 1W6QA 2QFEA 4CDWB 4MXWA 4DUXA 3T30A 1QXPA 5KC5A 3ZFEB 3GZEA 4PI2A 5H9SA 4AYUA 5A3MA 1OPOA 3PIGA 1MVEA 3LWCA 1EUTA 3WV6A 2A3WA 1L7LA 4ZXKA 4CCLA 5DPNA 1DZTA 2FD6A 4D3WA 2A7AA 2XL9A 4AI1A 3I2KA 2UYAA 3TYJA 3OLUA 3QMOA 3GCXA 4LUMA 2XJRA 1HT5A 4MGZE 4XDQA 1O7FA 2E7QA 4FAGA 4EN0A 1W0PA 3VN4A 3ROUA 2Y6JA 3K77A 2VW1A 4G1MB 1GBGA 4Y6DB 1LPKA 2Q0AA 1WBFA 2WABA 3GDBA 3LSDA 4P9YA 5HCFA 3GZUC 2RA0L 3N7MA 5IVCA 2ZEWA 1WW4A 4LBQD 3T2OA 4RGAA 1I0UA 1NCQC 5LCWL 4AR2A 3ZFEC 2XUEA 2VRSA 1TME2 1VRH2 1F4AA 2WSVA 5D8AB 4NA9L 2JE8A 1CZTA 3OB8A 5FIXA 4U36A 1WZXA 5KHKA 2PHBB 1WHEA 5FV3A 4QKNA 2VNVA 3ITQA 2NQYA 4LLOA 4XJWA 3CJIB 5K7PA 4KG0A 5CB7A 2WWJA 3QH7A 1SG3A 1DDXA 1X8MA 4HSLA 3F1SB 3H3UA 2WS92 4CUDA 1GZWA 3WG1A 3WEZA 5A1LA 1GICA 1RUG1 3HO3A 1RUD2 1RUJ3 1FV2A 1EMNA 2R073 5IT6A 2JDKA 2I74A 2GP5A 2JENA 2QJVA 3GALA 5C3OA 5C8CB 2VE1A 4QQOA 3MFAA 2ZGTA 4P08A 4EN6B 4CEWB 1H4HA 1K12A 2P37A 4XF9A 4HXCA 1BJQA 1NCQB 4J1WA 1NA1B 1ZYBA 3QACA 3I3QA 1J58A 2FZ1A 2I07B 1UIJA 4D0EA 1KFXL 4QDQA 1HAEA 3WF2A 5T55A 4QQLA 1I1EA 4Z2AA 5T5OA 2ADEA 4XILA 4XIOA 5CAZA 1J1TA 1CWPA 1RUC2 2DUQA 3NWKA 5A33A 4C0BA 1H4GA 1X36A 5F39A 2C0ZA 1H2LA 2DVAA 1YIFA 4GWJA 3AMHA 3WCSA 1EPGA 2GC3A 3SCGA 1PMJX 2VZSA 3MUZ1 1GNYA 1RMU3 2WJSA 4PH9A 5IAVA 1RUJ1 2BSFA 4ET7A 1BMV1 2KM2A 1W28A 4EN8B 4DXZA 2RR12 5FR3A 4IE7A 3ILNA 5L7OC 4D7SA 2PAEA 5GLWA 3BCWA 5CKNA 4BDXA 3S5QA 3UK9A 4FPKA 5J37A 4XIKA 1JN2P 1U67A 4XDPA 2XL7A 3MYXA 4GKXA 4MO3M 1H1IA 4LHLA 4W6WA 2BPA2 4C90A 2R6QA 3LSEA 4LIVA 5JR2A 2AYHA 3ELAL 3LZZA 3MIFA 4WM7B 5CZKA 1AYM3 3PURA 3W21A 2Q8EA 4YZ2A 5FBJA 3KV5A 3DEMA 2WNOA 3Q8BA 1JMUB 2HWD2 4UFMA 4DB5A 4FTSA 4ZU7A 2WZR2 2YB7A 3MIBA 2IXHA 1RMU1 4D7TA 3WX5A 1LOCA 2RHPA 1QQP3 2AEYA 5C4WA 5A6XA 4GWIA 1CQ9A 4N9HA 4NR1A 3H8RA 4HLTA 3MGUA 5J09A 2B7DL 4GA9A 1QOTA 4CCKA 5CU1A 2VZPA 3ATGA 5FMCA 1DIYA 4UBGA 4XBQA 2UWOB 2JG8A 2Y8KA 3VDCA 2VMHA 3VBHC 1W05A 3IIIA 2WZ8A 3H1WA 5FO7B 3ACHA 3KV4A 1EAH1 3WF3A 1HB1A 2VUDA 2GAUA 1CPNA 4Q4Y2 2NLRA 1ZBA2 4QDRA 2D6OX 4COZA 3TNQA 2XLAA 4DRVA 2YZ4A 2ZX3A 3VHRA 4A3ZA 1SDDB 1JHJA 1UMHA 4KBZA 2BOJA 4AI2A 2XLFA 5K0UB 1UOFA 1VAVA 2YROA 3ZFEA 4NO4A 1OA2A 4O9EA 3VBRB 3PU8A 5A6QA 3N9PA 2DURA 5FPBA 1UY1A 5FPUA 1R081 5FZ0A 2CV6A 3SOVA 3HT2A 2BVBA 2MNGA 3SLIA 1US3A 1NOVA 3BPSA 3ZSJA 4K8RB 1MS8A 2HH9A 4JAAA 1ZZ6A 1K45A 3BI3A 4A94C 3VBHB 3ACIA 4M4RA 1AL0G 2Y60A 1LAJA 3ZYJB 2BOUA 3ZSEA 3T0BA 2B9VA 1WBLA 5FLIA 1ENSA 2BGCA 4MV2A 1FNZA 4RR3B 3JU9A 4COYA 5LA1A 1YIPA 1W8OA 5I0SA 1BHGA 3LDKA 4BXSA 3HMYA 1IQIL 3KB5A 4UT5A 5A6YA 2JIGA 4GMP1 3POWA 3OBZA 3P5BL 1OUSA 1JI6A 1C5IA 1J3RA 4I01A 2QVSB 4IV3B 2DTWA 4Q2FA 1FOD2 1WLDA 3VBRC 4A4AA 5C5TA 1BBT2 3B94A 1AYN3 5AC92 2BEOA 4NWWA 1RVF3 3VBOB 1J59A 4AG4A 2DV9A 2J1VA 1COV3 3LEKA 5SV8A 4QAWA 1ND2C 1UU6A 2V5YA 2ZBJA 5L73A 2FDFA 4OHYA 1Q4GA 2XVKA 1C5HA 2Y6KA 1C8M3 2BT7A 3IDCB 1IP0A 1LHNA 5SV5A 3DPRA 4GH4A 1W2AX 4CP2A 2EICA 4DQAA 2JDPA 1G2LB 1HT8A 2JDAA 3D3AA 3H1YA 4AFDA 4DRRA 2FMYA 3I2IA 5E16A 1CR7A 5C33A 1O5LA 2VVDA 4L2NA 4OTYA 3CJIC 2VH9A 5FQ0B 3BU7A 1WMXA 1XNKA 1UD1A 1YQ5A 4GZ9A 2D6LX 1W8NA 4NHMA 4XTPA 3GF6A 4NPMA 4IV3C 5KXBA 1OSGA 2AACA 2AZ5A 1SBEA 2VBBA 2VJXA 2XBXL 3AP5A 3CO2A 3MF6A 3VBOC 5I8YA 2AYLA 4YVSB 4ZH8B 4CDQA 1D4VB 1UOJA 2G4IA 1JBCA 1DZRA 1X33A 2ZMLA 5G05L 2VAUA 1OC1A 5L19A 2R063 1YQCA 5J1XA 4EWEA 1RUD1 1O3SA 1JYTA 4U2AA 3NNFA 2ZEXA 4Q1PA 4R9CA 4FPEA 4PDWA 1POV3 2VTXA 1IGZA 3AMPA 2LM3A 1J83A 2JEMA 1LTEA 4Q26A 4FQZA 1UZ0A 2XQRA 2RJLA 1QXJA 4B7EA 1W9WA 5FQ0A 1NT0A 2EALA 3KGZA 4L97A 4CYDA 1F35A 3TN91 1V6OA 1XNDA 4HETA 3P5BA 1S0IA 3VD9A 4XBMA 2PR3B 1AX2A 2JX9A 3LAGA 1UWWA 1JHNA 1LOAA 4LUKA 3NQHA 5JIAA 5BNQA 3JQXA 3H9AA 1MOXC 3NW4A 3IIAA 1FOD3 3ES4A 1IPKA 5ANQA 1BBT3 4UF0B 1O59A 4XAEA 1VLNA 3KVAA 3PUIA 1E5HA 2CAUA 4Z1VA 3AX4A 5FPVA 3X29B 3LEGA 3M8LA 3W5MA 2VOKA 1YGCL 2HORA 3PIJA 2VQUA 3AP7A 4PT6A 4XUOA 4YYOA 3T4VA 3ZVXA 4CPBD 4BQ4A 4QGNA 3NO8A 1HAFA 1URXA 4AEMA 1KRIA 4PIZA 4QPIA 1EPWA 5F2SA 4EROA 1HQWA 5C71A 2VXJA 1H8TC 2OQ6A 5HV4A 2UYBA 4XFBA 1RJ7A 2A3YA 4EYUA 4GJZA 3WW1A 4DFSA 5JXHA 1T2XA 2FLGA 4FI9A 4HPKA 2XONA 2G00L 3Q3KB 3ORJA 4NPRA 1WUVA 3OBTA 5ABJC 3AFGA 4NPLA 1YFYA 3KV9A 2Z4FA 1O5UA 3IPVA 1QJEA 2N7GA 4XABA 2VWNL 2VMDA 3KCYA 3U73A 4Y5Z0 5DAWA 2Y6LA 1BYHA 1IQJL 2J1AA 3TK5B 3D6EA 3DGTA 3MIEA 2VWMK 1W8ZA 3HT1A 1UXXX 4KI5M 1AVBA 1V6MA 2R16A 3T2QA 1ASJ2 4XF3A 1XU1A 1EUUA 3LIGA 3M70A 2A5ZA 4MX3A 3OPTA 3VHNA 3E5XA 1JZ7A 2WLPA 4JZDL 1FI2A 4GMP0 1ENXA 1LHUA 5H9QA 3CU7A 1ZAQA 3F95A 1PO12 4LE3A 2TGFA 2VC9A 3U4SA 3GM8A 1QJU2 2XJSA 4K6BA 4NIGA 5IK7A 1N1YA 1OBNA 4OI2A 5A1FA 3ZFFA 2ARXA 2W1QA 3M36L 1IS6A 1CJPA 1W3VA 4YG3A 3ZXDA 1OFSA 4KGGA 2PFWA 1TPGA 2WN2A 4LLFA 4AL9A 1LESA 4Z82A 4IV3A 1OH3A 2VZTA 1X9PA 3WR0A 4NRMA 4A45A 4Q4W3 5I0DA 3LF7A 1YJLA 5EHDA 5JPNB 1Z0HA 2JDZA 2XWJB 3VKOA 3IITB 2TNFA 4R4XA 4CA9A 5AC93 4GMP3 4EQVA 1UAIA 3AM2A 4LBKA 1N7DA 4YM0A 4YW4A 2QUOA 3WP6A 2RDSA 2CAVA 2J1TA 3O1OA 2OA2A 2ORXA 5LY2A 2P28B 1WWYA 3B3QE 5A3NA 4YFZA 3GCWE 4PF5A 5IVFA 5FZBA 2XBO3 2R043 5CG8A 3K75B 3MIDA 5JZGC 4IE4A 4FPFA 3V0BA 3MFCA 4LJHA 4N7IA 3RI9A 3MW2A 4CDWC 4CSYA 3J7MA 4P9WA 4RFRB 3FLRA 1MZFA 3MDLA 2BNNA 3MV11 4IV1B 2YFZA 3RMYA 3H50A 1VMHA 4H7MA 3W5NA 1XE8A 3HJRA 4FP2A 2ARCA 3WQBA 2YBKA 2WWUA 3MUY1 4PCRA 4RSUA 4LULA 4XJUA 4HN1A 3I49A 4O1ZA 2GNDA 1TMF1 3VD5A 1XOYA 1OMIA 4K1YA 2AREA 3HO4A 2HOXA 2OXBA 3MBWA 4K21A 4YVSA 3MHZA 4Z0LA 3LCPA 4FBFA 3KK6A 2D98A 2I45A 5F8PA 4FOYA 3ZSKA 4KMQA 4IEZA 2A6WA 1FMD3 3Q9OA 4NOTA 4XJAA 1S0JA 2TEPA 2FBEA 2ENRA 1P8JA 1HRI3 2ZGRA 3T09A 5IVEA 1ZZBA 2ADXA 1V9U2 2DVGA 3JCIA 4GIQA 4GULA 4C91A 5HI0A 3H7YA 3N8XA 2MHFA 4AEDA 2WIIB 1W9YA 4P9IA 3H7JA 1V00A 5DN2A 3P3PA 1KDKA 3LFMA 1O4YA 1EP0A 1ZZ8A 3C2UA 2XR4A 1Y43B 1HRI2 2VMEA 1W2NA 1XYPA 4QPIC 1PVC3 4FTBA 5D21A 1U5ZA 4Y1YA 1GNHA 2HBTA 3HWJA 2LUWA 4BIOA 3IAPA 1LHOA 1ZBE1 5L7OA 2JKBA 1SZBA 2JDYA 3AP9A 4LHSA 4QGMA 1F2NA 3NJYA 2CDPA 4HKOA 5CFCB 2MHPA 1BZWA 3PVEA 2W92A 1OURA 2BGOA 2FLRL 3N3HA 4YM2A 4LO4B 2CY6A 5FY1A 1V1HA 4DINB 2VH6B 1KSNB 3IKWA 2QDNA 1POV0 1DQBA 3EBRA 4EN9B 1UW8A 4IEUA 4YGEA 4UXAA 4M10A 2KB9A 2W46A 2NZ9A 3FBYA 4HBNA 2ZPXA 3PUQA 4B4RA 1PK6A 3FE5A 3KGLA 5FP7A 1PVC1 2MPFA 5JMOA 4ISHL 1W8BL 1O6UA 1R092 3N8ZA 2JG9C 1QJU1 5KHIA 4IGOA 4IEWA 2ZEZA 5LY1A 2BT8A 2W2PE 4E1GA 1G1QA 4H55A 4OLLA 4XJ9A 5E88A 3I2FA 1PM4A 4ZS3A 2WNUA 2P26A 2ZX2A 3SXWA 2Y7XB 3IPVB 4V2VA 2VWLL 4Y3OA 3ILFA 3KL6B 1NG0A 2HWD3 3RG0A 2P3IA 1AR92 1UZPA 5F1RA 2WAOA 4GD4A 5IHRA 4HVRA 4KL1A 3WNMA 4C8DA 1AF9A 3SC7X 2OQ7A 1UMIA 4TYSA 3UV9A 4AQTA 1RUD3 3ZYPA 1G1SA 2EIGA 1I5PA 4NJ4A 5F19A 2NM1A 2WNVA 1HX6A 2WS93 3HNBM 1G7YA 3RZLA 2E7TA 4LKSA 4QKDA 2CL2A 2Q1FA 2XVGA 3TZIA 1W6NB 1VBD3 3NT1A 1GLHA 4KG8A 2E51A 1EGFA 1DQ5A 2ET7A 3VKFC 3A22A 3C7OA 2HWB2 1U8CB 2XJUA 1WCKA 1ZNPA 1PO22 5BV6A 3DECA 1DYPA 4Q8LA 5KIRA 1AR83 1UN1A 2BOIA 3KQRA 4WVMA 2EAAA 5IFTA 1GKBA 1VRBA 2NYYA 2YC4A 3VL8A 3WSOA 4CCNA 1FOD1 1IQDC 4CEYB 2LS6A 3C8XA 1K5MB 4G3YC 3VBFC 2HWB3 3WDXA 1NLQA 1XDTR 3LEIA 1V0AA 1DBNA 1PTHA 2OX0A 1JYCA 4KQ7A 4B29A 2WYSA 1YUFA 3ZYGA 4HANA 5K0HB 4XC9A 3PGHA 2WPME 2H0VA 5CISA 2ZGMA 4XW3A 1EQHA 1TME3 1VRH3 1XC6A 2GH2A 4CCCA 5IK5A 1WHFA 2DVBA 1Q8PA 1AJOA 4DPNA 1YFXA 3RZHA 2XBO1 4BQWA 3BT1A 1AR81 4GKYA 2J1SA 1FATA 3TH3L 1S0BA 5JZGB 1WCUA 2GZWA 4YZ3A 2OPWA 1MR5A 2PHTA 2J42A 5F6LB 3TEYA 1SLLA 1CPMA 2BP6A 4LO5B 4IV1C 4RRZA 3TEZA 4FXKB 2PLV1 3VGIA 1G8WA 5C8CA 2VUCA 4K20A 2XC0L 1CVUA 1MZEA 1IQAA 1H1AA 2R072 2VZOA 2WZR3 2ZABA 4GALA 4Q0VA 4RR3C 1AL21 4M3CA 3WW4A 1AR93 2D7FA 4D0FA 2UURA 4UOJA 3UKVA 4BQYA 2Y0IA 2VG9A 1NA1A 4P5HA 4UW5A 4BISA 4DXRA 4YVWC 4IQPA 1V9U3 1VIWB 4KU7A 4HG6B 1F0SB 3TGFA 4PI0A 1EAH2 1QH6A 1QJZA 2BNMA 3AP6A 2RMU2 2F6BA 2VMFA 2WZEA 4PBPA 4YT7L 4E4HA 3I2OA 3TOJA 4UYBA 1H1MA 2ZKNA 1EMOA 4JGZC 1PK6C 4Q4V1 2JDUA 2Y64A 4PBOA 4PLNA 4HVQA 2VVFA 1ND2B 1C57A 1NYWA 1GP6A 2YG0A 3AYCA 3DF0A 3FCSB 2FHRA 3K3NA 5FP4A 2VO5A 2WC2A 4BB3A 1L5GB 1HV1A 2UWLB 5FP9A 5CFDA 4BQ3A 3IDAA 3QD6A 4XF4A 3WT3A 1SFPA 1EZQB 2HJIA 5BNOA 4BTTA 2DCJA 1IOEL 3M37L 3AZXA 1NY71 3RYPA 2P1BA 3NJZA 3PUAA 2LW8A 3T0DA 4HZFA 5FXZA 1LECA 1NX9A 2QKDA 2VGDA 4XUQA 2Y34A 4G4FA 4AHWA 2ERFA 1ZRIA 1LU1A 1S1AA 3QOPA 5JCTA 1C5MF 4P14A 1U5XA 3V56A 4FO9A 1LU2A 3ETPA 5LRSA 5LATA 3BIEA 2PELA 2Y6HA 4Y5TA 2RS53 1GOFA 2ZZJA 5I0UA 1VR3A 2R041 1PK6B 1VAMA 2YV8A 3GXUA 3N9QA 5GJ6A 5CEHA 1W9FA 2A73B 1KJRA 1ULEA 2VCAA 3AJZA 4LR4A 1YYNA 2P34A 3AYDA 4RS5A 3BTZA 3VKLA 1JOJA 1LGBA 2OKXA 4QX0A 3WNOA 3U78A 4BMBA 2WYGB 2FCUA 5F1AA 1APOA 2QTWB 2UWAA 5DXDA 4A6OA 3EO6A 2QQIA 2VVVL 2W95A 4OUSA 4AI0A 4A2UA 1X7NA 1VBE1 2SLIA 2BQ7A 3FHIB 1RVF2 4MADA 3B9CA 2X5IB 1O3RA 3GZAA 2FZZL 3CJXA 2BZDA 5DAQA 3UKNA 1K37A 5A7WA 2O0OA 3HQUA 1FMD1 1P9JA 1RUI3 1Y3TA 3MDPA 1RUE2 4ISRA 4LXLA 1F4HA 2PA7A 2BJSA 3O0VA 2XHKA 1AR61 4A7KA 2ZHLA 2ZHKA 4Y20B 1C8NA 1SCRA 3BB6A 5DDJ2 2HWC3 1SLIA 2WO7A 5K0UA 1D4M2 1YJKA 1X7AL 2RV9A 4Q0PA 1VJ2A 1N1VA 1NUKA 2ZAHA 2Y6FA 4PIYA 3PU3A 3KMHA 5E89A 3UESA 4LMFA 4F3JA 4LQRA 1RUE3 1PGL2 1BK0A 2WS91 1KDMA 4FPJA 5C4WC 2W2IA 3L2YA 1BLZA 3WVJA 3RZGA 1OFNA 4NVPA 1HREA 1F8VA 4OYUA 2X5IC 4NGAL 1CN1A 4IUGA 5JDBA 5CG9A 4N8MA 1JZ3A 3ABZA 4F7ZA 1XNBA 2JG8C 2P3FL 3SH3A 1RITA 1IKPA 4CEYA 3JZVA 3B5LB 5I46L 1SMVA 3AZZA 3HQXA 2CJIB 1KLIL 4HKLA 3CENL 1OPMA 2ZGPA 3PHMA 4Y79B 4MHRA 3KCCA 2VQAA 5DG1A 4YW5A 1LB2A 1VBC1 3JBG1 5A80A 2JE9A 3N36A 5T5LA 1PGW2 2R0HA 3J4UH 3JB8A 3EB7A 1QU0A 3BODA 3SMHA 2FQPA 4X8UL 1JXNA 1GUIA 1CZSA 1UPIA 3BTAA 3MPBA 3CBNA 4MSVA 2IZWA 1AYN2 5B2GB 1E5SA 3VBOA 2VOWA 2H9EC 1KITA 3CL1A 3ZIXA 3RJ2X 4D90A 5A70A 4CU6A 3AYAA 5DDJ1 3BT2A 1PIV1 2PHWA 1EPJA 4NHYA 2EXJA 4E8CA 1ALYA 1ENQA 5FZOB 2RR11 5JZGA 5GKAC 3ZXAC 1Z7S2 4GH4B 2GMEA 2D5HA 1PX4A 2B9UA 1XSQA 4KNCA 3VHOA 4Q4X1 4MGTA 1JL9A 3G6JB 1VPHA 3MICA 1Q5OA 1NCRB 2YU1A 3A0KA 3AP4A 4QXCA 4OHZA 4DS0A 2WFF2 2BBAA 4FPHA 3EQEA 4DY5A 3MV01 3H0OA 4QKBA 2AENA 5F6KA 5BNOC 4MH0E 2CGPA 2W3IB 1QKQA 2RM23 1VBC3 2PXJA 2XJVA 2MEV2 3JBG3 1OQDA 1WMFA 2VM9A 3KD4A 4CDUC 2VW2A 4QB6A 3WNNA 2XC5L 4UFHA 4DIQA 5IJRA 3TEXA 3VZMA 1RUNA 4MG2A 3WG4A 2ES3A 4EZHA 3Q8FA 1XQNA 1XNTA 1AR91 1U12A 4FFIA 3C7FA 4HFSA 4AFMA 4ATFA 4Z8BA 1CAVA 1JTZX 3SHRA 2VCCA 3NSTA 2C5DA 1UO9A 3FFGL 1DQ4A 1K3IA 4Y33A 1RUH2 3W9AA 5FKCA 2WR9A 3OUHA 1DFQA 5ACA2 1STMA 4W6XA 5BNOB 1IG0A 1TZOA 1W6OA 3LA7A 2B42B 2YUEA 4FAHA 2P3TA 4JVAA 5JB8E 1D2QA 1NQDA 2ZHMA 2HWE1 3CFWA 4AF9A 3K2OA 4CDUB 1W8UA 2Y5HL 4Q29A 4LO6B 3BPZA 4CP9A 3RQ0A 3WF4A 2GNMA 5CVRA 4M3CE 4QQPA 3WXPA 1S2EA 3I8TA 3BU0A 3OTFA 2CNAA 2O1QA 3BIWE 4RS0A 5E1RA 1O91A 4CDXC 2RS13 3D0JA 4KBBA 1NCQA 2O8OA 3E97A 2M74A 2I9AA 2DBIA 4K7JA 4UF0A 1WCDJ 1H9PA 1IOAA 4N53C 5KHJA 4A7ZA 2RDRA 3BGAA 2QQKA 4AZZA 1YCIA 3D8CA 1TQ5A 2VQ0A 1ONAA 1LMJA 3PUSA 5FY4A 3VLBB 2ZGNA 3WHTA 4F8AA 4TXWA 2A71A 5JOXA 4Z07A 1G9DA 2WPIE 4JKLA 2PYTA 2ZACA 3L9JT 4S2HA 1D7PM 3V65A 3LGRA 2X5IA 1ODNA 3WW3A 2PLV3 3AB0A 4IEVA 3N35A 4Y5SA 1LENA 4R9DA 5FZHA 1H0BA 1Q3EA 2E31A 4MGYE 1NFWB 2YYOA 3CZJA 2B4KA 2MEV3 2VUAA 3BTYA 2X53S 2RS32 2LROA 3VBSA 1HXS3 3VV1A 4Y20A 3WNXA 1V9U1 2JXAA 5LBBA 2Y5GL 1RHI3 3RZKA 5F3GA 2D3PA 2GMMA 3N9MA 2FDKA 4JCKA 3FLTA 3LPGA 3PVNA 4OZXA 2ZMKA 1PGL1 4Z2WA 3ECQA 5FZGA 4LK6A 3CIHA 3HD8B 1FPN2 1YQ8A 2BZ6L 4BLIA 3OF1A 5J96B 4KWUA 3AL6A 1UOGA 5FZKA 4AQ2A 3O12A 4IE6A 3GCXE 4COWA 4CU7A 1H6YA 1RUF3 1TVGA 5BY5A 2Y82B 2VCBA 4LOTA 1W6PB 1N3PA 1VBA2 5FY7A 3SITA 1YUKB 1APNA 4QPGB 5C4WB 1LGCA 3IWZA 3RYRA 6COXA 3PTYA 1GSLA 1DQ2A 4E4SA 1FFMA 2ETEA 1OVPA 2ATFA 5A6ZA 3A23A 1AHSA 3WW2A 4SLIA 4CXXA 4YFWA 2VOVA 3NVCA 3PLQA 2JG8B 3IB3A 1UPSA 2DBNA 2OW4A 3NJPC 2XJQA 1IQLL 4FOQA 4AQ6A 2OT7A 4TGFA 3FX3A 1RVF1 3H42B 1UZZA 1IKQA 1PX3A 3A4UA 3E5QA 5FYYA 5LBFA 2NPRA 5C7GA 2P94L 3HVDA 2A3XA 3ZXJA 1T6BX 2IVJA 3M3IA 3ME2A 4I02A 5F5CA 3R0RA 1RUF1 2W1SA 4LBOA 2E7AA 1G9BA 4RD7A 5FK7A 3POIA 1A6CA 1N1SA 1PXXA 2BU9A 1JH5A 1NXD1 4QPGC 1PMIA 2ZJCA 1L7QA 4Y26A 5T50A 4K40A 1E57A 3B93A 5JW1A 2VXRA 3K4AA 2XOMA 4Y71B 4XZUG 3ZXLA 2EXIA 3IBMA 2E63A 1JV2B 1E5RA 4NMIA 3WNLA 5KN5C 1YNAA 4GH4C 3GJBA 3URFA 2PLV2 3U14A 2HBUA 2Z2SB 1AR62 2JJ6A 1SQ4A 3CMGA 1KQRA 1PNFA 5C3QA 1NCRC 1LOBA 3QH0A 1H8TB 3FMGA 1GWKA 4N90A 1J1LA 3ZN6B 2HEYF 2ZX1A 3OY8A 1GQGA 3M7AA 4W6YA 1IS3A 2RM21 1H9WA 2WL1A 1CCFA 1EPHA 4YZ4A 5E8DA 5HCAA 4BE3A 4MUVA 2TUNA 4MXVA 2B39A 1HRV1 1QQP2 1K5MC 5DAVA 3VBFB 4M0NA 2JB8A 1QMJA 2A70A 3HEIA 2OUJA 5EP9A 3W58A 4E2SA 2EF6A 4BU2A 5KWRA 1GZ9A 4XL1A 1K36A 1VB4A 1CIYA 2XG3A 2WO1A 1BVP1 4S2FA 3TB0A 4NG9L 3FWEA 1IG3A 4IETA 5M0TA 3PNAA 1MS0A 5JMCA 3SCHA 4BDWA 5FZEA 2R071 1UYYA 4Z92B 3VHPA 1SFNA 4XZPA 5E8AA 5JI7A 1GOHA 2RDQA 4LBJA 2QQNA 3PUHA 2JWPA 4QT6A 3S7EA 2AC1A 1DGLA 1CD3G 5C9AA 1QXRA 3LIHA 5I91A 2W1WA 5L9RA 3PJQA 5T3NA 4AK3A 4EV0A 1HJ7A 3BYWA 1UX6A 1VBB1 2K9ZA 2YPDA 3ETQA 3KSCA 2ZX4A 1AR82 2JB4A 4XF1A 1E5IA 5JPMB 2DU0A 3WOGA 1G1RA 4YRDA 4E8DA 4ZXEA 1H8VA 1RTVA 4I09A 2DFBA 3ACLA 1PM7A 1ZM1A 2FCVA 1DHKB 4PJYA 1FPN1 3ENRA 5HBAA 1L7RA 2PN5A 4CRQA 3Q8CA 3MQEA 4FM5A 1PO23 2BV4A 2RR13 5GLTA 4OTJA 3GBFA 2E33A 2UWPB 4DUVA 3O1VA 3LEMA 1L3JA 4YGCA 4Q4X3 5DMYA 4W65A 1MEC2 4N53B 4Y24A 3P1IA 1N3OA 2IXJA 2EIBA 2VL4A 3GCWA 4P9JA 4PDWB 2I2SA 3WDYA 3TRSB 5JXJA 1HW5A 4CVUA 2ET1A 1CAWB 2RS31 4K1ZA 4AHYA 1HB4A 1G1TA 2UY8A 2UWBA 1LR5A 2P6CA 1CGPA 2XXZA 3LQCA 2Q1MA 1RC6A 3ZFGA 1DGWX 1XB9A 3ZDSA 3KCXA 2G9ZA 4UFJA 5GZDA 4ATEA 2EXKA 4XMAA 5K4LA 4TTGA 3U07A 4HSJA 3BN6A 5T54A 4NN0A 3VDBA 3ZR5A 1BQPA 1YI9A 3HIFA 4NRQA 1JYWA 5JBCE 4AFCA 2WAAA 2QQUA 4X8NA 4QU2A 2J1UA 2K0GA 2PHXA 3NV3A 4LOSA 5AFEA 1YFUA 5KXEA 3PVBB 3DL3A 2OYZA 4PDWC 4QPGA 4FFGA 2WPHE 1DIWA 2QQVA 1HB3A 1NKGA 5CKQA 2D6PA 2GC1A 1VMJA 3RZMA 1OLQA 4B4QA 1GU3A 5JOWA 4HL0A 1HX2A 4XE9A 5L2ZL 5IWFA 2Q8CA 4Y76B 4XF0A 4QPIB 1JUIA 2Y6GA 3ILRA 5A32A 3OG2A 4DNYA 3CHXA 3I2DA 4WVMB 2XPJA 1HJFA 3NV2A 3ZX7A 4XFHA 1FV3A 1W04A 5BNNA 4QQ2A 2DU1A 2EI7B 1P0SL 2W2QE 5FZ4A 1JZ8A 2JE7A 2WBKA 1DLCA 1F15A 1HKDA 1IS5A 5CFCC 2G9FA 5CKMA 4WM8C 2C4XA 3C7HA 3RJRA 5KHGA 1B35B 2QQPA 2OYEP 2VMGA 2DCKA 4LK7A 1D2SA 4QPYA 2WFTA 1OLME 4YW2A 2GC0A 2W94A 4AVTA 1DQ6A 5F32A 3VD3A 2IFWA 1ZZ7A 1IOXA 1S2BA 2RS52 5FWEA 5DAPA 4CUCA 3O0XA 3M3QA 5BPXA 2FDJA 3ZPYA 4DY3A 2XBVL 1QGLA 2WQ4A 2ZTNA 1RUOA 1W90A 3VZKA 3QCWA 1WLWA 2CWMA 1PZ7A 1W6QB 2MEV1 1LHWA 4PIXA 3OY8B 5JSPA 2Y5FL 2G19A 4TLFA 1RINA 4M01A 2PMWB 5EFUA 1AX1A 3ZSMA 5KR7A 1JYXA 4Y22B 1AL22 1AX0A 1RHI1 1PO11 5IATA 4OHVA 2WZPP 4Q0QA 4LEJA 1ULDA 1B35C 1HRI1 5FUPA 4CXWA 4P9GA 2J38B 4GWMA 4YSFA 4Y1XA 1GP4A 1URKA 1UCXA 3ZIWA 4D69A 1UOBA 1Z7S3 4B1MA 5I93A 3U1XA 1PIV2 2P3FN 3VDDB 1JBUL 4CTEA 1ULOA 1XNCA 1KLJL 3S57A 1XU2A 4H14A 4PF1A 4XPVA 3PMEA 2XQXA 4FPGA 2WFF3 1HRV3 1UXZA 1UZWA 3EGFA 2XDVA 1EAH3 1CX1A 5GZFA 1M4WA 1D4M3 4D7YA 5DABA 5FCCA 2TBVA 1D0GA 5B4XA 5J3UA 1S0GA 3ZM8A 1ND2A 2ZMNA 2JIJA 2FDGA 3B02A 5IK4A 1XE7A 3WQ0A 2XUMA 1ZBE3 4ITCA 3UT0A 5L2YL 3NV1A 5IVJA 3M3EA 4RYDA 4QM9A 3V0BB 2WPKE 1MS1A 1IQKL 3VZOA 4XUPA 3E6DA 1HRV2 1RUI1 1WA4A 2DFCA 3UETA 1LPZA 1EV12 1LNSA 4Q5OA 2W2NE 4NIAA 3SQOA 3NTGA 3JXSA 2CDOA 2Q1ZB 3LB9A 2YXSA 5FTTC 3LN0A 1COUA 2Y26A 2Z42A 4XUTA 5FZAA 1BKZA 1UU5A 3K4ZA 4ASMB 4CSWA 5JAXA 2QZ2A 4FPYA 4A42A 1RXFA 3NTBA 3U7UG 2BWAA 4X8SL 1I9RA 3IM0A 1FNYA 4CCEA 3KHCA 3CZUA 3VL9A 2D97A 1VE0A 5JOZA 1V70A 2ZKLA 5EZWA 1QF3A 1YLLA 3I3DA 4RS5B 5LEJA 4YM3A 2RG4A 5FP3A 1W8FA 4P02B 4LBQA 3A0NA 4TSVA 2I9BA 5FOJB 4YGDA 1JYNA 3DYMA 2K2TA 3IDEA 1PRHA 1QJY1 4FPOB 2RDNA 2XKOA 4QXBA 5FY9A 2ADDA 1WD3A 3AMNA 4J6GA 4EWAA 2EIDA 1K42A 5FLHA 1ULGA 4CP1A 5A33B 5LW9A 4MGSA 3S7IA 4NAMA 3AZWA 5A3LA 1MACA 2QE3A 1KS4A 1HLCA 3DKQA 3R6SA 1UYPA 4QPWA 5FMOS 4OVEA 5LBEA 4EJRA 3C7GA 1GK5A 2JD9A 2WNUC 4QMAA 4XMIA 3AKRA 4INDA 5CFCA 4CXYA 1O4TA 2X10A 4H7LA 4OI4A 3DXUA 5DDJ3 1N3QA 4ES9A 3N7JA 5FYCA 4HMZA 4YVWB 4IESA 1VBD1 2EVXA 2V4AA 3WQ1A 1JZ6A 1KEXA 3OPZA 4AXOA 4BYYA 1VBA1 4N43A 1N1IA 1WW6A 2D6KA 1L3YA 2QBXA 3K3OA 5EJ3A 3BALA 1SDWA 3USSA 1DQ0A 5IKQA 5IKVA 5IAXA 4HN0A 1QJFA 3ZXKA 3AYEA 3HN1A 2J94B 1NY72 2XGXA 3OGRA 5GALA 4BTIA 3WDVA 4BCUA 1OQ1A 1M1XB 5JUVA 4NHKA 3K4DA 1HQNA 2BNOA 2W5FA 4XBLA 5FZ3A 1UL9A 4W4ZA 3NAPC 1NFYB 3KLSA 2P4EA 2R7EB 3OUJA 4AW7A 1Y9GA 5G04L 1ATAA 4COXA 3R4UA 5LEKA 4OHWA 2HWE2 1W2TA 1B9WA 1OH4A 4A41A 4CCJA 3KT4A 5ISLA 2W9XA 3RZJA 2AUYA 3ZDVA 5IK8A 2NN8A 2WWSA 3ES1A 2G1MA 4YZ1A 5ACA1 3M4FA 1CONA 3HS6A 5D8AA 3MW3A 1GANA 5L30L 1FAYA 2WO2A 2WNVB 4AHZA 1FXZA 2VCMA 4YW7A 5FZOA 4BA6A 2IFRA 1PFXL 4Z0KB 3ST7A 1HQLA 2RJKA 2R32A 4O9GA 5FY0A 1KIGL 5HV0A 1OQEA 1GZWB 1ULCA 4QB1A 1SACA 4LA2A 2BFUL 1VBC2 3JBG2 5FYTA 4F83A 4EWDA 3ZFFC 1Z6CA 1WKYA 1VMFA 1HJGA 1ATDA 1WGPA 2AGSA 2GU9A 2D6NA 2XBO2 2XJTA 3B7MA 4NHXA 4I30A 5EYYA 2RS11 1OA4A 3LE0A 1SBFA 2JDHA 1W2UA 4WV8A 1OLMA 5EQUA 4L8QA 1UIKA 2WNVC 3MLKA 3LAQA 3RS6A 1OKQA 1Z7S1 1HN1A 1F31A 5A7NA 2YMZA 2NPIA 1BEV1 3LIWB 1LHVA 5GLUA 3W59A 5FAXA 4NIHA 1UY2A 4RQPB 1NLRA 3FJSA 3F2ZA 1Q56A 4LO7A 4UBHA 3VZLA 3WG2A 3AZVA 1IHMA 4X8PA 1BVVA 3WF1A 3QBQA 3PJYA 3VKNA 1D4M1 2C9KA 2JD4A 1RJ8A 1FMD2 1LJ7A 1RUF2 1W6OB 1DZQA 4WVWA 4ZXXL 1W6MA 2OYUP 5FY5A 3ZYIB 4KGQA 1W8TA 3JUUA 1Z78A 2J22A 3OCPA 4K3UA 3USUB 5KXDA 1O8PA 2DVFA 1W0NA 2IC1A 3O1UA 2HYKA 2YC2A 2WKKA 2VPVA 4ZPIA 1U5YA 1MZ6A 1G2MB 4R9BA 2VNGA 2YGLA 5DUUA 1YXWA 1VBE2 5GZGA 1F0RB 1FJSL 2D6MA 2DUOA 3NRUA 4JDMA 4FTEA 3N8WA 1QJX3 3OLTA 3ZOIA 1XNAA 1OOPA 1R64A 5F37A 4IDZA 4LBQB 1QJY2 3OSDA 4JV4A 4AVVA 3V64C 1YFWA 4V2WA 4OQ9A 4DXTA 4YT6L 4BOWA 4NROA 2H0BA 2PHUA 3WDWA 2Y80B 3TBDA 4BTUA 4GJYA 2ZS6B 5A1AA 2K2SB 1HCGB 4CUFA 1VBE3 2VNRA 2R042 3KT1A 4RS5C 2XC4L 1LOFA 1DGWA 3SCFA 4JX0A 4BXFA 3MEPA 5K8SA 2H6CA 4ZAEB 2YGMA 3J8F3 1GZTA 2LTNA 1XFEA 2B5HA 3POYA 3CF6E 1UY3A 3C3VA 2VR4A 3EMRA 3DYOA 1IJQA 5CIRA 3HBKA 5LK7B 1PGW1 3ELNA 2XJPA 5BNPC 3OBAA 5HXVA 5DUWA 2V5DA 1R083 5FZMA 1PMHX 1HIXA 2C26A 5IUQA 2D5FA 4GU4A 2WO3A 4KWLA 4EZ4A 3WP5A 2ZZQA 3GYDA 3I7DA 2WFF1 3MPPG 4UWDA 5GLVA 4ASKA 1U0AA 4M0HA 4MGQA 2CSGA 3ACFA 4QX7A 4AVCA 5FZ7A 3O14A 1POV1 1JU3A 2ZGKA 2W3JA 3VBRA 5LA0A 3T3YA 1X82A 1Y9QA 1YQ6A 3B01A 3PTRB 2WPLE 2A1XA 1NQJA 1KXGA 5JVVA 2ZGOA 3LC5B 2GALA 3IAQA 1DQ1A 1EPZA 3Q7DA 2P6HA 2W86A 3C7EA 3PVOA 4JHTA 4RHV3 1NAEA 1VBA3 5L36A 5LBCA 2QZ3A 3WY6A 1A3KA 1A8MA 5FFOC 4AGVA 4B7KA 2E26A 1UY4A 4CZSA 5EPAA 4ZU5A 2PUQL 1ZRFA 4OUEA 3ZSLA 4XLWA 3K9XA 1SLCA 4QX5A 3VBSC 1RUJ2 1C8M1 5FO9B 1PVXA 2Q30A 4LPLA 5AVPA 2AR6A 2ZA9A 3KQ4B 4HONA 4A7YA 1LKNA 1YUGA 4COUA 1PZ9A 2RS12 3UJQA 5HCHA 4I2OA 5C3PA 5FDBA 5JBAE 1EQGA 5J48A 3KQDL 4R4ZA 5FRAA 4D6SA 2O8QA 1TOZA 2Q5TA 3VD4A 4CDXB 4L11A 2DYCA 4Q0SA 4AFBA 1R1A2 1JODA 2DTYA 2E6VA 4GB33 2B45X 4FSJA 4UW6A 3A7QA 1Y9MA 2VQTA 4JGYA 2QQOA 3ZXFA 3NV4A 3T0AA 1W0OA 1TMF2 3D82A 4AOCA 1KJLA 4URTA 1VBB3 3V0AB 5FOBB 5JXIA 1NFUB 1MS9A 3POBA 2KD7A 4Y1ZA 1CVNA 1H2NA 3UJOA 1QIUA 1ND3A 1ODMA 2KNIA 2B46X 2W52A 5GZEA 5FYBA 3ZKYA 1SLTA 3N4MA 1RHI2 2XLGA 3M3CA 2W91A 3S6XA 1VB2A 2K46A 1WA6X 3DYPA 4RFT0 3I97A 3ZFFB 1PO21 3SOQA 4QHBA 2KR2A 4CE8A 2VUJA 3IDBB 4CDQB 3VBFA 2FLBL 3RPQA 1TG7A 1OOPC 5DZEA 4META 4AI3A 1Z6EL 3Q8AA 4WZFA 5DQ0A 5IYYA 1POQA 2XMLA 5T5JA 1BXHA 2F9BL 1BEV3 3SW2A 1C1LA 2ZCWA 1HRFA 4BJ0A 5C5UA 4FOWA 4DXSA 3VBUA 1B09A 4XXPA 3GBWA 2X05A 4ISQA 4ONUA 1O5DL 3WP4A 4BDVB 1NCRA 4K9SA 4JTOA 2YHJA 5KXCA 4DEQA 1UNBA 4FPLA 4LBMA 4XURA 2VZ3A 4IV1A 3RI8A 4QU1A 5HPOA 3AKTA 3J26N 1XKBA 1IQML 1Y4WA 1GFF2 1DLLA 1MS4A 1APQA 1BF9A 2X8KA 1LK9A 3MW4A 4ES8A 2EXHA 2DCYA 2W0XA 3HPNA 3U37A 2FDIA 2J7MA 1OF4A 2D3SA 2QQWA 4JKKA 3RRDA 1F7MA 4YGBA 1UZJA 1R091 4TN7A 5FZ1A 3ZN5A 3VDDC 3ZPOA 5IVBA 1XRUA 1QJX1 4P9LA 5I8TA 1CAVB 3OBRA 3N9NA 1MEC3 1QFKL 1CX4A 4O61A 2BYVE 1KKEA 4TWTA 3PDQA 3RMXA 2A6ZA 2ZGQA 4NE9A 1XE0A 4Q4X2 5KC6A 3I2JA 3THDA 4AEDB 5KHHA 1CAWA 2WINB 2BBVA 1SBDA 4CUGA 3AK0A 3E5UA 4R9AA 1OF3A 5AVAA 3N9OA 4A6SA 1HXS1 2GNTA 4N7UA 3KQEL 1CAXA 4NUBA 4JZFL 3ZFGB 3N8VA 4D6QA 2GNBA 2DF7A 5FWJA 2E32A 1H6XA 1VP6A 4CDUA 2YPJA 2YGOA 3ASIA 5FMOL 3WHUA 4E9KA 1Q8VA 4YLZA 1JZ4A 1V1IA 2RS51 2XWBB 4MZUA 1O8SA 1FE2A 1XPWA 4O7XA 2C1FA 2DCTA 1R093 3T4HB 4LITA 4CU8A 1F5FA 4O65A 1MPXA 2DVDA 4OCTA 4PHZA 1UMZA 3P6BA 3WNPA 5FPXA 4PQ9A 4FQ4A 4UFLA 4XFIA 1C1FA 2ZGLA 3RZZA 4KH9A 3HBZA 3MI8A 4KWJA 4NHLA 2W2OE 4AEDC 4DO0A 2BOXA 1KFUL 2A6YA 4XJ8A 5FPLA 4IEXA 4Q4W1 3HQRA 4P9XA 4R52A 4XXAA 3U4XA 1ZVFA 1CAUA 2IXCA 3KT7A 1NZIA 2WSUA 4RHV1 1NFXB 2BUKA 3V65B 1FX5A 4FPCA 4OMDA 2IUWA 4OI0A 1YI7A 4LKFA 2VWOL 5FMDA 2R0FA 2GSYA 2A6XA 1UZQA 1HZ8A 1UYXA 1FAKL 1IGXA 2BQ6A 4A3XA 5BNNB 3APBA 1DF0A 3I2HA 2HWC1 1YO8A 1ZBE2 4UW3A 2P16L 3OD0A 3VBSB 5F7UA 1W9SA 2JDNA 4LKEA 5E6HA 1OD5A 1B35A 5A7QA 2WNUB 3FFQA 4YW3A 4AWDA 5JLVA 3GBGA 1RUH3 4LBLA 2D3RA 1Y7BA 1PGSA 5LASA 1CZVA 2FD8A 1ZREA 3LOBA 2PHRA 2DCZA 5C8WA 1LQDA 1QJU3 1F7EA 2B8MA 2RVAA 3P3NA 2VTFA 4IGPA 4QGLA 4WZCA 1IQFL 4QX1A 4OI1A 1UZVA 3UKTA 1XKAL 2KXLA 3J8F1 4B3NA 3NJXA 4HOOA 3O1RA 3FN9A 3FC0A 3NKGA 3H8OA 2P3YA 4IXLA 2P5BA 3GZTB 5EYXA 4W50A 5F2WA 1D0HA 3TN93 4D6RA 4COVA 5KBFA 1DCSA 4NWVA 3GGLA 3MF9A 1COV1 3AXDA 3S30A 2VU9A 1W9TA 1V6IA 3HS5A 2WA4A 4JRLA 1RXGA 3LD8A 4Y22A 1XJAA 1A8DA 1GWMA 3WQ7A 3MLJA 2HEVF 3HR9A 3WF0A 3LKJA 1UQXA 4XQDA 2J1RA 1G86A 1Q8QA 2PHLA 4EN7B 1QNWA 1DG6A 1YEWA 2JICA 1F9KA 1OD3A 3WG3A 2L9LA 5IKRA 4CEWA 3H8XA 4P5YA 3LC3B 4QB2A 4QX3A 4BMEA 3OGGA 1JZ2A 2G9GA 1JYVA 2PQSA 1K5MA 1YUDA 1VAKA 3LFIA 4CDQC 2XB6C 5C70A 1HDKA 1OKOA 1TNRA 1A34A 1WW5A 3AMMA 5DUVA 1GR3A 1U5IA 2OZ6A 5A3UA 1X9TA 4G9SB 1JUHA 3U75A 2JG9A 4Q4Y3 2ARBA 2VBPA 3H3LA 1AJKA 4XOGA 1NLSA 3WD5A 3ZYHA 3U0ZA 4M11A 2E9QA 2BMGA 4ZHNA 4PLMA 4XFGA 2BW8A 5BXXA 5CBLA 4MMYB 5EV7A 2VJ3A 4IE0A 3AXEA 2H6BA 3OEBA 1W39A 3GNEA 1UKGA 3M2MA 3N7KA 1FPN3 4I0BA 3ZYFA 3ZR6A 3OYWB 3CA7A 1XYOA 2B7YA 1SPPA 4ZZ5A 5APAA 5HXMA 1H2KA 4IEQA 2Y38A 4C16A 3E6BA 1KD7A 4FXGB 4LKDA 4YG0A 1W03A 3RNSA 1XXNA 4WM8B 3D4KA 3SH5A 4URAA 1N1TA 4GB31 1QEXA 4M3CB 2LALA 4MOAA 4ARYA 4XJZA 2ID4A 4WM7A 1NPEB 3INAA 4NIIA 3KRKA 2VH0B 3S6PA 4I0WB 2HWE3 2EI8B 1C4RA 4RQPC 1G9FA 4BPZA 4ZU4A 2D1JB 4FOVA 4JKMA 1OT5A 1ACCA 1IS4A 4HVOA 4L92A 2VULA 2BWCA 4UFKA 1G9AA 1NZCA 5B4NA 3E6CC 2NP0A 1LMMA 1AL23 2BFUS 2WUHA 1J3PA 3NMBA 3O0WA 2Z5WA 5F3CA 2FDHA 3I3EA 3SNMA 1RYYA 2RM22 4RRXA 4ZKTB 3OGJA 4LNVA 1O3TA 1N47A 5A7SA 3SEEA 1QDOA 1US2A 1QOSA 3Q8EA 4AI9A 2C24A 2VOXA 4QDSA 1PGEA 3SKJE 3WDUA 3ENSA 1UX7A 2C6SA 4Q4V3 2WT2A 5I0RA 4YVWA 3AMQA 4RL7A 5ERLA 2JDMA 1ZRRA 3DKWA 1W6NA 4XFFA 5LWBA 1CAUB 5D8AC 4FCAA 5CNAA 1W7XL 2CGOA 1AR72 4LHKA 1CQEA 1HV0A 2Q4SA 4LO8A 3JB4C 2YGPA 4YPJA 4QM8A 3GHNA 2P95L 4OQ8A 5FP8A 1AYM1 2HWC2 1CESA 1DU3D 5C6CA 3FZ3A 2BVVA 4M4PA 3RWKX 5JB9E 4IERA 3WZ1A 4HK8A 4CCMA 4PQQA 2W2ME 1JOPA 2YY1A 3ZMOA 4PLOA 2P93L 2R062 5A3WA 5BNPB 1FF7A 1SEFA 3FBMA 4CEWC 3TEWA 1PZ8A 3B9IA 5A7WB 3H8UA 5FUIA 4E2GA 1WW7A 2VY0A 3CQOA 1AUTL 4ZS2A 2E53A 5A7OA 5JSOA 5FYUA 4AE2A 1ZX5A 4N43C 1RUH1 2BGPA 4QXHA 2DWRA 1QNYA 2A75A 1F5JA 2ARAA 2JECA 2D40A 1IQGL 2VVEA 1S0FA 4QX2A 3BVCA 3KF5A 3ZMNA 4RRWA 4WVVA 1OUXA 3DCQA 4MHUA 3GJAA 2OUHA 3LDBA 3NL1A 4XQ4A 5FDQA 4WBBA 2YBSA 2WG4B 1ZZ9A 3CKHA 4MXWB 3AVSA 4QHZA 1PO13 4CDWA 2P3KA 4OUMA 4BM8A 1WD4A 3K51A 5J36A 5F3IA 2GDFA 2J1EA 1ND3C 1AR63 2YC0A 1QHDA 3SOBB 4H2AA 4Q1RA 3IMMA 4DOUA 4Z6AL 1CCVA 3VKMA 4AI8A 3R05A 3IN9A 3MIHA 4E27A 1GWLA 2NMOA 2IVIB 1YRZA 4N9IA 5D2AA 3L2HA 5EXOA 1G6NA 1EBVA 2PTMA 3IMNA 1VBB2 2AH2A 1R082 4XFAA 3H1MA 5LA9A 2BRTA 3LOIA 4D0QA 4WM7C 5COXA 3WUDA 2HWF1 5F5IA 4X8VL 1J9CL 4ORFA 5T5PA 2RNLA 1W3XA 5JVZA 4YNIA 3U10A 2UWCA 1W2OA 5F3EA 4AFAA 1EAIC 3AKQA 4MVTA 2VMIA 3DPRC 1AYN1 3ON7A 1W6MB 3E1F1 5CFDB 4GU3A 1DVAL 3HAGA 4JRAA 4R8HA 3OGVA 5GLZA 4B8EA 3UL2A 2W26B 1HN0A 1AXKA 1CEJA 4L9BA 1IGOA 2OS2A 4Q4Y1 4LA3A 3N9LA 3OYWA 4XEZA 5FK8A 5EJZB 1T6GC 4YM1A 3USUA 2WG3C 3TNPB 1PHMA 5EWSA 2C9AA 4DEVA
chains in the Genus database with same CATH topology
3DV8A 2F4PA 2ZHNA 3NAPB 2KV4A 4LBNA 4WM8A 4JYUL 1BEV2 2XVLA 4B4PA 4OFGA 1GNZA 1KLOA 3U11A 3VDDA 4V1PA 5HCBA 1QJY3 1ULFA 4FP3A 2IXIA 5BYNA 2X29A 4H3WA 3LTFB 2GN7A 1ASJ1 3LTGD 1AZDA 3T1LA 4IEOA 1DDLA 2XH6A 3ZXGA 3VZJA 3ALQA 1RUG2 1UF2C 1WLTA 3FUOA 2HKXA 2R30A 5J7MA 4K8FA 2PHDA 2ZGUA 3EHKA 2WPJE 1MZ5A 3IT8A 3N7LA 4LE4A 5JR7B 1DX5I 1RUG3 4KU8A 2EAKA 1TME1 1VRH1 3JD71 5DZGA 4ISIL 3SH4A 3V64A 1UZYA 1V6KA 4YARA 2GMPA 1C3HA 2YDEA 4AGRA 4BIFA 1FYUA 1RUC1 2HWD1 4DMIA 2RS33 2PAKA 2OIIA 4GQ7A 1EPIA 1LOFC 1MS3A 4X6RB 3T1MA 2RMU1 2D93A 3THPA 5J98B 1RUI2 2XBWL 1BBT1 1QOOA 4BH9A 1S2KA 3R4SA 3OD4A 4XFCA 1C8M2 1LEDA 5FPZA 3IJEB 1PIV3 5I0TA 5BNPA 1SLBA 2J95B 2D43A 4AGGA 2ZX0A 3O7OA 1EY2A 4X6QB 3HPTA 2H9EL 1ADXA 4DZGA 4X8TL 3KS7A 4C1WA 3AJYA 1REEA 1VBD2 4GXLA 4OHXA 1DGRA 1UZKA 1RUC3 4YVSC 3H5CB 4MLOA 3BOPA 4CDXA 4XETA 5LK5A 4XQWA 4HT1T 1IVOC 3R4DB 4JTNA 4SBVA 3WG1A 2RMU3 1FSBA 2W68A 4GB32 1MQTB 1RMU2 3I54A 2VVCK 1EYBA 1R1A3 4N43B 4JGYB 3F6UL 1CVWL 4S2DA 4Q27A 5CADA 1Q8SA 1TE1B 3ZN4A 5F9TA 2JKHL 4Y7BB 4Q0UA 2DUPA 1UU4A 1ZRDA 1W6PA 3VBUC 4AVAA 1RIRA 1MVQA 4L99A 3MZHA 3VBHA 2QCSB 4JC1A 5JWPA 3OJBA 2ZOEB 1AYM2 4LTAA 2W39A 2GD4A 4I3PA 4RR3A 1TLEA 4E4DX 4MGIE 5JIUA 1YWKA 5F5QA 4JDOA 3N8YB 1FAXL 4E2QA 4CP0A 3TN92 3VZNA 1MQTC 2WQZC 4LHNA 5TSWA 4LORA 4YZUB 1GV9A 2VW0A 3EJKA 1AXYA 2WZR1 4C1XA 1RB8G 1R1ZA 4FVVA 5DG2A 4J1XA 1S0EA 3HS7A 1WLCA 2HWF3 5FBZA 1TEIA 2GN3A 1CJDA 1OA3A 3VBUB 4YW1A 4TZDA 1REFA 2W08A 4CUEA 1GZCA 3DPRB 1FT9A 1V6JA 2UU8A 2DDUA 1IPJA 3NAPA 4JDNA 5L7OB 3PMSA 5JVYA 1M06G 1EV13 1LOEA 1ZBA3 2IXKA 1I5ZA 1BK1A 2BTVC 1RUE1 1BMV2 1NE6A 4BWOA 3MIGA 1LRHA 1UKRA 1LOGA 1NE4A 2Q8OA 5JOYA 4M00A 3WINE 2WFXB 4BZ4A 2OVUA 4MMXB 5EGMB 4RQPA 3WP3A 1ZA4A 5T52A 3AFKA 4AHXA 1WMEA 1SFYA 4UW4A 2V73A 3HO5A 2P17A 1C28A 1CAXB 2XKPA 5K9YA 2MGPA 2RE9A 3B00A