3ASIA

Alpha-neurexin-1 ectodomain fragment; lns5-egf3-lns6
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
395
structure length
395
Chain Sequence
ADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Variant-Specific Neuroligin-Binding by alpha-Neurexin
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion
molecule keywords Neurexin-1-alpha
total genus 92
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3asiA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA01
1N1VA 5T50A 4YT7L 1SBEA 1FFMA 3UJQA 1HKDA 3UJOA 1YGCL 1WLCA 2W2OE 1SACA 4BTTA 2G4IA 2A6VA 3D4KA 1N47A 1APNA 3N7LA 3LSDA 3O0WA 3EGFA 1JBUL 1N3QA 3ZXEA 2C5DA 4Y20B 1URKA 4C1WA 2Y5GL 1AX1A 1AXKA 3B01A 1YI7A 1LOFA 1IS6A 2ZHMA 1GLHA 4U2AA 3OY8B 3LCPA 5GLWA 4Y6DB 3AZZA 4XXAA 1DIWA 1W7XL 1CVNA 1WD3A 4BDXA 4Y1VA 1UZZA 1IQKL 1A8DA 4FQZA 1BQPA 4P9XA 2DUOA 2LTNA 5HCFA 1RIRA 1KLJL 1V6MA 2NZ9A 2KV4A 1SLAA 1ADXA 4ITCA 4ISIL 1L3YA 2W2NE 4YGDA 2YROA 3BTAA 4UW5A 1KRIA 2D1JB 1LHNA 4YG3A 2W86A 4UW6A 2I9BA 1EPJA 2UU8A 1TEIA 1Z6EL 5T52A 4DFSA 2EIGA 4YZ3A 3TK6B 2ZABA 4FPEA 2WG3C 1JW6A 3R4UA 2DDUA 1UAIA 3F6UL 2PR3B 3CFWA 1HQLA 1Q4GA 5DG2A 1HDKA 2BOHA 2CY6A 2FLRL 1MQ5L 1RINA 2D6LX 2AUYA 1SBDA 3N8WB 2ARBA 1CONA 2R49A 2P2KA 2W2PE 2ZGTA 3M2MA 2Y38A 1EGFA 4XXPA 1GV9A 4G1MB 2EF6A 1C5MF 4NOTA 1V6OA 5AVAA 2KM2A 1IQGL 1DHKB 1GYKA 3WCSA 2JECA 2WPJE 4UW4A 3ILFA 5DUXA 1WW7A 3POWA 1FAXL 1R1ZA 4WVVA 2OYEP 5I46L 3BT1A 3KQRA 1QGLA 2XBVL 6COXA 2ZGMA 1C4RA 5L30L 2P3TA 4Q1RA 1C57A 2Y7XB 5BYNA 5JW1A 1ULCA 3AZWA 1XQNA 1IKQA 5GJ6A 2A70A 2RHPA 1NT0A 1PGEA 4ASMB 4BMBA 3KRKA 2HYKA 1WHEA 3M1HA 1UZYA 5CB7A 1G9AA 1IQNL 3ATGA 2ZA9A 1S0EA 4CRQA 2PHRA 3B3QE 4RUTA 4AVVA 2CTVA 2KL7A 4K20A 3NTBA 2YMZA 4Y1ZA 1PTHA 1N3OA 1UX6A 5T5OA 2BOUA 4YW5A 1YUFA 2P93L 1Q8PA 2ERFA 5T5JA 4Z0LA 3WDWA 4FOYA 1MZ6A 1LHVA 3SOBB 2DTYA 1MOXC 3TB0A 2JKBA 4M00A 1W6OA 4XTPA 1CCVA 3N7KA 4MMXB 1QF3A 3HO5A 3WUDA 2DUPA 2NMOA 5JDBA 3ELAL 3TBDA 4Y1YA 3RG0A 4Y22B 3QCWA 4XHXA 2WQZC 3AJYA 3C2UA 1VAMA 1W6OB 2OUJA 3LAQA 1UZQA 2AYLA 2FZZL 1EZQB 1LOAA 5DUVA 1P0SL 3SOQA 3DEMA 1YUGA 2D3PA 2A6XA 4LBQB 1YXWA 2W3KB 1MS9A 5JBCE 5JOZA 4BM8A 3SOVA 4Q8KA 3AP4A 3LN1A 1LOBA 4YM0A 4CZSA 1QDCA 4YLZA 4ZXXL 2WYJB 2WPHE 3UK9A 4Y7BB 2GMEA 5GZGA 1HAFA 1NQLB 1DYPA 1X50A 1GSLA 5DZFA 3IKWA 4BTUA 1FNYA 5T55A 5T5LA 2ZZJA 1PXXA 2P26A 1CQ9A 5JBAE 1MZ5A 3WVJA 4JZFL 4ISHL 1O4ZA 2VW1A 4ZXYL 5SV8A 2XBWL 1IS5A 1UZJA 4RRXA 2ZMLA 2AENA 2AREA 2D6PA 5HCAA 2DUQA 1ULFA 5DG1A 1XKBA 3HMYA 3LSEA 1JV2B 2V73A 1APOA 2WNEA 3P5BL 2ZGRA 1CIWA 1G2MB 1IKPA 4WZFA 2ZAAA 5HCBA 3FBYA 3WUCA 2M74A 2WSUA 3RS6A 4M3CE 1JYIA 3NV4A 5L73A 3ZSMA 2ZKNA 3FCSB 3H0OA 4FP3A 4XLWA 4C16A 3RMXA 4XILA 3RMYA 3K9XA 2W2QE 1NZIA 1Q56A 2W39A 1MS3A 3T2TA 2PUQL 3WDVA 3ZYJB 2DVBA 3W59A 3LN0A 3B69A 2F9BL 1SLIA 2D6OX 1IOEL 1DQ6A 4IQPA 3SH5A 2VH0B 3T1MA 1N1YA 1V6KA 4X8UL 1G86A 5CKMA 2EXIA 2B7DL 4PBPA 1N1TA 2ENRA 1LPKA 3WG4A 1EPGA 4SLIA 1ENSA 1DQ5A 3HS7A 4BXSA 2ZMNA 4DRRA 4GKXA 1V6JA 4RRWA 1ENRA 1MS0A 2ZGUA 4TGFA 1G8WA 2ZHLA 1G1QA 2PELA 3N36A 3SH3A 3AP7A 3KQBL 2NM1A 4YZ1A 2W2ME 1ZM1A 1LCLA 1LOEA 3N7MA 3BOPA 1F0RB 3VKLA 2VW2A 4XJ8A 1CVUA 3ZVXA 1QNYA 4M01A 1K36A 1EPIA 1F31A 2I2SA 1QKQA 2A7AA 4PBOA 1DBNA 4YW4A 2K2SB 1H9WA 1SZBA 2Y81B 5COXA 1W0PA 1IQEL 3PVEA 4W65A 4L8QA 3M36L 4E1GA 1SCRA 1WU1B 5IK4A 3MDLA 4XMAA 4MMYB 1ENQA 3TGFA 1Z78A 4FPKA 4XJAA 1ATAA 1MS4A 2Q5TA 2VWNL 2VU9A 1DX5I 4Q8LA 4BDWA 1JBCA 3D5OA 3Q3KB 4FOWA 3WNXA 1HZ8A 3WG3A 1S0GA 2NPRA 1N1IA 4LBKA 1ULGA 1LEDA 1HT5A 1YUKB 1QOTA 5K0HB 1WW5A 1IGZA 1OKQA 4CTEA 4JZEL 2R0FA 3IITB 1MR5A 2A75A 4RL7A 3N7JA 5KXCA 4CSYA 1LHWA 2UWAA 4YGCA 1XFEA 3BODA 2WT0A 3F1SB 4FM5A 3PVOA 4AGVA 3WZ1A 2A3XA 3HPTA 1Q8QA 2E6VA 5JMCA 4KBBA 4P14A 1GANA 1F9KA 3JUUA 1G9BA 2E53A 1U0AA 5CNAA 1WCSA 3OJBA 3RRDA 4Z8BA 3FFZA 1HAEA 3HS6A 2JDZA 1C1FA 1YRZA 1LGCA 4Z0KB 1IS3A 2FMDA 3U4XA 1MVEA 4PCRA 1OFSA 3KQCL 1W6PA 1NPEB 4HANA 4M3CF 1NFYB 1JXNA 4H55A 2R0HA 5IK8A 1S0BA 4FQ4A 4FOVA 3GCXE 3N8YB 1EAIC 1F7MA 3AP6A 4XMIA 4RRYA 3IJEB 4Q26A 1EQHA 1GZCA 2PHBB 5KXBA 4JRAA 2P16L 3ZXJA 1AZDA 1UL9A 5EXOA 4XTMA 1H30A 2W68A 1C1LA 3FFGL 1FF7A 1KDKA 4AGGA 2AH2A 2ZBJA 2AGSA 3CA7A 3N35A 4MYEA 1DQ1A 2P3FL 1LEMA 2SBAA 1SCSA 1FAYA 1S0JA 4Y24A 3SW2A 3AP5A 4DRVA 3M37L 1AUTL 1GZ9A 1MACA 3MW4A 1WBFA 1DZQA 4A7IA 1JHNA 1UZPA 4PQ9A 2BMGA 4YGEA 2BOKL 2R16A 4Y20A 3BT2A 4M10A 2WPIE 5KN5C 1D2SA 2GNBA 2OW4A 3O0XA 4AWDA 1ZAQA 1KLOA 1PFXL 4JYUL 4R9AA 4DQAA 1QOSA 5FDQA 3V0AA 3KK6A 1F5FA 2D7FA 1LOGA 4YM2A 1W6NB 2ZGQA 2J38B 2D6NA 4JZDL 3SISA 3WDTA 1IOAA 4YW3A 2ZMKA 1Q8VA 1Z6CA 2BZ6L 1LGBA 2ZHNA 3RQ0A 3AP9A 3A0KA 1QOOA 2ZGOA 4ZKTB 2NMNA 1G2LB 1O4YA 3H5CB 4BLIA 1KQRA 4Z6AL 2GN7A 2A5ZA 2TEPA 5L2YL 2EXJA 1IQLL 2UURA 3ASIA 3VKNA 5CISA 2A6ZA 4NG9L 3N3HA 1I3HA 1FE2A 4YM1A 4TZDA 4CUFA 3OPZA 3LTGD 4FVVA 5GLTA 5JOXA 2VWOL 1SLCA 2SLIA 3FLTA 3KL6B 3ZXFA 3OGGA 4M3CB 1CESA 1HQWA 4BOWA 1CJPA 1CEJA 2DU0A 1WHFA 2PHFA 2C9AA 1FAKL 3NTGA 4PH9A 2ZHKA 1AXZA 3A0NA 4CUEA 4XL1A 4RS0A 1G1SA 2GMMA 4R9CA 5E8DA 1DDXA 1LMJA 1IQIL 3RSJA 3HO3A 3PJQA 3GALA 2P3KA 2WYGB 2XC0L 2DVAA 3NV1A 3BPSE 4NA9L 4YGBA 3V0AB 3VV1A 2VWMK 3PGHA 5IKRA 1UMZA 3IN9A 1UKGA 5GZDA 3WHTA 2WKKA 4BMEA 1IGXA 1PZ7A 1W6QA 4X8SL 2CWMA 4XBLA 1BXHA 3APBA 3V0BA 1VIWB 2DYCA 3ZYGA 1Z0HA 2XC4L 2EXHA 3AYEA 2W26B 5H9SA 2I9AA 1SLBA 3WG1A 3WG2A 5JB8E 1LHOA 2TGFA 4Y79B 3WV6A 1CQEA 3ZXKA 1LHUA 3ILRA 4BLJA 4RA0A 2DV9A 1JL9A 1JOJA 5IKQA 1N3PA 4XBMA 3TZIA 2BQ7A 4OZXA 1X7AL 3SNMA 3V64A 1G7YA 4AGRA 2J94B 3V64C 4X8VL 5JB9E 4BQ1A 1NXD1 3KQDL 4Y71B 5IK7A 1AX2A 1BZWA 4YW2A 4LORA 2BQPA 2YXSA 4FP2A 1IS4A 4MMZB 1YO8A 1IVOC 1S0DA 3NT1A 1U8CB 3NV2A 2R1DA 2EALA 4COXA 1MVQA 3AXDA 1A78A 3O5SA 2EAKA 3QH0A 4LBNA 3ZSJA 1FV2A 2Q1JB 3VKOA 2Y82B 2A71A 1W6MB 3WDUA 4AVSA 2Y5HL 3USUB 3AZYA 2RNLA 1LENA 4FPLA 1FNZA 1ATBA 5CKNA 3JU9A 2XG3A 5EYXA 3NJPC 1ZA4A 3FLRA 2RA0L 1F0SB 4FPCA 1GKBA 2GNMA 3B9CA 4O02B 1J1TA 4GKYA 1DIYA 4WVWA 2FLGA 4Y76B 1UZKA 1LJ7A 3AYDA 3MPPG 3D6EA 5KXDA 2MHPA 5F19A 3V65B 1EQGA 1GZWA 2B7YA 5GZEA 2EXKA 2GN3A 4GWNA 5E8AA 2ZGNA 5H9RA 1FSBA 4ZAEB 4XDQA 4XHBA 1S1AA 1ULEA 3LTFB 4BXWA 5H9PA 1TPGA 4ZHAB 2ZGLA 1FV3A 3QLQA 4YZ5A 4XJWA 5IKTA 4XBQA 4OTYA 2OUHA 1ONAA 3WOGA 1Q8SA 2UWBA 2NN8A 2GNTA 1UPSA 4ISRA 4XOGA 4YM3A 2VVCK 2UWLB 3WLUA 2H9EL 3IMNA 5E89A 3VKFC 1LU2A 4Y1UA 2J34B 1LECA 1BKZA 2CNAA 2YV8A 4O1ZA 4TYSA 3N8YA 1JYCA 4X8TL 1TLEA 3AFKA 1Q8OA 3AX4A 2WFXB 1V6NA 1CX2A 2JD4A 3B00A 1HX2A 3MQEA 5JVZA 5LK5A 5L2ZL 2CWSA 1U67A 1DLLA 4D0FA 4P9WA 4AYUA 5T5PA 4I30A 2DTWA 3ZPYA 1P9JA 1LQDA 3ILNA 1W6NA 2CYFA 5IUQA 1PRHA 3I4IA 2PHXA 1LESA 1CVWL 3U7UG 3HR9A 3AK0A 1W0OA 5FREA 1CCFA 1GK5A 4YZUB 3POSA 3N8VA 2DVDA 2ADXA 5KXEA 3GISX 3AYCA 3OY8A 2JJ6A 1WW6A 1QNWA 4XIOA 1HLCA 1COUA 2ZGPA 1XKAL 3PMEA 4DS0A 1HREA 3T1LA 4YZ2A 2WPKE 4M3CA 3WHUA 2P37A 4YG0A 4YG6A 4LBQD 2WJSA 4YFZA 2EI7B 4ZH8B 1GICA 1QMJA 5E88A 3NV3A 3M3QA 1RITA 1BYHA 2FHRA 1IQHL 2W3IB 2ZACA 2GALA 2A3YA 2MGPA 4HL0A 5DZEA 3SH4A 2GD4A 3O12A 2Z42A 4Q27A 2P3FN 4AQTA 1W6MA 2EI8B 4ZXKA 1QU0A 3ZSLA 3AYAA 2VXRA 4LBMA 1QFKL 4Q2FA 1FX5A 4P9YA 2VW0A 1GNZA 1HJ7A 2VH6B 4FOQA 2LALA 3LC3B 3SLIA 2WPLE 1IJQA 3Q9OA 2MGRA 1EPHA 3N8ZA 4F83A 2D3RA 1W6QB 2Y80B 3TH3L 2A3WA 5CA6A 1WBLA 3FUQA 3ZYPA 5IK5A 1DYKA 4FPFA 1LPGA 1TOZA 2EI6B 1B09A 2JKHL 1G1TA 3LC5B 1QDOA 1YIFA 4YFWA 3KM5A 2P3JA 2UWPB 3OYWA 4BTIA 1H9PA 3OLUA 1HCGB 2BOXA 3GCWE 3M3CA 1MS8A 4CUDA 1I1EA 1N1SA 1A3PA 2R1BA 4LBQA 4ATFA 1NFWB 2E7TA 5JLVA 1VLNA 1AX0A 1LU1A 2DVGA 3V0BB 1LPZA 2DURA 1CR7A 2D6MA 2ES3A 4LBJA 1OB1C 4C1XA 1RFNB 1NFXB 3CNAA 1N7DA 3MEPA 1AJKA 3VKMA 4FPOB 1BJQA 1WW4A 1G9DA 4K1ZA 1AVBA 2BQWA 2W08A 1DQ4A 1K37A 3AZVA 1FATA 3N8XA 1S0IA 4JYVL 3UL2A 1CPNA 1WLDA 1BF9A 3DGTA 2BQ6A 2W52A 1FJSL 4OTJA 5IKVA 1LOCA 2WPME 4XJ9A 4XJZA 5F9TA 1DFQA 2A6YA 1ATDA 4FPYA 3ENRA 3INAA 1EMNA 2NYYA 4D69A 1KIGL 1IOXA 5CBLA 2OVUA 1V6IA 3BIWE 5GALA 5GM0A 2WLQA 2XB6C 2GNDA 2DVFA 4AVTA 1G9FA 4Y22A 4FPHA 2D44A 1WUVA 3AXEA 4M11A 4Y1XA 3OLTA 5H9QA 2WSVA 3V65A 2P34A 5JOYA 2GMPA 3OBTA 2VVUL 2JE7A 1W6PB 1SLTA 3AJZA 2NP0A 1LODA 1URXA 4GALA 1V3XB 1GBGA 1ULDA 3VUOA 4PF5A 5GLUA 1JN2P 1OQ1A 4XJUA 1XDTR 3KQEL 3SITA 2VJ3A 3FUOA 5JOWA 2VH9A 1EPWA 1CN1A 1LTEA 1KJRA 3HS5A 1HT8A 2V5YA 5GLVA 2JE9A 1GZWB 2UWCA 2PHTA 2VVVL 4RRZA 3NWKA 1LGNA 2XBXL 2D43A 3AZXA 1F7EA 1DQ0A 3ZXLA 2Y7ZB 2OYUP 3U73A 4Q1PA 1PZ8A 2WT1A 1Y7BA 5F5QA 3GNEA 5EYYA 3TAYA 3ZYIB 4U36A 1AJOA 3WDXA 1HRFA 1S0FA 5CAZA 5T54A 4GXLA 3OYWB 3M3EA 1G9CA 3PVNA 4GA9A 3W58A 2E7QA 3Q7DA 1W8BL 3C9AC 3KCGL 2VUAA 4K1YA 5FRAA 1CPMA 3MW3A 4XIKA 5KIRA 2XC5L 2YY1A 1SLLA 2XBYL 2AR6A 2WFTA 4YT6L 2PHWA 2J4IB 2DU1A 5IT6A 1MS1A 2A6WA 3FLPA 3L2YA 2BO2A 3I8TA 1V00A 4FPJA 2P3UA 2GDFA 1S0CA 2CL2A 2E51A 1J9CL 2G00L 3R4SA 1IQJL 4ISQA 3QMOA 2WG4B 4NGAL 3A4UA 3N8WA 4D90A 4YZ4A 1YYNA 1LULA 2D6KA 4D0EA 2H0BA 5GZCA 2FD6A 1FYUA 3POYA 1DGLA 2ZGKA 4LBLA 1KSNB 1ATEA 4UW3A 5GZFA 1IQFL 4Y7AB 4XBNA 2DWRA 3OBRA 2AYHA 1VAVA 2P95L 1UN1A 2P3IA 1GNHA 4JC1A 3IPVA 1SFYA 3R05A 1MS5A 4XZPA 1V6LA 4YW1A 4R9BA 5F1AA 2VY0A 4DPNA 5DUUA 1EBVA 1KITA 4R9DA 1PZ9A 4BPZA 5EGMB 2J2UB 1O5DL 1I0UA 1VALA 3USUA 3IPVB 1JUIA 2UWOB 1NFUB 1APQA 2ZGSA 5JBBE 3LIWB 1WLWA 4LBOA 3ZYRA 1L5GB 4XE9A 1M1XB 1WD4A 5JVVA 4Y26A 2YGPA 1KDMA 3IM0A 1MQ6L 4GWMA 3RR3A 3HN1A 3CS7L 3ZSKA 1KLIL 2VWLL 2D3SA 4WV8A 2J95B 3HO4A 5GLZA 4NO4A 1DQBA 3MW2A 1LOFC 3WDYA 1G1RA 2WT2A 3M3OA 3O0VA 2P28B 4LMFA 5DUWA 2CJIB 1KJLA 5DZGA 1IP0A 4JCKA 1D0HA 2P94L 4ATEA 1B9WA 3TK5B 3DUIA 2KB9A 2PHUA 5CKQA 2YGOA 1AXYA 1DVAL 1SBFA 2FLBL 1AF9A 2K2TA 3ENSA 4FPGA 4XYXA 2ARXA 1DQ2A 1EMOA 3WCRA 5EWSA 3CENL 2Y5FL 4K21A 5JVYA 1A3KA 5DXDA 1IQML 2YZ4A 1NLSA
chains in the Genus database with same CATH superfamily
4E8DA 5C3QA 1KEXA 1N1VA 2ZOEB 2BGOA 2VZRA 5T50A 3O7OA 3C7OA 1ZZBA 4YT7L 1WA4A 2W91A 1SBEA 2BPA2 4XETA 1FFMA 5BNOB 3UJQA 5FPUA 1FMD1 2XLFA 1VMJA 1HKDA 3UJOA 5C9AA 1YGCL 1T2XA 1WLCA 2JDPA 2YC2A 3H3UA 4OQ9A 4EWEA 2ZX2A 2W2OE 2VMFA 3OUJA 1SACA 4BTTA 1AL22 2G4IA 2WZ8A 3S5AA 2BV4A 2A6VA 3D4KA 1N47A 5FY4A 1R081 1JH5A 2WRAA 5ANNA 1APNA 3Q8FA 2JDUA 3N7LA 3RZLA 3PDQA 4OZOA 3LSDA 3I3BA 2GSYA 1IGOA 1ND2C 4HVRA 4S2FA 3I2HA 3O0WA 4P5HA 3ZXAC 3EGFA 4BXSV 3EHKA 1JBUL 1PO22 1N3QA 3JCIA 2C5DA 3ZMNA 3IDAA 2X05A 3OCPA 3D8CA 2WZEA 3DYOA 1URKA 4Y20B 1W3VA 5ERLA 3WD5A 5BUVA 4C1WA 2Y5GL 1IQDC 5ABJA 1AHSA 1AX1A 2O8OA 4IV1C 1AXKA 3T0BA 5A6YA 1MEC1 1SMVA 4YVSC 2FDGA 3B01A 4K40A 4XFCA 1PGW1 1BK0A 1YI7A 1OOPB 3E5XA 1LOFA 1IS6A 2ZHMA 2ZX1A 1GLHA 1UIJA 2JE8A 2XHNA 3S7IA 3H8UA 1U5XA 2WS92 4U2AA 4FTEA 3OY8B 3B9IA 5JR2A 3O1VA 4K6BA 1F4HA 4XPVA 3LCPA 3WG3A 1V0AA 2IFRA 5GLWA 4Y6DB 3AZZA 3GBGA 3HPNA 4BH9A 4W6YA 4BE3A 4XXAA 1DIWA 3BGAA 2BRTA 1YNAA 3ZN4A 1W7XL 1CVNA 1WD3A 4BDXA 1YQCA 4Y1VA 2QDNA 3B7MA 4IE6A 1UZZA 1EV11 1IQKL 4IEYA 1A8DA 4HK8A 3VHNA 4RQPA 4FQZA 1BQPA 4P9XA 2FMYA 1RXFA 2DUOA 1YIPA 2LTNA 1NX9A 1Q3EA 1WMEA 3Q8EA 4GD4A 4LKEA 4N43A 2YC4A 5HCFA 1RIRA 2VMDA 2R6QA 5FZEA 1KLJL 1V6MA 2NZ9A 2KV4A 1SLAA 3JBG3 1OPMA 1UXZA 1ADXA 4ITCA 4LHLA 1XU2A 4ISIL 1L3YA 5F2SA 2W2NE 1XSRA 4YGDA 1LMMA 2YROA 4BU2A 4FSJA 4X8NA 3BTAA 2VCCA 4UW5A 2I07B 2KR2A 1KRIA 2D1JB 1LHNA 3E6DA 4YG3A 4CDXC 1RUH1 4QWNA 4QM9A 4FBFA 2W86A 3KF3A 4CCOA 5FZ8A 4UW6A 2I9BA 3OUIA 3VBUA 5D2AA 2HWF2 4A6OA 1EPJA 2UU8A 4HOOA 1TNFA 3JD73 3VBOB 2R062 3J8F2 1TEIA 2RS31 1BBT2 1RUH3 2VQTA 5IVEA 2VOKA 4JGZC 2XBO3 4CCJA 5CEHA 1Z6EL 2GC1A 2WINB 1XU1A 2XQXA 5T52A 4QT6A 1X33A 4OHVA 1HRV1 3T30A 3AM2A 4DFSA 2EIGA 1H1MA 4YZ3A 3TK6B 1GOGA 2XDVA 3KMHA 2ZABA 4FPEA 5F3GA 2WG3C 1JW6A 1U5YA 4HN1A 5FWEA 1PMHX 3R4UA 2YPJA 5L9VA 2DDUA 1UAIA 3MGUA 4OMCA 3DL3A 3DPRC 2C24A 3F6UL 2XJPA 2WWUA 2PR3B 3KT1A 1RUC2 5CG8A 4JGYC 4CU9A 3CFWA 1HQLA 1Q4GA 1NQJA 1ZZ9A 5DG2A 1NYWA 5F1RA 1HDKA 5LA2A 3I97A 2RV9A 1BVP1 2BOHA 2CY6A 2FLRL 1MQ5L 4DXRA 1RINA 5IVYA 1AYM1 2R043 2D6LX 2AUYA 3BI3A 2VUJA 4A2UA 1AR72 1SBDA 5FP4A 3N8WB 1YHFA 1BVVA 1CONA 2ARBA 2CHHA 2R49A 2P2KA 1VBD1 2W2PE 2Y6LA 2ZGTA 1V1HA 1JU4A 4L11A 3C3VA 4RR3B 4QHZA 4DXZA 4ZXEA 2X5IC 4AHXA 3M2MA 2Y38A 1EGFA 1XNTA 4QX7A 4R52A 1GV9A 4XXPA 5FOJB 4G1MB 1AR71 2EF6A 1C5MF 4O65A 1GMMA 4CXWA 4RHV1 3X29B 2X8KA 3WP6A 2VQ0A 3I2KA 4NOTA 2BNOA 4PJYA 5HPOA 2ZX0A 4QX1A 2WO3A 5IFTA 4XUTA 4IV3C 2MNGA 1V6OA 3HNMA 5AVAA 1IPJA 2KM2A 1IQGL 1DHKB 1GYKA 2EAAA 4NHXA 2B8MA 2XQRA 3WCSA 1QHDA 2JECA 1XNBA 5G05L 5F6LB 3I3QA 5A3PA 3FMGA 2V72A 2WPJE 3EQEA 4UW4A 2J1UA 2ILMA 5FP7A 4DIQA 3CF6E 3ILFA 5DUXA 5CG9A 3GBWA 1WW7A 2D97A 3POWA 4OLLA 1FAXL 1R1ZA 4WVVA 2OYEP 5I46L 3BT1A 3KQRA 3SCHA 5DAWA 1GZTA 1QGLA 1RUE3 2XBVL 6COXA 2ZGMA 3H50A 4WBBA 3ZIWA 3MIHA 1C4RA 5L30L 2TNFA 2R071 3RYPA 2P3TA 2C6SA 2OZJA 4Q1RA 1UD1A 4QPYA 4D3WA 3JQXA 4HT1T 2YFUA 4XZUG 1C57A 3ETPA 1RL3A 4MHUA 4ASLA 3IAQA 2IVIB 4LULA 4QU2A 3RZMA 5JSOA 2Y7XB 1WWYA 4UFMA 5BYNA 1XYPA 2VULA 2Y64A 3MV11 5D8AC 4Y5TA 5JW1A 1YFYA 3M3IA 2WN2A 3GHMA 4N53A 1ULCA 4PDWB 1S2BA 3AZWA 4D0QA 1XQNA 4QPIA 1NKGA 1IKQA 1AYN2 1OF4A 4KNCA 3U75A 1QJU2 4HKWA 4B3NA 1AL0G 2HEWF 5GJ6A 2VD7A 1ASJ3 2A70A 2RHPA 4A7YA 3BPSA 5F8PA 4EJRA 1NT0A 1PVXA 1PO13 1PGEA 4Q0UA 3AMMA 4CE8A 1QJU3 1XNAA 2XKOA 4IE7A 4ASMB 4BMBA 3KRKA 3WP3A 2Z69A 2HYKA 5BNNA 1OUSA 2WDBA 1WHEA 2ZTNA 5L9RA 1LK9A 1VRH3 4CDQC 5J7MA 1JMUB 2XBO2 3VBSB 3D3AA 3KCCA 3M1HA 1UZYA 3FX3A 5CB7A 1G9AA 4YWAA 1IQNL 2YUEA 4NWWA 4CEYB 1YI9A 3WNLA 3ATGA 2LM3A 3THPA 4JGZA 1NE6A 5C8CC 2ZA9A 2HWB2 3PMSA 4PHZA 2RR11 4QPIB 4QPGA 1OOPC 1S0EA 3VZMA 4CRQA 2PHRA 3P3PA 5KHJA 3B3QE 4RUTA 2QFEA 4AVVA 2CTVA 2QBXA 3K51A 2WZR3 3BYWA 1UYZA 2KL7A 4OQ8A 2VE1A 3NTBA 1OA3A 1HRI1 2PAMA 2YMZA 4K20A 4A3XA 4Y1ZA 1PTHA 5BNQA 1N3OA 4C0HA 4JHTA 2WN3A 1OMIA 2W2IA 1Y4WA 4QQLA 5DAVA 1D4VB 1XJAA 1UX6A 4YRDA 5T5OA 4AG4A 3LEGA 5F7UA 2BOUA 4YW5A 1YUFA 3ZOIA 3AMHA 2P93L 2RG4A 4GB31 1Q8PA 2ERFA 5T5JA 1ZBE1 3PUIA 1XE0A 4Z0LA 1H8VA 1RUJ1 3WDWA 3ES1A 1MZFA 2PTMA 4UF0B 4FOYA 4RFT0 1CX4A 1LHVA 1MZ6A 3E5QA 4OUSA 4KWLA 2JDKA 3LDRA 3SOBB 2DTYA 3QOPA 1H2LA 1MOXC 3TB0A 2JB8A 4BXFA 3SEPA 1E5HA 4CDUC 2JKBA 4M00A 3KF5A 1IG3A 1W6OA 3P3NA 1WLTA 4XTPA 1OSGA 3KVAA 1O3QA 1CCVA 2O14A 5BV6A 1KFXL 3N7KA 4MMXB 1QF3A 3HO5A 4XVHA 1AR73 3BU7A 3NNMA 2RM23 3RYRA 2GU9A 5FO9B 1GU3A 2BBAA 1QXRA 3OGRA 3WUDA 2OA2A 1QQP3 3JZVA 2DUPA 3NSTA 1W0NA 1RXGA 3LOIA 4IXLA 2VNGA 1FOD1 2NMOA 2VM9A 2QTWB 1D0GA 1W9FA 3VN4A 4GH4B 3ZXEA 5FPXA 5JDBA 3ELAL 3TBDA 2DCKA 3FL7A 2WNUB 4RFRB 4V1PA 5FY7A 1W99A 1COV1 1XOYA 4KQ7A 5JZGB 4HLTA 4Y1YA 1ND3A 4S2GA 3RG0A 1RVF2 4OI2A 3QCWA 4Y22B 4B4QA 3BTYA 3AC0A 4XHXA 1J3QA 2WQZC 3AJYA 3GF6A 4MGKE 5C3RA 3C2UA 1CAXB 1VAMA 1K5MC 1RHI1 4RS5A 4F3JA 3ACHA 1W6OB 1DF0A 2FDFA 2RS33 2OUJA 4CP9A 2RMU1 1RUE1 1OH4A 3LAQA 2OQ7A 1WGPA 1YQ8A 5A3OA 1UZQA 3T09A 2AYLA 3VDDB 2FZZL 2N7GA 2OKXA 1EZQB 1LOAA 3AVSA 1P0SL 3HBKA 5DUVA 3W5NA 5CYYA 2VZVA 3SOQA 3DEMA 2B9UA 1YUGA 4LIUA 2D3PA 2QQVA 4LEJA 4Q4V2 4XCAA 4XAAA 2A6XA 1GNYA 5IW0A 4LBQB 4CU6A 2WIIB 4XQDA 1YXWA 5FDBA 3IIAA 4AHWA 2W3KB 2HWF1 3PUQA 5F37A 1MS9A 2C0ZA 5JBCE 5JOZA 1H2NA 3IAPA 1UYYA 1J3PA 3SOVA 4BM8A 4Q8KA 1NCRC 3AP4A 3CZJA 4RQPB 1IPSA 3U78A 3LN1A 1LOBA 4YM0A 3L2HA 2DCYA 4CUAA 1WCQA 3T0DA 3QH6A 5FYHA 4CZSA 5C7GA 3IM0A 3S0MA 5C4WB 1QDCA 4YLZA 4TXWA 4ZXXL 1W8ZA 4N7IA 3MIDA 5IATA 4BB3A 4MOAA 2WYJB 1UY1A 1K12A 2WPHE 2RM21 3GXUA 3UK9A 3BIEA 3DF0A 1TE1B 2PYTA 4Y7BB 2VNOA 2GMEA 5GZGA 4IEPA 1HV0A 2VO5A 1HAFA 1NQLB 1ACCA 1DYPA 1KS4A 1X50A 1YEWA 3MUY1 4KH9A 4AAPA 1GSLA 5DZFA 5FZOA 4IEZA 3IKWA 2VPVA 3VZNA 4RHV3 1UY2A 2BVBA 4CEWB 4BTUA 1FNYA 2EIDA 5T55A 3OTFA 3RNSA 5T5LA 3RZKA 2BEOA 2ZZJA 3POBA 1PXXA 2P26A 1CQ9A 2RS51 2WFF3 2Y0OA 5JBAE 1MZ5A 2NLRA 3WVJA 3JQWA 4JZFL 1ND3C 4QD2A 5FYYA 3VZKA 3GZUC 1YC61 5KC5A 4PF1A 4ISHL 4P9JA 1O4ZA 2VW1A 2WZR1 4ZXYL 3N9LA 2YGQA 5SV8A 1RUG3 2XBWL 1IS5A 1ZBA2 1UZJA 3VBHA 4OI0A 4HSLA 2PMWB 3ES4A 1GQPA 4RRXA 2ZMLA 4BISA 2AENA 4ZONA 2H9EC 5BNPB 2BSFA 2AREA 3ZM8A 2D6PA 2W3JA 1JZ5A 4P08A 2CV6A 5FQ0A 5LCWL 5TSWA 5HCAA 2DUQA 1ULFA 1QIUA 4GWJA 5DG1A 1XKBA 3SXWA 4JGYB 3WF3A 5F2WA 3HMYA 1FMD3 4IE0A 1VBC3 1LR5A 5FK7A 5A7OA 3LSEA 4LOSA 1JV2B 1QWRA 3DPRB 2V73A 1APOA 1NQDA 1HJGA 1LRHA 3HVDA 4MGZE 2W1QA 3MHZA 2WNEA 3P5BL 2JKXA 3WW1A 5A7SA 1AR91 2ZGRA 3LEMA 1PMJX 4QKNA 1CIWA 4GJYA 1VBE3 2E63A 1DP0A 2JEMA 1G2MB 1XSQA 1IKPA 4WZFA 2ZAAA 4CDQB 1Z7S2 4LPLA 5HCBA 3FBYA 5C3OA 1DDLA 3WUCA 2M74A 2WSUA 3BN6A 3RS6A 1FPN2 4NPRA 4M3CE 1CAXA 5FV3A 3TN93 3VDAA 1JYIA 2WNVC 3G7DA 4B4RA 3LDBA 1E5SA 3NV4A 4IGQA 4Q4Y2 5L73A 3ZSMA 3LOBA 3I54A 3EMRA 1RUI1 2ZKNA 4CCDA 2XUMA 3FCSB 3H0OA 2ZJCA 4FP3A 2Y0IA 4D8MA 1QJX2 1H8TA 4XLWA 4CYDA 4C16A 3RMXA 2RMU2 4MSVA 2XWJB 1V1IA 4E9KA 5KHGA 1KFUL 1PVC2 4NPMA 4XILA 4NHYA 3RMYA 3U37A 3K9XA 4NN0A 5FZLA 2W2QE 1NZIA 4DXTA 1UXXX 1O7FA 5FLHA 5J1XA 3IBMA 4AI0A 3Q8CA 1Q56A 3SKJE 2W39A 1MS3A 1VBC1 3O1TA 1PM4A 2PUQL 4IUGA 3S30A 3T2TA 5FCCA 3HQXA 1VBE1 2FDIA 2EICA 3VBFB 1W05A 3ZYJB 2DVBA 4MGIE 3W59A 3WDVA 4GB33 3LN0A 3B69A 2HWD1 2VXJA 2F9BL 1SLIA 1YJKA 2D6OX 3SCGA 3ZSEA 4ES9A 5FJKA 1OT5A 1IOEL 2OX0A 4OUEA 5FZ7A 5IAVA 5A70A 1DQ6A 3WNNA 4IQPA 4ZS3A 3SH5A 4PT6A 3MF6A 3ZYHA 2VH0B 3T1MA 2VVDA 4OHZA 4PIZA 2QQWA 1N1YA 1CAVB 1RJ7A 1V6KA 3VD5A 4V2VA 3W9AA 3VBFC 4X8UL 4AEDB 3AFGA 3ALQA 3EB7A 4CEWA 1G86A 5CKMA 1JZ4A 4C90A 4COYA 4EN6B 2EXIA 2ORXA 2B7DL 4PBPA 3O1RA 1N1TA 1W06A 5JMOA 2PN5A 2ENRA 2Q4SA 1A34A 3GBFA 5A7WA 1LPKA 3WG4A 2X5IB 1EPGA 2OQ6A 1ENSA 2VCBA 4NROA 4SLIA 2GC2A 1BBT1 3KCXA 1DQ5A 1DGRA 3HS7A 2XUEA 4BXSA 2ZMNA 2AC1A 4GKXA 4DRRA 2ET7A 5C5TA 1QJY3 2QQLA 1Y9GA 2PQSA 1V6JA 3N9OA 4RRWA 4RGGA 2QQIA 4URAA 3ZKUA 3BALA 5EJ1B 1ENRA 1MS0A 3U4SA 1GQGA 2R32A 2ZGUA 4TGFA 1M4WA 1G8WA 1QJX3 2ZHLA 1ODNA 4CPBA 3U1XA 5EPAA 5FLJA 2GH2A 4C0BA 1G1QA 2HH9A 4GQ7A 2PELA 3BVCA 3N36A 3SH3A 3AP7A 3KQBL 3DKQA 3J8F1 5E6HA 4AW7A 4GWMA 2NM1A 3J26N 1CGPA 1R093 1ZYBA 4YZ1A 2W2ME 3C7FA 1ZM1A 1BK1A 4KGGA 3WF2A 4NIAA 1LCLA 3UYJA 1LOEA 4UAPA 3N7MA 3BOPA 3VLBB 1F0RB 1C8NA 1AYN1 2IXLA 1C8M1 2VW2A 2Y6JA 3J7HA 3Q8AA 4XJ8A 5FUIA 4DY3A 1JYVA 3BUCA 3S57A 4HMZA 1CVUA 4I2OA 3ZVXA 5JCTA 2WS93 4I09A 4GJZA 3OUHA 2XL7A 4XFAA 4XUPA 1RMU1 1QNYA 4M01A 3TYJA 2OPWA 1K36A 3VHOA 1EPIA 2VG9A 3RVHA 3WXPA 2BP6A 1F31A 2I2SA 3HQRA 1QKQA 3DXTA 3J8F3 2A7AA 2XGXA 2P5BA 4PBOA 4QXHA 5HI0A 3BTXA 4Z92B 1DBNA 4YW4A 1KS5A 2K2SB 1H9WA 1SZBA 3KLSA 2Y81B 1TMF3 2FDHA 3GYDA 4Q4X3 4WM8C 5C6CA 3BPZA 3WW4A 5FP9A 5FO8B 5COXA 3H7YA 1W0PA 3I2JA 1IQEL 4J25A 2JX9A 3PVEA 1ZRIA 4W65A 1MQTC 4L8QA 3UGHA 3IB3A 3M36L 4E1GA 2JWPA 3PUAA 4BQXA 4E2QA 5JXJA 1EAH3 2X29A 1SCRA 1WU1B 1ZZ8A 4XF1A 5IK4A 1R64A 3MDLA 4XMAA 2DCZA 4MMYB 3NW4A 1ENQA 1QIQA 2J1TA 3T08A 3UKVA 5LA0A 1O5LA 3MLJA 3TGFA 1CD3G 1FXZA 1Z78A 4FPKA 4XJAA 1CIYA 1XBFA 1ASJ2 1EV13 2ARAA 3JBG1 4AI9A 3PIJA 4HPKB 1JYTA 1ATAA 5AC92 1MS4A 2Q5TA 5FY5A 1ZVFA 3ACIA 4CDXA 3OOXA 3FFQA 2G9FA 2WO1A 2Y6HA 2VWNL 2VU9A 2JXAA 3JB8A 2HBUA 2J42A 1DX5I 2VOTA 4I02A 4Q8LA 4BDWA 3NNGA 3ZFGA 1ZA7A 2D5HA 1JBCA 2RS11 1SPPB 2JG8C 3D5OA 2JG9A 2DFCA 5FMBA 3VD4A 3Q3KB 4FOWA 3WNXA 1HZ8A 3JD72 3NO8A 1S0GA 2ZEXA 2NPRA 1VB4A 3PUHA 1JUHA 1N1IA 2OPKA 1DGWA 4LBKA 4R4ZA 5LB6A 1ULGA 3ZMOA 5C3PA 1Z7S1 5HBAA 1LEDA 4KL1A 4Q4V1 4XUOA 1HT5A 1X7NA 3DYMA 1YUKB 4LKFA 3NJZA 4UOJA 5FXWA 1QOTA 3H42B 5FWJA 1SDWA 2YGLA 4E2GA 3I3DA 4HVOA 4AOCA 2FZ1A 3HQUA 5K0HB 2E33A 1SEFA 3B5LB 4INDA 3S7EA 1WW5A 5C33A 3ZSKA 1H6XA 3JD71 3ZFEA 1ZBE2 3L9JT 3TN92 1IGZA 1OKQA 4L0PA 4CTEA 1E5IA 2YDEA 4IDZA 2QDRA 2VNVA 5EP9A 4JZEL 1EPZA 2R0FA 1UY4A 3K4ZA 3WQ7A 2FD8A 3IITB 2R063 1HRV3 4P9GA 3O14A 2C26A 3LWCA 4MUVA 1MR5A 1UIKA 2A75A 1R083 4RL7A 1PVC1 3N7JA 4BQYA 3K48A 5KXCA 2WNOA 2XHKA 4CSYA 4C8DA 1PK6C 1LHWA 2UWAA 4YGCA 1XFEA 5BNOA 1DCSA 5FY8A 3BODA 2WT0A 4LA3A 5C9AC 3F1SB 4FM5A 4XUQA 5DDJ3 2QQMA 3FBMA 3PVOA 1VE0A 1QJEA 1PVC3 3GCXA 4NIIA 2VTFA 3E97A 5FKCA 4AGVA 2BFUL 3H3LA 3WZ1A 1UOFA 1AR92 3ZFEB 1RVF3 5JWPA 4KU8A 5DDJ2 2A3XA 3AVRA 4ET7A 1VP6A 1SDDB 2WNUC 3ZXGA 1QJX1 3HPTA 1Q8QA 4UFIA 3ZR6A 4I3PA 1TVGA 3FHQA 3R6SA 3RJ2X 2E6VA 5JMCA 2JDYA 4JTNA 1CJDA 4QPGB 2MHFA 2VTXJ 4KBBA 2JG8B 1GANA 4P14A 1D4M3 1F9KA 1HRV2 3JUUA 4CA9A 4Z2AA 4UWDA 5CVRA 5AFBA 1R091 1GP4A 3E1F1 4XABA 1G9BA 2IXHA 1F15A 2E53A 3N4MA 1U0AA 2HWE3 4YVSB 1C8M2 2HEYF 4X6RB 1GQHA 5CNAA 1WCSA 3OJBA 2J1SA 3TNQA 3VZJA 3RRDA 3SHRA 4BZ4A 3FFZA 4Z8BA 1AR82 1ZZCA 2PQQA 2XONA 4NE9A 4CCMA 1HAEA 4LO5B 3HS6A 4OYUA 5F3CA 2JDZA 1ODMA 3MUZ1 1YFUA 1C1FA 1YRZA 2HWC3 4XQ4A 1IZ3A 1LGCA 2XVLA 4Z0KB 1IS3A 4K9SA 3OD0A 5FOBB 1BMV1 2FMDA 3H7JA 3U4XA 1MVEA 5J48A 4QMAA 2BW8A 4PCRA 1OFSA 1VMHA 2VMGA 4XF3A 2WZPP 4CCEA 2R7EB 2IVJA 2QQPA 3KQCL 1GOFA 1W6PA 1XC6A 1PO23 1NPEB 1NY71 4HANA 1NFYB 4M3CF 5KHHA 2JB4A 1JXNA 5JZGA 4P00B 4H55A 2R0HA 3UKTA 1S0BA 1YJLA 1JOBA 4JKLA 1XPWA 4FQ4A 2PAEA 4PI2A 5A7PA 4FOVA 4AEMA 3GCXE 4W50A 1GWLA 3N8YB 3QH7A 4UT5A 2J1AA 1EAIC 1F7MA 4AEDC 3LQCA 3WY6A 2BBVA 3AP6A 1POQA 5A6QA 4XMIA 1IG0A 4RRYA 3ZYFA 4CDWB 1W2NA 2BT7A 2VCAA 3IJEB 4XAEA 4YVWB 4Q26A 5F5AA 5C8WA 5FY9A 2XPJA 1EQHA 1GZCA 2PHBB 1W2UA 4IV3B 5KXBA 3VBOC 4JRAA 5F39A 2Y6FA 2P16L 1OURA 2XH6A 3CO2A 2WABA 5D1IA 3ZXJA 4LLOA 1AZDA 1UL9A 4IEUA 5EXOA 2A1XA 4DNYA 3H3ZA 5CFDC 4XTMA 3O1PA 4RGAA 1H30A 2W68A 2BJSA 1PGL1 1AUYA 3FFGL 1C1LA 3WX5A 5C9AB 5IVFA 1FF7A 1PHMA 3FE5A 2E32A 3PUSA 4OULA 3H8RA 1KDKA 3ORJA 4N90A 2K9ZA 2AH2A 1BEV1 2ZBJA 4H3WA 4PIYA 4AGGA 4BHPA 4RR3C 2VZPA 2AGSA 1XYOA 4EN0A 3TN91 1OLMA 1L7LA 3CA7A 1US2A 3N35A 5D8AA 4COWA 1WMDA 2PA7A 2DCJA 1QJU1 2XJTA 3FHIB 3LF7A 4IESA 1W28A 4MYEA 3PU3A 4K8FA 4J1XA 1DQ1A 4W6WA 4LK7A 2VOXA 5FFOC 5A7NA 2WNVB 5A33B 2P3FL 4Q4W3 2QCSB 2XMLA 1AR93 1LEMA 2SBAA 2RVAA 1SCSA 2VQUA 4DEVA 2VR4A 1FAYA 1S0JA 4ARXA 5J37A 4Y24A 5K4LA 1H4GA 2IXCA 3SW2A 3AP5A 3DN7A 4DRVA 4GULA 4JRLA 3BU0A 3ZR5A 2QZ3A 3M37L 2XJQA 3POIA 4HBNA 5FMOL 5HV0A 1AUTL 1GZ9A 2G9GA 4G3YC 1MACA 3MW4A 3JXSA 1WBFA 4B1LA 2ADDA 2FZ2A 4JKKA 1DZQA 3ZPOA 2Q30A 4A7IA 4A42A 1JHNA 2Z79A 1UZPA 2Q0AA 1J83A 4YVSA 4PQ9A 5C5UA 2BMGA 4YGEA 3VD3A 1O3TA 4Q29A 2BOKL 3ZFFB 2HKXA 2R16A 3HNBM 4Y20A 3BT2A 4M10A 2AEZA 3JB4C 5ABJC 2WPIE 5KN5C 1D2SA 1H2MA 2EVXA 2GNBA 2OW4A 2VOVA 2VZ1A 4YYOA 4QQ2A 2VRSA 3O0XA 3UGFA 4AWDA 2OT7A 1ZAQA 1RUF3 1KLOA 4CP9B 1PFXL 3OEAA 4OI1A 1U5ZA 2VL4A 4JYUL 5KWRA 1BEV2 3VBHB 5DABA 2W9XA 4R9AA 3K4DA 5FMCA 4BIFA 4DQAA 2V4VA 1QOSA 4BQ5A 3KWVA 1CZVA 2Y6KA 2J1EA 4SBVA 5FDQA 3TEWA 2GAUA 1UU5A 3OPTA 3KK6A 1F5FA 5CZKA 3V0AA 4DO0A 2D7FA 1LOGA 1UZVA 2WYFA 3P5BA 4YM2A 1W6NB 1O4TA 2ZGQA 4WM8B 2J38B 3WT3A 2O8QA 2D6NA 3GHNA 3VZOA 2LS6A 4JZDL 2VMHA 4IV1A 3SISA 2K2SA 1I5ZA 3ELNA 4EN7B 3WDTA 1H6YA 2YFZA 5FMOS 1IOAA 2Q8CA 5BNNC 4YW3A 4AL9A 2RR12 1X8MA 2ZMKA 1Q8VA 2WQ4A 1Z6CA 2BZ6L 1POV1 1YFWA 3QACA 1LGBA 4FT8A 4N53C 5EV7A 2ZHNA 4E4DX 3ECQA 1F2NA 3RQ0A 3AP9A 4JQRA 4TSVA 5FYUA 1JYWA 3A0KA 1HN1A 3RI8A 3U10A 1QOOA 2ZGOA 4MXWB 4ZKTB 3KHBA 2PLV1 4NVPA 1TME2 3W20A 2NMNA 1RHI3 1G2LB 1O4YA 1UYPA 1HB2A 3OBAA 3H5CB 3FC0A 4BLIA 1KQRA 4Z6AL 4HONA 2GN7A 1JTZX 2A5ZA 2TEPA 1C8M3 5L2YL 2EXJA 3THTA 4E27A 3CDZB 1PX3A 5BNNB 3NVCA 1IQLL 2ID4A 1POV3 2UURA 3LDKA 5DAPA 5FYMA 3R4DB 3ASIA 2G19A 4DUWA 3VKNA 5CISA 2JG9B 4LR4A 2B5HA 3A21A 5DPNA 1PK6B 1QQP1 1VR3A 1W9WA 1UYXA 3A22A 2A6ZA 5FZFA 2ZS6B 4NG9L 2DBIA 3OG2A 4QKBA 1W3XA 3N3HA 1I3HA 1FE2A 4MXWA 5F5IA 4YM1A 1X9TA 3KS7A 1ULOA 2Y8KA 5BNPA 1DGWX 5J09A 4CUFA 3OPZA 3LTGD 4FVVA 1COV3 5A32B 4KWJA 4FFGA 3ZN6A 4DY5A 5GLTA 3DV8A 2ZKLA 1CWPA 2O0OA 3HT2A 4X6QB 3WF0A 5JOXA 4N8MA 4IGOA 2VWOL 1SLCA 2SLIA 4R8HA 3FLTA 3KL6B 3ZXFA 1AR62 3OGGA 1OA2A 1OBNA 4M3CB 2G1MA 1CESA 4B8EA 1HQWA 1BCXA 5D21A 1CJPA 2H0VA 4BOWA 2WFF2 4NIHA 1CEJA 1VBE2 5LW9A 5JPMB 2DU0A 3U11A 1WHFA 4ORFA 3T2OA 3BKZA 2PHFA 1TQ5A 1W9TA 2C9AA 2VUCA 3U14A 1FAKL 1CAVA 3NTGA 4PH9A 2ZHKA 4OCTA 1AXZA 2RS53 4QPGC 5FTTC 2AEYA 3EXUA 4RR3A 4B7EA 2YHJA 3A0NA 2W46A 2XLAA 3M70A 4HKOA 4CUEA 4XL1A 1PNFA 3O1MA 4RS0A 2BWAA 1G1SA 2GMMA 3HIFA 4R9CA 5E8DA 3E6BA 1OI6A 2VBPA 4TTGA 1DDXA 2XJUA 1LMJA 1RUG1 2QKDA 1IQIL 2BTVC 3HO3A 4L92A 5FKBA 3RSJA 3LFMA 5KHIA 2P4EA 3VL9A 1FMD2 3PJQA 4L9BA 3GALA 1SG3A 3J7NA 2X09A 4RHV2 1QQP2 2P3KA 3KT7A 3OGSA 2WYGB 2XC0L 2DVAA 3WQ0A 3KT4A 3NV1A 2WYSA 3I7DA 3ZFGC 3BPSE 3DCQA 4NA9L 1MQTB 4YGBA 3V0AB 2LUWA 4AFDA 2QQUA 4AFAA 3MZHA 3VV1A 2VWMK 3PGHA 5IKRA 1UMZA 1A8MA 3IN9A 4MH0E 1UKGA 4FCAA 2BNNA 2W0XA 2J1VA 5GZDA 4QB2A 2CAUA 3WHTA 2WKKA 4BMEA 4CDUA 3PNAA 1IGXA 4OHXA 1PZ7A 4BWOA 1W6QA 1T6GC 2W1WA 5E1RA 3SC7X 2E7AA 4X8SL 2CWMA 4W4ZA 4XBLA 1BXHA 3APBA 3V0BA 1CZSA 1OPOA 5FZ3A 5FUNA 1OVSA 1KKEA 1VIWB 2DYCA 4QDQA 3H8OA 3ZYGA 2FDJA 1Z0HA 4JAAA 4NMIA 2LRPA 2BUKA 1WCDJ 3VBSA 2AZ5A 2XC4L 3ON7A 2EXHA 3W5MA 3AYEA 5AC91 2PXJA 3HD8B 1T6BX 2W26B 4LE3A 3NRUA 3VDCA 5A1FA 5H9SA 5KHKA 2I9AA 4P9IA 1SLBA 3WG1A 4B1MA 4ZU7A 1BMV2 1LNSA 3WG2A 5JB8E 1LHOA 4UBGA 2ATFA 2TGFA 4Y79B 3WV6A 1CAWA 1RUI3 3H8XA 1ZBA1 4IEQA 1RYYA 2RDNA 5L7OB 4MVTA 1SFPA 2HWB3 1CQEA 2Q1ZB 3ZXKA 2A73B 1LHUA 4QGNA 2BU9A 2W95A 3ILRA 2BOJA 5C8CA 3H1WA 4BLJA 4FTSA 4RA0A 2DV9A 3TEYA 2VZOA 1JL9A 3KV9A 4RSUA 1JOJA 4WZCA 2BVVA 4NRMA 4DXSA 5IKQA 3W21A 1N3PA 4XBMA 5FPLA 4EN8B 3TZIA 3NQHA 4X8PA 5L19A 2RJKA 4EN9B 5ISLA 1C3HA 4Q4V3 2BQ7A 2VOWA 2X53S 4OZXA 1X7AL 2W47A 1Q43A 2YYOA 1PMIA 1UMIA 2FCVA 2XVGA 3J4UH 2MPFA 3V64A 1B35C 3I2IA 4H2AA 1G7YA 1ENXA 5FPVA 4AGRA 2DBNA 2J94B 3WF4A 3V64C 3E5UA 4O9EA 4X8VL 2IXKA 1Y43B 3THCA 3GJBA 5JB9E 1J1LA 4BQ1A 1KD7A 1NXD1 2VNRA 3KQDL 5LBFA 4Y71B 5EJ3A 5IK7A 1AX2A 1BZWA 4M4PA 5JR7B 4IEXA 2QNKA 3HAGA 4YW2A 1PIV2 4GIQA 4LORA 4EE2A 2BQPA 2JDNA 3PIGA 3RDIA 2YXSA 4PI0A 3T0AA 4FP2A 2XR4A 4QPWA 1IS4A 4MMZB 2HYXA 1XE8A 2F6BA 4UF0A 5APAA 4IL7A 5BXXA 1YO8A 1IVOC 1Y9MA 2RJ2A 3QD6A 4FFIA 5A33A 3VBUC 5KC6A 5L9BA 4MG2A 2MEV1 1S0DA 3NT1A 1U8CB 3NV2A 4JTOA 2C1FA 3T4HB 2R1DA 2OYZA 3WSOA 1TZOA 4JZRA 4BQWA 3O1SA 1GP6A 3MIEA 2EALA 3O1OA 2VQAA 4ZPIA 5FPAA 4Q4Y3 2W1UA 5IJRA 4YW7A 1GWMA 1EAH2 4XQWA 4COXA 4A6SA 5F3IA 1JOPA 1MVQA 2JDMA 2VBDA 1VBA1 3VBRB 3AXDA 1A78A 3O5SA 4XEZA 3T4VA 3ZFGB 2EAKA 3VBRC 3QH0A 4LBNA 3ZSJA 1FV2A 1JZ2A 2Q1JB 3VKOA 2Y82B 2A71A 1W6MB 1K5JA 2DF7A 3WDUA 4AVSA 4O7XA 2Y5HL 2HWF3 3USUB 5FK8A 3AZYA 3AMPA 2W87A 2VTXA 3LEKA 3PHMA 2RNLA 1NCQC 1UOGA 3NNJA 2Q8DA 5J3UA 5FZ9A 5L7OC 1LENA 3G6JB 4FPLA 4CU7A 1FNZA 1H0BA 4MHRA 1ATBA 4YPJA 5CKNA 2QQKA 3JU9A 2XG3A 3M7AA 5EYXA 3NJPC 4MGTA 3POGA 1ZA4A 2BFUS 3FLRA 3LPGA 4YVWC 2RA0L 1VBA3 2P6CA 2QQNA 1SPPA 1RUE2 1F0SB 4FPCA 3VBRA 3VKLA 4TN7A 5LK7B 2VZSA 4KI5M 1RUC1 4CCKA 3IDEA 1GKBA 5A3MA 2Z2SB 2CGNA 1ALYA 2GNMA 2VJXA 3I59B 3B9CA 4FO9A 4O02B 5HXVA 4HXCA 1IQAA 1J1TA 1HB4A 5FZ1A 1NCRA 5FIXA 2YGMA 4GKYA 4WVMA 3WW2A 4RS5C 4B4PA 5JPNB 2MEV3 1A6CA 1RMU2 1DIYA 5C70A 4AF9A 4LKSA 4WVWA 2WFF1 4Y5Z0 1Z7S3 4I3GA 4JVAA 3EBRA 3GCWA 3D0JA 3GJAA 3GZEA 3KB5A 1PX4A 1V9U1 4JV4A 4D7TA 4Q0PA 2FLGA 4TLFA 4Y76B 1UZKA 2H6BA 1LJ7A 4NAMA 3AYDA 4XACA 2ZAHA 3AL6A 3MPPG 3D6EA 4LA2A 5KXDA 5CFCB 5JIUA 5AFEA 2MHPA 5F19A 5LA9A 3S5QA 1PGSA 3V65B 3ITQA 2BT8A 1EQGA 3P6BA 4AEDA 5CFCC 1GZWA 5DMYA 1EUUA 2XWBB 3LD8A 3I59A 2B7YA 5GZEA 5FR3A 2EXKA 2GN3A 1QJFA 4GWNA 5E8AA 2ZGNA 1ZRRA 1GR3A 3FWEA 3MF9A 5HV4A 1FI2A 5H9RA 3E6CC 1FSBA 3D82A 4ZAEB 2XXZA 3HN3A 4OHWA 3URFA 3C7HA 1US3A 4QHOA 4C91A 1IPKA 1EY2A 4XDQA 4XHBA 3VHPA 1NCQA 1RB8G 4GAZA 3LFIA 5JZGC 3DPRA 4JQTA 1S1AA 1ULEA 2IZWA 5FZIA 3LTFB 4BXWA 4Y3OA 1DZTA 1HXS3 2W5FA 2BWCA 2WAOA 4DUVA 5H9PA 3ZXDA 4JHZA 3WEZA 1W9YA 4IETA 4CEYC 3A7QA 4Z2WA 4AVAA 5C3SA 4AVBA 4UBHA 4CXXA 1ULPA 3KV4A 1TPGA 4ZHAB 1F8VA 1OXCA 1W90A 3K2OA 4IV1B 5CIRA 2ZGLA 5FZOB 1FV3A 3GDBA 4NJ4A 2W92A 3QLQA 4A41A 5LRRA 5EHDA 4YZ5A 1OQEA 4XJWA 5IKTA 1L7RA 1Y3TA 3IDCB 2JIGA 4XBQA 5FZ6A 4OTYA 1W8UA 1NZCA 4NRQA 3M4FA 2OUHA 4QQHA 5FZGA 1UOBA 4W6XA 5M0TA 2R072 1ONAA 4GU4A 3WOGA 4N7UA 1Q8SA 5FQ0B 4GU3A 2UWBA 2NN8A 1O3SA 4LKDA 2GNTA 4COZA 1UPSA 4ISRA 4XOGA 3KGLA 2VVCK 4YM3A 2WNVA 2UWLB 3WLUA 2H9EL 3ETQA 4YARA 3OSDA 4AHYA 3RWKX 3IMNA 4LOTA 1W03A 4S2HA 5E89A 3RI9A 1LU2A 3PURA 4NR1A 3MIFA 4Y1UA 1NOVA 1B35A 3VKFC 2J34B 1LECA 1BKZA 2CNAA 2YV8A 1OOPA 4O1ZA 2JDAA 4TYSA 3N8YA 1JYCA 1ZX5A 3B93A 3ZFFA 3DXUA 3P1IA 4X8TL 3T2QA 1AL21 3CJIC 4MLOA 3VBOA 1TLEA 1HX6A 3AFKA 5FYIA 4QPIC 5JXGA 3S6XA 4LNVA 3HEIA 2W1SA 1Q8OA 1RUI2 4QAWA 1V70A 3AX4A 2WFXB 1V6NA 1CX2A 1CAUB 1YQ2A 2K46A 1E5RA 4CXYA 1WMXA 4CDWA 4QU1A 5FAXA 2NPIA 5LA1A 1HXS2 1QXPA 4AZZA 5A32A 2JD4A 3NAPA 3B00A 4BQ3A 3THDA 4WVMB 4TWTA 1HX2A 3MQEA 5JVZA 2YB7A 3CL1A 5FZHA 5LK5A 1O6UA 2CSGA 2OXBA 3VB9A 1RUD3 5F3EA 4CDQA 1D7PM 5ACA1 5JSPA 5L2ZL 1KGYA 1U67A 2CWSA 3IIIA 4QX0A 1DLLA 4D0FA 1C5IA 4P9WA 5A6XA 4AYUA 2VMEA 5LBBA 2JENA 4H7MA 5T5PA 4I30A 2RMU3 2DTWA 1O59A 4LHSA 5BNPC 3ZPYA 3HJRA 1P9JA 5FZDA 5JXIA 5J98B 1C5HA 1PO21 5F32A 4GMP3 1LQDA 1UMHA 2OZ6A 1W6NA 2ZXQA 2CYFA 3ILNA 2I45A 4Q4W1 5IUQA 1AR83 1PRHA 2WBKA 2WFPA 3I4IA 2VGDA 1H8TB 1L3JA 1LESA 1W8TA 2MEV2 2PHXA 3ZO0B 3WNPA 1RC6A 1TME1 1CVWL 2PAKA 1AL23 3U7UG 3HR9A 3MBWA 3AK0A 1W0OA 1NAEA 2RS13 4P9LA 5FREA 1CCFA 4D94A 4GB32 1GK5A 1GOHA 1YWKA 4YZUB 2XKPA 3POSA 3N8VA 4H14A 1UU4A 1JS9A 4ZU4A 2DVDA 5K8SA 4QM8A 2ADXA 3RFRA 4EZ4A 4D6SA 4ARYA 3UESA 1TG7A 1JU3A 5I93A 5KXEA 4LTAA 5LRSA 3GISX 3AYCA 3OY8A 2JJ6A 1WW6A 3PU8A 1QNWA 5CADA 1LB2A 2AACA 3PTYA 3ZLIA 1W8HA 4XIOA 1HLCA 1COUA 2ZGPA 5FLIA 3BTZA 3LPFA 1D4M1 1XKAL 4QQOA 2C4XA 3PMEA 5B4XA 3VHRA 4DS0A 4WM7A 1UCXA 5FUPA 5I0RA 4QGLA 3J9SA 4OVEA 1HREA 3NKTA 3MPBA 4WM8A 2JICA 2GH8A 1I5PA 4G9SB 3T1LA 4NUBA 3SNMA 2WPKE 3PLQA 4YZ2A 1YFXA 4M3CA 3H9AA 1M06G 3Q8BA 1RJ8A 1UKRA 3WHUA 2VZ3A 2P37A 4FFHA 3AKPA 4YG0A 4LBQD 2WJSA 4YG6A 4UFJA 5CFDA 3T2PA 2EI7B 3UGGA 4YFZA 5HXMA 4ZH8B 5DDJ1 1ZREA 2TUNA 2WAAA 1J3RA 3BOWA 1GICA 3K75B 4GMP0 1RHI2 2X5IA 1NXMA 1QMJA 1PK6A 3ST7A 4ZZ8A 5KR7A 5E88A 3BCWA 1OKOA 3NV3A 4IEVA 4AI2A 2TBVA 4MGYE 1POV0 4LUMA 1X9PA 2BERA 3M3QA 1RITA 2RR13 2V4AA 2ZZQA 4LO6B 1BYHA 3WR0A 4ZZ5A 4N9HA 2JD9A 1K5MB 2FHRA 1IQHL 2W3IB 1P8JA 2YBPA 5FZKA 4AI8A 5IFPA 2ZACA 2P17A 5G04L 4MGQA 2GALA 5E16A 2A3YA 1R1A1 2MGPA 3KVBA 4HG6B 4HL0A 1VBB1 2B4KA 3I49A 2FCUA 2I74A 3VBFA 3WP4A 2ZX3A 5DZEA 2LW8A 3EYPA 3I2FA 3SH4A 2GD4A 4UYBA 3O12A 4FAGA 2Z42A 2YPDA 4K3UA 2P3FN 4AQTA 2EA7A 2WR9A 4Q27A 1W6MA 4NIGA 3DYPA 2EI8B 1FOD3 3MFAA 2UY9A 4ZXKA 1QU0A 1K45A 4IE5A 4JGZB 2ZEWA 3ZSLA 3AYAA 1RUJ3 2VXRA 3HBZA 3WNMA 3OF1A 3CJIB 4LBMA 2IUWA 1QFKL 4Q2FA 4EROA 4JX0A 1O8SA 4XDOA 1FX5A 1K5MA 4P9YA 1JZ8A 2R042 2VW0A 1GNZA 2VMCA 3CZUA 1R082 1HJ7A 2WO7A 4KWKA 4B7KA 5A3WA 2VH6B 4FOQA 4NWVA 1MQTA 2LALA 4KGQA 3LC3B 3SLIA 1D2QA 1YLLA 2WPLE 5FO7B 1IJQA 3Q9OA 2MGRA 3DKWA 5FZ4A 1ZBE3 1EPHA 4IV3A 3NL1A 4MXVA 3ROUA 2PFWA 3N8ZA 1PIV3 1R1A3 4F83A 1SFNA 2D3RA 1W6QB 1REFA 1UZ0A 4UXAA 2WWSA 1OFNA 1VB2A 3NNFA 3UNPA 2Y80B 3TH3L 1CAWB 1O5UA 2A3WA 1F35A 2HWB1 3NJVA 3SQOA 4WM7B 4AEKA 5CA6A 1AYN3 1WBLA 3FUQA 5FYZA 1VBB2 5I8TA 3RGBA 1EAH1 4J6GA 5K7PA 4OUMA 2FQPA 2JJLA 2PLV3 3WINE 5JSRA 3OGVA 3ZYPA 4MV2A 1RTVA 5IK5A 1CX1A 3LKJA 5B2GB 1FPN1 2KNIA 3AKQA 4CUBA 4D6RA 5F5CA 2ORZA 5FBJA 1DYKA 4FPFA 3TWIA 2QQOA 1JZ6A 1RUD1 1LPGA 1TOZA 2EI6B 1B09A 3FN9A 4I0WB 2JKHL 5FPZA 5JAXA 4TZDA 1G1TA 3KCYA 3WF1A 4NHLA 3LC5B 3TRSB 1QDOA 1YIFA 4HK9A 4YFWA 5IVJA 5I0SA 1HQNA 3KM5A 3ZIXA 4JDOA 2IWGB 2UWPB 2P3JA 2ZX4A 2HWC2 3AMNA 3ZN5A 4D6QA 3F2ZA 4BCUA 3OYWA 4RGKA 4BTIA 2WA3A 4WM7C 3WW3A 3VD9A 1H9PA 5C71A 4QB1A 1G6NA 2RS32 1H2KA 4OI4A 4CPBD 4QXCA 1MZEA 3OLUA 3ACLA 1HCGB 3WQ1A 2BGPA 4LO7A 4CVUA 1NLQA 2ET1A 2D5FA 2E31A 3I2GA 4PDWC 4IW3A 2BOXA 3GCWE 2CDPA 3M3CA 1BBT3 1RUH2 1MS8A 4CUDA 1I1EA 1N1SA 1A3PA 1QJY1 1HB1A 2R1BA 2J22A 4LBQA 4URTA 1WA6X 1W8FA 1ZNPA 1UU6A 2R30A 3NJXA 1NFWB 2V5DA 2E7TA 3RPQA 4ATFA 2JG9C 5A3TA 5JLVA 4O9GA 1XB9A 3B94A 1VLNA 3KSCA 1AX0A 5FXVA 4HKLA 3WP5A 5IYYA 1LU1A 2QUOA 2UYBA 1V9U2 2UYAA 2DVGA 3NKGA 1UY3A 3V0BB 1LPZA 2DURA 1JYNA 2C9KA 3TEXA 1CR7A 1W04A 5L7OA 4L97A 2D6MA 2ES3A 4D7YA 4Q0QA 1VBC2 4LBJA 1OB1C 5C8CB 1AR81 3PVBB 4C1XA 1OC1A 2BDRA 2WNUA 1RFNB 1ZRDA 1D4M2 4KMQA 3C7EA 4V2WA 3S6PA 5ACA2 3VBSC 1NFXB 1OVPA 2J1RA 3CNAA 3T3YA 4A3ZA 4AR2A 2Q8OA 2ZEYA 3TOJA 1N7DA 4XFFA 3MEPA 5A3NA 1AJKA 3VKMA 4Q4X2 1QH6A 2HWC1 3RZGA 5FP8A 5I8SA 4FPOB 4A7KA 5KBFA 4QX8A 4RQPC 3K3NA 4YSFA 3KGZA 1BJQA 1WW4A 1VBD3 3LA7A 1G9DA 3M8LA 4K1ZA 4IGPA 3AKTA 5HCHA 4BA6A 1AVBA 3ACGA 2BQWA 3VZLA 2W08A 2IC1A 2LROA 2RE9A 1H8TC 1DQ4A 1OLME 1K37A 3N9MA 3MV01 1OHFA 3AZVA 1FATA 1DU3D 4M0HA 4META 1YCIA 3J7LA 1VRH1 3LE0A 1XRUA 3N8XA 1S0IA 4JYVL 3UL2A 1HJFA 1CPNA 4LO4B 2J7MA 4QDSA 1QY4A 1ST8A 2O1QA 3NAPB 3VDDA 1WLDA 4XW3A 2NQYA 1BF9A 4EWAA 3DGTA 1RVF1 2BQ6A 2W52A 5ANQA 1FJSL 4OTJA 5IKVA 1LOCA 3OD4A 1XYNA 2WPME 4XJ9A 2P1BA 1DYOA 1ND3B 1X8EA 4LJHA 1S2EA 4HETA 4XJZA 1DFQA 5F9TA 1VRH2 1IHMA 1RUF1 2A6YA 2HOXA 1ATDA 1OF3A 4FPYA 4ZU5A 5FYCA 4YW6A 3ENRA 3INAA 1EMNA 2NYYA 1WCKA 4QKFA 3TEZA 1HIXA 4MGSA 4BJ0A 4E4ZA 2CGPA 4D69A 1C28A 1U12A 1KIGL 1IOXA 4M4RA 5CBLA 2OVUA 2YBKA 5A6ZA 1V6IA 5CFCA 3HWJA 4YVWA 1RUOA 2IFWA 4KG0A 3BIWE 2JG8A 1VJ2A 2EIBA 5GALA 4F8AA 5LZ6A 1XE7A 2VMIA 5GM0A 3LIHA 2WLQA 2D98A 1DG6A 2FCTA 1TMF1 4GWIA 1UOJA 2XB6C 5IWFA 4N53B 2BGCA 4E2SA 2GNDA 2JIJA 2VZUA 2XL9A 4AFMA 3OBZA 1RUD2 2DVFA 4XURA 2L9LA 1OQDA 4AVTA 1G9FA 2ZCWA 2PHDA 4Y22A 4FPHA 2D44A 1WUVA 3AXEA 2K0GA 4M11A 3ZKYA 1NCRB 3CU7A 3LZZA 4Z1VA 4Y1XA 1S2KA 3OLTA 5H9QA 1GUIA 3UT0A 2WSVA 3N9QA 3OEBA 4Z07A 4A4AA 5J96B 1WCUA 1OUXA 3V65A 1KXGA 1ND2B 4Q0SA 2P34A 3J7MA 4AEJA 5EFUA 5I0TA 1JZ3A 2P3YA 5JOYA 4Q4Y1 2GZWA 3F95A 2B46X 3N9NA 3FHAA 3ABZA 2GMPA 1SHWB 2VVUL 3OBTA 1R1A2 4XFIA 3LAGA 2RDQA 5DQ0A 2Z4FA 2JE7A 4FI9A 1W6PB 3EJKA 3CEWA 2WC2A 2RS12 4LUKA 1JHJA 4ONUA 2HJIA 1SLTA 3POEA 2HWE1 1UF2C 5CFDB 3ZDVA 2RM22 3C7GA 5FZCA 1JYXA 3AJZA 2NP0A 2QE3A 1LODA 2XJRA 5FBZA 1TME3 1URXA 4GALA 2GC0A 1V3XB 1GBGA 1ULDA 2V09A 3WQBA 5K0UC 3VUOA 5FYVA 4PF5A 3LA2A 4BQ4A 4CDWC 5GLUA 1W39A 1BLZA 4G4FA 1NA1C 1WMFA 1JN2P 4MADA 5LBEA 1L7QA 1JI6A 4DOUA 1NG0A 2BYVE 4GZ9A 1OQ1A 2B42B 1XDTR 4XJUA 1I9RA 3KHCA 3KQEL 2RS52 2VJ3A 4ZY9A 3SITA 4AQSA 4CP2A 3FZ3A 3FUOA 4BIOA 3B02A 4AI3A 5JOWA 4XF9A 4JGYA 2XBO1 3GGLA 2VH9A 4TLGA 5SV5A 1EPWA 1HRI3 3VL8A 2VZTA 4HVQA 1CN1A 5IVCA 1LTEA 1UNBA 1KJRA 1HW5A 3K4AA 1EV12 2ADEA 3MYXA 4XFBA 1W8WA 1FPN3 3CQOA 3CHXA 4O61A 1MEC3 1QH7A 3HS5A 1NA1A 1EUTA 3MICA 1YQ5A 4LXLA 4YNIA 1HT8A 5FZMA 1J59A 4EQVA 4A7ZA 2V5YA 1HB3A 4ZHNA 5GLVA 3ZDSA 2JE9A 1QJY2 2WL1A 5D8AB 3MIBA 1GZWB 5A3LA 3U07A 1MEC2 4NAOA 4CUGA 5K9YA 3VD7A 3HT1A 4AK3A 2B39A 2UWCA 2WS91 2PHTA 2VVVL 2QJVA 5DAQA 1NY72 4RRZA 1PO11 2KD7A 3NWKA 1LGNA 2XBXL 4P5YA 2D43A 5A80A 1X36A 3AZXA 4Y5SA 1VPHA 2F4PA 4Q4W2 1W9SA 4AHZA 3ZFFC 3CLPA 4JKMA 5BY5A 1F7EA 3SCFA 3VBUB 4IEOA 2VZQA 4BQ2A 1DQ0A 1OLQA 3ZXLA 2Y33A 5DN2A 4NRPA 5FZBA 5I8YA 4GH4C 1ZZ6A 2Y7ZB 3NJYA 2HBTA 1BEV3 1Y9QA 2PHLA 1WZXA 4N43C 4OMDA 4I0AA 4BK5A 3K46A 2OYUP 1F4AA 2WO2A 4EZHA 4Q0VA 5I91A 5IAXA 2OS2A 5FPBA 4FAHA 2Y34A 4CU8A 4RN5A 1ZZ7A 4LT5A 1LAJA 5IVBA 3U73A 2G9ZA 4Q1PA 5JI7A 1PZ8A 2WT1A 1H1IA 3N9PA 2JDHA 4KU7A 4NPLA 1GWKA 2BOIA 5JIAA 4AQ2A 1J58A 4BDVB 5I0DA 1W8OA 2WWJA 1Y7BA 1R092 2VVFA 1NE4A 5IHRA 1AR61 1B35B 2QZ2A 4IEWA 4AQ6A 4M0NA 4HSJA 4LHNA 1XNDA 2Y60A 2QQJA 5F5QA 5LEKA 1EP0A 3QBQA 4AAXA 3GNEA 1RUG2 1COV2 5EYYA 3TAYA 1UZWA 3ZYIB 2BZDA 4U36A 3KZ4C 1AJOA 4GMP1 3WDXA 3ZN6B 3ZX7A 4OFGA 1HRFA 2CGOA 4HFSA 2RDRA 1S0FA 2XOMA 5LASA 4DINB 5CAZA 1FOD2 5T54A 4GXLA 3OYWB 2FBEA 4RYDA 1CAUA 2Z5WA 5FY0A 2VCMA 3M3EA 5J36A 5T3NA 4LQRA 1G9CA 1SQ4A 1VMFA 3IWZA 5FYSA 2E9QA 2F4LA 4F7ZA 1TMF2 3PVNA 4EYUA 4GA9A 2KA3A 3POFA 3SMHA 3W58A 5FYTA 2E7QA 3Q7DA 1W8BL 4QHBA 2B45X 3C9AC 3KCGL 1XNKA 2GP5A 2YBSA 5EQUA 1H1AA 4ES8A 4OHYA 3KV6A 2VUAA 3CKHA 1NA1B 4LHKA 4WVZA 4K1YA 3PTRB 4R4XA 5FRAA 1CPMA 3MW3A 2DCTA 4CCNA 2Q1FA 3U0ZA 3AB0A 1RUF2 5C4WC 3PJYA 4QQPA 4P02B 4Q5OA 4XIKA 3C8XA 4XDPA 2IXJA 4AXOA 1W8NA 5KIRA 2XC5L 2VAUA 4FFFA 4BK4A 4CDUB 4XF4A 1UWWA 2YY1A 1E57A 3FJSA 5FYBA 1SLLA 4XC9A 5EJZB 2VVEA 5LBCA 2XBYL 2AR6A 1OD5A 2WA4A 2HWE2 2WFTA 4YT6L 4CUCA 4IERA 4W8JA 1F5JA 2IXIA 1GFF2 2PHWA 2J4IB 2DU1A 3RZZA 4DEQA 5IT6A 3I3MA 1CZTA 1ZRCA 4PLMA 1MS1A 2WQ8A 1I6XA 2A6WA 2X10A 4NIDA 4Y33A 3OGJA 3FLPA 3L2YA 4J1WA 3VBHC 2BO2A 1EYBA 3I8TA 1V00A 4HPKA 5EIYB 5DAXA 1ASJ1 3JBG2 4FPJA 2D93A 2P3UA 2VBBA 2D40A 2GDFA 2QVSB 1S0CA 4B29A 3VGIA 4XCBA 5IK8A 2CL2A 1DLCA 4QB6A 4L2NA 3GZTB 2E51A 1J9CL 2CDOA 4EV0A 2EIEA 2G00L 5A3UA 5JI9A 4CEYA 2RJLA 3R4SA 4A94C 1HV1A 1IQJL 4ISQA 3QMOA 1OD3A 2Q1MA 1FT9A 2ZPXA 4QX5A 4ASKA 4COVA 3R0RA 2WG4B 4NGAL 3A4UA 3I2OA 4DUXA 1O8PA 3MIGA 5FXXA 3O1UA 4Y4RA 1NLRA 4N43B 5ACA3 3N8WA 4QXBA 4KWUA 1LKNA 3KQ4B 3LA3A 4GH4A 2RDSA 4D90A 3I3EA 4PLNA 1HXS1 1REDA 1J84A 4XF0A 2BNMA 4YZ4A 4LLFA 4FXGB 1VBD2 1YYNA 4EWDA 2XJVA 2GC3A 4JDNA 3TNPB 3ZFEC 1LULA 3CJXA 2D6KA 4D0EA 5GKAC 3V56A 5B4NA 2GP3A 3K3OA 3D0SA 1OLRA 5FZAA 3LB9A 2UY8A 4CDXB 2DFBA 5IVVA 2H0BA 4ZS2A 3UV9A 5GZCA 1NUKA 2FD6A 5EZWA 4MO3M 4COUA 4L99A 2VECA 3RWNA 5LATA 1FYUA 3POYA 1DGLA 4D7SA 3NAPC 2OIIA 3RJRA 1PGW2 2ZGKA 2HLEA 3WNKA 4LBLA 1AR63 1VBB3 1KSNB 4FTBA 1ATEA 4CCLA 4UW3A 5GZFA 2WUHA 1IQFL 5FJHA 2XLGA 4Y7AB 1XXNA 5AVPA 1AYM3 3K77A 1DZRA 4XBNA 3IDBB 2DWRA 4HN0A 1K3IA 3CJIA 1O3RA 1OH3A 5LY1A 4I01A 3OBRA 1V9U3 2AYHA 1VAVA 3H1YA 2P95L 4CEWC 4E8CA 1AYM2 1UN1A 1UW8A 3MDPA 2P3IA 1GNHA 4UFHA 4JC1A 1QXJA 4PIXA 4AFCA 2B9VA 4QXKA 2HEVF 4XFGA 5A7WB 3KD4A 3IPVA 5FMDA 3OB8A 4NHKA 4PLOA 1RUNA 1SFYA 4QGMA 3R05A 3NNLA 5K0UB 1HN0A 1MS5A 1VBA2 3MFCA 4XFHA 4XZPA 5I0UA 1PO12 1K42A 1REEA 4AE2A 1V6LA 3H1MA 4YW1A 4E4SA 4R9BA 3NMBA 4QKDA 3VDBA 5LY2A 5F1AA 3SEEA 2VY0A 4QX3A 2PLV2 4MZUA 1RUJ2 5JUVA 5FXZA 3UETA 1VAKA 3AMQA 5JXHA 3CBNA 4DPNA 4XUNA 1PIV1 5DUUA 5LWBA 1EBVA 1H4HA 1KITA 1O91A 4R9DA 1MPXA 1PZ9A 2KXLA 5FP3A 4BPZA 2F17A 5EGMB 5BPXA 3MI8A 3UKNA 1RMU3 2R061 2J2UB 1HRI2 1O5DL 1I0UA 2HWD2 4CCCA 2VC9A 1VALA 1RGSA 3USUA 4AFBA 4CP1A 3IPVB 1UQXA 4H7LA 1JUIA 2UWOB 3LGRA 1NFUB 3AL5A 1APQA 3MLKA 5AC93 2ZGSA 1YUDA 3ME2A 5JBBE 4LIVA 4DZGA 3LEIA 3LIWB 2WLPA 1ZBA3 3GZAA 4KG8A 4N9IA 2XVKA 4I0BA 2YG0A 4MX3A 2Q8EA 4DB5A 1WLWA 2E26A 4LBOA 3ZYRA 1L5GB 4XE9A 3ZYBA 4A45A 1M1XB 5C4WA 5BNOC 4AI1A 1WKYA 1WD4A 4HZFA 2P6HA 3RYKA 3SKVA 2YU1A 5ABJB 3CMGA 5JVVA 5A7QA 4Y26A 2YGPA 1KDMA 1Q5OA 1MQ6L 3BB6A 3RR3A 1DGRN 1S55A 3CIHA 2CU5A 3HN1A 4KBZA 4S2DA 1ND2A 4A44A 1UO9A 5FY1A 3AKRA 3CS7L 1VRBA 1U5IA 2CAVA 1YQ6A 1PM7A 1KLIL 3GM8A 3IZOA 3PL0A 4UFKA 3POJA 4AVCA 4RD7A 2VWLL 1PGL2 3MLLA 3HOBA 4JDMA 2D3SA 4WV8A 2J95B 3HO4A 3OPWA 1JODA 5GLZA 1ZRFA 3RZJA 4NO4A 3HNYM 5FZ0A 2ZEZA 4LITA 4DMIA 4FXKB 1UPIA 4Q4X1 1DQBA 4PDWA 4K8RB 3MW2A 1LOFC 5CU1A 1W2OA 2R073 3WDYA 1G1RA 2WT2A 1RUC3 4UI9L 4Y4YA 4QDRA 3M3OA 1QEXA 3O0VA 3IT8A 4QX2A 1NCQB 3AKSA 2P28B 4LMFA 2H6CA 3USSA 5DUWA 2CJIB 1KJLA 2WZR2 5DZGA 4BYYA 5LEJA 1IP0A 4Z82A 2Y26A 1GP5A 4JCKA 4UFLA 4LO8A 1D0HA 1X82A 3I2DA 1UX7A 2HORA 5A1AA 2P94L 2Y6GA 4ATEA 1B9WA 3TK5B 3DUIA 4CSWA 2XJSA 2VUDA 3IMMA 2KB9A 1S4CA 1UY0A 4IE4A 2PHUA 3WNOA 5CKQA 2YGOA 1AXYA 1DVAL 3VDDC 2ARCA 2YC0A 1SBFA 1TNRA 2FLBL 1BHGA 2ETEA 2R041 5F6KA 1AF9A 2FDKA 2K2TA 2HWD3 4LE4A 4CP0A 5L36A 4NHMA 5K0UA 3LIGA 2YU2A 3ENSA 2W94A 4FPGA 4XYXA 3MO4A 2ARXA 3DECA 1DQ2A 5A1LA 4RS5B 1JZ7A 1EMOA 1W2TA 3WCRA 5EWSA 1XNCA 1W2AX 1OA4A 3CENL 1QJZA 2Y5FL 4K7JA 4E4HA 1PNGA 4K21A 5JVYA 1A3KA 4LK6A 5DXDA 3ACFA 1IQML 2YZ4A 3A23A 3KV5A 1NLSA 4PQQA 3RZHA 3EO6A 1STMA
chains in the Genus database with same CATH topology
1N1VA 2ZOEB 5T50A 3O7OA 1ZZBA 4YT7L 1WA4A 1SBEA 2BPA2 4XETA 1FFMA 5BNOB 3UJQA 1FMD1 2XLFA 1HKDA 3UJOA 5C9AA 1YGCL 1WLCA 3H3UA 4EWEA 2ZX2A 2W2OE 1SACA 4BTTA 1AL22 2G4IA 2A6VA 3D4KA 1N47A 1R081 1JH5A 1APNA 3N7LA 3LSDA 2GSYA 1IGOA 1ND2C 4HVRA 4S2FA 3O0WA 4P5HA 3ZXAC 3EGFA 3EHKA 1JBUL 1PO22 1N3QA 3JCIA 2C5DA 3ZMNA 3ZXEA 3OCPA 3D8CA 4Y20B 1URKA 3WD5A 5BUVA 4C1WA 2Y5GL 5ABJA 1AHSA 1AX1A 2O8OA 4IV1C 1AXKA 1MEC1 1SMVA 4YVSC 3B01A 4K40A 4XFCA 1PGW1 1YI7A 1OOPB 3E5XA 1LOFA 1IS6A 2ZHMA 2ZX1A 1GLHA 1UIJA 3S7IA 3H8UA 1U5XA 2WS92 4U2AA 4FTEA 3OY8B 3B9IA 4K6BA 4XPVA 3LCPA 2IFRA 5GLWA 4Y6DB 3AZZA 3GBGA 4BH9A 4W6YA 4BE3A 4XXAA 1DIWA 1YNAA 3ZN4A 1W7XL 1CVNA 1WD3A 4BDXA 4Y1VA 2QDNA 3B7MA 1UZZA 1EV11 1IQKL 4IEYA 1A8DA 4HK8A 3VHNA 4RQPA 4FQZA 1BQPA 4P9XA 2FMYA 2DUOA 1YIPA 2LTNA 1Q3EA 1WMEA 4N43A 5HCFA 1RIRA 2R6QA 1KLJL 1V6MA 2NZ9A 2KV4A 1SLAA 3JBG3 1OPMA 1ADXA 4ITCA 4LHLA 1XU2A 4ISIL 1L3YA 2W2NE 4FSJA 4YGDA 1LMMA 2YROA 4X8NA 3BTAA 4UW5A 2I07B 1KRIA 2D1JB 1LHNA 3E6DA 4YG3A 4CDXC 1RUH1 4FBFA 4QM9A 2W86A 4UW6A 2I9BA 3VBUA 2HWF2 1EPJA 2UU8A 3VBOB 1TNFA 3JD73 2R062 3J8F2 1TEIA 2RS31 1BBT2 1RUH3 2VOKA 4JGZC 2XBO3 1Z6EL 2GC1A 2WINB 1XU1A 5T52A 4DFSA 4QT6A 1X33A 4OHVA 1HRV1 3AM2A 2EIGA 1H1MA 4YZ3A 3TK6B 3KMHA 2ZABA 4FPEA 2WG3C 1JW6A 1U5YA 4HN1A 3R4UA 2YPJA 2DDUA 1UAIA 3MGUA 3DL3A 3DPRC 3F6UL 2XJPA 2PR3B 3KT1A 1RUC2 5CG8A 4JGYC 3CFWA 1HQLA 1Q4GA 1NQJA 1ZZ9A 5DG2A 1NYWA 5F1RA 1HDKA 1BVP1 2BOHA 2CY6A 2FLRL 1MQ5L 1RINA 1AYM1 2R043 2D6LX 2AUYA 2VUJA 4A2UA 1AR72 1SBDA 1YHFA 3N8WB 1BVVA 1CONA 2ARBA 4L11A 2R49A 2P2KA 1VBD1 2W2PE 2ZGTA 4RR3B 3C3VA 4DXZA 2X5IC 4AHXA 3M2MA 2Y38A 1EGFA 4R52A 4XXPA 1GV9A 5FOJB 4G1MB 1AR71 2EF6A 1C5MF 4RHV1 3X29B 2X8KA 3WP6A 2VQ0A 4NOTA 2BNOA 4PJYA 2ZX0A 4IV3C 2MNGA 1V6OA 5AVAA 1IPJA 2KM2A 1IQGL 2EAAA 1DHKB 1GYKA 3WCSA 2B8MA