3ASIA

Alpha-neurexin-1 ectodomain fragment; lns5-egf3-lns6
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
395
structure length
395
Chain Sequence
ADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurexin-1-alpha
publication title Structural Basis for Variant-Specific Neuroligin-Binding by alpha-Neurexin
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion
total genus 92
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3asiA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA01
3KQBL 1DFQA 5F5QA 5CB7A 4YW5A 4E1GA 4DQAA 2PR3B 3FUQA 4Y1UA 2P3FN 2ERFA 1I3HA 1HJ7A 3IM0A 4Z8BA 3VKOA 4R9DA 3O0VA 5DZGA 2XBYL 2TEPA 4H55A 2P3JA 2J2UB 3W59A 4FOWA 3B69A 1J1TA 1MACA 3Q3KB 2P3TA 1HLCA 3LTGD 1SBDA 4WV8A 3N3HA 3ZSLA 3D5OA 2ZHMA 2EXIA 3OBRA 1WHFA 1LOCA 2JDZA 2JE9A 4X8TL 2FLGA 4YFWA 3MQEA 1TLEA 1GNHA 1AXYA 4M3CA 2WT0A 3LN1A 3AX4A 4AYUA 4YM0A 4CUEA 2BOKL 1WUVA 2I9BA 1QF3A 2JD4A 1EZQB 2EF6A 1N47A 3ASIA 4DRVA 1EMNA 4O02B 2YV8A 3Q7DA 3RR3A 4AGVA 3NWKA 4XTPA 2EIGA 2NMNA 2JECA 2WSUA 3ATGA 1LENA 3RRDA 5AVAA 3U4XA 3IITB 3N8WA 1EPHA 2JKBA 5JVVA 5GLTA 1C4RA 3HS5A 3IN9A 2DU0A 2DVBA 3VKFC 1D2SA 2E7QA 2Z42A 1HRFA 3N7KA 4XIKA 2GDFA 3HS6A 2E51A 1O4YA 3V65B 5GZEA 1GANA 4Y1ZA 2AREA 2UWBA 3R4SA 2W39A 2OUJA 4Q8KA 1VLNA 1MS1A 4ZH8B 4FPOB 3LSEA 3WDTA 5H9SA 4M00A 4FPJA 4RRYA 1LU1A 2D6KA 2AYHA 4LBKA 5HCBA 1MS3A 5K0HB 3VUOA 3AZZA 2W3IB 3N36A 4XIOA 2FD6A 3AZXA 2VVCK 2A6VA 2DTWA 5KXBA 1S0FA 4P9XA 1SBFA 2BOHA 3ILRA 2RNLA 1ATBA 1VALA 3B9CA 2WT1A 1DQ1A 2KV4A 1JV2B 1CPMA 1VAMA 5FDQA 3WCRA 1WW5A 4ISRA 2ZA9A 1YUKB 2FMDA 3WOGA 4BM8A 6COXA 3TGFA 4PCRA 2LALA 4Y1VA 2GMMA 4PBPA 4FPYA 1DQ2A 2VVVL 3M1HA 1PTHA 3TH3L 1COUA 1NZIA 2ZMKA 2DYCA 2P28B 3APBA 2NM1A 2H9EL 1HQWA 2DV9A 3WCSA 1S0DA 1FJSL 1URXA 3VKNA 1ENSA 1ZAQA 1GKBA 5KXDA 3QMOA 5IKRA 3DEMA 4LBQB 2E6VA 1SCSA 1RFNB 3AP5A 5T5PA 1AX0A 4XBQA 2VY0A 2YZ4A 4YGDA 4ISIL 1LOFA 3CS7L 1JUIA 1CCVA 1Q4GA 4NA9L 1V00A 5F9TA 4WVWA 4CRQA 3B01A 1SCRA 1TEIA 1APNA 5GZGA 2NPRA 1GYKA 4FOQA 4XJAA 3AYEA 2A3YA 5EGMB 3AZYA 2EXJA 2SLIA 4Y26A 3V64A 4UW4A 2EI6B 3RMYA 3A0NA 4XBMA 5JDBA 1U0AA 2YXSA 2W2PE 3POYA 2ZGNA 2XB6C 4Y1XA 1A3KA 1CR7A 1WW7A 1DIYA 4COXA 5CKQA 1WLWA 2P3UA 1S0EA 2V5YA 1XFEA 1NFUB 1BXHA 5EYYA 3TZIA 1SLCA 2ZGTA 3DGTA 2A70A 3BIWE 1LEMA 1Z6CA 4P14A 2UU8A 1WD4A 1GICA 4CSYA 2WFXB 3I8TA 1DZQA 2Y5FL 1YYNA 2P3IA 1W6QA 2A3XA 2KM2A 3OYWA 2GN3A 2DTYA 1JOJA 4Q1PA 1MS0A 4AQTA 3AXEA 4CUDA 2GNBA 4YGBA 1PZ8A 5CAZA 5JMCA 1N3OA 4LBJA 1FX5A 3FBYA 3BPSE 3WHTA 2VWNL 3V64C 2Q5TA 3BTAA 2DURA 4JRAA 1BYHA 2ZHKA 3MPPG 1SFYA 1G1RA 1BF9A 3V0BA 1WW4A 2R1DA 5EWSA 1MS9A 2W2ME 4GWMA 1V6NA 4FOVA 4X8VL 2W86A 1OB1C 4LBOA 3A4UA 2WPJE 4FVVA 5JB9E 1Q8SA 1IQGL 3B3QE 1DQ0A 1DQ6A 5DUVA 1N1YA 3FCSB 2D43A 3WDYA 1F0RB 3ZXJA 4ZXKA 2BQ7A 4LBQD 1LOBA 4YFZA 4JC1A 1V6IA 2GN7A 4FOYA 5IK8A 1DX5I 3NV2A 5GM0A 3UJQA 1ULCA 1B9WA 3QH0A 4ISHL 5JVZA 3HO3A 3HN1A 1WHEA 1UL9A 3N35A 1DGLA 2C5DA 3SLIA 4YW3A 2A6XA 2I9AA 2NMOA 3ZYRA 1G9CA 5IKQA 1IKQA 3TK6B 2I2SA 1CX2A 3WDVA 3IPVB 5GLUA 3LC5B 3PVOA 4Q2FA 5JBCE 4X8UL 1ULGA 3O5SA 2KL7A 3ZSJA 1UPSA 2WLQA 1G9FA 5T52A 1PRHA 4Z0LA 1WLCA 1IQKL 1FNYA 2D7FA 3HO4A 4GA9A 4M3CF 1W6NB 3JU9A 2F9BL 1KDKA 2LTNA 5LK5A 5FREA 4RL7A 2WPME 5T5JA 2W2NE 1MQ6L 4YM1A 5DG1A 1LGBA 4YW2A 3M3QA 4ITCA 2FLBL 2WFTA 5IT6A 2EI8B 1BZWA 5JW1A 4SLIA 4BTIA 1YXWA 1G7YA 3BT1A 3TB0A 2YROA 1QU0A 2A3WA 1N3QA 4XHXA 2WPIE 3FFZA 1UZZA 5JB8E 1ATDA 1ATAA 5E88A 4LBNA 2D3PA 3WDWA 2ZGRA 3A0KA 5L2YL 4XE9A 1LHVA 3K9XA 4RUTA 1JBCA 4K1ZA 1I1EA 1N3PA 1KJRA 3VV1A 1A3PA 3RMXA 2DWRA 3ZVXA 4YZ2A 2W52A 1I0UA 2WKKA 3OLTA 4ISQA 4Q1RA 4ATEA 2P26A 3USUA 3ZXFA 2ZGKA 1MQ5L 1AVBA 1FFMA 2BOXA 2ZMNA 5JLVA 3T1MA 2P2KA 2XBWL 4K1YA 2D44A 4FPCA 3IMNA 4P9YA 4D69A 4Y7AB 1P9JA 3AYAA 4M3CB 2K2TA 4Y20A 1LEDA 3WG3A 5CKNA 4JYUL 2A6WA 1FE2A 4YZ5A 1EPJA 2SBAA 1IQIL 2A75A 2W2OE 5H9RA 2RA0L 4FPLA 2BQPA 2Y81B 1EPIA 1IGZA 1YUGA 3F1SB 1JXNA 1WCSA 4BOWA 5CA6A 1V6LA 2Y38A 3N8ZA 3INAA 3OBTA 2VW2A 2OW4A 4YG3A 2ZHLA 1GZCA 1EGFA 4BDXA 4YG0A 3SH3A 2A7AA 2FLRL 2OVUA 2B7DL 2ZZJA 1AF9A 1G2LB 3AZVA 3KK6A 5E89A 5GLWA 2Y5GL 2GD4A 1A78A 4TZDA 5E8AA 1HDKA 4LBLA 1X7AL 1G1TA 3ELAL 4YT6L 4FPGA 3HR9A 1FSBA 1UMZA 2WSVA 3AP4A 2ENRA 1CONA 4G1MB 3N8XA 4BXWA 1SZBA 2Y82B 2VW1A 3RQ0A 1RITA 2YGPA 2JE7A 1HAEA 2R49A 2WJSA 3NV4A 1JYCA 1FNZA 3NT1A 1G9AA 1AXKA 2BMGA 1AJOA 1CQEA 5H9QA 4JZEL 3GCXE 2BOUA 3N7LA 4OTYA 3PMEA 2YY1A 1SLTA 1W6PA 1S0CA 1GK5A 1ATEA 1U8CB 3D4KA 2PHRA 2D3SA 5T55A 1QDCA 2WPLE 1CESA 1LCLA 1S0JA 4WVVA 3SITA 4NOTA 1IS4A 1JN2P 1AZDA 3WG4A 2CWSA 2CJIB 1H9PA 1ULFA 1DYPA 5GZDA 1FAKL 4XL1A 1QFKL 1LPGA 4HL0A 1EPGA 1HX2A 1DQBA 2D1JB 1PFXL 4XMAA 4FP3A 2KB9A 3WUDA 1V6MA 2CY6A 1WD3A 4XOGA 4JZFL 2W08A 3ZXLA 1IS3A 3H0OA 2C9AA 3T1LA 4Y24A 3FUOA 4CUFA 3LIWB 3ENSA 4D90A 3OY8A 3AK0A 1FF7A 3U7UG 3O0XA 2BQ6A 3KQEL 3LTFB 1ADXA 1DBNA 2YMZA 1UZQA 4YM3A 4PQ9A 3FLTA 3WLUA 2ZGPA 1UN1A 2ZBJA 4XILA 2ZHNA 2OYEP 1NXD1 1EQGA 1C57A 2J38B 1O5DL 2P95L 2DVFA 3Q9OA 4FPKA 2VH9A 5KXEA 2AYLA 4NGAL 1MS8A 4TYSA 3LAQA 2UWAA 2GMEA 1W6QB 1EPWA 4XJUA 2GNMA 3M3EA 2VU9A 4YM2A 4M10A 5JOXA 5CNAA 4UW3A 1HAFA 1C5MF 3CENL 1FV2A 1DLLA 3U73A 2DVAA 4RRXA 4LBQA 4Q27A 2Y7ZB 2ZABA 1YIFA 1CVUA 2RHPA 1F9KA 4MMZB 3SOVA 2A6ZA 3F6UL 1LQDA 1LHWA 5DUXA 2ADXA 2Q1JB 3BT2A 1LTEA 1RIRA 2FZZL 1Q8OA 5KN5C 3R4UA 1GZWB 3AJZA 1NQLB 4ZXYL 4ZKTB 2J4IB 3KQCL 1ULDA 1P0SL 2E53A 1B09A 2UWLB 1JW6A 4BTUA 1YI7A 3OPZA 1F0SB 2XC5L 2ZGUA 2R1BA 1Q56A 3SW2A 1K36A 4MMXB 1U67A 2CNAA 1KRIA 1LULA 2GNTA 3N8YB 2NZ9A 3MEPA 2D6NA 3WHUA 2ZGSA 1KLJL 3NV3A 1Y7BA 2DUPA 2UWPB 2CTVA 3KL6B 2R0FA 4Y22A 4RRZA 4UW5A 4OTJA 1QDOA 2W2QE 3IJEB 1TOZA 1IQFL 3N8VA 5GALA 1W0PA 3P5BL 3W58A 5BYNA 4Y71B 4RA0A 2DVGA 1UZYA 3C9AC 3CFWA 3LCPA 5GLVA 1G1SA 3ENRA 2ZGQA 1CJPA 1MVEA 3ZXKA 3FFGL 4A7IA 4X8SL 2AUYA 2P34A 2XBVL 3QCWA 4Y1YA 2M74A 1X50A 2PELA 1OFSA 4XXAA 2PHBB 2YGOA 4YT7L 2DUQA 4XJWA 4YGEA 1KQRA 2WYJB 1N1IA 2DU1A 3N7MA 1FV3A 1W6OB 1DDXA 1W6MB 1NT0A 1WLDA 5I46L 2EI7B 2DDUA 4YGCA 3OJBA 2Y5HL 1IS6A 2P37A 4BDWA 1IS5A 2WPKE 1XDTR 4R9BA 4W65A 2P3FL 5CKMA 4L8QA 2CL2A 2ZACA 1UKGA 3WDUA 1MZ6A 5EXOA 1GLHA 2EXKA 1IQEL 2MGRA 3V0AB 2P16L 4GKYA 2ZAAA 2PHUA 3AP9A 1ZA4A 1JBUL 3LC3B 4GALA 3LSDA 1G1QA 1RINA 2VVUL 3RG0A 3IPVA 4ASMB 1DVAL 1IOXA 4R9CA 3M36L 2BO2A 1EAIC 3IKWA 5T54A 4BMEA 4U2AA 3MW2A 3UK9A 2D3RA 3HPTA 2B7YA 1JL9A 1W6NA 4Y20B 3WDXA 1LHNA 2XG3A 4YZUB 4XJ9A 4BLIA 1ENRA 1JHNA 1IKPA 3ZXEA 3BODA 2OYUP 1G8WA 2ARBA 1LOGA 1SACA 5COXA 2VWLL 3MDLA 1EMOA 5DG2A 1QOSA 1KSNB 1HQLA 5KIRA 4C16A 4XJZA 1IQHL 4DPNA 1PXXA 2VWMK 5FRAA 1MS5A 4I30A 1N1TA 3ZYGA 2VH6B 1DYKA 2ZGLA 4FPFA 1LODA 3TBDA 3ILNA 5JBAE 4Z0KB 3HO5A 3NTGA 1LGNA 2VUAA 4M11A 2JKHL 5DUUA 3VKLA 4O1ZA 1EBVA 1KITA 2A6YA 1PZ7A 4LORA 3HS7A 2AGSA 4Y7BB 2UURA 3I4IA 2VWOL 1WBLA 3WUCA 2P3KA 4WZFA 3OLUA 1KLOA 4CZSA 2PHXA 2ZGMA 3KCGL 1CEJA 1G86A 3GCWE 1N7DA 1K37A 3MW3A 3KQDL 3PVEA 1XKBA 3ZYJB 4AVTA 4Y6DB 3N8WB 3O12A 1W7XL 4Y76B 1LU2A 4XXPA 3ZYIB 4C1WA 2WQZC 2WG4B 2D6LX 1XKAL 2ZGOA 3TAYA 3OGGA 3GALA 4HANA 1WU1B 2PHTA 5T5LA 5EYXA 1UZJA 4NO4A 3WG1A 4YZ1A 2UWCA 3JUUA 3NJPC 1IQLL 4IQPA 1DQ4A 4KBBA 3KRKA 1W6PB 3SISA 5L73A 5DZEA 1HZ8A 1S0BA 3H5CB 1QKQA 2P93L 3D6EA 1ZM1A 4TGFA 3KQRA 1EQHA 3UL2A 5KXCA 1V6JA 1ULEA 3WNXA 2TGFA 1XQNA 2EALA 4F83A 1W0OA 5F1AA 3CA7A 2EXHA 2DVDA 5HCAA 1Z0HA 1SLBA 4AVSA 3M3CA 4R9AA 2R0HA 1HCGB 1FAYA 1KIGL 3ZSMA 1NLSA 1ENQA 2NP0A 4RRWA 1YUFA 1LMJA 3SNMA 3AFKA 2WNEA 3O0WA 1HT8A 5GLZA 2K2SB 4XMIA 5HCFA 1UAIA 1IJQA 1SLAA 4Q26A 1KDMA 4JCKA 3OY8B 1G2MB 5CBLA 1CVWL 3POWA 3SOQA 1H9WA 2PHWA 1LESA 4M3CE 1LPZA 3T2TA 5JBBE 1APQA 5DXDA 1NFWB 2J34B 2D6MA 3M37L 3AP6A 3QLQA 4PBOA 2WYGB 3SH5A 3V65A 4XJ8A 2PUQL 2J95B 4JZDL 2EAKA 3PJQA 2VH0B 3AYCA 1IQJL 4XTMA 5T5OA 2GNDA 4BPZA 1L3YA 3B00A 1MZ5A 4FPHA 5H9PA 5GZFA 2PHFA 2DUOA 2AH2A 3POSA 5JOZA 1OQ1A 4XHBA 2ARXA 2WG3C 3RSJA 2ZKNA 1IOAA 2XBXL 1MR5A 3SOBB 4BQ1A 1DIWA 1NFYB 1KJLA 3SH4A 4Q8LA 1G9BA 4FP2A 1IGXA 4RS0A 2NYYA 1AXZA 1IOEL 5IUQA 4BTTA 4PH9A 2BQWA 4ATFA 1Z6EL 3TK5B 4XZPA 3UJOA 3L2YA 1PGEA 1QGLA 4FM5A 1AUTL 3OYWB 2CYFA 1NFXB 3ILFA 3VKMA 4FQZA 3M3OA 1LHOA 2FHRA 2BZ6L 4MMYB 4XYXA 1JYIA 2V73A 1UZKA 2P94L 1C1FA 2XC0L 4YZ3A 1S0GA 3AP7A 2GMPA 1MS4A 1MOXC 1BJQA 1URKA 2A71A 1R1ZA 4BLJA 4AGGA 4LMFA 1AJKA 2R16A 1F7EA 2E7TA 3V0BB 4FPEA 5IKTA 4BXSA 1GSLA 2UWOB 1YGCL 2W26B 4YLZA 1S1AA 2ZMLA 1VAVA 5GZCA 4LBMA 3WV6A 4C1XA 3FLRA 3AXDA 2W3KB 1FATA 1CIWA 4Y22B 1IP0A 2D6PA 2OUHA 4MYEA 5F19A 4K20A 1FAXL 1LOFC 4PF5A 2GALA 3ZSKA 1CVNA 2MGPA 4XBNA 1OKQA 5CISA 1QNYA 4P9WA 4GKXA 4CTEA 4AVVA 1YO8A 1UX6A 1O4ZA 2Y7XB 3MW4A 4YZ4A 2NN8A 2Y80B 2XC4L 1GNZA 3ZPYA 1V3XB 1HREA 1CN1A 1GZWA 5IK7A 1V6KA 2MHPA 3DUIA 1QOOA 3M2MA 1MVQA 3PVNA 1V6OA 5JOWA 2G4IA 1BKZA 4GWNA 3CNAA 1VIWB 2H0BA 3N7JA 4AWDA 3R05A 3PGHA 5IK4A 1DQ5A 4ZAEB 1ONAA 3N8YA 1SLIA 4GXLA 1J9CL 4UW6A 1WW6A 3HMYA 1W8BL 2W68A 3EGFA 1LPKA 4ZHAB 3AJYA 5T50A 1AX1A 3WZ1A 1Q8QA 1LHUA 4NG9L 1CQ9A 3LN0A 1GBGA 1S0IA 3GNEA 1QMJA 2J94B 3BOPA 1GV9A 2JJ6A 3KM5A 2D6OX 5L2ZL 3AZWA 1N1VA 4YW1A 1LGCA 2WT2A 1LOEA 5SV8A 1AX2A 3FLPA 1QNWA 4K21A 1KLIL 1D0HA 2VXRA 4XBLA 1LJ7A 3ZYPA 5GJ6A 1L5GB 4D0FA 1TPGA 1SLLA 1G9DA 4Z6AL 4DRRA 3WVJA 2G00L 1UZPA 5E8DA 5IK5A 4JYVL 1APOA 1Q8VA 3USUB 1H30A 1A8DA 2A5ZA 1F31A 1GZ9A 2VW0A 4XLWA 1SBEA 1LECA 1W6OA 1PZ9A 1CPNA 3C2UA 1W6MA 1N1SA 2CWMA 4AGRA 1IQML 5JOYA 2WPHE 1Q8PA 1QOTA 5L30L 4U36A 1DHKB 1HT5A 4FQ4A 3RS6A 1M1XB 4YW4A 3WG2A 4M01A 1FYUA 1BQPA 4OZXA 1IQNL 1CCFA 5IKVA 1YRZA 3V0AA 2HYKA 1NPEB 4D0EA 2AENA 1F7MA 4YG6A 2VJ3A 5DUWA 2AR6A 1C1LA 4ZXXL 5DZFA 4DFSA 1Z78A 3AYDA 5JVYA 1HKDA 1IVOC 1WBFA 4Y79B 4DS0A 1F5FA 3GISX 4BMBA 2ES3A 3NTBA 3NV1A 1LOAA 4XDQA
chains in the Genus database with same CATH superfamily
1UF2C 3KQBL 1DFQA 3HNMA 5F5QA 5FTTC 5CB7A 4YW5A 3WNNA 5AC93 2Y60A 1UYXA 1XE8A 1JU3A 4E1GA 3C7FA 4NWWA 4DQAA 2PR3B 1XE0A 3FUQA 4IW3A 1ZRIA 4Y1UA 2BZDA 1L7RA 2P3FN 2E63A 2ERFA 1XJAA 3SKVA 1H8TC 1I3HA 5F5CA 1HJ7A 2W2IA 3IM0A 4QGNA 4Z8BA 5A3OA 3VKOA 1C5IA 3A22A 1KD7A 1EUUA 1HN1A 2ID4A 3MFAA 4R9DA 4GH4B 3J7HA 3O0VA 5DZGA 3JBG2 5J98B 2XBYL 2TEPA 4H55A 1X8EA 3RFRA 4EN7B 2P3JA 1B35C 2J2UB 4HVRA 2VMHA 2VRSA 3W59A 4FOWA 1KXGA 4Q5OA 3URFA 4I2OA 3B69A 4NVPA 2PHDA 1J1TA 5FZ9A 4A45A 2RM23 4RHV2 1OXCA 1MACA 1W2AX 4XVHA 3WF4A 1ZZ9A 5DN2A 4BHPA 3Q3KB 2P3TA 1HLCA 5C7GA 3EYPA 3LTGD 4D94A 4C0BA 5JSPA 1SBDA 4WV8A 3FZ3A 3NNGA 3S6XA 1EUTA 1H1MA 3N3HA 1PMHX 2C6SA 3WP5A 3ZKUA 1RHI1 5CG8A 2OT7A 1LRHA 4PHZA 5CADA 4QXHA 2P3YA 2R041 3ZSLA 3D5OA 1IPKA 2ZHMA 2EXIA 3OBRA 4TLFA 4AR2A 4BH9A 4CDXB 4EN6B 1WHFA 2VXJA 4CCNA 4AI1A 5K0UC 1LOCA 2JDZA 5DDJ1 4LQRA 4LHSA 1OSGA 3CO2A 4OVEA 2JE9A 3L2HA 4X8TL 2FLGA 4YFWA 1O59A 5FXWA 4AQ6A 4BK4A 3MQEA 4JHTA 1TLEA 1GNHA 5FPLA 3J7NA 1H6XA 3BKZA 1AXYA 4IL7A 2WT0A 4M3CA 3LN1A 3KCCA 4G4FA 5A3NA 3UKNA 3AX4A 1PO22 4AYUA 2P6CA 4L0PA 4YM0A 3ZFGB 4CUEA 2BOKL 1WUVA 4BQYA 2I9BA 1QF3A 3KB5A 5FO7B 2DCYA 2JD4A 4CDQA 1EZQB 2EF6A 4IE5A 5E16A 3VDDB 1N47A 3OBAA 4QX3A 3RYKA 2HJIA 2V72A 3ASIA 5EQUA 3VL8A 1RMU2 4QPIA 1EMNA 4MLOA 3WNPA 4AFBA 4O02B 2YV8A 3Q7DA 2BP6A 3RR3A 1W9YA 1W8UA 3GZUC 4ORFA 3NWKA 3UT0A 4AGVA 2HEVF 5FO8B 4XTPA 2EIGA 2NMNA 1VBC1 2ZZQA 2J1SA 3N4MA 1RUD3 2JECA 4Q4W1 2WSUA 5KHGA 3ATGA 1LENA 3POFA 3VBSC 1NE4A 1DZTA 1EV12 3RRDA 1RB8G 4GJYA 1PGW1 2XBO2 3GYDA 5AVAA 4CP9A 4QPYA 2VMIA 4CU7A 5DAQA 4P02B 3U4XA 4KU7A 1RUF3 4E4ZA 4XFBA 1MPXA 4OYUA 2XVGA 3ON7A 3AVRA 1YFYA 5BNPA 2BNOA 5FXZA 3U11A 3IITB 3N8WA 1EPHA 2JKBA 2FDHA 4PJYA 3ZYBA 1RUF1 5JVVA 5L9RA 5GLTA 1KS4A 1S2EA 1C4RA 4A7KA 3HS5A 4MGKE 3IN9A 2DU0A 4LA3A 2DVBA 4UFLA 1FOD3 4Q4V3 4HVQA 1SDWA 4FFFA 3VKFC 2QZ3A 3MIEA 2CGNA 4HPKB 1UZWA 3PUIA 4XUTA 1D2SA 3WT3A 1JHJA 3T0DA 2E7QA 2Z42A 1HRFA 3N7KA 4XIKA 1FOD1 4N53B 2BTVC 4CCKA 5I0SA 4J25A 2GDFA 4LE4A 3HS6A 2VQAA 2E51A 3H42B 1S2BA 4JQTA 3E5UA 4CU6A 1O4YA 3V65B 1ZBA2 1D7PM 4Q4Y2 2XWJB 5JXJA 5GZEA 3T0AA 1AYM1 1GANA 3LOIA 1Y9QA 4RN5A 2PMWB 4Y1ZA 2AREA 2UWBA 1O8PA 3K2OA 4QX2A 3R4SA 2W39A 3WP6A 2QCSB 4B1MA 5EJ3A 2OUJA 3MICA 4BQ4A 1VLNA 1MS1A 4QB2A 5FZLA 4ZH8B 4FPOB 4Q8KA 3LSEA 3WDTA 1DU3D 4FI9A 1NOVA 4W6WA 3OTFA 5KHJA 5H9SA 1SDDB 4CCCA 4M00A 2B8MA 4FPJA 4RRYA 5HV4A 2ZX0A 5FYCA 5I91A 1LU1A 3VBHC 4AEDC 5LA2A 1W99A 2D6KA 5LA1A 1UU6A 2WYFA 4V2VA 4NIGA 2R063 2AYHA 3IIAA 4LBKA 1HXS3 4W50A 2I74A 3MIGA 1MS3A 5K0HB 5HCBA 4KNCA 3VUOA 3AZZA 2W3IB 3N36A 4XIOA 1FMD2 2FD6A 4PI0A 4CEYC 3AZXA 3RZZA 2R061 1HXS1 1QJY3 3H1YA 3FC0A 5LBBA 1NCQB 4FTEA 1RJ7A 1W8WA 2PTMA 4IUGA 5A3TA 2VVCK 1WWYA 2A6VA 2V4VA 2DTWA 2IXKA 3NVCA 4KMQA 4XF9A 4W8JA 4DXSA 5IVFA 1S0FA 5KXBA 2WN3A 5FOBB 2VUJA 2HWB3 3KV5A 4GH4C 1SBFA 2BOHA 3ILRA 4P9XA 1COV2 4ZXEA 2RNLA 1ATBA 5IHRA 1AR63 1VALA 3B9CA 4LHNA 2HWD2 2HWB1 2WT1A 2P6HA 1DQ1A 2KV4A 1JV2B 3KV6A 4X8NA 2WFF3 4QU1A 1CPMA 3I59A 5FY7A 1OHFA 1AR61 1VAMA 4NPRA 5BNPC 5ABJB 5FDQA 1YIPA 1WW5A 3POJA 3WCRA 3N9OA 4ISRA 4Q0SA 1Q43A 1O3TA 2ZA9A 2WNUA 3M70A 3FHAA 1O3RA 1VE0A 2WZR1 4XUPA 2QVSB 1YUKB 4JRLA 5IAVA 4YWAA 4CCLA 2Y6LA 1PGL2 4XC9A 2FMDA 2E9QA 3WOGA 4BM8A 6COXA 3TGFA 4PCRA 2LALA 4Y1VA 3S7EA 2GMMA 2VMFA 2HBTA 5IVBA 2HWF1 4LUMA 4PBPA 4FPYA 1DQ2A 5B2GB 1JTZX 1W28A 4G3YC 5CVRA 3HIFA 2VVVL 3M1HA 1PTHA 3MYXA 5C9AA 2W0XA 3TH3L 1COUA 3KVAA 4GQ7A 1NZIA 2ZMKA 4UFMA 3GBGA 1XPWA 2DYCA 4LTAA 4PIYA 2P28B 2Q4SA 3NNMA 3SEPA 3APBA 2PLV3 4D6QA 2B42B 2NM1A 3T2QA 2H9EL 2FCVA 2JG9A 1HQWA 1JYTA 2O14A 1W2NA 2DV9A 3WCSA 1S0DA 2PLV1 1FJSL 1URXA 1YQ2A 2ZTNA 4HKLA 4I02A 2XKOA 3VKNA 1ENSA 2VTXJ 4I0AA 4BU2A 4E2GA 3VZOA 5LEJA 2XL9A 1ZAQA 1GKBA 3ZFGC 5KXDA 3QMOA 1RUJ2 5IKRA 3DEMA 1Z7S2 2JDKA 2YB7A 3HEIA 4LBQB 3VDDC 4DO0A 4J1XA 5LCWL 4COZA 1ND3A 2E6VA 1UWWA 1HB3A 2QQVA 3UKTA 4Z82A 3VBFB 1UZ0A 1UYYA 4K8FA 4OUEA 4A3XA 3LOBA 1RVF1 3AVSA 1SCSA 1BEV2 4IV3B 4FTSA 1OOPC 3ZN6A 1RFNB 1VBB3 3AP5A 4Y4RA 1TMF3 5FMCA 4LO6B 4L99A 2EVXA 2FZ1A 3OB8A 4I01A 5T5PA 2OZJA 1AX0A 2OPWA 4C91A 5J36A 4XBQA 2VY0A 3AFGA 2YZ4A 4YGDA 1Y3TA 2WDBA 4ISIL 1O8SA 1HRV1 3K3NA 3ZFEB 3WSOA 3WQBA 1LOFA 5BNNC 5FY4A 3CS7L 1MQTA 3I97A 3PUAA 1JUIA 3WNOA 3J7MA 5JSOA 4NIHA 3QOPA 1CCVA 4YW7A 4D7SA 3ZYHA 2Y6FA 3KMHA 4DZGA 1Q4GA 3EQEA 5F5IA 4AK3A 1ZA7A 4NA9L 2VPVA 3GZAA 3ZSEA 4IEOA 4D6SA 2FDIA 1OLRA 1V00A 1K42A 4AFDA 4Q0UA 4QHZA 4WVWA 4XURA 4CRQA 5F9TA 3RZKA 5FZOB 1E5RA 1YFUA 3B01A 1W03A 4HKOA 2PQQA 1SCRA 1TEIA 1VBD1 1APNA 2Y33A 3VD5A 4E4DX 5GZGA 5J09A 3DYMA 4GIQA 1RUNA 1O91A 2NPRA 1GYKA 4FOQA 4XJAA 1WA6X 3AYEA 3PUSA 4OQ8A 2A3YA 2EIEA 5EGMB 4WM7A 3C7HA 3AZYA 1PVC2 2WL1A 2EXJA 2SLIA 4Y26A 5FZHA 1AR82 4UW4A 2EI6B 1H6YA 3A0NA 4YVWC 2TNFA 4WVMB 3RMYA 2VZPA 4YVSB 4XBMA 4B4PA 5C9AC 5JDBA 4YSFA 1HN0A 1U0AA 2HORA 2YXSA 3FN9A 2W2PE 3POYA 1NE6A 1QWRA 2ZGNA 4PT6A 2XB6C 3VB9A 1W8ZA 4HK9A 3DPRA 4Y1XA 4IE6A 3KGLA 5CIRA 1A3KA 2IVJA 1CR7A 1WW7A 1DIYA 4COXA 3JB8A 3LKJA 3MGUA 5CKQA 4HT1T 1WLWA 3OSDA 4Y5SA 2P3UA 1S0EA 2BOJA 1RL3A 1XFEA 2V5YA 4IE7A 4XQDA 1NFUB 1ZRFA 3CKHA 1BXHA 4XABA 5FY9A 5EYYA 3THPA 5LBFA 3TZIA 3JBG1 1UD1A 1SLCA 2ZGTA 3DGTA 2A70A 3VZMA 3BIWE 4PLMA 1LEMA 4QAWA 1Z6CA 4UAPA 5LEKA 4P14A 2UU8A 1TZOA 2VD7A 1WD4A 1IPSA 1GICA 3MDPA 4CSYA 3B94A 2WFXB 1NCQC 2VCMA 3IDEA 3ZKYA 4HFSA 1MEC2 4KWJA 3ORJA 3I8TA 1RYYA 1CAWA 5LBCA 1DZQA 5FYSA 1PO12 2Y5FL 4H7MA 4O7XA 5LA0A 4Z07A 4EROA 3RJ2X 1YYNA 4C90A 4YPJA 4DB5A 2RR12 2P3IA 4AF9A 1W6QA 3NSTA 1UYPA 2A3XA 2KM2A 2GC1A 2W47A 3E6BA 3GHNA 3OYWA 2XLGA 3J8F3 1UU5A 2Z5WA 3ZIXA 2GN3A 3WP3A 1SG3A 1LR5A 2DTYA 5ABJC 1JOJA 1OI6A 4FSJA 4Q1PA 1W2UA 1MS0A 2EIBA 4LEJA 1DP0A 4AQTA 1VBE2 3PNAA 5FLJA 3AXEA 3KLSA 1GOFA 4W4ZA 1V9U2 1Y9GA 4CUDA 2GNBA 4QDQA 3ZIWA 4AAXA 4AHXA 5A1FA 4YGBA 1PZ8A 5CAZA 5JMCA 1VB4A 4UBHA 1N3OA 4LBJA 1UW8A 5FZ1A 3ZFFA 1FX5A 3LPFA 2EIDA 1PO21 3FBYA 3UYJA 3ZXGA 2VR4A 1MZEA 3RZHA 1OQDA 2R7EB 3BPSE 2VVFA 3WHTA 2VWNL 2VVEA 3V64C 4MXWA 3ZXDA 5J96B 1NCRB 1HB2A 2TUNA 4INDA 4BCUA 1EY2A 2Q5TA 1RMU1 3U4SA 1W8FA 3BTAA 1RUG2 2DURA 3OG2A 1GP4A 3W9AA 4JRAA 1UOGA 4LKDA 4ZU7A 5AFEA 1BYHA 2ZHKA 4BE3A 3MPPG 1ZRCA 1SFYA 5FY0A 1G1RA 4OHWA 4CCMA 5HPOA 1BF9A 4DEVA 5EJ1B 1WW4A 5C71A 3V0BA 5D2AA 4ET7A 2MPFA 2R1DA 4P5HA 5EWSA 1YUDA 5FPBA 1EV11 1MS9A 4AEMA 3CLPA 2Z4FA 2W2ME 2XBO1 1AL0G 3IMMA 1AR93 1AL23 4GWMA 4EWEA 1V6NA 5CFDA 4FOVA 2ATFA 1QJZA 4OULA 4XUQA 4CP0A 2LRPA 1E57A 4X8VL 1OMIA 5FPXA 4LO8A 3VBFC 2W86A 1NYWA 1J3RA 1RTVA 4Q0QA 1OB1C 4RS5B 1NUKA 2WQ8A 4LBOA 4AI8A 3RGBA 3ALQA 1YCIA 5KC5A 3A4UA 3TYJA 2WPJE 4FVVA 1X7NA 1QH6A 4OUSA 1Q8SA 5JB9E 4KQ7A 1IQGL 3B3QE 1DQ0A 3E6DA 2RMU3 3GM8A 2RS32 1XC6A 2OQ6A 2QQUA 3BCWA 2DCKA 1JYVA 1R083 2WNOA 1DQ6A 1HQNA 1SFPA 2ORXA 3OUHA 5FZ6A 5DUVA 4CVUA 2RDSA 1N1YA 3O1SA 3FCSB 1CJDA 1F2NA 2D43A 4MOAA 4NROA 5C4WB 3RI9A 3WDYA 1ZBE3 1F0RB 3I2FA 1QIUA 3ZXJA 1GQHA 1XB9A 3BTZA 4ZXKA 3MLJA 3HBZA 4DNYA 4CDUA 2BQ7A 4KWLA 2YBSA 5L7OB 2VMCA 4OHZA 4LBQD 2OXBA 4IDZA 3POGA 4KL1A 5A32A 5F7UA 1LOBA 3MLKA 2VZ3A 4YFZA 4QKDA 1T2XA 2ET7A 3ZR6A 5B4NA 4JC1A 1SEFA 1JZ5A 4NJ4A 1HRI3 1PIV2 2I45A 1QJX2 1JZ3A 5FZ3A 5BV6A 1V6IA 1QXRA 2GN7A 5FZKA 4FOYA 5IK8A 4QXKA 3MUZ1 3VD9A 1EAH3 3VD3A 1DX5I 3Q8BA 3EB7A 1YHFA 2C1FA 5LB6A 3CQOA 1RGSA 3NV2A 3OGSA 5I8SA 5GM0A 3UJQA 1O7FA 4H2AA 5FMBA 4ES8A 5HI0A 1ULCA 1EAH1 1B9WA 4YVSC 3QH0A 4LIUA 4ISHL 5JVZA 1Y43B 3IIIA 3N9MA 3HO3A 3HN1A 2VM9A 2HEWF 3T08A 3W21A 3CJIB 2BBAA 1WHEA 3U75A 4QGLA 4HZFA 4BWOA 1UL9A 3N35A 1R1A3 3QH6A 4D6RA 1AHSA 1DGLA 3T0BA 2C5DA 3SLIA 5JZGA 1XYOA 2VMEA 4YW3A 3VBRB 2JG8A 4LE3A 3MIBA 1ASJ3 2A6XA 2I9AA 1R1A1 2NMOA 3WNKA 3ZYRA 1G9CA 5IKQA 1FI2A 1WMDA 1YFXA 1IKQA 3QH7A 1Y4WA 1OLMA 5FLIA 5JI7A 3TK6B 2I2SA 3H3UA 1CX2A 3WDVA 3IPVB 1TNFA 4XDPA 1QH7A 2IFWA 5D8AA 5FBJA 5GLUA 3LC5B 2Q1MA 3EBRA 3ACLA 3ELNA 3PVOA 4FFHA 4GWJA 4OMCA 5JBCE 4Q2FA 4BB3A 1O3QA 3VBOB 1UIJA 3VHPA 5JI9A 3ES4A 2B4KA 5J3UA 4X8UL 1ULGA 3O5SA 2KL7A 3WW3A 2UYAA 3TEWA 2R30A 5FQ0B 2WS92 2VQ0A 4JAAA 4JV4A 5LATA 3ZSJA 1UPSA 1BMV2 4Q0VA 3D8CA 1OQEA 2WLQA 4R52A 2W91A 1ZZ7A 2HYXA 1G9FA 3Q8AA 2VBDA 5T52A 4GMP3 1PRHA 3G7DA 4ZU4A 4Z0LA 1BBT2 3I3EA 3JD73 1WLCA 3RDIA 3ZYFA 5C3SA 1IQKL 2CAVA 1FNYA 1F4HA 2D7FA 2RS53 4JKLA 1ENXA 3HO4A 4GA9A 4M3CF 5KHKA 1W6NB 3JU9A 4XFIA 3LDKA 4B4QA 2F9BL 2XUEA 4S2HA 5IVYA 1KDKA 2K0GA 1PK6B 2LTNA 5AFBA 3VZNA 1H2KA 5LK5A 5C8CC 5TSWA 1QJU2 3EJKA 1BLZA 4RYDA 5FUIA 5FREA 2EAAA 2VUDA 2CU5A 4RL7A 2WPME 5T5JA 1WGPA 1UU4A 2W2NE 2XONA 5EHDA 2QTWB 1MQ6L 5A3PA 4YM1A 3EMRA 4B7KA 5C3PA 4JGZA 5DG1A 5FP3A 2YDEA 1LGBA 4H14A 2XJTA 4YW2A 4MGTA 5IVEA 1RUJ1 3M3QA 4ITCA 2FLBL 2WFTA 5IT6A 2EI8B 4BQWA 1BZWA 5JW1A 4SLIA 4UXAA 2J22A 3LWCA 4BTIA 4H3WA 1ND2B 1JYXA 4M0HA 3HBKA 2FDKA 4CPBD 3JB4C 1YJKA 1YXWA 4GD4A 1POV0 1G7YA 5DABA 5F32A 1V1IA 5APAA 2JDYA 3BT1A 2QQWA 2XQRA 3TB0A 2YROA 5JCTA 1CAVB 3QBQA 3KT1A 2JDAA 2WFF2 1QU0A 2XGXA 3M3IA 1F4AA 4UFHA 2A3WA 1N3QA 1ZYBA 1XNCA 2WPIE 4XHXA 2FCUA 1H8TA 4QX8A 4CU8A 2BPA2 3FFZA 4LO7A 2KR2A 4UFJA 1RUE3 1UZZA 3RWKX 4OCTA 5JB8E 4Q4X3 4BDVB 5D8AC 3J4UH 2RG4A 2X09A 3WNMA 1D4VB 4KI5M 1RUE1 1W9TA 4PDWB 1S4CA 3BTYA 3HJRA 4A2UA 1B35A 4Q4X1 5IFPA 3VHNA 2RVAA 2NQYA 1GUIA 1ATDA 3D0JA 3UGHA 1L3JA 4AVAA 1OLME 5SV5A 3AKSA 1YQ6A 5FPZA 5A33A 1ATAA 1RUOA 2RS12 4IEVA 2W9XA 5E88A 2RE9A 4LBNA 3WF3A 2D3PA 4DXRA 1UMIA 3WDWA 2ZGRA 5C4WC 3A0KA 5L2YL 2WNVB 2ARAA 4XE9A 5FK8A 1PVC1 5JR2A 1LHVA 2Y26A 4UBGA 1RUH3 3OPWA 3K9XA 4GB32 4RUTA 4ONUA 4DUXA 1JBCA 4K1ZA 2VZTA 4X6RB 1I1EA 2GSYA 4YYOA 5L7OC 1N3PA 4CDWA 3LDRA 1KJRA 3VV1A 2K46A 2HWE3 2WWJA 4QQHA 1A3PA 4QB1A 4F8AA 3RMXA 2IUWA 2Y0OA 3K3OA 4ASLA 2DWRA 3ZVXA 3K4AA 2W52A 4BXFA 4YZ2A 1I0UA 3WW4A 2L9LA 2WKKA 4MO3M 2WRAA 1O5LA 3NAPB 1W04A 2R072 3OLTA 4ISQA 4Q1RA 4ATEA 4NMIA 2P26A 3MO4A 1CAXA 3JQWA 4K7JA 3USUA 3OUJA 5FZMA 2ZX3A 3ZXFA 2ZGKA 4IE4A 5HCHA 3CJIC 4OMDA 1MQ5L 1U5ZA 4AI2A 1AVBA 1QXPA 3WQ1A 4DMIA 5F1RA 3R6SA 1FFMA 2BOXA 3KWVA 4XDOA 3VGIA 2ZMNA 2V09A 5JLVA 2VOXA 3T1MA 1ACCA 2P2KA 3VBRC 1F8VA 1PO11 2ADDA 3SMHA 3PHMA 2XBWL 2LUWA 2C26A 4K1YA 1UX7A 2D44A 3RZGA 3VBSA 4FPCA 4WM8A 3IMNA 3P5BA 4P9YA 4D69A 4Y7AB 1P9JA 3AYAA 4M3CB 5FAXA 2K2TA 5FWEA 1R092 1NQDA 1UZVA 4Y20A 5F5AA 4AI0A 1LEDA 2ZAHA 4BA6A 3NKTA 3WG3A 4EN9B 5CKNA 4DUWA 4JYUL 2A6WA 4CDQB 1FE2A 5BXXA 3LGRA 4YZ5A 1EPJA 3BUCA 5J37A 2SBAA 2WIIB 1IQIL 2A75A 1VBE1 1XNAA 2W2OE 1XNTA 4KG0A 3NMBA 3IT8A 4QPIB 2RA0L 1RXFA 1V9U1 4FPLA 5H9RA 5LW9A 2BQPA 2JXAA 2Y81B 2VQUA 1QEXA 1W3XA 4EN0A 5FPUA 1SHWB 3S0MA 2ZEXA 1EPIA 1IGZA 1YUGA 3F1SB 1F15A 1QQP3 1I6XA 1GWKA 1QHDA 1RHI3 2HEYF 5BPXA 1KKEA 4XFFA 1JXNA 3C8XA 2BWAA 2R043 3AMPA 1WCSA 4QDSA 3PIJA 1QQP1 3OOXA 1OBNA 2J1RA 2B5HA 3AC0A 4HBNA 4CEWC 4JDNA 4BOWA 4ZZ8A 1PK6C 5DDJ3 3GCXA 2BNMA 3OEBA 5CA6A 1V6LA 4J1WA 2Y38A 1RUG1 4CDWC 2FD8A 5A6QA 2IXHA 4AEKA 4AAPA 3N8ZA 3INAA 3LFIA 1UXZA 3OBTA 4RR3C 2VW2A 4AHZA 2ARCA 2OW4A 4CCOA 4QKBA 4YG3A 4K8RB 4HMZA 2ZHLA 1GZCA 1EGFA 4BDXA 2QBXA 4YG0A 1E5IA 3VBHA 4AEDA 3SH3A 2A7AA 2FLRL 1ND2C 2B7DL 2OVUA 4HG6B 5DPNA 2ZZJA 5J48A 1CIYA 3S57A 4W6XA 1AF9A 2XUMA 2VZQA 2QJVA 1G2LB 1VBC3 4D7TA 5A1AA 4Q4W3 1K3IA 3AZVA 3I2IA 4XUOA 3KK6A 5E89A 2WWUA 3L9JT 4PF1A 5GLWA 1JYNA 5IVCA 2Y5GL 1PM4A 1YI9A 2J1AA 4LHLA 1VRH2 1PHMA 2OPKA 2GD4A 5A7WB 1A78A 1D4M2 1H4GA 1XRUA 5JIAA 4TZDA 1BVVA 2X5IB 5E8AA 4PLOA 3LA7A 4WM8C 4Y33A 1HDKA 4LBLA 4ZONA 1HJFA 2JIJA 2VGDA 4GH4A 1CZVA 3BU7A 4NRQA 5C3OA 2MEV2 3LZZA 4PDWC 1X7AL 1X9TA 2PQSA 2Y34A 3HQXA 5FZ7A 4DY3A 2PN5A 3MV11 3DYPA 1VB2A 3IBMA 1G1TA 3ELAL 4YT6L 1YQ8A 3KVBA 1WCDJ 4FPGA 3DXUA 4LKFA 1OVPA 1FSBA 1UMZA 2WSVA 2WUHA 3AP4A 3HR9A 2ENRA 2LM3A 3KGZA 3H3ZA 4RFT0 5IVJA 1W90A 1CONA 4DPNA 4G1MB 1QJX1 1DGRA 3N8XA 2YU2A 4BXWA 1SZBA 2P1BA 2Y82B 2VW1A 3PU8A 5F2WA 4YW6A 2R6QA 3RQ0A 4QX7A 1JZ2A 1GNYA 5DAWA 4MADA 4PIXA 4AFAA 2QKDA 1V0AA 5F3IA 4NIDA 1RITA 2YGPA 1XXNA 4COVA 2JE7A 1AYM3 3FMGA 1HAEA 3K4DA 1XNKA 1C8NA 2G1MA 2R49A 2WJSA 2HOXA 3HQUA 4CXYA 3NV4A 4N43B 3ZN5A 4NHXA 1JYCA 4N7IA 2PAMA 5ANQA 4MUVA 4EWDA 3TN92 3I59B 1FNZA 5L19A 3CJXA 2YGQA 1W9SA 3TNQA 3NT1A 1UKRA 1G9AA 1AXKA 3EHKA 1RC6A 2BMGA 1AJOA 1UOBA 3HNBM 4I3GA 3GBWA 4WBBA 1CQEA 4HK8A 4EJRA 3NAPC 5H9QA 3PIGA 4JZEL 3BGAA 2P5BA 4RGAA 4Q0PA 2FDJA 3U1XA 3GCXE 2BOUA 4MX3A 3N7LA 4OTYA 2JB8A 3NNLA 3PMEA 2JX9A 3I2KA 1NQJA 2A73B 3ZFGA 2BT7A 3MFCA 4ZY9A 2YY1A 3GF6A 1SLTA 3PDQA 1W6PA 2QNKA 1S0CA 3VDDA 1GK5A 3MIFA 2XHKA 1ATEA 1U8CB 3D4KA 1OUSA 3WY6A 2PHRA 2XJPA 5FP4A 3AB0A 2D3SA 5I0DA 3VN4A 5T55A 1QDCA 2D93A 4XAEA 2WPLE 1CESA 1OOPA 2Q8DA 1LCLA 1S0JA 4XQ4A 4WVVA 3SITA 5JSRA 4NOTA 1ZZ6A 2JG9B 1IS4A 1JN2P 2ZX1A 1AZDA 4XCBA 3WG4A 5FUNA 3RNSA 2CWSA 1EP0A 2CJIB 3D3AA 3R0RA 4NHLA 2QDRA 1H9PA 1ULFA 3BTXA 3NNFA 1DYPA 2YYOA 5BNNA 3E5XA 3Q8CA 4IERA 5KHHA 3W5MA 4HSJA 2IZWA 3KV9A 5GZDA 4D3WA 1ND3B 1OH3A 1FAKL 4CUBA 4CUCA 4XL1A 2WZR3 4P9GA 4E27A 4TXWA 3THCA 1QFKL 1XNDA 4KGGA 1LPGA 4HL0A 2O1QA 1STMA 4LA2A 1EPGA 3H1WA 3HAGA 4XF4A 4HPKA 2HWF3 5IVVA 1HX2A 3ETPA 4HXCA 1DQBA 2D1JB 1PFXL 3AKPA 4FP3A 4XMAA 3WF0A 4DEQA 3OCPA 2KB9A 1VP6A 3WUDA 3C7GA 4OI0A 1V6MA 2CY6A 1ASJ2 1WD3A 4XOGA 5EZWA 4JZFL 2K2SA 4QPGB 3RPQA 2W08A 5LASA 4DY5A 1RUC2 3H8UA 4QQLA 4YVWA 1NX9A 3UV9A 1W8TA 4CDXC 3ZXLA 4L9BA 4OHVA 5K7PA 2O0OA 1IS3A 3H0OA 2D98A 5FJKA 3WF2A 1HIXA 2C9AA 3RI8A 2YFUA 3T1LA 5FZIA 4Y24A 4AZZA 5C70A 5FDBA 4XCAA 1W9WA 3FUOA 1QJFA 1REFA 1CWPA 4CUFA 5FZ0A 3LIWB 3ENSA 4D90A 3OY8A 3AK0A 4QX1A 3UGGA 1FF7A 3U7UG 3N9LA 3FWEA 3O0XA 2BQ6A 3KQEL 3LTFB 1ADXA 4LLOA 1WA4A 5FKBA 5FZBA 2WAAA 1DBNA 1RVF3 3ST7A 2YMZA 3AKQA 1UZQA 3LQCA 4K9SA 1C5HA 2ORZA 2ZJCA 4YM3A 2BVVA 4PQ9A 3FLTA 4E9KA 5DQ0A 2HH9A 3WLUA 5J7MA 1NCQA 3H9AA 1VBA2 3MUY1 3CU7A 2ZGPA 1HRV3 2DCZA 2HWC2 2IXJA 2X5IC 3LD8A 4MZUA 4CCJA 1UN1A 1AYN3 2ZBJA 4LJHA 1OPOA 4XILA 4XF1A 4DRVA 1XSQA 1FPN2 1NKGA 2ZHNA 4MG2A 3MF6A 2OYEP 1J3QA 1NXD1 2ETEA 4UWDA 2DCTA 1AYN1 1EQGA 5BY5A 4D0QA 4RGKA 4QU2A 2VBBA 5ABJA 1C57A 3CL1A 2J38B 4IGQA 4N53C 1H0BA 2GP5A 5IFTA 1O5DL 4TTGA 1H1IA 2ZCWA 3TEXA 2P95L 3CHXA 1VBD3 3BPSA 4ARXA 1AR73 2DVFA 2LW8A 3Q9OA 4FPKA 2VH9A 5KXEA 2JB4A 5I93A 3KF3A 2W94A 3DN7A 2AYLA 4NGAL 1MS8A 2R071 4HKWA 4TYSA 3LAQA 1AR71 3VD4A 3OEAA 2UWAA 4JKKA 5ERLA 2GMEA 1W6QB 1EPWA 4XJUA 2GNMA 3M3EA 2VU9A 2EA7A 3LEIA 4M10A 4YM2A 4AQSA 5JOXA 2QDNA 3O1MA 3A23A 5CNAA 4COWA 4UW3A 1HAFA 2BGCA 1C5MF 3CENL 2YUEA 1XNBA 1FV2A 2GH2A 3I3DA 2XLAA 1RUI2 5ACA2 1ODMA 1NLRA 1DLLA 3U73A 5FYTA 3IDCB 3JBG3 2DVAA 4RRXA 3OD4A 3CEWA 2Z69A 5FBZA 2KXLA 1K12A 4I0BA 4JTNA 1NY72 1UXXX 5FXXA 4LBQA 4Q27A 2Y7ZB 2ZABA 4AQ2A 1YIFA 2QQKA 1CVUA 5C5TA 4RHV3 2RHPA 3VBFA 1F9KA 4MMZB 4XDQA 3PUQA 3F95A 4BQ5A 4K40A 3SOVA 2VZOA 3I49A 1UY3A 4GZ9A 2WO3A 3F6UL 2A6ZA 3PMSA 1JS9A 1W9FA 1LQDA 1ZRRA 2OA2A 3CMGA 4QMAA 1LHWA 4RHV1 5FZEA 5DUXA 2KNIA 2VOKA 3DL3A 2ADXA 2Q1JB 1HB4A 4W6YA 5AVPA 5FZFA 3BT2A 1LTEA 1RIRA 1KFXL 2FZZL 3FE5A 1Q8OA 2AC1A 5KN5C 3ZFEA 4KWKA 1ULPA 3GBFA 2FMYA 3R4UA 2PHLA 5FYBA 1GZWB 2PA7A 2IXIA 1NQLB 3AJZA 2VNOA 5ISLA 4ZXYL 2P17A 5A70A 4ZKTB 3UKVA 4K3UA 2J4IB 3KQCL 1ULDA 1W05A 3GZEA 5FP7A 5A7PA 1C8M2 5LY1A 4NPMA 2Y8KA 5B4XA 1P0SL 2E53A 1SPPB 1B09A 2GC3A 2UWLB 1T6BX 2C0ZA 4HVOA 2WWSA 5FZOA 4AVCA 5C5UA 1DCSA 1JW6A 1OF4A 3HQRA 5HV0A 4LKSA 4BTUA 4DINB 1PO23 1YI7A 3OPZA 5IW0A 1F0SB 1TME2 2XC5L 5AC92 4AI3A 3VBUB 2ZGUA 2R1BA 3N9PA 1RMU3 4A41A 1Q56A 3SW2A 1K36A 4LITA 1PGSA 4MMXB 4UYBA 1U67A 2CNAA 2V4AA 3POIA 4WVMA 4YVSA 3SC7X 1OFNA 5EIYB 1KRIA 2XDVA 3ACHA 1UCXA 2X8KA 3E1F1 2YPJA 4CDUB 1LULA 3P1IA 3I2GA 2GNTA 1VJ2A 3N8YB 2NZ9A 3JCIA 3MEPA 3PJYA 5FFOC 4UF0B 3C3VA 3HOBA 2D6NA 4OI2A 1VMFA 3E97A 1EV13 3MF9A 2JD9A 2OYZA 3WHUA 2ZGSA 1VRH1 2XBO3 2BW8A 1KLJL 3SHRA 2BGPA 4LPLA 2VMDA 2P4EA 4X6QB 4CE8A 2ILMA 1Q5OA 4RSUA 4B29A 2RM22 1DGWX 2J1EA 3FHQA 3NV3A 1Y7BA 3OGJA 2DUPA 4XQWA 2Y6GA 1WMFA 5CFCB 2UWPB 2CTVA 1RHI2 1YQCA 4Y3OA 3VDBA 4ZS3A 3KL6B 2R0FA 1OT5A 3BALA 2W1UA 2PAKA 3USSA 2RJ2A 1X9PA 5A6ZA 2W92A 3PURA 4EYUA 4FBFA 2QE3A 2MNGA 2VL4A 2VCBA 4IV3C 1JZ6A 4Y22A 2J42A 4LK6A 4RRZA 4NUBA 4OUMA 4O65A 4UW5A 4OTJA 1QDOA 4P9IA 5ANNA 1X36A 2W2QE 3IJEB 3MIDA 3QD6A 4FO9A 4XW3A 2VZVA 1TOZA 2ZXQA 1HJGA 2VBPA 4WZCA 1IQFL 3N8VA 5GALA 1W0PA 3P5BL 1CZTA 3PLQA 4FXKB 5FZDA 3W58A 5BYNA 4Y71B 3ZFEC 3AL6A 2BEOA 5HBAA 4QKNA 4RA0A 3GGLA 4NHYA 2DVGA 5D21A 1UZYA 3C9AC 3CFWA 4BQ2A 2JJLA 3LCPA 5GLVA 2PYTA 2CDPA 1G1SA 3QACA 4NIAA 3ENRA 1ZBA1 2WFPA 2DFBA 2ZGQA 1CJPA 3KT4A 1MVEA 4Q4Y1 2RJLA 4QM9A 1POV3 5FMDA 3ZXKA 3FFGL 4A7IA 3WQ0A 4X8SL 5C8CA 2AUYA 2P34A 4EQVA 4MSVA 5GKAC 4B1LA 2BSFA 1POV1 5FY5A 3KQ4B 1VBC2 3NJYA 3AMMA 3VL9A 3H7YA 1TG7A 4Q4W2 5JIUA 3JXSA 3KSCA 2GH8A 3LPGA 4LOTA 2XBVL 4QD2A 5LWBA 3QCWA 1RUD2 1FMD3 4Y1YA 4GULA 4EZ4A 2M74A 1NCRA 1X50A 2PELA 1DDLA 4IV1B 1OFSA 4XXAA 3PTRB 1FMD1 2PHBB 2YGOA 1X82A 2GC2A 4YT7L 4JGYB 4AG4A 2JICA 1RUF2 1I5PA 2VUCA 1COV3 4LLFA 3AL5A 2DUQA 1IG0A 2RV9A 4UOJA 2HWD3 3H3LA 2B9VA 4IETA 1E5SA 4XACA 1COV1 4XJWA 4YGEA 3H7JA 3THTA 1FOD2 2I07B 3T3YA 4Q4V2 2HWD1 5CYYA 2HBUA 1KQRA 2WYJB 1N1IA 3GXUA 4FAHA 3UNPA 2DU1A 2PAEA 1KEXA 1OH4A 1NA1B 4BXSV 3N7MA 1FV3A 1OUXA 4RQPB 5KWRA 1H4HA 1W6OB 4C0HA 1DDXA 5M0TA 1O4TA 1JYWA 5EJZB 1GZTA 1O5UA 1W6MB 3TEZA 1NT0A 1PGL1 1WLDA 2QQOA 5I46L 2EI7B 1K5MB 3WX5A 2DDUA 2W1WA 4YGCA 3OJBA 1UO9A 4QXBA 2Y5HL 2H6CA 4IEUA 2PXJA 5C4WA 5LY2A 1IS6A 2P37A 4BDWA 1IS5A 3VD7A 2WPKE 1XDTR 3AMNA 1YJLA 3T2OA 4R9BA 4PLNA 3H8RA 1U5IA 3IB3A 4OFGA 4YNIA 3I7DA 4AVBA 4QB6A 4W65A 2P3FL 5L7OA 5F8PA 1PNGA 3UETA 5CKMA 3KZ4C 2GP3A 1A6CA 4KH9A 2CL2A 2ZACA 4L8QA 1GP5A 1UKGA 3WXPA 2R062 4AW7A 3WDUA 4BQXA 1HXS2 1MZ6A 4NN0A 5EXOA 1GLHA 1REEA 4L11A 4MGIE 1RUJ3 2EXKA 1YFWA 3O1VA 3E6CC 1Z7S3 3GHMA 3Q8FA 1GQPA 1QJY2 2XVKA 1ZVFA 3CDZB 2ZKLA 1IQEL 2MGRA 4OHYA 5A3MA 5G05L 1Z7S1 5F6KA 1OURA 3V0AB 2P16L 1BEV3 4V2WA 3WW1A 2YHJA 1NCRC 1XOYA 3GJAA 4GKYA 5DAXA 1LMMA 2HWB2 2ZAAA 2PHUA 2W87A 3CJIA 3N9QA 3IZOA 1TQ5A 1RXGA 3AP9A 4I3PA 1BEV1 1DYOA 4KGQA 1ZA4A 4UFIA 1AR62 5K0UB 2YPDA 1ZREA 1P8JA 1UY0A 2BOIA 1JBUL 3LC3B 1VBA1 3VBRA 4PIZA 2DBNA 2H9EC 4Z92B 4GALA 3X29B 3LSDA 1G1QA 1VR3A 4XFCA 4LO4B 1X33A 1RINA 3VHOA 4UFKA 1OD5A 1FPN1 2IVIB 2VVUL 5CFCC 3RG0A 2WO2A 3IPVA 4MHRA 4ASMB 1DVAL 4BQ3A 1IOXA 2YU1A 2VNVA 3BI3A 1ZZBA 1WCKA 3HVDA 5FZCA 3ZOIA 5BNQA 1W06A 1AUYA 4XUNA 2BV4A 2FDGA 4NWVA 4RS5C 1GOHA 1OA2A 3BPZA 4R9CA 3M36L 3VBOA 4E2SA 5JWPA 3I2DA 2VC9A 2VOWA 2WZ8A 2BO2A 4NAOA 5FQ0A 1EAIC 3IKWA 5T54A 4CUAA 3AKRA 5FPAA 3GCWA 4BMEA 2G9GA 2C24A 3LEKA 2E26A 4R8HA 3KCYA 3FL7A 4TLGA 2YC0A 1IGOA 2K9ZA 2OIIA 3NW4A 1PVC3 3MW2A 4U2AA 5FZGA 2PLV2 3UK9A 1AR83 2D3RA 3PL0A 3HPTA 2B7YA 4P9JA 1JL9A 1W6NA 5FOJB 4Y20B 3WDXA 1LHNA 1AR81 4CEWA 4COUA 2XG3A 4IEPA 1BK0A 1TVGA 4YZUB 2BBVA 1PK6A 4XJ9A 1WLTA 2G9ZA 4BLIA 1ENRA 5KC6A 4CCDA 3S5QA 1JHNA 1IKPA 1W8HA 2ZEWA 3ZXEA 3K75B 2F4PA 4OQ9A 2WZEA 1RVF2 3BODA 2OYUP 2B9UA 2J1UA 1RUI1 5FYZA 1G8WA 2ARBA 4B7EA 3LEGA 1LOGA 4IEYA 1SACA 5COXA 2W95A 2VWLL 4RR3A 5LRRA 4A7YA 4ARYA 3MDLA 2WC2A 2RJKA 1EMOA 3KD4A 5DG2A 1YNAA 3B7MA 1QOSA 1KSNB 3P3NA 1HQLA 5C8WA 5F6LB 1D0GA 1DG6A 5KIRA 2B45X 4C16A 2BU9A 4IGPA 1VBB2 2Y64A 3I2JA 1TMF2 2W46A 5A7SA 4JZRA 2D5FA 4XJZA 5LK7B 4IV1C 3G6JB 5IATA 1ND2A 4QPWA 2VZRA 1MEC3 1ZNPA 1IQHL 1LNSA 1PXXA 1SFNA 2VWMK 2W1SA 1IQAA 1HW5A 4MH0E 4X8PA 1MS5A 5FRAA 1PO13 5BUVA 2IFRA 4L92A 5CZKA 5FJHA 4I30A 3U14A 4AOCA 1CAVA 1N1TA 3H1MA 1MEC1 4HN1A 2RR13 1M4WA 3ZYGA 2AEYA 4BISA 2VH6B 1DYKA 2ZGLA 4FPFA 1JZ7A 1NG0A 2D5HA 1VAKA 3DKQA 4TWTA 1LODA 2RR11 4R4ZA 4GMP0 3TBDA 3ILNA 5JBAE 4AL9A 4Z0KB 1PX4A 3HO5A 4P08A 3NTGA 1JUHA 1RJ8A 1LGNA 2IXLA 3VBHB 2VUAA 3I54A 4M11A 2JKHL 3FJSA 1U5YA 3KF5A 4IE0A 1VBE3 4PDWA 2B39A 4QX0A 5DUUA 2QQPA 3VKLA 3VBOC 4O1ZA 1EBVA 1KITA 2A6YA 1V9U3 4QWNA 1PZ7A 4LORA 5K9YA 3HS7A 1OA4A 2D40A 1NA1C 3HN3A 2AGSA 4CU9A 4Y7BB 2UURA 3D0SA 2VWOL 3I4IA 4RQPC 1WMXA 1WBLA 2VZ1A 4LIVA 5JR7B 4CEYB 3WUCA 2GAUA 3OF1A 2P3KA 3I3MA 1GFF2 5JXGA 4LT5A 2FZ2A 4WZFA 3OLUA 3O14A 4FCAA 3DV8A 1TME1 1KLOA 2OZ6A 1K5MC 4V1PA 4CZSA 5FYHA 5L36A 2XJUA 2FCTA 5AC91 5BNOC 2PHXA 2ZGMA 3KCGL 2WNVA 2VQTA 1CEJA 2XWBB 3IAPA 4BJ0A 3PTYA 2WZPP 1DGRN 1WCUA 2E32A 2JWPA 1RUG3 3ECQA 3I3BA 1G86A 4AFMA 3GCWE 2EICA 2VZUA 3BYWA 3NJVA 1N7DA 4CP9B 1K37A 5IJRA 3MW3A 4E4SA 1CAUA 3KQDL 1IPJA 1QXJA 1HB1A 3PVEA 1GU3A 2ZX2A 3ZR5A 2G19A 3ZPOA 2G9FA 1XKBA 1H8VA 3ZYJB 5BNPB 4AVTA 4Y6DB 3N8WB 1ZZ8A 1WZXA 2XXZA 5K8SA 3SXWA 3O12A 4NHMA 1W7XL 4Y76B 3A21A 4EE2A 2VO5A 1LU2A 4XXPA 3NAPA 3ZYIB 1Y9MA 5A7OA 5C3RA 2RM21 3LB9A 4C1WA 2WQZC 3RVHA 2WG4B 2D6LX 4LUKA 4QDRA 4A3ZA 5A3WA 4AXOA 3SCFA 1XKAL 2BT8A 4QGMA 2ZGOA 3TAYA 3OGGA 3GALA 5FPVA 3WQ7A 1UQXA 4HANA 1WU1B 2RS33 4QX5A 2PHTA 3J8F2 1F35A 1QIQA 2F4LA 4YRDA 5T5LA 1UY4A 5EYXA 2RS31 5FZ4A 2YGLA 4AE2A 1UZJA 4OI4A 1CGPA 1GOGA 4Z2WA 2WA3A 2Y6KA 4NO4A 1C3HA 2F17A 3J9SA 4TSVA 3WG1A 2WQ4A 4YZ1A 2UWCA 3JUUA 1V70A 4YARA 3NJPC 1ALYA 1K45A 1IQLL 4IQPA 1DQ4A 4KBBA 3KRKA 1OLQA 1W6PB 5A7NA 3SISA 5L73A 5DZEA 1HZ8A 1PIV3 4IEZA 1QJX3 3LIGA 5A7QA 5FCCA 1S0BA 3H5CB 2B46X 2QQLA 1QKQA 1JZ8A 2P93L 1UPIA 3D6EA 3O1PA 1ZM1A 3IAQA 4TGFA 1OOPB 3KQRA 1PIV1 2PFWA 2GZWA 4JKMA 5FP8A 5A3UA 4MVTA 1EQHA 3NQHA 3UL2A 4N7UA 3RYRA 3ACGA 5KXCA 1V6JA 3O1RA 1V1HA 2WNVC 3ACFA 3W20A 1RUD1 1PX3A 1SQ4A 4COYA 5BNOB 5BNNB 1ULEA 3UGFA 3WNXA 2TGFA 1PM7A 1XQNA 2E31A 1ULOA 2EALA 5I0TA 3T4HB 3TRSB 4F83A 1IHMA 1W0OA 2XHNA 5F1AA 1AL22 1AR92 3CA7A 2EXHA 2DVDA 2J1VA 3B02A 3LA2A 4XFGA 5EFUA 4CDXA 5HCAA 1Z0HA 1I9RA 1SLBA 4AVSA 3DCQA 5F2SA 3M3CA 1MZFA 4R9AA 1K5JA 2R0HA 3M8LA 2OKXA 1HCGB 1FAYA 3MZHA 4I09A 2WNUB 1KIGL 1JMUB 2NLRA 2CAUA 3MPBA 5FR3A 4MGYE 4QT6A 3ZSMA 1NLSA 1ENQA 1LB2A 4RRWA 1GWMA 2NP0A 1YUFA 1LMJA 1KS5A 2RMU2 1A8MA 4Q4V1 1J59A 4XF0A 4FFIA 3SNMA 3AFKA 1R082 2WNEA 3O0WA 3RWNA 1HT8A 2VZSA 5A1LA 2WS93 5GLZA 1S2KA 2VJXA 2K2SB 2D97A 4A7ZA 3ZDVA 4XMIA 4YVWB 3VLBB 5HCFA 2UYBA 4FT8A 5C9AB 1ZBE2 2JE8A 2WS91 1UAIA 5DAPA 4A44A 1BMV1 3M4FA 3EXUA 2WABA 3Q8EA 1IJQA 4OI1A 2VTXA 1BBT3 1SLAA 2DF7A 5FY8A 2UY8A 4OLLA 4Q26A 4E8CA 5A7WA 4NAMA 1KDMA 1X8MA 2X5IA 2YGMA 2C9KA 3K48A 5LZ6A 1BBT1 4JCKA 3OY8B 3FX3A 4B4RA 2YC2A 1KFUL 1UY1A 3OD0A 2YFZA 4IEXA 1G2MB 1HRI2 5CBLA 3IDAA 2QZ2A 3RYPA 1CVWL 1QJU3 1CZSA 3POWA 4CDQC 1DLCA 2BNNA 4MGQA 4BYYA 3SOQA 1EAH2 2VMGA 1POQA 3MLLA 3AKTA 4LOSA 3A7QA 3D82A 2WBKA 1H9WA 2PHWA 3O7OA 4N53A 1Q3EA 1LESA 1QJU1 2VVDA 4M3CE 2Z2SB 4QPIC 1LPZA 1NAEA 5L9BA 4Y5Z0 5JBBE 3T2TA 1APQA 2E7AA 3ZN6B 1UIKA 3O1UA 1LAJA 5DXDA 1QJY1 3ME2A 1VMJA 1W39A 1R1A2 1EYBA 2Z79A 4KWUA 2WO1A 3PU3A 1NFWB 2J34B 2D6MA 3M37L 2VAUA 1ZRDA 3AP6A 3QLQA 4PBOA 2WYGB 2X05A 2RDQA 1MQTB 3T09A 5F37A 2JDMA 3NJZA 4N43A 3SH5A 4TN7A 3V65A 3HPNA 3ZO0B 4XJ8A 2PUQL 4H7LA 2J95B 3MHZA 4JZDL 5A6XA 3HT2A 2EAKA 2BUKA 3PJQA 2VH0B 3AYCA 4I0WB 5EPAA 1O3SA 3ZM8A 2WFF1 1JU4A 3TOJA 4JVAA 1H2MA 1IQJL 4CEYA 2V5DA 4Z2AA 2QQJA 2ZS6B 2WO7A 4HOOA 4XTMA 5T5OA 2GNDA 2VECA 4BPZA 1L3YA 3B00A 1XBFA 1MZ5A 4IEWA 4XFHA 2LROA 4FPHA 4WM7B 4HLTA 3K77A 4XAAA 4XEZA 5H9PA 5GZFA 2YBKA 2PHFA 1NZCA 2JDUA 1REDA 3K4ZA 2DUOA 1PMIA 3JD72 5J1XA 2FDFA 2AH2A 2RS13 1ZX5A 2RS52 3POSA 1BCXA 3BU0A 4XFAA 4AHYA 3WD5A 3SKJE 5JOZA 1WMEA 1HX6A 1I5ZA 3LE0A 4IXLA 1OQ1A 3LFMA 3DPRB 2ARXA 3GDBA 2E33A 4XHBA 2RS11 1CD3G 2Q1ZB 3P3PA 2WG3C 3RSJA 1LK9A 4C8DA 1W2OA 4GB33 2ZKNA 3UESA 1IOAA 2VNRA 4LNVA 5FZ8A 5JXIA 2QQMA 4XZUG 2XBXL 1MR5A 5JAXA 3SOBB 3TWIA 1DIWA 4PQQA 4BQ1A 4BZ4A 1NFYB 4GB31 1KJLA 5A6YA 3SH4A 3OGVA 4Q8LA 5D1IA 4FAGA 5HXMA 4N90A 4FP2A 1G9BA 2CGPA 2DFCA 4RD7A 2QQIA 1IGXA 4RS0A 2NYYA 2X29A 1AXZA 2BGOA 1IOEL 3AM2A 5IUQA 2BERA 1OF3A 4BTTA 5F3CA 4PH9A 2BQWA 2R073 3I2HA 2Q0AA 5IWFA 5K4LA 5T3NA 4O61A 3IWZA 4QM8A 4ATFA 1W0NA 4P5YA 1CAWB 1Z6EL 1VMHA 5C33A 4KU8A 4DXZA 3TK5B 1VBB1 3V56A 1TMF1 4D7YA 5FP9A 4XZPA 4QKFA 3DF0A 3L2YA 1PGEA 1QGLA 3SCGA 3UJOA 4QPGA 2CSGA 4FM5A 2XVLA 1AUTL 2WN2A 4M4PA 3OYWB 5FYMA 5CG9A 4N43C 2VCAA 4QQOA 1RUE2 4S2DA 2CYFA 5FXVA 1NFXB 3DKWA 1QJEA 4FXGB 2RDRA 4Q4X2 3ILFA 3VKMA 2FQPA 3ES1A 4FQZA 5KHIA 4EV0A 3M3OA 5C3QA 1LHOA 2FHRA 2WNUC 2BZ6L 4MMYB 2QQNA 4XYXA 1JZ4A 2Q8OA 1R093 3ZMNA 5HXVA 2XL7A 1JYIA 4FFGA 2V73A 3AMQA 2X53S 1UZKA 2P94L 1HV0A 3GZTB 3FBMA 1BK1A 2J7MA 3ZFFB 3ZMOA 1C1FA 1J83A 2XC0L 1R091 1S0GA 2TBVA 1PVXA 1W8NA 2GMPA 3AP7A 4META 4YZ3A 1MS4A 1MOXC 1W2TA 1BJQA 1URKA 4QQ2A 2A71A 4GU4A 2XJRA 2J1TA 3HWJA 3KV4A 5I8YA 1R1ZA 5FZAA 4MXWB 4M4RA 4LXLA 4BLJA 4AGGA 1TE1B 1UY2A 2WINB 1JOPA 4G9SB 4IV3A 1RUH2 1XU2A 4LMFA 3DXTA 2XH6A 1AJKA 4NE9A 3VZKA 4CP2A 2R16A 2JG9C 1F7EA 2HWE2 2E7TA 3V0BB 4FPEA 2KD7A 5IKTA 2GU9A 4BXSA 1GSLA 2UWOB 4LKEA 2AZ5A 4PI2A 4NPLA 1YGCL 4GJZA 1R64A 2W26B 4MHUA 4YLZA 1S1AA 1WKYA 5KR7A 2ZMLA 5F3EA 5CFDB 1KGYA 1VAVA 5GZCA 5L9VA 1ND3C 1OD3A 4LBMA 4P9LA 5JXHA 3RZMA 3WV6A 3CZUA 2Q1FA 1YQ5A 3FLRA 3R4DB 4HSLA 3VDCA 4AFCA 3AXDA 2W3KB 4C1XA 1FATA 3NJXA 4XF3A 2XMLA 1CIWA 5E6HA 4Y22B 2Q30A 1DGWA 1QY4A 4XETA 3S30A 5CU1A 1IP0A 2D6PA 3ETQA 3GJBA 3H8XA 2OUHA 2IXCA 3K46A 3ZXAC 2XPJA 3H50A 1JODA 4WVZA 4BIFA 4MYEA 5F19A 4K20A 4OZOA 3VHRA 1FAXL 3U07A 1LOFC 4URAA 1MQTC 4PF5A 4QPGC 2GALA 3AMHA 3U0ZA 4MGSA 3DECA 1L7QA 1J1LA 3ZSKA 2N7GA 3O1TA 1CVNA 2MGPA 3J8F1 3ROUA 1VRH3 3VZLA 3ABZA 4CA9A 1D4M3 4XBNA 5C8CB 5A32B 4D8MA 2LS6A 1OKQA 1UMHA 2Q8CA 1XE7A 5DMYA 4LO5B 5CISA 1GR3A 1NXMA 1QNYA 2AEZA 4A6OA 3T4VA 4P9WA 4GKXA 1D4M1 4N9IA 4ES9A 2MEV3 3S6PA 4JDMA 3CBNA 4NRMA 2BYVE 2WA4A 4CTEA 4AVVA 3WNLA 1YO8A 4WM7C 1UX6A 1QQP2 2MEV1 4S2GA 1DF0A 1O4ZA 3U10A 1BHGA 2Y7XB 1UNBA 3B93A 2H6BA 3MW4A 4LR4A 4MV2A 1YEWA 2R042 4YZ4A 4M0NA 1IZ3A 4MGZE 2ZEZA 1G6NA 1XU1A 5FY1A 4B3NA 5IYYA 3O1OA 4HETA 2IWGB 2NN8A 2Y80B 3DPRC 3LDBA 3WEZA 1O6UA 2VE1A 5DDJ2 3W5NA 4ASKA 4NHKA 2XC4L 1GNZA 3ZPYA 4F3JA 1J58A 5JZGB 1V3XB 1T6GC 3JQXA 2JG8B 1HREA 2C4XA 4RGGA 3SQOA 1CN1A 2RDNA 2WR9A 4CYDA 4E2QA 1GZWA 4XPVA 1ZBA3 1YLLA 1EPZA 4Q4Y3 5JPMB 4EWAA 4CPBA 1H2LA 2XKPA 2CGOA 1V6KA 3TN93 4CCEA 4CSWA 4Q29A 1ZZCA 5D8AB 2MHPA 1OKOA 1AR91 1AL21 1LKNA 3B9IA 3DUIA 4Y4YA 3CZJA 1QOOA 5JMOA 4KG8A 2KA3A 3M2MA 1MVQA 3POBA 3RJRA 1SPPA 3PVNA 4JHZA 3TN91 3WR0A 2W5FA 1C28A 1DZRA 4CP1A 4O9EA 4ZPIA 3VZJA 1V6OA 4S2FA 5JOWA 2G4IA 2GC0A 1W8OA 3VDAA 1YWKA 4A4AA 1BKZA 4GWNA 3CNAA 3ITQA 1VIWB 2H0BA 4N9HA 3VBUA 2RMU1 1M06G 3N7JA 2Y6HA 4GWIA 4AWDA 4EN8B 3R05A 3I2OA 3PGHA 1R081 1JI6A 2JEMA 3BVCA 5IK4A 1PGW2 1DQ5A 1OA3A 5IK7A 5FYUA 4E4HA 4ZAEB 1ONAA 1IQDC 1UYZA 4JTOA 5G04L 2QUOA 3TNPB 1GWLA 1PNFA 2UY9A 2VOTA 3N8YA 1SLIA 1ZBE1 3CIHA 4GXLA 3N9NA 4BIOA 3MIHA 2XR4A 4UF0A 5JPNB 3BIEA 2ZOEB 1J9CL 3SEEA 3HD8B 3JZVA 4UW6A 4LHKA 2AACA 3MV01 3WF1A 1YC61 2Y0IA 3KHCA 3C7EA 5LA9A 1WW6A 3HMYA 4O9GA 1J84A 3NKGA 4CXWA 5FO9B 3MI8A 1S55A 2ADEA 3J26N 3ZN4A 3ZFFC 3RZLA 1W8BL 2W68A 3EGFA 1LPKA 1HRI1 4JGZB 5CFCA 5A3LA 2XJSA 5FV3A 4ZHAB 2VTFA 2WAOA 3AJYA 4NRPA 5FKCA 5T50A 3SCHA 3THDA 5I0RA 2VULA 1HV1A 3BN6A 1AX1A 3NRUA 3RZJA 4RS5A 1WCQA 3WZ1A 4MXVA 2Q8EA 1SMVA 1W3VA 1Q8QA 1LHUA 4DUVA 4NG9L 1VRBA 1CQ9A 2VNGA 1AYM2 3LN0A 1XYNA 2CDOA 1S0IA 1GBGA 5FMOS 1VPHA 4GU3A 1ST8A 3GNEA 1QMJA 3J7LA 2J94B 3BOPA 1GV9A 1XYPA 2JJ6A 3KM5A 3WP4A 3P6BA 5C6CA 1L7LA 3KS7A 2D6OX 1RUC3 4DXTA 5LRSA 1H8TB 4R4XA 5L2ZL 3WW2A 2WYSA 5CFDC 2OX0A 4IEQA 1ASJ1 3AZWA 1N1VA 2BFUS 1RUC1 1XSRA 2W1QA 2QFEA 1US2A 1U5XA 3LAGA 1ODNA 1CX1A 3M7AA 3B5LB 2VCCA 1H2NA 1B35B 4YW1A 1LGCA 2WT2A 1LOEA 2W3JA 4IGOA 3MBWA 5F39A 5SV8A 1TNRA 3BOWA 2O8QA 1AX2A 1F5JA 3FLPA 1QNWA 4J6GA 4K21A 1KLIL 3IDBB 4FTBA 1H1AA 5A33B 1D0HA 2ZX4A 2X10A 3U78A 4AEJA 4AI9A 4KBZA 1JH5A 4CUGA 2VXRA 3VBUC 3C7OA 2Y6JA 2ET1A 2VG9A 4XBLA 4QHBA 5FYYA 3NL1A 3EO6A 3BB6A 2YBPA 1GP6A 5FLHA 1LJ7A 3PUHA 4GMP1 4IV1A 3ZYPA 4CEWB 1OPMA 3JD71 3KHBA 2JDPA 4CDUC 2BDRA 3OPTA 5GJ6A 2RS51 1L5GB 1VBA3 2JDHA 4D0FA 4JGYA 4CDWB 2FBEA 4NIIA 4EZHA 2HWC3 3I3QA 2CHHA 3TEYA 1D2QA 5LBEA 3OBZA 1TPGA 1SLLA 4L2NA 4F7ZA 1OVSA 5FUPA 1G9DA 4Z6AL 1FPN3 2H0VA 3E5QA 2G00L 3WVJA 1UZPA 5E8DA 5A80A 4DRRA 2HWC1 4DOUA 4RR3B 2WZR2 4A6SA 5IK5A 2BRTA 1FT9A 3FFQA 4JYVL 3FHIB 5E1RA 1CX4A 2F6BA 2BVBA 1GQGA 2BJSA 1APOA 4JQRA 5FYIA 4B8EA 5DAVA 2JDNA 1Q8VA 3USUB 1H30A 1CAXB 2HWF2 2YG0A 5CEHA 1NLQA 1A8DA 3OUIA 2A5ZA 3POEA 2HLEA 2HKXA 4OHXA 5FYVA 4NR1A 1F31A 3PVBB 1GZ9A 4LULA 4ZS2A 3S5AA 3HT1A 2VW0A 4XLWA 1NA1A 1SBEA 1LECA 2MHFA 2ZEYA 4RQPA 3WINE 2A1XA 1W6OA 5FK7A 4JX0A 1PZ9A 1CPNA 4A94C 3C2UA 5EP9A 1IG3A 4HONA 1UOFA 1W6MA 5JZGC 3OGRA 1E5HA 4CXXA 1N1SA 1PMJX 2JG8C 2CWMA 3LIHA 1K5MA 4AGRA 4UI9L 1US3A 1IQML 2VOVA 2WPHE 5BNOA 5JOYA 1UOJA 1Q8PA 1QOTA 2OS2A 5L30L 3VBSB 2DBIA 3LA3A 1JOBA 4U36A 4UT5A 1BVP1 3F2ZA 4WM8B 3H8OA 4E8DA 5JUVA 4ZHNA 1DHKB 5I8TA 1HT5A 3KCXA 4FQ4A 1RUI3 5FWJA 5ACA3 4RFRB 3RS6A 2YC4A 1M1XB 4YW4A 3T30A 2XJVA 5I0UA 2JIGA 2XOMA 2OQ7A 4Z1VA 2R32A 5ACA1 3WG2A 2BWCA 1FYUA 2JENA 4M01A 3ZX7A 1BQPA 4OZXA 4P00B 1IQNL 5IAXA 1CCFA 1GMMA 4L97A 5FIXA 5IKVA 1NY71 2XLFA 5F3GA 4N8MA 1YRZA 3V0AA 2HYKA 3T2PA 1U12A 2XJQA 1NPEB 1HRV2 4AHWA 5KBFA 2CV6A 2IC1A 3CF6E 4K6BA 4D0EA 1AYN2 2AENA 4BK5A 4DIQA 1F7MA 1CAUB 5FMOL 4YG6A 1RUH1 2VJ3A 4JGYC 5DUWA 2AR6A 4ZU5A 5K0UA 1C1LA 4QXCA 4ZXXL 3S7IA 3DYOA 5EV7A 5DZFA 2WLPA 3U37A 4QQPA 3ZDSA 3V64A 2HWE1 3K51A 4HN0A 2JKXA 3HNYM 4Y5TA 4IESA 4QHOA 3NO8A 4DFSA 1Z78A 3LEMA 3AYDA 2BFUL 5JVYA 3ACIA 1HKDA 4JGZC 1FXZA 3LF7A 1A34A 2XQXA 1VBD2 1IVOC 1WBFA 2DCJA 1AR72 2O8OA 2ZPXA 2NPIA 1C8M3 4ZZ5A 4Y79B 4DS0A 1F5FA 3KT7A 3GISX 1J3PA 4GAZA 4AEDB 4URTA 4BMBA 4A42A 1C8M1 3ZLIA 4JDOA 4SBVA 2ES3A 3NTBA 3NNJA 3NV1A 1LOAA 4LK7A 1TME3 1OC1A
chains in the Genus database with same CATH topology
1UF2C 3KQBL 1DFQA 5F5QA 5FTTC 5CB7A 4YW5A 5AC93 1XE8A 4NWWA 4E1GA 4DQAA 2PR3B 3FUQA 4Y1UA 2E63A 2P3FN 2ERFA 1H8TC 1I3HA 1HJ7A 3IM0A 4QGNA 4Z8BA 3VKOA 1C5IA 1KD7A 4R9DA 3MFAA 4GH4B 3O0VA 5DZGA 3JBG2 5J98B 2XBYL 2TEPA 4H55A 1X8EA 4EN7B 2P3JA 1B35C 2J2UB 4HVRA 2VMHA 3W59A 4FOWA 1KXGA 4I2OA 3URFA 3B69A 4NVPA 2PHDA 1J1TA 2RM23 4RHV2 1MACA 1ZZ9A 4BHPA 3Q3KB 2P3TA 1HLCA 3LTGD 4D94A 4C0BA 5JSPA 1SBDA 4WV8A 3FZ3A 3S6XA 1H1MA 3N3HA 3WP5A 5CG8A 1RHI1 1LRHA 5CADA 2R041 3ZSLA 3D5OA 1IPKA 2ZHMA 2EXIA 3OBRA 4TLFA 4BH9A 4EN6B 4CDXB 1WHFA 5K0UC 4AI1A 1LOCA 2JDZA 5DDJ1 1OSGA 3CO2A 4OVEA 2JE9A 3L2HA 4X8TL 2FLGA 4YFWA 4AQ6A 3MQEA 1TLEA 1GNHA 1AXYA 4IL7A 2WT0A 4M3CA 3LN1A 3KCCA 4G4FA 3UKNA 3AX4A 1PO22 4AYUA 4YM0A 3ZFGB 4CUEA 2BOKL 1WUVA 2I9BA 1QF3A 3KB5A 5FO7B 2DCYA 2JD4A 4CDQA 1EZQB 2EF6A 5E16A 3VDDB 1N47A 3RYKA 3VL8A 2HJIA 3ASIA 4AFBA 1RMU2 4QPIA 1EMNA 4MLOA 4CEYA 4DRVA 4O02B 2YV8A 3Q7DA 3GZUC 3RR3A 4ORFA 4AGVA 3NWKA 5FO8B 2HEVF 4XTPA 2EIGA 2NMNA 1VBC1 2ZZQA 3N4MA 1RUD3 2JECA 4Q4W1 2WSUA 5KHGA 3ATGA 1LENA 3VBSC 1NE4A 1DZTA 1EV12 3RRDA 1RB8G 1PGW1 2XBO2 3GYDA 5AVAA 4QPYA 2VMIA 3U4XA 4KU7A 1RUF3 4XFBA 2XVGA 1YFYA 5BNPA 2BNOA 3U11A 3IITB 3N8WA 1EPHA 2JKBA 4PJYA 1RUF1 5JVVA 5GLTA 1KS4A 4A7KA 1C4RA 3HS5A 4MGKE 3IN9A 2DU0A 4LA3A 2DVBA 1FOD3 4Q4V3 4HVQA 1SDWA 3VKFC 2QZ3A 3MIEA 2CGNA 4HPKB 1D2SA 3WT3A 2E7QA 2Z42A 1HRFA 3N7KA 4XIKA 1FOD1 2BTVC 5I0SA 2GDFA 4LE4A 3HS6A 2VQAA 2E51A 1S2BA 3E5UA 1O4YA 3V65B 1ZBA2 4Q4Y2 2XWJB 5GZEA 1AYM1 1GANA 3LOIA 1Y9QA 4Y1ZA 2AREA 2UWBA 3R4SA 2W39A 3WP6A 2QCSB 5EJ3A 2OUJA 3MICA 4Q8KA 1VLNA 1MS1A 4ZH8B 4FPOB 3LSEA 3WDTA 1DU3D 5KHJA 1NOVA 4W6WA 3OTFA 5H9SA 4M00A 2B8MA 4FPJA 4RRYA 5I91A 2ZX0A 1LU1A 3VBHC 4AEDC 2D6KA 1UU6A 2R063 2AYHA 3IIAA 4LBKA 1HXS3 2I74A 3MIGA 1MS3A 5K0HB 5HCBA 4KNCA 3VUOA 3AZZA 2W3IB 3N36A 4XIOA