3ASIA

Alpha-neurexin-1 ectodomain fragment; lns5-egf3-lns6
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
395
structure length
395
Chain Sequence
ADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurexin-1-alpha
publication title Structural Basis for Variant-Specific Neuroligin-Binding by alpha-Neurexin
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion
total genus 92
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3asiA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA01
2OW4A 1IQNL 2C9AA 2DVDA 2WPJE 1SLCA 2P3UA 2R1DA 2VWOL 4YZ2A 2VH0B 3AZXA 5HCBA 1W6NB 3A4UA 1V3XB 1NPEB 2R0HA 4M11A 2Y82B 1WLCA 2ZHNA 1JOJA 3N36A 3M2MA 2CTVA 5GLVA 4Y20A 1NFUB 4X8VL 3PJQA 3LIWB 5JMCA 1N1VA 3V64A 4ZKTB 4Y71B 3VKNA 5KXBA 4Y7BB 3ZXJA 1LOCA 1LENA 4GKYA 2FLGA 3WG1A 1U8CB 1G2MB 1PGEA 4AGGA 2YXSA 4R9BA 2P3JA 2FLRL 1U67A 5T5PA 1GYKA 4MMYB 2AYLA 5L2YL 2GNTA 3BODA 3W58A 4DRVA 1LHUA 1CR7A 1LPKA 3MEPA 3AX4A 3GNEA 4D0FA 4YGEA 5E89A 4I30A 3GCWE 2ZKNA 1N3PA 4DRRA 1V6OA 4L8QA 4XHBA 1N1TA 2BQ6A 4A7IA 1NQLB 3MDLA 3IKWA 3PVEA 3O5SA 4CSYA 4YM2A 3BTAA 5CISA 1FATA 4YM1A 1IQIL 3VKFC 1I3HA 3NV4A 4UW6A 1DQBA 1AX2A 2WPKE 1XKBA 4YT6L 5EWSA 4XIKA 1X50A 4RUTA 3IM0A 4ZXKA 1AXZA 2W26B 2WPME 2D43A 4ZHAB 4LBOA 2A6VA 2SLIA 1A78A 1EAIC 3ZSLA 1ZM1A 3WVJA 3AYDA 4XILA 4JC1A 1ULEA 4XXAA 2D6OX 2W08A 2BOHA 2VVUL 2CWSA 3OYWB 5E8AA 5GLWA 3TAYA 2NMOA 1NXD1 2PHRA 1CPMA 1IOAA 1HREA 5F1AA 3OBRA 1TLEA 5GZEA 1I1EA 1EMNA 1IKQA 2EIGA 4Y1YA 1DQ4A 3VKMA 3ZXFA 3SH4A 2Y80B 1DDXA 1CCFA 2EI8B 1U0AA 4P9XA 1MS0A 3KQDL 1IQHL 2NYYA 1X7AL 1GNHA 2TGFA 1SLAA 1TEIA 2AENA 4SLIA 4GKXA 2DU1A 1DHKB 3ZYJB 3BIWE 4YG6A 3ZXKA 2ZGMA 3HMYA 3U73A 5IKTA 1LTEA 2XC5L 4M3CF 5E8DA 1BJQA 2G00L 1RFNB 2LTNA 2ZZJA 1HAEA 2P3FN 4Q26A 2K2SB 3LTGD 3NJPC 2DV9A 2AR6A 5E88A 2GN3A 5IK4A 1GLHA 3M37L 2DTYA 2WQZC 4Y22A 1DQ5A 1JN2P 3ZYRA 1EQHA 1MQ5L 4XYXA 4JCKA 2DTWA 1SBFA 2FMDA 4M01A 1BQPA 4BXSA 3AZVA 2W2PE 4YG3A 4YFWA 5JOWA 4PCRA 2FZZL 1MR5A 3BOPA 1NLSA 4Q27A 4FQZA 4YW3A 1WW5A 2WYGB 2WT1A 2ZGKA 1LHVA 2KL7A 1QOTA 1G1RA 2WKKA 4XZPA 5CKQA 1MZ5A 1F0RB 2P16L 4YZ5A 1DQ1A 1KLIL 2PHFA 2YGOA 1Q8OA 1BXHA 4AWDA 3HPTA 2NPRA 1H9PA 5KXCA 4XDQA 4ISIL 2P3IA 1UL9A 2OYEP 2CJIB 3WDVA 3DGTA 4TZDA 1IJQA 2FLBL 1Z78A 4FP2A 1W6PB 5T54A 3B00A 1DIYA 3B9CA 2PHBB 3M36L 2VWLL 4Q1PA 3WDXA 1OKQA 3HS5A 2EXHA 3NTGA 1W6QA 2ZGTA 2WYJB 2J38B 1G7YA 1N1IA 5DG2A 1FYUA 2ES3A 1KLOA 1LGBA 3FBYA 1HDKA 4UW4A 4XJ8A 2VH6B 4O02B 1N3QA 2A70A 4D69A 1DVAL 1BYHA 4Z0KB 2A7AA 5JLVA 1WU1B 4Z8BA 2UURA 2UU8A 2WPIE 4PF5A 4AGRA 1LCLA 5COXA 5CNAA 1COUA 3V65A 1FV3A 2WFTA 1LEMA 2KV4A 2ZGRA 3ASIA 1DIWA 1JBCA 1DYPA 1FNYA 3SNMA 1LHWA 4XXPA 1PTHA 4D90A 4BTUA 3V64C 3O0VA 1N1YA 3N7KA 1IOXA 3MW3A 4FPKA 3B3QE 3FLPA 3AXDA 3RMYA 4P9WA 3ILRA 2NM1A 2D7FA 1GSLA 1W6MA 3M3OA 1SACA 4Y20B 3OPZA 1ZA4A 1GV9A 1PZ9A 4JZEL 1R1ZA 4GWNA 2WPHE 2ZGPA 1F5FA 4AQTA 2YY1A 1NZIA 1KLJL 2ZHKA 2FD6A 3H5CB 4ITCA 4ZH8B 1IQEL 5H9PA 3KL6B 4RRXA 3AXEA 1IS3A 1UZJA 3WG4A 3LN0A 2GN7A 4Q1RA 1C5MF 3LAQA 1KIGL 1CVUA 1GZWA 4FP3A 1W7XL 2Z42A 5IKVA 1EMOA 4R9AA 5JDBA 3ZYGA 2EALA 3NV1A 1H30A 3WG3A 1DFQA 4LBQB 3TB0A 4X8UL 1IGZA 1ATEA 1QNWA 1JYIA 1IS6A 3Q3KB 2YGPA 3V0AB 4BQ1A 4AVSA 2MGPA 3MPPG 2A3XA 3AJYA 5T5LA 5IT6A 1MS8A 2WT0A 2DYCA 1KSNB 2I2SA 2ZGUA 4LBNA 2ZMKA 2VWMK 1W6OA 4PBOA 3ELAL 1B09A 4DS0A 3BT2A 5CA6A 4Z0LA 4FPLA 2HYKA 4AVVA 1CONA 3UK9A 2W2ME 5IK8A 4MYEA 4XTMA 4MMXB 5CAZA 4MMZB 4TYSA 2J34B 4XMAA 3LCPA 2VH9A 2GMEA 1WHFA 2BOXA 1DQ0A 3QLQA 3BT1A 3AP5A 5GZDA 1AXKA 3BPSE 5T5JA 4YZUB 2P2KA 2BOUA 1DYKA 4KBBA 2D3PA 3AZZA 3KRKA 1IQFL 5DXDA 3P5BL 4XBMA 2WFXB 1LJ7A 2ZGSA 4D0EA 4NA9L 2P95L 4Y6DB 2TEPA 1G86A 1MQ6L 5JOYA 1MZ6A 2VJ3A 3N8WB 4LBKA 1ATAA 3SISA 5DUXA 4PH9A 2J95B 1IS5A 3M3QA 2BQPA 1LOFA 2GNDA 4K20A 1WBLA 2Y7ZB 1WD4A 2DUOA 4Y22B 1JUIA 1LPZA 4K1YA 1RINA 4CTEA 3WNXA 3QH0A 3FCSB 1ATDA 3SOBB 3LSDA 1G1SA 1BZWA 5DUWA 5KN5C 4F83A 2GD4A 2WLQA 2A75A 3ILFA 1G8WA 1XKAL 2AUYA 1DX5I 2NN8A 3RSJA 3WCRA 2YROA 5HCFA 4YM0A 5H9RA 1C1LA 2D1JB 1MS9A 3N35A 1LODA 4XTPA 2DVFA 1GZCA 2K2TA 4ISHL 1WLDA 5GJ6A 3RR3A 2D6PA 3CS7L 2SBAA 1Q8QA 2GALA 2XG3A 1APNA 1RITA 3AFKA 3M1HA 2P3FL 1FV2A 3UL2A 1ZAQA 1G1QA 3AZWA 3QMOA 1JV2B 2JJ6A 2H0BA 3GISX 1GK5A 3N8XA 2VVCK 2A3YA 1QU0A 2CWMA 4YZ4A 1ULGA 1S0IA 4C16A 4M3CA 4AVTA 3WDWA 2C5DA 3ATGA 4XBQA 2D6NA 4M00A 1W6QB 4XOGA 2XC4L 1SZBA 1FAKL 3QCWA 5GM0A 1GBGA 1W6NA 2R16A 1IQML 3WUCA 4JZDL 1FAXL 2AH2A 5EYXA 3N8VA 3ZXLA 4BM8A 1PRHA 4XE9A 2W2OE 1BKZA 4AYUA 3N7JA 2XBVL 1ONAA 1SCSA 4X8SL 4GA9A 1YUGA 1HT8A 2UWOB 3F6UL 5LK5A 3IJEB 3RRDA 2W68A 3U4XA 1LMJA 1C57A 4BDXA 3PVNA 4YLZA 2UWAA 1GANA 2WG3C 4BLIA 2D6KA 3V0BA 3SW2A 3WHUA 1NFXB 1Q4GA 3N3HA 4YW1A 1FFMA 2ZHMA 1SLIA 4YGBA 5JBBE 4U2AA 3D5OA 4CUEA 3USUA 1C1FA 1KDMA 1YUKB 2Y7XB 2A6ZA 5DG1A 1ULFA 2J4IB 2VUAA 3AZYA 1UZPA 1H9WA 2ZAAA 2ZBJA 1EPJA 4BPZA 3HR9A 2NZ9A 3RG0A 5DZEA 3TBDA 1Z6CA 4FVVA 4X8TL 4RRYA 1Q8VA 2JE7A 5L30L 1IQJL 4LBQD 3UJOA 1ULCA 3O0WA 2BMGA 1V6KA 4YZ1A 5JVZA 3OJBA 2BZ6L 2CY6A 1WHEA 1YI7A 1QFKL 2ZMLA 1CVNA 2WSVA 1GZWB 1GICA 4R9DA 2D3SA 4UW3A 1WUVA 1VALA 4ISRA 1UZZA 1G9CA 2DURA 4M10A 1V00A 4CZSA 2Q5TA 2JDZA 2GNMA 2PHXA 2YZ4A 3WCSA 4JYUL 3IMNA 2WT2A 1QDCA 2H9EL 3OGGA 2DVBA 4FOQA 1KDKA 4FOWA 1LECA 1HZ8A 2UWLB 4NG9L 1G9FA 2A3WA 1SCRA 2VW1A 1QOOA 4OTJA 4COXA 3ZSJA 4RA0A 4FQ4A 3AK0A 1ULDA 2EI7B 1IQGL 1MS4A 1SBEA 1HAFA 4Z6AL 1D0HA 3TZIA 2P94L 1LHNA 1EGFA 3RQ0A 1GNZA 4FPHA 5EYYA 1G9DA 3N8YA 1MACA 3FLTA 1UZQA 5F9TA 2A6YA 2E7TA 1WW4A 4Y76B 1QMJA 1AX0A 1URXA 2KM2A 3R4UA 4ISQA 1LESA 4XJ9A 2VU9A 2NP0A 1FNZA 1VIWB 1YO8A 1PZ8A 3IN9A 4ATFA 3HS6A 2D3RA 1QDOA 4Q8KA 2PELA 3CNAA 1NT0A 2AREA 1APOA 1IS4A 4Y1ZA 2CYFA 3LC5B 4XJAA 2ZACA 2JECA 1EPHA 4Y26A 3R4SA 5GZGA 1CQ9A 1A3PA 5T52A 1KJLA 3FLRA 1LOAA 3R05A 3U7UG 3OY8A 2ZGLA 4FPEA 2WPLE 2P26A 1V6MA 3AYEA 2ARBA 1OQ1A 4FOVA 4XJUA 2DUQA 1FF7A 1KITA 1I0UA 4JYVL 2XBYL 2WJSA 2R49A 1EBVA 4OTYA 3LSEA 1PZ7A 3HN1A 3DEMA 1WLWA 1LOFC 3GCXE 1F0SB 1IP0A 1DQ2A 5DZGA 3F1SB 3AJZA 2OUHA 4C1XA 1UMZA 3NWKA 4GXLA 3HO3A 1EQGA 1MS5A 1N3OA 1KRIA 5CKMA 4YW5A 4Q2FA 1LU1A 4RS0A 4XL1A 2E7QA 2ENRA 2W39A 3KQRA 2DUPA 3LN1A 3KQCL 1LEDA 1KQRA 1O4ZA 1A3KA 3TH3L 2V73A 1TPGA 1UZKA 3JUUA 1AUTL 4YM3A 5I46L 4FPCA 1PXXA 2DU0A 5FREA 1V6JA 1V6LA 3D6EA 1F7EA 3FUQA 3SOVA 1L5GB 4P14A 4U36A 1YIFA 1HQWA 4FM5A 1UN1A 2YV8A 3ZSMA 4YG0A 4BTIA 3FUOA 2XB6C 4XJWA 1P0SL 2ZABA 4Y24A 2EXKA 2J2UB 2D6LX 4CRQA 4FPYA 1O4YA 2P93L 1APQA 4AGVA 4LMFA 5SV8A 2BQWA 2E6VA 4M3CE 1C4RA 1N1SA 2PR3B 4NOTA 3FFGL 4XBNA 1QKQA 1QGLA 1EPGA 4Y1UA 5DZFA 3SH3A 1SLBA 2F9BL 1L3YA 2JKHL 3HO5A 3AP7A 1EPIA 1S0JA 3MW4A 4FPGA 1WD3A 3ZSKA 5H9SA 1RIRA 4Q8LA 1JBUL 5JB9E 2VW0A 3AP4A 3AP6A 4Y1XA 6COXA 2WSUA 4M3CB 5JB8E 3VUOA 1UPSA 2W2QE 5L2ZL 5JBAE 2PHWA 1YGCL 1PFXL 2A6WA 2A71A 3K9XA 1DGLA 2AYHA 5GZCA 1SLTA 3WLUA 2Y38A 1S0EA 1A8DA 5GLTA 4ZAEB 3NV2A 5IKQA 5CKNA 3APBA 1HCGB 1LPGA 2D6MA 1YRZA 2A5ZA 4XJZA 2BOKL 2DVGA 2W2NE 1V6IA 3VKOA 3VV1A 3T1MA 2I9BA 2OVUA 1F31A 1Q8SA 4XHXA 1S0FA 1LOGA 1AZDA 1VAVA 1HQLA 1IQLL 2EXIA 3KQEL 1P9JA 3IPVA 4LBLA 4BOWA 3V0BB 2RHPA 3WDUA 3AYCA 2EI6B 2W3IB 3TGFA 4BLJA 4E1GA 1W8BL 3USUB 5IKRA 5L73A 1LU2A 2GNBA 4XLWA 4RRWA 3IITB 4DFSA 3ZPYA 2ZGOA 1IGXA 3PMEA 2R1BA 1GZ9A 4WZFA 4LBQA 4ATEA 1QOSA 2E51A 1HLCA 3B69A 3SOQA 2Y5FL 1W0OA 2ERFA 2ADXA 2XC0L 4RRZA 1MS1A 4BMEA 5HCAA 1VAMA 1DZQA 3T2TA 2WNEA 3V0AA 3L2YA 5JOXA 4W65A 2JD4A 1ADXA 1LULA 1YXWA 2GMMA 1WW6A 2DWRA 4C1WA 1CVWL 2VWNL 1CN1A 1UKGA 2D44A 1YUFA 3ZYIB 1GKBA 1Q8PA 1MOXC 1TOZA 3KCGL 1XQNA 1IQKL 1S1AA 5F19A 1S0DA 4DPNA 5KIRA 2R0FA 4OZXA 1AVBA 3POYA 3MW2A 1Z6EL 2EAKA 2EF6A 4DQAA 5JVYA 3WDTA 1JHNA 2DVAA 3A0NA 1ATBA 2B7YA 3T1LA 2FHRA 2P3TA 4XIOA 4ZXXL 3A0KA 1URKA 4YGCA 4NO4A 5F5QA 3C9AC 3N8YB 4PQ9A 1G2LB 1MVEA 1OFSA 3O12A 4FPOB 2LALA 1UAIA 3WHTA 4BDWA 2OUJA 1MVQA 1VLNA 2VY0A 3V65B 3N7LA 3M3EA 4BXWA 4WVWA 3TK5B 1JYCA 1HX2A 3N8WA 1CJPA 4HL0A 2M74A 1LGCA 2RNLA 2UWPB 1AXYA 3WOGA 1O5DL 1EPWA 5IK5A 4K1ZA 4P9YA 3VKLA 3W59A 3OY8B 1UZYA 3DUIA 4HANA 1F9KA 5IUQA 5FDQA 2EXJA 1LOBA 1NFWB 1W0PA 1W6MB 1CEJA 1CCVA 2GMPA 2BQ7A 1WW7A 1MS3A 1IVOC 3I4IA 2I9AA 3D4KA 1WCSA 1CQEA 3UJQA 3ZYPA 2Y81B 1QF3A 2ZHLA 3PVOA 4H55A 4WVVA 4YGDA 3LC3B 4Y7AB 3N8ZA 1JXNA 3WG2A 5DUUA 3MQEA 4CUDA 1CPNA 1S0CA 3JU9A 1LOEA 2MGRA 1ENRA 1FAYA 2XBWL 3SLIA 3ENRA 1SLLA 1FSBA 2JKBA 1S0GA 3N7MA 1AJKA 5JVVA 1Z0HA 2W52A 5KXDA 3KK6A 2Q1JB 1ENSA 3OYWA 2W86A 4CUFA 4NGAL 2NMNA 3AP9A 1FJSL 1V6NA 1W6OB 1FX5A 3HS7A 1DLLA 1AX1A 1CIWA 3PGHA 3I8TA 4UW5A 5JW1A 4BTTA 3LTFB 2PHUA 1JL9A 4YT7L 1Y7BA 1G9AA 1IKPA 4K21A 4JZFL 5GZFA 2ZGNA 2VW2A 2VVVL 3ZVXA 3INAA 4FPJA 3HO4A 5JOZA 2CL2A 3OLUA 1G9BA 3OLTA 1D2SA 1LHOA 5IK7A 1LQDA 5BYNA 3KM5A 3Q7DA 1G1TA 4LORA 5EGMB 3EGFA 2P37A 5KXEA 2GDFA 1F7MA 2YMZA 3ENSA 4R9CA 3TK6B 2RA0L 1S0BA 2UWBA 1OB1C 3KQBL 2WG4B 4JRAA 3NV3A 3SITA 3WV6A 3OBTA 1M1XB 2Y5GL 1HKDA 2J94B 4FOYA 2VXRA 5JBCE 3RS6A 1AJOA 2UWCA 5K0HB 1HRFA 3ILNA 5FRAA 3SH5A 2V5YA 4PBPA 2W3KB 2JE9A 1UX6A 1FE2A 1IOEL 3WDYA 3FFZA 1BF9A 1N7DA 1J1TA 1AF9A 1B9WA 1SFYA 5EXOA 3IPVB 1LGNA 3CENL 2ZGQA 2AGSA 2OYUP 1CESA 1XFEA 2P28B 3CA7A 2ZMNA 1K36A 3Q9OA 1QNYA 1HJ7A 5GALA 3RMXA 1N47A 1XDTR 5GLUA 2MHPA 3C2UA 1JW6A 2CNAA 3AYAA 4ZXYL 5AVAA 3M3CA 1EZQB 4WV8A 4ASMB 1WBFA 4IQPA 3GALA 4XBLA 3POSA 3ZXEA 2P34A 1W6PA 1HT5A 1YYNA 1J9CL 4XMIA 4YZ3A 5T5OA 3WZ1A 4GALA 4O1ZA 5CBLA 3NT1A 3CFWA 3B01A 1KJRA 3WUDA 1NFYB 2PUQL 3H0OA 4Y1VA 2XBXL 1K37A 2DDUA 4TGFA 4YW2A 2E53A 4YW4A 4YFZA 2P3KA 4RL7A 4LBJA 2BO2A 4Y79B 1DQ6A 2B7DL 1SBDA 1ENQA 1DBNA 2KB9A 4G1MB 3NTBA 3O0XA 5DUVA 1CX2A 3POWA 2Y5HL 4FPFA 5GLZA 5H9QA 5T50A 5CB7A 2A6XA 4GWMA 4BMBA 5T55A 2ARXA 2ZA9A 4LBMA 1Q56A 2PHTA 2G4IA
chains in the Genus database with same CATH superfamily
4AI8A 4WM7A 2OW4A 3ZR5A 5F32A 3RNSA 1IQNL 5C9AA 4CDUC 2DCZA 2YGQA 2C9AA 2DVDA 2WPJE 3O7OA 4IE6A 1XE7A 4P5HA 1SLCA 2P3UA 2OX0A 2R1DA 2VNOA 1H4HA 3KGZA 4IERA 2VWOL 2Y8KA 3WW2A 4YZ2A 1OOPC 4LULA 2VH0B 5A70A 2JG9B 5M0TA 1JZ7A 2R041 1GP6A 1H2MA 4NVPA 3AZXA 5L36A 3WW3A 5F3IA 4W6XA 3JZVA 4JX0A 5HCBA 4ARXA 4FBFA 1AYN2 3HNYM 5AFEA 1RUG2 1W6NB 3DPRC 5LA9A 3I2OA 1AR82 4BZ4A 3A4UA 2JDMA 1UOJA 1V3XB 1NPEB 4OHVA 1PHMA 1PO13 2DCKA 2R0HA 4QDQA 3HQUA 4M11A 4OUMA 2Y82B 3KVBA 1OH4A 3S6PA 1WLCA 2ZHNA 1JOJA 3WX5A 4I3GA 4CXWA 4AHZA 1Y3TA 3VBOB 3N36A 3MYXA 3M2MA 3I2FA 4GZ9A 1D4VB 3H3ZA 3LIGA 4JHTA 5J1XA 5T3NA 3O1OA 2CTVA 3VL9A 2G1MA 3I3BA 5GLVA 4Y20A 1W8WA 1NFUB 1OQEA 3CBNA 2WFF3 4X8VL 3PJQA 3LIWB 2Q1MA 3TEWA 1QIQA 3T0DA 4ZHNA 3L9JT 1OQDA 5IWFA 5HXMA 5JMCA 2GU9A 2XVKA 3VBUA 4XUTA 3DPRB 1N1VA 2LW8A 1JHJA 5J3UA 2MEV2 1UOBA 4D94A 4LOSA 3V64A 4ZKTB 2HWE1 3LWCA 2PLV2 1K12A 5JIAA 4CP9B 4Y71B 3VKNA 4LHLA 5KXBA 2J22A 4Y7BB 3ZXJA 3ZPOA 1LOCA 3ZOIA 1LENA 4GKYA 3SCGA 3VB9A 2XJVA 5FY7A 2FLGA 1DCSA 1TMF3 3WG1A 5A3WA 1U8CB 1G2MB 3TYJA 4B29A 4EZHA 5F1RA 2VCBA 4HSLA 1PGEA 4AQSA 4AGGA 2UYAA 4N9HA 2YXSA 1GQPA 4NIDA 1PM7A 4R9BA 2P3JA 3UYJA 4HPKA 1CX1A 2FLRL 2RDNA 5FP3A 1U67A 4R4ZA 1PK6A 1NLQA 5T5PA 5DMYA 2G19A 4AFCA 1SQ4A 1GYKA 3NO8A 1TME2 4JDMA 3BTXA 1NCQA 1SFPA 2CGNA 1BK1A 3PVBB 4MMYB 5L9RA 5JXHA 2AYLA 5L2YL 1W2NA 1RJ7A 2GNTA 3BODA 4QPGC 1PO23 1OLMA 3W58A 1QQP2 4XW3A 4DRVA 1LHUA 5EJZB 1CR7A 1LPKA 5FYVA 5AC92 1GUIA 4JQRA 3V56A 5FZ3A 2XKOA 3MEPA 2W91A 3AX4A 3VD9A 3BPZA 3GNEA 4D0FA 1UQXA 4YGEA 5BNPC 1OF4A 2XHNA 2RM21 2E32A 3ACGA 3AL6A 1DU3D 2EAAA 3IAPA 4I30A 4IV1B 5E89A 5A32B 3GCWE 2JIJA 5HCHA 4AFAA 4AI0A 1S55A 2ZKNA 5FYZA 4LA3A 1N3PA 5KBFA 4DRRA 1XSRA 1V6OA 1I5PA 4XZUG 3S30A 4L8QA 1Y9GA 1QJEA 5FZIA 3CEWA 2FDGA 4XHBA 2Q1FA 3G7DA 1N1TA 4QX2A 4DMIA 4ZPIA 2BQ6A 5FYTA 1IPKA 3PU3A 3EBRA 4AEMA 4A7IA 1NQLB 2P4EA 4NHLA 2XR4A 4A94C 1PIV2 3MDLA 1TZOA 3IKWA 3MI8A 5FWJA 1JI6A 3B5LB 3PVEA 4QPGB 5JSOA 3O5SA 4CSYA 4YM2A 2WZR2 3KMHA 2E33A 4H7LA 4H7MA 2BDRA 5CISA 1FATA 3BTAA 4KWKA 4YM1A 5A7NA 1VBE3 5EP9A 3MGUA 1IQIL 3VKFC 1I3HA 3NV4A 2J1UA 2TNFA 4UW6A 1DQBA 2RS52 5IVCA 1AX2A 1RMU1 2WPKE 1XU1A 2WNVA 1XNCA 2Q30A 4HN1A 1XKBA 1DYOA 4YT6L 4QX0A 4XIKA 5EWSA 1X50A 1XNBA 1K42A 4RUTA 1G6NA 3IM0A 2JDHA 3HT1A 4J25A 4ZXKA 1GFF2 1AXZA 2W26B 2WPME 3GM8A 1SG3A 1RVF3 3NQHA 3TNQA 3J7HA 3MV11 2RS11 2D43A 4G9SB 4I3PA 4L0PA 4ZHAB 3WNLA 4CE8A 4LBOA 1CGPA 4LHNA 2A6VA 2SLIA 1A78A 2VZSA 3WF3A 5FOJB 5LWBA 1EAIC 4LQRA 3ZSLA 1ZM1A 2W3JA 2VOWA 3WVJA 4RHV3 4BB3A 1YQ8A 2JKXA 2X29A 4IUGA 2WN2A 2JG8A 4DIQA 3BYWA 3AYDA 1NA1A 4XILA 1X8MA 2HWC2 2P5BA 3FFQA 3POGA 4JC1A 3WEZA 1ULEA 1J83A 3UETA 1POV0 4XXAA 2D6OX 2W08A 2BOHA 2VVUL 2FCVA 2CWSA 3OYWB 5E8AA 4XFHA 3K3OA 5GLWA 4QKDA 3WP3A 4BIOA 3TAYA 4O61A 3ZYFA 4AK3A 1YJKA 2NMOA 1NXD1 1X9TA 2FCUA 2PHRA 3E6DA 1CPMA 3J7LA 4Q4W3 2BVVA 1ACCA 3OG2A 1IOAA 1HREA 5F1AA 2E9QA 3OBRA 4UF0A 3OPTA 4NJ4A 3VL8A 1TLEA 3P3NA 3U37A 5GZEA 5LBCA 1I1EA 1EMNA 1IKQA 3MDPA 1A8MA 2ILMA 3PURA 2EIGA 4Y1YA 1DQ4A 3VKMA 3ZXFA 3SH4A 4A7KA 4AI9A 4BISA 5FPUA 3C7OA 2Y80B 1DDXA 2KNIA 1CCFA 2EI8B 1U0AA 1DGRA 2ADDA 4EWAA 1BEV2 1XYOA 1MS0A 3PNAA 4NRMA 2PN5A 4P9XA 3KQDL 1IQHL 1WA6X 2NYYA 1S2EA 4MSVA 1X7AL 2PAMA 1GNHA 4JZRA 1CAVB 2XWBB 5A3TA 2TGFA 4E2QA 1SLAA 2V72A 3OGRA 5ACA3 1TEIA 2AENA 1VMJA 5C5TA 4GH4C 3FWEA 2WS91 5L7OB 2ZEXA 1VJ2A 4SLIA 3VZOA 3RI9A 3E1F1 1X8EA 2VZ1A 4GKXA 2DU1A 2IXIA 3I3QA 1DHKB 3ZYJB 1EV12 1PVXA 1RUD3 2RG4A 3BIWE 4YG6A 2RS51 3WXPA 3RGBA 3ZXKA 4CEYB 4HVQA 5CYYA 2Z69A 3OEBA 2ZGMA 3HMYA 3I3EA 3C7EA 3U73A 5IKTA 1OT5A 2HWB1 5FWEA 1LTEA 2XC5L 4AVCA 3ROUA 4M3CF 3GJBA 5E8DA 1CZVA 1BJQA 4A45A 1VB4A 4GB32 2GC1A 4S2GA 3U1XA 1VRH2 4NAMA 4AHWA 3NNJA 1D7PM 1UY1A 5ISLA 2G00L 1JH5A 1RFNB 2ZEYA 1X33A 1HN1A 4CUAA 1UWWA 1ZVFA 2LTNA 4QM9A 3KHCA 1DZRA 2ZZJA 1HAEA 2P3FN 4Q26A 3VBRA 4RQPA 2K2SB 2JIGA 3IB3A 3VDAA 5FUPA 3LTGD 1KD7A 1VBB2 3OEAA 1PM4A 3IDEA 3NJPC 2DV9A 4QQOA 2AR6A 4YW2A 4R52A 2HWC1 1LAJA 4N90A 1KS5A 2GN3A 3K2OA 4W4ZA 5E88A 5IK4A 4GU4A 1XOYA 3POEA 5FCCA 5JR7B 1UXZA 2ZJCA 1KS4A 3U0ZA 1GLHA 4Q4X2 4AVBA 5FZMA 3OUHA 4AHYA 3M37L 1CZSA 2DTYA 2WQZC 3C8XA 1DQ5A 4Y22A 1AR62 1JN2P 1C8M3 1PVC3 3ZYRA 1EQHA 1MQ5L 4Q4Y3 4JCKA 2DTWA 1SBFA 3JD72 1VPHA 4XYXA 3W20A 4D0QA 1O6UA 2FMDA 3ZFEC 3B94A 1BQPA 4M01A 1OSGA 4BXSA 2DFCA 3LA2A 1HRI1 3AZVA 2W47A 1QEXA 1GQHA 1F4AA 4QMAA 3VBFA 5BNNA 2W2PE 1BMV2 4YG3A 1RUF3 5CU1A 4YFWA 5JOWA 4PCRA 4BYYA 3RJ2X 4D7YA 4BXFA 4SBVA 3NRUA 2FZZL 1NY72 3ELNA 3WP6A 3VD7A 1MR5A 3BOPA 1NLSA 4Q27A 4FQZA 2HJIA 4HONA 4YW3A 2W0XA 3W5MA 1WW5A 2RMU3 1EPZA 1HB1A 3ETQA 1JZ8A 2QQKA 5A1AA 2WYGB 2VQAA 3PUIA 2WT1A 2ZGKA 4NRQA 1CAWA 4JHZA 1LHVA 1QXJA 4GJZA 5FO9B 2KL7A 1QOTA 1G1RA 3Q8AA 1H2NA 4K7JA 2WL1A 2X05A 2R7EB 4A41A 2WKKA 4XZPA 1ZNPA 1UOFA 2Y60A 5CKQA 1YJLA 3IWZA 4COYA 4QB2A 2BNMA 1ND3A 4CCEA 3S57A 2QQNA 1MZ5A 2RJLA 1F0RB 2J42A 5SV5A 1CAXB 2P16L 4AI3A 4YZ5A 1XNDA 5A7WA 1DQ1A 1W28A 3K48A 2OPWA 4LEJA 5A3NA 5JI7A 1KLIL 2PHFA 2YGOA 4HKLA 4A6SA 1Q8OA 2PFWA 1VRH1 1X36A 2QUOA 4J1XA 4XUPA 1OUXA 1BXHA 2Z79A 3NNFA 3Q8CA 4AWDA 2HBTA 3E97A 4CUGA 4N8MA 5FY0A 1BVP1 3HPTA 2NPRA 1H9PA 4XUOA 5KXCA 4XDQA 4ISIL 3JCIA 1JZ2A 4BJ0A 2W87A 2ORZA 3POFA 5FZ8A 4K8RB 4EV0A 3O1PA 3NKGA 1VBB1 1WZXA 1AYM2 4LR4A 1XNKA 2P3IA 1UL9A 4R8HA 2F4PA 1BK0A 2OYEP 3TWIA 3ETPA 3LA7A 4CCMA 2CJIB 4CDXA 3NNLA 4RS5B 3WDVA 3DGTA 4ASKA 4IEZA 5FMBA 3RWKX 1AR61 4Q29A 1IJQA 3WW1A 2FLBL 4TZDA 4RYDA 2YHJA 1Z78A 2VPVA 4JGYB 5A7SA 2CDPA 2LROA 5BNQA 4FP2A 1OVSA 1W6PB 4PDWA 2PAKA 2W1QA 4CPBA 4OHZA 3WQ0A 1BCXA 1AR92 2WNUA 5FZCA 5T54A 5FZ0A 2QQOA 3B00A 4MZUA 3LPGA 5KR7A 1H1MA 3PLQA 1DIYA 1HXS2 3SHRA 2VJXA 5IJRA 3B9CA 4GAZA 2VCAA 5BNOA 1TVGA 1RB8G 5I0RA 2PHBB 2QBXA 3M36L 1JODA 1HIXA 3B9IA 2VWLL 4Q1PA 3WDXA 2K9ZA 2JDAA 3HVDA 2CGOA 1OKQA 1R091 1W2UA 1W99A 1TG7A 4LKDA 4ARYA 2BPA2 3HS5A 2EXHA 3A21A 3NTGA 1W9WA 3BN6A 1W6QA 2V09A 2YYOA 2BFUL 2W94A 2ZGTA 2WYJB 2J1VA 3HAGA 4WM7C 1SFNA 3B02A 4NPMA 4PF1A 3POIA 1RUE3 5C9AC 2J38B 1G7YA 1N1IA 4BIFA 1ULPA 4LT5A 5DG2A 1FYUA 2ES3A 1ZRDA 1KLOA 5J09A 1LGBA 3C7FA 3KV5A 2Q4SA 3BB6A 4DUVA 5J96B 3FBYA 3CO2A 1R083 1HDKA 2JDYA 4FTEA 3OD4A 4Q4V3 4QGLA 4UW4A 4XJ8A 2YGMA 3NVCA 3EHKA 4AI2A 4B4RA 2VH6B 4O02B 1N3QA 2A70A 2RR11 3DCQA 2VZ3A 4D69A 1JZ4A 1DVAL 3FX3A 5C3RA 4L11A 3ZKYA 4E27A 3NJVA 1YQCA 3TEZA 1AL22 1STMA 1W03A 1BYHA 4Z0KB 2A7AA 5JLVA 2CU5A 1WU1B 5LY2A 3THCA 2RS32 4QU2A 1FOD3 4Z8BA 2Y26A 2UURA 3FBMA 2UU8A 2V4AA 1AYM1 2YU2A 2LUWA 1J1LA 3H1WA 3PIJA 2WPIE 1H6YA 4KGQA 4LO5B 4PF5A 4AGRA 4IEYA 1LCLA 5FMOL 4CP2A 1IZ3A 3E6BA 5COXA 4HG6B 4UXAA 4WM8A 5CNAA 3T0BA 2IUWA 4OUEA 2FMYA 4ASLA 3T08A 5FXVA 1COUA 4BQWA 5CG8A 1EAH1 3V65A 2VNRA 1FV3A 5F3CA 4MO3M 2WFTA 1LEMA 2KV4A 2ZGRA 3ASIA 4XUQA 3EB7A 1DIWA 5A3LA 1JBCA 2TBVA 1DYPA 2HEYF 1DF0A 1FNYA 1XBFA 2VOXA 3SNMA 3SQOA 4EE2A 4D6RA 3W9AA 4QHOA 3VBUC 1LHWA 1QJY3 4Z82A 3HWJA 4XXPA 1V9U1 2Y6KA 1PTHA 4D90A 2KR2A 4BTUA 3V64C 1N1YA 3LDRA 1W3XA 3N7KA 1IOXA 3O0VA 4FXGB 4KU8A 5FTTC 2Q8OA 3MW3A 5F3EA 3ZIWA 5FO8B 2GC3A 1RUI1 4JKKA 1HXS1 4QHZA 4FPKA 3B3QE 3FLPA 5ERLA 3AXDA 3RMYA 4P9WA 3ILRA 3SMHA 4ES8A 3HT2A 2NM1A 1P8JA 2Y64A 1WKYA 2D7FA 1CAUA 1O4TA 5LATA 1GSLA 1W6MA 3BTYA 3M3OA 3WP5A 3GBWA 1SACA 4Y20B 5FR3A 3CKHA 2B42B 4RSUA 4DINB 5GKAC 3OPZA 2ARAA 1U5IA 1OLME 4AI1A 1RUJ1 1ZA4A 1GV9A 4BQYA 2VTXA 1UYYA 2VL4A 2B9UA 4L99A 1PK6C 2R043 1PZ9A 1KFUL 4JZEL 4UOJA 3WQ7A 1R1ZA 3VBUB 4GWNA 1ULOA 1F4HA 2WPHE 1NCQC 4HMZA 4A7ZA 2ZGPA 1F5FA 1UZWA 4IEOA 4AQTA 2YY1A 1NZIA 1KLJL 4CXYA 2ZHKA 1E5IA 4IV3A 2FD6A 3DF0A 3H5CB 1ZZ9A 4ITCA 4ZH8B 4LOTA 1IQEL 4C0HA 3HIFA 5EHDA 5J7MA 1NCRB 3AKQA 5H9PA 4AXOA 2IFRA 2RS31 3KL6B 4RRXA 1UU5A 1W8HA 2VTXJ 1IS3A 1ZYBA 1UZJA 2VO5A 1ASJ2 3AXEA 4Y4YA 3WG4A 5B2GB 3T2PA 2B46X 3LN0A 4LO4B 2GN7A 4NIGA 4Q1RA 1C5MF 4HPKB 4UFIA 3LAQA 4CXXA 1KIGL 1CVUA 1GZWA 1MQTB 1W7XL 2ORXA 5IKVA 2Z42A 4FP3A 4MXWB 1EMOA 1PK6B 1Z7S2 4R9AA 4OQ9A 5JDBA 2ZZQA 3ZYGA 1COV1 3T2OA 2EALA 4LKSA 4EN0A 5C8WA 4QD2A 3NV1A 3ABZA 1FPN2 3POJA 1GQGA 1H30A 3WG3A 2B45X 4IGOA 2HWE3 3VBSA 3E6CC 3NJYA 1DFQA 5FYHA 2OXBA 4LBQB 4TLFA 1Y9MA 4KG0A 1H1AA 3TN91 3VBHA 3KS7A 4COUA 4HVRA 3TB0A 5IVEA 3AMNA 3KB5A 1S2KA 4AL9A 1W9FA 3HPNA 3ALQA 4CDWA 4X8UL 2WNVC 4YW7A 5I0DA 4BQ5A 3S7EA 1D2QA 3MIDA 3M7AA 4Q0QA 5CFCA 2B4KA 4N43A 2IXJA 1OLRA 1IGZA 1ATEA 1QNWA 1JYIA 4GWJA 3G6JB 1VBA2 1IS6A 2B9VA 3SEEA 3Q3KB 2YGPA 4QX3A 3V0AB 4BQ1A 3ES1A 3K3NA 4HOOA 2R071 4JTNA 5LBFA 4AVSA 2MGPA 1IPJA 1UY3A 4P00B 4KL1A 3MPPG 3NNGA 5FXWA 2A3XA 1L7RA 1HW5A 2MNGA 3AJYA 3NJXA 5T5LA 5IT6A 1MS8A 2WT0A 1XE8A 5HV4A 2DYCA 3WP4A 2ARCA 1KSNB 2I2SA 1QJX2 1A6CA 2JG8C 2ZGUA 2XQXA 3OGVA 4LBNA 1NA1C 4QHBA 5DABA 2ZMKA 2I45A 4CDQB 1MEC2 3A22A 5I0TA 3ZYHA 1D4M1 3AKPA 1O3RA 1AR83 3GHNA 4NWVA 2RV9A 1W8TA 2J1RA 3Q8BA 2LS6A 1X9PA 3O1TA 1NOVA 4AW7A 2RM23 5D8AA 2VWMK 2GZWA 4N53A 1W6OA 4PBOA 2I74A 3ELAL 1UW8A 2JENA 1B09A 3EO6A 4HXCA 2WBKA 3ZM8A 4DS0A 2BRTA 2XLFA 5F6KA 1X82A 1QJU1 3BT2A 2IVJA 2BV4A 4Z0LA 3EYPA 4IEVA 4FPLA 4PHZA 2HYKA 2WO2A 4XFCA 2BBAA 1ODNA 3WNMA 4AVVA 4A3ZA 3PTYA 2FDIA 4MG2A 2JDKA 4DXRA 1OXCA 1CONA 3U4SA 4LUMA 4JDNA 1OA2A 2D97A 3UK9A 4QX1A 4B7KA 4TXWA 4YVSA 1VBC2 2W2ME 1ZZ8A 2UY8A 3LFMA 4K6BA 1B35A 5IK8A 3I49A 3IDCB 4ZU7A 1FPN1 2ZEZA 3ACFA 2Y0IA 1GOGA 2XDVA 4MYEA 4XTMA 3BU0A 2VBPA 3J9SA 5FK8A 4MMXB 1GNYA 1RMU3 1GMMA 2PLV3 2P17A 1JYVA 4QT6A 4EN6B 1AR72 3PUQA 4O9GA 2EVXA 5CAZA 4RGKA 5C8CA 1IQAA 3WW4A 4MMZB 4TYSA 1J59A 4OZOA 4ZU5A 2J34B 2R062 4PIXA 4XMAA 4B8EA 1UYPA 2D93A 4UF0B 4O9EA 3O1MA 3LCPA 1NYWA 2VH9A 2GMEA 2RS13 3CDZB 5FZ4A 4WVZA 1WHFA 2BOXA 1DQ0A 3J8F2 3LDKA 3VZNA 1NKGA 1ZZCA 3ZDVA 1Q43A 3AVRA 3I7DA 4EN9B 3QLQA 2H6CA 3BT1A 2WLPA 2H9EC 1XXNA 3LD8A 2HEWF 2X10A 4PI2A 1W39A 3AP5A 5C71A 4NUBA 2HKXA 5GZDA 2XH6A 1AXKA 1E5RA 3ZLIA 3BPSE 3K75B 4DEQA 5FZFA 4CUCA 5LBEA 5T5JA 3JBG2 4YZUB 4CDUB 1BLZA 1YNAA 3DV8A 2P2KA 3H1MA 2BOUA 1DYKA 4KBBA 2BEOA 2AACA 2D3PA 3AZZA 3KRKA 3VBRC 5IAXA 4RQPC 5FQ0B 1IQFL 3S0MA 1MZFA 5A1FA 1OOPB 1BBT1 5DXDA 4KWJA 5FP8A 3DYOA 5HXVA 3WF4A 4XABA 1RHI1 3P5BL 1OA4A 4XBMA 3RZJA 2WFXB 1LJ7A 4FFFA 4CVUA 2ZGSA 4D0EA 2Y0OA 2WAOA 4NA9L 2P95L 4Y6DB 3IIAA 2NPIA 3OUJA 4IEQA 1VB2A 2QTWB 2TEPA 5FYMA 1PGL2 1VBD2 3R6SA 1G86A 1MQ6L 4JVAA 4DY5A 2XMLA 2LM3A 2X09A 2B39A 2WNOA 2VMCA 4I01A 1K5MA 1WCUA 1MZ6A 5JOYA 3N9NA 2VJ3A 5IVJA 3N8WB 1GP5A 1PMHX 4LBKA 4K8FA 3VBFC 2E26A 1ATAA 1UY2A 3SISA 4CCOA 5BNNC 3BCWA 3VBRB 3VLBB 3MZHA 4RQPB 5DUXA 4Q0VA 4CP0A 2D5HA 4PH9A 2J95B 3ACLA 2WS93 3CZJA 4BA6A 2XJSA 3MO4A 4FCAA 1DG6A 1IPSA 3HD8B 1IS5A 2WA4A 2BQPA 3M3QA 4W6YA 4W8JA 1R64A 2HWF2 1LOFA 2E7AA 4IDZA 5C7GA 1RYYA 2B8MA 2GNDA 5LRSA 3O1SA 4K20A 1WBLA 1XNAA 4Q0UA 4B4QA 2RS53 1W9TA 3Q8FA 2PXJA 1HRV2 3KCXA 2Y7ZB 1WD4A 1YCIA 2DUOA 4Y22B 2DFBA 2HWB3 1JUIA 1OBNA 4WZCA 4E4SA 1GOFA 2QDNA 1LPZA 2WWUA 3BGAA 3CZUA 4K1YA 5FPAA 5A6XA 1ND2A 3GCXA 1RINA 2BWCA 4CTEA 1JZ6A 4RD7A 3WT3A 3WNXA 3QH0A 2WABA 1AYN1 1PO12 4XCAA 1RUG1 4IE5A 4GD4A 1ND3C 3J8F1 1AR81 3ZX7A 5ABJA 5JZGA 3FCSB 1ATDA 3VBFB 3TRSB 1F5JA 3SOBB 5E6HA 3LSDA 1G1SA 3BU7A 3WNPA 5JAXA 3I2GA 1BZWA 5DUWA 2VQTA 2R6QA 3DYPA 2W5FA 5A1LA 2HWC3 4FI9A 1EYBA 5FYYA 1QIUA 2J1AA 2WO7A 2VM9A 4Q0SA 3HQXA 3ME2A 4MGTA 1IQDC 2WFF2 5KN5C 4MGIE 1L3JA 4F83A 2GD4A 4FAGA 2WLQA 3ZKUA 4QPIA 2W2IA 4LK6A 3ACHA 4NPRA 2OT7A 2BFUS 4XFFA 2A75A 3ILFA 1G8WA 4UFKA 4RFT0 4KWLA 2QZ3A 2WO3A 1H2KA 4CCJA 4P9GA 3NW4A 1XKAL 1ND3B 4CDXC 1HRI3 1DX5I 1H8TA 2AUYA 2MEV1 1WLTA 2ZS6B 3WF1A 5BNPB 1RTVA 3BI3A 4XDPA 2PLV1 3LEIA 1W04A 2NN8A 3RSJA 3WCRA 1PGL1 1HV0A 1VBD1 2WWSA 2N7GA 2YROA 5HCFA 1TMF2 4YM0A 3OOXA 4PDWC 2IFWA 5H9RA 3FMGA 1C1LA 2WNUC 5A7QA 2D1JB 5JSRA 2PTMA 1MS9A 3N35A 1LODA 2WO1A 4XTPA 4AAXA 2DVFA 1GZCA 2K2TA 4ISHL 1WLDA 4AEDA 4BWOA 4BQ2A 5GJ6A 5K0UB 3RR3A 2W1SA 3IAQA 2D6PA 3CS7L 5F5CA 3ZN4A 2PQQA 5BNOC 4LITA 2SBAA 4YARA 1Q8QA 1QHDA 1SEFA 4IL7A 2GALA 5C6CA 1UPIA 2HWF1 2XG3A 2BNNA 4D6QA 4XUNA 1APNA 4XF4A 1RITA 4IE4A 1W9YA 2XJRA 2HWD2 3K4AA 2ZX2A 2BSFA 3AFKA 3FHQA 1SPPA 1UU6A 3M1HA 3OBAA 1TME1 1HRV1 2XGXA 1UYXA 2P3FL 1FV2A 2OKXA 3UL2A 1UZ0A 3DN7A 3AKTA 5IATA 1ZAQA 1QQP1 4GB33 1G1QA 3AZWA 1T6GC 3C3VA 3QMOA 4NN0A 5AC91 1VRH3 3PUSA 4LO8A 4PDWB 4IGQA 3SXWA 1JV2B 2JJ6A 2H0BA 2WNUB 3GISX 3L2HA 1GK5A 4J1WA 4A42A 2QFEA 1O3TA 4PI0A 3N8XA 2VVCK 1WMXA 2A3YA 1QU0A 2CWMA 3QACA 1ULGA 4QAWA 4YZ4A 4YYOA 4AFDA 1S0IA 2ZAHA 3K77A 4QPYA 5FZ6A 3LQCA 5A3UA 2XPJA 5BNOB 1VBB3 4IGPA 4C16A 1ZRRA 4M3CA 2OQ7A 3DXUA 2BOJA 1XB9A 3I54A 1UY0A 3KWVA 3LOIA 4KWUA 5FPVA 3WDWA 3JB4C 3PIGA 2C5DA 4AVTA 2RE9A 1J3PA 3ATGA 2V5DA 4XBQA 5BY5A 2MPFA 5FBJA 2D6NA 1U5ZA 2WQ4A 4M00A 1W6QB 1OHFA 1ZBA2 3AVSA 4PIZA 4AZZA 4XOGA 2XC4L 2JG9A 5K9YA 1PIV1 1NX9A 3LDBA 1SZBA 1FAKL 1AR63 4CSWA 3QCWA 3MHZA 2W9XA 1UIJA 4CU7A 5LASA 5GM0A 1HX6A 3A23A 1GBGA 1W6NA 2R16A 4WM8C 1IQML 2WZR1 3JD73 4MGSA 3WUCA 4JZDL 4LA2A 1O3QA 1QY4A 1FAXL 2A1XA 2AH2A 2XOMA 2OZJA 2Y6LA 4XDOA 3K4ZA 3MIFA 3DKWA 5EYXA 4XF3A 3N8VA 1H2LA 2AEZA 2OPKA 3DL3A 3ZXLA 4BM8A 1CJDA 1VMHA 1PRHA 2VGDA 4XE9A 2W2OE 1BKZA 4B7EA 4CPBD 5IFTA 4AYUA 1RC6A 1YUDA 1RVF2 3N7JA 4TSVA 4UAPA 3VBOA 4A4AA 1Q5OA 2CAVA 4EQVA 2XBVL 3OUIA 5LEKA 1ONAA 1SCSA 4X8SL 1XRUA 3VHPA 4GA9A 4OHXA 1RXFA 4DO0A 1YUGA 1HT8A 2UWOB 3F6UL 1R093 3Q8EA 1UU4A 3KGLA 4OI4A 1J58A 4MLOA 4RHV2 5LK5A 3VZMA 3IJEB 3CF6E 4BXSV 4FTBA 2CHHA 4GQ7A 2VZRA 4YWAA 3RRDA 2Q1ZB 4LK7A 4MH0E 4Y5Z0 1W8UA 2W68A 1Y4WA 2ZTNA 1UD1A 3CLPA 3P1IA 4QGNA 4QQPA 4X6RB 5FY4A 4GH4B 3U4XA 1LMJA 1C57A 1W2TA 2C1FA 4BDXA 2AC1A 3PVNA 4WM8B 4URAA 3CQOA 2HWD1 3CMGA 4YLZA 2UWAA 1GANA 3HQRA 2WG3C 4GIQA 4XURA 4BLIA 2D6KA 3UNPA 3V0BA 4CP9A 2AEYA 5CG9A 3MUZ1 4LXLA 2BT7A 4BQXA 4QGMA 3SW2A 4IETA 3WHUA 1NFXB 4IXLA 1Q4GA 2XXZA 3JXSA 3N3HA 5FYIA 4YW1A 2BP6A 4HKOA 4MHRA 3KT7A 1OD5A 4ET7A 1FFMA 2RR13 2ZHMA 1JMUB 4LIVA 4X8PA 1RJ8A 1SLIA 2RDSA 4YGBA 3I2KA 5JBBE 4U2AA 5BUVA 1R1A2 1M06G 3D5OA 4CUEA 2IWGB 3USUA 3PL0A 4AQ6A 1C1FA 1U5YA 3U78A 2LRPA 1KDMA 1YUKB 4IV3C 4EYUA 1WA4A 1AYM3 3H8XA 2Y7XB 2A6ZA 2CSGA 2GP3A 2Z4FA 4M4RA 3I2JA 5DG1A 1ULFA 1WMFA 2XBO2 4V2VA 1BEV1 2UY9A 2J4IB 2JB8A 4FFHA 2VUAA 3AZYA 5FUIA 1UZPA 1H9WA 2A73B 2ZAAA 2ZBJA 1ZBA1 1EPJA 1EAH3 4TLGA 5ACA2 4BPZA 3HR9A 2PHLA 2NZ9A 3RG0A 5DZEA 2QQPA 2GP5A 4QKBA 3GZAA 4QXHA 3TBDA 5EFUA 3KV6A 5FMDA 3RYRA 4I2OA 2IZWA 3OD0A 5EJ1B 1POV1 2Z2SB 2Q8CA 4GMP1 5A33B 1Z6CA 1RUD2 4FVVA 3I3MA 4IV1A 1WCKA 4EN8B 4X8TL 4RRYA 2FDFA 1EV11 1Q8VA 3ZFEB 1V9U3 1W06A 2JE7A 2QQWA 3VBSC 5KC6A 2JDUA 5L30L 3JB8A 4RGAA 1IQJL 2D40A 1WCQA 1RUI3 3VBHC 1HXS3 4LBQD 1LMMA 3UJOA 1ULCA 2JEMA 1UCXA 3O0WA 4GB31 2BMGA 1V6KA 4YZ1A 5JVZA 3OJBA 1T2XA 5KHGA 2BZ6L 4NMIA 1S4CA 2CY6A 3U75A 4CDWC 2XKPA 4OFGA 1WHEA 3TEXA 1YI7A 3BALA 1QFKL 2ZMLA 4P5YA 2WUHA 3FN9A 1CVNA 4UFMA 5CFCC 4N43C 5JWPA 2WSVA 2ADEA 1BVVA 1GZWB 1GICA 3R0RA 1RUJ3 2D3SA 3CU7A 4PQQA 4R9DA 4UW3A 1WUVA 1VALA 2Y6JA 3NMBA 4ISRA 3VZLA 1PMIA 3P6BA 1UZZA 1G9CA 4QU1A 4QB1A 3ZSEA 2DURA 4M10A 4Z2AA 2BZDA 1V00A 4CZSA 3C7GA 2Q5TA 4C91A 1LRHA 4DZGA 5FJKA 2JDZA 3VBSB 1C8M2 1GWLA 1PVC2 2GNMA 2PHXA 2YZ4A 4Q4X1 3VBHB 1ZRIA 4JYUL 1EP0A 3IMNA 3WCSA 3GHMA 2WT2A 1QDCA 2H9EL 3OGGA 5BXXA 1O7FA 3HNBM 4O7XA 1DLCA 3JD71 2DVBA 4FOQA 1KDKA 1R1A1 4FOWA 1LECA 3URFA 1LNSA 4CDWB 1HZ8A 5D8AC 2VUDA 4I02A 4IESA 4N53C 2RS33 4P08A 2UWLB 4NG9L 1UO9A 4ZZ5A 1F35A 2VCCA 5AVPA 5CFCB 1G9FA 3IMMA 2A3WA 4N43B 3MFCA 3OSDA 2KXLA 1SCRA 1BMV1 2VW1A 3U07A 1QOOA 2XUMA 4OTJA 2VMEA 2ZX1A 4UWDA 4BDVB 1AUYA 1MPXA 1YI9A 2XBO1 4COXA 1NY71 2PQSA 3IDBB 3LPFA 4YPJA 3ZR6A 3KQ4B 2RMU2 2ET7A 1ZZBA 3ZSJA 1COV3 1O5LA 4RA0A 1REEA 4Z1VA 3VDBA 3BKZA 4GU3A 3ZMOA 1AL0G 4UFJA 4FQ4A 3USSA 3AK0A 3D8CA 1H4GA 2BGOA 3RPQA 4BH9A 3OCPA 1VMFA 1PX4A 1ULDA 2JXAA 4YVSC 3UGFA 5I91A 1JUHA 3TN93 2EI7B 1B35C 2ZXQA 1GP4A 1IQGL 1MS4A 1SBEA 4KH9A 4L92A 1MZEA 1HAFA 3UV9A 5A6YA 4Z6AL 1D0HA 3TZIA 2Y6HA 1L7LA 2P94L 1LHNA 4JQTA 4NIHA 1EGFA 1LKNA 4RR3A 5E16A 4N53B 3RQ0A 1GNZA 5FXZA 1OC1A 4FPHA 1REFA 5EYYA 4YW6A 3S5AA 5C8CC 4JDOA 5IHRA 3MPBA 3N8YA 1MACA 4D8MA 5C3OA 5JUVA 1G9DA 3FLTA 3VHOA 1UZQA 4E8DA 2L9LA 1UMIA 4NHYA 2A6YA 3SCFA 5F9TA 4NIIA 3KCYA 4DNYA 2E7TA 1WW4A 1F8VA 2GC0A 4Y76B 2DBIA 1VP6A 1V1HA 1CAVA 3R4DB 2B5HA 2R073 1QMJA 1AX0A 4QXKA 3THTA 1URXA 5FY9A 4MVTA 5L7OA 2KM2A 4EZ4A 1RUH2 2GSYA 3PTRB 1FMD2 2D5FA 3R4UA 4YVSB 4ISQA 4QKFA 4BU2A 2HEVF 1LESA 4XJ9A 4QQLA 5E1RA 4XVHA 2VU9A 1ZBE2 4WM7B 1B35B 5EV7A 1KGYA 3S7IA 2NP0A 4CEYA 1FNZA 1VIWB 1YO8A 5DDJ2 4BK4A 3FC0A 4D6SA 1PZ8A 5C9AB 5DAXA 1D4M3 3IN9A 4JV4A 2JD9A 4V1PA 5CIRA 3HS6A 2D3RA 5FZLA 2F17A 4ATFA 3MF9A 1QDOA 5FZGA 2VVFA 4Q8KA 2OA2A 3HOBA 2JE8A 2YC4A 3QH6A 4E9KA 5C8CB 4UYBA 2PELA 1D0GA 2YG0A 1NT0A 3CNAA 2AREA 2IC1A 4E2GA 3D3AA 1APOA 1RGSA 3GBGA 4LO6B 4PLOA 1JU3A 1IS4A 4JKMA 1NXMA 1QJU3 2CYFA 3LC5B 3N9LA 4Y1ZA 1GOHA 4XQ4A 4HK9A 4XJAA 1K5JA 2JJLA 2ZACA 1QH7A 2WN3A 1AR91 5FPZA 2JECA 1EPHA 3NKTA 4I0AA 4Y26A 4EWDA 3R4SA 4HETA 5GZGA 3H42B 5K7PA 1CQ9A 2BW8A 4RFRB 2WYSA 1JYWA 1A3PA 1J3QA 3NSTA 4RGGA 2MHFA 3B93A 5FY1A 1KJLA 5T52A 2JB4A 3FLRA 4LTAA 5FZAA 1LOAA 2WZ8A 3R05A 3K4DA 3U7UG 4D7TA 1XYNA 3OY8A 4HBNA 1C5HA 1K5MC 2WPLE 2P26A 2ZGLA 4FPEA 1V6MA 2VBBA 1FPN3 3AYEA 1QXPA 2ARBA 2BWAA 2QJVA 1OQ1A 4FOVA 4XJUA 1AHSA 2DUQA 2Q0AA 1FF7A 1KITA 1I0UA 4JYVL 2XBYL 2WJSA 2VZOA 2VZVA 4Y3OA 5FY5A 2R49A 1EBVA 3VN4A 1JZ5A 4OTYA 4DXSA 3LSEA 4FSJA 1PZ7A 3HN1A 4NHKA 3DEMA 1WLWA 4QPWA 1LOFC 3GCXE 1F0SB 3LEMA 3RFRA 1IP0A 1DQ2A 3N9PA 5DZGA 4D7SA 3F1SB 1R082 3K51A 3AJZA 5JSPA 2OUHA 2VZTA 5BPXA 5K4LA 3ZN6A 4A44A 1OMIA 5K0UA 4C1XA 2DBNA 4CCLA 4UT5A 1US3A 2PHDA 1NQJA 1UMZA 3NWKA 2ETEA 4GXLA 4AE2A 5CZKA 4S2FA 1ND2C 5JI9A 5DPNA 3HO3A 1EQGA 3H8UA 4HVOA 1MS5A 1N3OA 5FZ7A 5CADA 1YFWA 1KRIA 5CKMA 1AL21 1K5MB 4YW5A 4Q2FA 2C4XA 2BYVE 5ABJC 5KWRA 2IXLA 5LRRA 1LU1A 1HB3A 2Q8EA 4COZA 4RS0A 5CEHA 5JZGC 4XL1A 2E7QA 1KEXA 1RUH1 1OH3A 1W90A 2ENRA 2W39A 3UKTA 3AM2A 3KQRA 2DUPA 3LN1A 2XVLA 3KQCL 1LEDA 1ZBE1 3C7HA 1KQRA 1BBT3 1O4ZA 3EMRA 1A3KA 3B7MA 4QKNA 3TH3L 2V73A 5DDJ1 1RHI3 4L2NA 4UFLA 1TPGA 1UZKA 4Y5SA 1CAXA 3LF7A 5LK7B 1OF3A 3JUUA 3ECQA 1C3HA 1NCQB 1AUTL 1JYNA 4YM3A 5I46L 3RWNA 4FPCA 4OULA 4QPIC 2ID4A 3PU8A 1PXXA 2DU0A 2VZPA 4WVMA 1QJY2 5B4XA 2E31A 5FREA 1V6JA 3T4VA 1V6LA 3D6EA 1FT9A 1NQDA 3NAPA 1NG0A 1W9SA 2HH9A 2GH8A 3ES4A 1F7EA 4HLTA 5ABJB 2IXHA 1H8TC 3FUQA 3SOVA 1FXZA 3WY6A 4AHXA 4CCKA 2GAUA 5IVFA 5JZGB 1YQ6A 1L5GB 2K0GA 5FO7B 2VUCA 1YIPA 3OTFA 3GYDA 1OPOA 5HV0A 3QBQA 3LGRA 4JTOA 4P14A 2DCYA 4U36A 1YIFA 4AOCA 1HQWA 3TEYA 4FM5A 4NAOA 1UN1A 4A2UA 1OPMA 1W05A 3EXUA 1PNGA 2YV8A 4BQ4A 2R32A 4QX8A 1QJFA 5C4WA 4RS5A 1OD3A 3ZSMA 4YG0A 3AMQA 4ZY9A 4BTIA 1VE0A 3A7QA 3FUOA 2XB6C 4XC9A 4QQ2A 4XJWA 4AEDC 5CVRA 4JGYA 1UZVA 4AFMA 1ZZ7A 2PA7A 3VZJA 1P0SL 5A6ZA 2ZABA 1RL3A 4Y24A 4A6OA 1DZTA 2VMFA 2EXKA 2QQJA 2J2UB 2D6LX 4CRQA 4CUBA 2DCJA 4FPYA 1AYN3 1O4YA 3SKJE 2P93L 1RUG3 1APQA 3J4UH 3J8F3 3RI8A 2VMDA 5LCWL 3WR0A 4AGVA 5JPMB 4LMFA 5SV8A 5JXJA 3VDDA 2BQWA 1Q3EA 2WNVB 3S6XA 1J84A 3RVHA 5FZOA 2E6VA 2WR9A 4M3CE 3WNOA 1C4RA 4KBZA 2YBPA 4ZONA 1N1SA 2PR3B 2VZUA 3GZEA 4HKWA 2G9GA 4MUVA 3HNMA 4P9IA 2VOKA 4NOTA 2VXJA 1GR3A 2CV6A 1ODMA 5FLIA 5FYCA 3FFGL 2QQVA 4GJYA 5I0SA 4XBNA 1QKQA 4FFGA 5FZBA 4AEDB 3BUCA 1ASJ1 1QGLA 4NR1A 5A3MA 1EPGA 4Y1UA 4ES9A 4NWWA 4COWA 5HI0A 2OYZA 5DZFA 1CZTA 5LZ6A 3SH3A 1SLBA 1Z7S1 2F9BL 2JG8B 1L3YA 3O14A 4IEUA 5IFPA 3WQ1A 1NA1B 3CJIA 1SPPB 2JKHL 2HWE2 4PT6A 3HO5A 2JG9C 2MEV3 3AP7A 2CGPA 3I59A 1EPIA 4XQWA 5FKCA 1I9RA 2PAEA 1S0JA 1L7QA 3MW4A 5FIXA 1VBD3 1GWKA 1LR5A 4FPGA 1WD3A 2BU9A 3CL1A 3ZSKA 2P6CA 5FJHA 1UKRA 5H9SA 3KT4A 1RIRA 4Q8LA 1SDDB 4YVWA 2XLAA 4Z92B 1O59A 2VCMA 5ANNA 1JBUL 3VHRA 5JB9E 2VW0A 3AP4A 3AP6A 4Y1XA 3ZYBA 3VBOC 4UI9L 4E4ZA 3PJYA 5F3GA 6COXA 2QVSB 2WSUA 4M3CB 4E4HA 2BVBA 4W50A 1DDLA 5JB8E 3VUOA 1UPSA 2W2QE 5L2ZL 2HWF3 1VBA1 5EQUA 1LK9A 3MIGA 2QDRA 3PUAA 1WMEA 5JBAE 2ZKLA 4XEZA 1WGPA 2P6HA 2PHWA 1TME3 1YGCL 1HRV3 1PFXL 1OA3A 2A6WA 3H3LA 3F95A 2A71A 3LEKA 3D0SA 3GGLA 3K9XA 4MGKE 1DGLA 5F6LB 2AYHA 1SMVA 5GZCA 1SLTA 2BT8A 3WLUA 5K8SA 1I5ZA 2Y38A 2V4VA 3HEIA 4NHXA 1QQP3 1S0EA 1A8DA 1QJX1 5GLTA 4B1LA 1H6XA 1NAEA 4O65A 5AC93 1RUOA 2HYXA 4ZAEB 1QH6A 2RM22 1KKEA 1MEC1 1CX4A 5IKQA 1IG3A 2X5IA 3KV4A 3NV2A 4NHMA 3RJRA 4CCCA 5CKNA 3AC0A 3APBA 5JCTA 1HCGB 1LPGA 4C0BA 2C24A 2D6MA 4KU7A 4UBHA 2AZ5A 1YRZA 5G05L 2FCTA 2A5ZA 3RZKA 4XJZA 2BOKL 1NE6A 1U5XA 2DVGA 1ENXA 1RUC2 4NE9A 2W2NE 1V6IA 4UFHA 3VKOA 3VV1A 2RVAA 3T1MA 5C3QA 2VTFA 2I9BA 5JR2A 2ZPXA 2OVUA 5LEJA 1F31A 1Q8SA 4XHXA 3HBZA 3KZ4C 3CHXA 3FE5A 3POBA 4FTSA 1UY4A 1S0FA 3EJKA 3MICA 4BCUA 1LOGA 1AZDA 2YDEA 4P9JA 1VAVA 4P9LA 1NLRA 1PIV3 4A3XA 1HQLA 4XFIA 4CEWA 1IQLL 2EXIA 4MXVA 4EJRA 4AQ2A 3THDA 1VBC1 5D21A 3KQEL 3MF6A 1P9JA 5JXGA 2WZR3 3IPVA 2JX9A 4LBLA 5DAPA 4BOWA 2P1BA 4NRPA 3V0BB 1RMU2 2RHPA 4NROA 4XETA 3WDUA 3AYCA 2QQUA 4N7IA 4QWNA 2EI6B 2W3IB 1TNRA 5A3OA 3WNKA 1JS9A 5CFDA 3O1RA 3TGFA 3FJSA 3T09A 1AR71 4LIUA 4AG4A 1NCRA 2RS12 2R061 4IV1C 4BLJA 4E1GA 1QXRA 1V70A 1W8BL 2WFPA 3USUB 1A34A 5IKRA 2W92A 5L73A 4HSJA 1LU2A 4HZFA 2GNBA 1H8VA 4XLWA 2FDHA 1E5HA 3ST7A 1MQTA 2OIIA 2P3YA 4MXWA 4RRWA 4PLNA 5BNNB 3IITB 5D2AA 1BHGA 3AB0A 3ZPYA 2ZGOA 1IGXA 4DFSA 5JPNB 3PMEA 3KF3A 3SC7X 2J1EA 3RZGA 4CA9A 4KI5M 2HWD3 2R1BA 3JBG1 2J1TA 4OUSA 4BQ3A 1GZ9A 4WZFA 3ZFGA 2Z5WA 3ZN5A 4LBQA 3KF5A 2HBUA 2PMWB 5LW9A 1CD3G 4ATEA 1QOSA 2E51A 3E5UA 1CAWB 3IBMA 4NPLA 2QNKA 3WQBA 1HLCA 2BTVC 4UBGA 4A7YA 1S2BA 5J98B 2QQMA 3B69A 4OVEA 3SOQA 2Y5FL 1UXXX 1W0OA 4JGZA 2ERFA 2ADXA 4XCBA 5FPXA 2XC0L 3CIHA 4RRZA 3RZLA 2XJQA 2F4LA 1MS1A 2VE1A 4KG8A 4KNCA 3PMSA 4BMEA 5HCAA 3H50A 5A7WB 5LA1A 3O1UA 1RUC1 1VAMA 1DZQA 2D98A 5KHHA 3T2TA 4XF1A 2YB7A 2WNEA 3ZFFA 3V0AA 4LLOA 5FOBB 4X8NA 3P3PA 3L2YA 4HFSA 1E57A 5JOXA 1CIYA 1BEV3 1KXGA 1CWPA 4W65A 2JD4A 2YBSA 3IDAA 1ADXA 4S2HA 1UNBA 3D0JA 1ZBA3 1LULA 4XAAA 2BUKA 2WS92 5ANQA 4XF9A 4CP1A 1YXWA 4I0WB 2CDOA 4CDQA 2GMMA 1WW6A 2DWRA 3KVAA 4C1WA 1CVWL 1POV3 1XE0A 2VWNL 1JU4A 3QOPA 3DKQA 4GMP3 1PGW2 3E5QA 1CN1A 2EA7A 3UKVA 3TOJA 1UKGA 2D44A 1YUFA 4ZZ8A 3ZYIB 1EV13 1GKBA 1IG0A 2HWB2 1Q8PA 2VUJA 4XQDA 1MOXC 2WDBA 2O0OA 1HB2A 4JAAA 1OVPA 4CDXB 4MOAA 1PO22 1HV1A 1TOZA 4HN0A 5FMOS 1XYPA 4CYDA 3IIIA 3KCGL 1XQNA 4URTA 4WBBA 1XSQA 4G3YC 3J26N 1IQKL 4N9IA 5F39A 3BTZA 1S1AA 5F19A 1EUUA 1S0DA 1PO11 2VVEA 4DPNA 5KIRA 5FP7A 4RR3C 2R0FA 4RN5A 1YFXA 4OZXA 1AVBA 1JTZX 1WCDJ 3ZXDA 3POYA 2XWJB 3MW2A 3WSOA 4TWTA 1JYTA 1Z6EL 2EAKA 2RJ2A 4Q0PA 2Q8DA 4GMP0 3GBFA 2VRSA 5F5AA 4M0NA 2EF6A 4IE7A 5FZ1A 4DQAA 3I3DA 5JVYA 3WDTA 3J7NA 5L7OC 1QJZA 5A80A 3LEGA 3RZHA 3BOWA 1JHNA 2DVAA 2WFF1 1DGWX 5BV6A 3A0NA 2BGPA 4Q5OA 3D82A 4Q4X3 1ATBA 1ST8A 1UMHA 2B7YA 3M3IA 2VBDA 2VVDA 4QX5A 3MIHA 5EPAA 5LA0A 4CEYC 3T1LA 1VBE2 2FHRA 2ATFA 2P3TA 1HRI2 4ZS3A 5FLJA 4XIOA 4ZXXL 3A0KA 3KD4A 4FXKB 4N7UA 1R1A3 5C3PA 4OHWA 2ET1A 1URKA 3OPWA 4RR3B 4YGCA 3VHNA 1XPWA 4NO4A 4E2SA 5FFOC 5F5QA 3C9AC 4GWIA 1ZRFA 3N8YB 4PQ9A 3FHIB 4OCTA 1G2LB 3OBZA 1MVEA 4H14A 4AR2A 1TMF1 2XBO3 4CDUA 3NL1A 4QM8A 2ZX4A 3LE0A 2X53S 3S5QA 4HT1T 5FQ0A 1SHWB 5HBAA 4CU9A 2H6BA 4AEKA 3LA3A 1DP0A 4DOUA 1OOPA 3H7YA 1OFSA 2NLRA 3O12A 4FPOB 5C3SA 1YFUA 2LALA 3KCCA 1XC6A 5FY8A 4OLLA 1UAIA 3U10A 4AVAA 1YHFA 2WINB 3M4FA 3WHTA 1PGW1 4BDWA 2OUJA 4KGGA 1MVQA 4YRDA 4ZS2A 3RZZA 3I2DA 4DUXA 3DPRA 4PJYA 2XVGA 3GXUA 1VLNA 1TQ5A 2VY0A 3I97A 5APAA 3LIHA 3GDBA 4IW3A 3V65B 3LKJA 2VQ0A 3N7LA 3M3EA 1PO21 4BXWA 5DAVA 5FK7A 3GJAA 2BERA 4WVWA 2XHKA 5A7PA 4I09A 3TK5B 1JYCA 4Q4W2 4K9SA 1HX2A 2FBEA 1J3RA 3N8WA 1CJPA 1W3VA 4HL0A 5F5IA 1K45A 2M74A 3GF6A 2FDKA 1LGCA 4D3WA 4YNIA 3VD3A 5K0UC 2RNLA 1O91A 4Y33A 5FYSA 1XNTA 2UWPB 1IGOA 1AXYA 5A7OA 2C0ZA 4META 3WOGA 1O5DL 1EPWA 4E4DX 3OGJA 4K1ZA 3SCHA 5IK5A 4OHYA 3BPSA 4P9YA 3KV9A 2KD7A 4OMCA 3VKLA 1OFNA 2VMIA 4F8AA 5LA2A 3W59A 3OY8B 1UZYA 3DUIA 1HJFA 1O8PA 4FO9A 4HANA 3O1VA 1F9KA 4XF0A 2G9FA 4LJHA 5IUQA 5FDQA 1POQA 3WD5A 3E5XA 1CAUB 2EXJA 1LOBA 2IVIB 3I2HA 5FV3A 1NFWB 1W0PA 1W6MB 4Z07A 5EIYB 5HPOA 3AMMA 5IVVA 3MFAA 3BIEA 2XL7A 1CEJA 4IE0A 3H9AA 3MLKA 1CCVA 1JOPA 1YC61 4CU8A 1ZRCA 2VD7A 1VBE1 2GMPA 2QCSB 2BQ7A 1WW7A 5DAQA 1MS3A 3KHBA 1IVOC 1W8OA 1VRBA 2WIIB 3I4IA 3AKRA 3ZN6B 2HLEA 1V1IA 5A32A 2I9AA 1RUNA 4I0BA 2VNGA 3D4KA 1AR93 1WCSA 1CQEA 4KMQA 2FQPA 2VAUA 4PIYA 3UJQA 2YPDA 4S2DA 4EROA 3ZYPA 1YWKA 5I8SA 4IEWA 2Y81B 1HN0A 1Y9QA 1RVF1 4IV3B 1QF3A 2ZHLA 3PVOA 4XFBA 5F37A 4H55A 3W21A 1YFYA 1V0AA 4WVVA 1R092 3AFGA 3NAPC 4AEJA 3OGSA 2C9KA 2ZCWA 5C70A 2VC9A 1I6XA 2WWJA 4YGDA 5FP9A 4RHV1 3LC3B 4Y7AB 4MGZE 4OI2A 2OS2A 1PGSA 3N8ZA 1JXNA 1H1IA 3WINE 4QPGA 3WG2A 5DUUA 3U14A 5G04L 3MQEA 2C6SA 4CUDA 3VD5A 3IZOA 3WF2A 5IYYA 1CPNA 1GWMA 4RS5C 5C4WC 5L9VA 3H8OA 1ZX5A 4F7ZA 1S0CA 4DY3A 4W6WA 3JU9A 4M0HA 1LOEA 3RYPA 5BNPA 5C5UA 3ZDSA 4IEPA 1C5IA 2BJSA 2O8QA 4JGYC 2MGRA 1ENRA 1FAYA 2QKDA 4MADA 4QDSA 2RR12 2XBWL 2HORA 3BVCA 4ZXEA 5IW0A 3TNPB 3ZMNA 2YBKA 5DAWA 3SLIA 3W5NA 3ENRA 1SLLA 4Q4W1 4WVMB 4Q4Y2 1FSBA 2RDQA 4XFGA 2E63A 1YLLA 2VMGA 3M8LA 3NAPB 4P02B 3DXTA 4MGQA 4MHUA 2EIDA 5FAXA 2JKBA 2IXCA 1AL23 2W95A 2Y33A 2YC0A 3GCWA 3MLJA 4DXZA 5FZHA 3VDDC 1RUF2 5A6QA 1KFXL 1RUH3 1T6BX 1FMD3 3T3YA 2WQ8A 2YC2A 5F7UA 2W46A 4NIAA 1S0GA 3N7MA 1AJKA 2XONA 3UGHA 5JVVA 1Z0HA 1ZBE3 1YEWA 2BGCA 4OQ8A 2W52A 4OI0A 1EAH2 3WNNA 3ZXGA 2EIBA 5C4WB 5DDJ3 5KXDA 3KK6A 2Q1JB 3AKSA 1ENSA 3OYWA 3UKNA 5DN2A 5ACA1 3OB8A 5FYBA 3LB9A 3ACIA 4IEXA 2QQIA 2W86A 4CUFA 2YUEA 3OF1A 2XQRA 3HBKA 4FT8A 1W2OA 1VR3A 2BNOA 2QZ2A 4NGAL 1RUD1 3GZTB 3M70A 3KSCA 3UESA 1V9U2 3CJIC 5KHKA 2ZEWA 1WMDA 1NUKA 2NMNA 5I93A 1RXGA 3N9OA 4TTGA 5D1IA 1XJAA 1RUI2 3AP9A 3PDQA 1FJSL 3VDDB 5IVYA 5D8AB 1V6NA 2GC2A 1W6OB 5LY1A 1FX5A 5FZOB 2JDPA 3HS7A 2VG9A 2Y6GA 3H3UA 3ZIXA 3ZXAC 1F15A 1DLLA 3HJRA 1AX1A 1OKOA 1CIWA 2W1WA 4QXCA 3PUHA 4YVWC 3PGHA 3I8TA 4UW5A 3RYKA 3UT0A 5JW1A 3VDCA 1E5SA 5JIUA 4YSFA 4BTTA 3LTFB 3T30A 2PHUA 2XUEA 3N9QA 1JL9A 4YT7L 3RDIA 1RUJ2 1Y7BA 1M4WA 4OI1A 2VNVA 1EY2A 3F2ZA 4DEVA 2BBVA 1DGRN 1JYXA 1ZREA 2XJUA 1G9AA 1IKPA 4K21A 4JZFL 2K46A 5GZFA 3CJIB 2ZGNA 2VW2A 4Z2WA 1NE4A 2VVVL 2VZQA 4KQ7A 5FZDA 3INAA 3ZVXA 2FZ2A 5AFBA 1OLQA 3DYMA 4FPJA 3I59B 1UF2C 3MV01 3HO4A 5DQ0A 5JOZA 2YU1A 1C8M1 1TNFA 4CCNA 1PVC1 2Y6FA 4Q4Y1 2CL2A 3OLUA 1G9BA 4QB6A 3OLTA 2ZOEB 1D2SA 5I8TA 5JMOA 2PYTA 2X5IC 3FHAA 3MUY1 1LHOA 2DF7A 2RDRA 3QH7A 4YVWB 1LQDA 5FKBA 3IT8A 5IVBA 5IK7A 5BYNA 4XPVA 1ZA7A 3KM5A 3EQEA 4INDA 5KC5A 3Q7DA 1G1TA 2G9ZA 1RUF1 4LORA 1UYZA 2RJKA 3WF0A 5EGMB 4JKLA 3EGFA 1JOBA 2R30A 1ASJ3 3MLLA 2K2SA 4GH4A 1EUTA 2C26A 2P37A 5KXEA 4HK8A 2GDFA 2WC2A 3LFIA 1F7MA 2YMZA 4V2WA 3ENSA 1COV2 4BK5A 3THPA 5J48A 5FPBA 4R9CA 1W2AX 3TK6B 2RA0L 2WRAA 1HB4A 1U12A 1S0BA 3AL5A 1Z7S3 2UWBA 5TSWA 2RMU1 5J36A 1OB1C 3KQBL 5I0UA 2WG4B 2YPJA 4JRAA 3LOBA 3NV3A 3SITA 3SEPA 3WV6A 2W1UA 4QDRA 1F2NA 3OBTA 3ON7A 5I8YA 5FBZA 2WYFA 2VULA 3K46A 4OYUA 5FZKA 1M1XB 4LO7A 3TN92 4CEWC 1JZ3A 3H7JA 2Y5GL 4CCDA 1RUE2 4BHPA 4QXBA 1HKDA 1UIKA 3AMPA 4JRLA 2J94B 4FOYA 2VXRA 5JBCE 2WAAA 1O5UA 2X5IB 2EICA 3X29B 2KA3A 1H0BA 1C8NA 5EJ3A 4AF9A 1HJGA 3RS6A 4X6QB 2GH2A 5CFDC 4Q4V2 5FXXA 1AJOA 5FZEA 2X8KA 2UWCA 2OZ6A 5K0HB 5FZ9A 1HRFA 1GU3A 4LHKA 3ILNA 1NCRC 3KT1A 5FRAA 1REDA 4C8DA 3SH5A 4E8CA 2V5YA 3RZMA 4PBPA 4EWEA 4DXTA 2R072 2W3KB 1VBA3 3PHMA 2QQLA 2JE9A 2FD8A 3MIEA 1UX6A 3H1YA 1FE2A 3SKVA 1OUSA 5FUNA 1FOD2 3VGIA 2ZX3A 5F2WA 4XACA 1IOEL 1MQTC 2F6BA 1LB2A 3WDYA 3I2IA 4DUWA 5A33A 4CEWB 3ZO0B 3FFZA 1BF9A 1FMD1 1N7DA 1J1TA 1AF9A 2JDNA 4M4PA 1B9WA 4MGYE 5F8PA 5IAVA 1SFYA 2YGLA 5FPLA 1YQ5A 3QD6A 1W8NA 5EXOA 1D4M2 4B4PA 1QJX3 2O8OA 3IPVB 3N4MA 3ZFEA 1MEC3 2WZEA 3ZFGC 1LGNA 2H0VA 4J6GA 3CENL 2YFUA 2HOXA 5CFDB 1ALYA 2ZGQA 4K40A 4LPLA 4MX3A 4FAHA 1QJU2 2AGSA 2OYUP 1CESA 2FZ1A 1YQ2A 4LLFA 1XFEA 4JGZC 2P28B 2JICA 1ND2B 1C28A 5L9BA 5A3PA 3CA7A 2EIEA 2J7MA 4H3WA 3MBWA 4QX7A 2ZMNA 1K36A 3Q9OA 2ZX0A 4LHSA 4LKFA 1QNYA 4TN7A 1DGWA 1HJ7A 5GALA 1W0NA 2CAUA 5F2SA 3RMXA 1N47A 1ZZ6A 2IXKA 4B1MA 1XU2A 4Y4RA 4EN7B 1XDTR 3ZFFC 5GLUA 2MHPA 3C2UA 5FYUA 5CA6A 1HQNA 1JW6A 1VBC3 2CNAA 5LB6A 1X7NA 1UOGA 2UYBA 3AYAA 4ONUA 4ZXYL 2WA3A 5KHIA 5AVAA 2J1SA 2XL9A 2XJPA 1O8SA 4DB5A 3M3CA 1EZQB 3ZFGB 5FMCA 1OI6A 3GZUC 2WZPP 1PX3A 3ORJA 4WV8A 4ASMB 1GZTA 1OURA 2JWPA 3DECA 3AMHA 1WBFA 4CDQC 1FI2A 1RUE1 3U11A 4IQPA 4XFAA 1AR73 2R042 3LAGA 3GALA 1UX7A 3P5BA 4QPIB 3POSA 3FL7A 2P34A 4MV2A 4XBLA 3ZXEA 1W6PA 4JGZB 1HT5A 1TE1B 1J9CL 1YYNA 3JQWA 4FFIA 4XMIA 4YZ3A 2R063 5T5OA 3WZ1A 3VD4A 4OMDA 1R081 4GALA 4F3JA 5J37A 5LBBA 4O1ZA 4Q4V1 4PLMA 4K3UA 2Y34A 3NT1A 1PNFA 5CBLA 4LKEA 1H8TB 4COVA 3CFWA 2OQ6A 3B01A 1KJRA 3NNMA 4R4XA 3UGGA 3NJZA 5JXIA 3ZFFB 4L97A 3T2QA 3WUDA 1NFYB 1VAKA 2PUQL 1US2A 4Y5TA 4C90A 2VECA 5B4NA 3H0OA 2YFZA 4ZU4A 1W8ZA 3VZKA 4Y1VA 5L19A 2O1QA 4LNVA 4GULA 2XBXL 1FOD1 4H2AA 4LE3A 1K37A 2DDUA 3H8RA 4TGFA 2TUNA 3JBG3 2E53A 4YW4A 2FDJA 2DCTA 1IHMA 1K3IA 2P3KA 4ORFA 4YFZA 4RL7A 1NZCA 4LBJA 2VOVA 2BO2A 1BBT2 2BOIA 3FZ3A 4Y79B 1DQ6A 3J7MA 2B7DL 1RHI2 1SBDA 1ENQA 1Y43B 1DBNA 2KB9A 1WWYA 2I07B 1SDWA 2XLGA 4G1MB 3CJXA 1W8FA 4LUKA 3NTBA 2NQYA 3LZZA 4G4FA 4XAEA 4AAPA 2VR4A 4B3NA 2QE3A 1O3SA 3O0XA 3ITQA 5C33A 5DUVA 2VQUA 1CX2A 5KHJA 2Y5HL 3HN3A 3POWA 4FPFA 4LE4A 5GLZA 5H9QA 1QWRA 4AFBA 4QQHA 5T50A 5FP4A 5CB7A 1RUC3 2A6XA 3T0AA 4CU6A 1QJY1 3KLSA 4GWMA 3MIBA 4BMBA 4L9BA 5T55A 2ARXA 5FDBA 2O14A 3JQXA 2ZA9A 3N9MA 2VOTA 5FLHA 5EZWA 2VMHA 4LBMA 3T4HB 1Q56A 1PMJX 2PHTA 4BE3A 2G4IA 2XJTA
chains in the Genus database with same CATH topology
4WM7A 2OW4A 3RNSA 1IQNL 5C9AA 4CDUC 2DCZA 2YGQA 2C9AA 2DVDA 2WPJE 3O7OA 1XE7A 4P5HA 1SLCA 2P3UA 2R1DA 2VNOA 1H4HA 3KGZA 4IERA 2VWOL 3WW2A 4YZ2A 1OOPC 4LULA 2VH0B 2JG9B 2R041 1H2MA 4NVPA 3AZXA 5L36A 3WW3A 4W6XA 3JZVA 5HCBA 4FBFA 5AFEA 1AYN2 1RUG2 1W6NB 3DPRC 1AR82 4BZ4A 3A4UA 1V3XB 1NPEB 4OHVA 1PHMA 1PO13 2DCKA 2R0HA 4OUMA 4M11A 2Y82B 3S6PA 1WLCA 2ZHNA 1JOJA 3WX5A 4I3GA 4AHZA 1Y3TA 3VBOB 3N36A 3MYXA 3M2MA 1D4VB 3H3ZA 5T3NA 2CTVA 3VL9A 5GLVA 4Y20A 1NFUB 1OQEA 2WFF3 4X8VL 3PJQA 3LIWB 2Q1MA 3L9JT 1OQDA 5JMCA 2GU9A 2XVKA 3VBUA 3DPRB 1N1VA 5J3UA 2MEV2 4D94A 3V64A 4ZKTB 2HWE1 3LWCA 2PLV2 5JIAA 4Y71B 3VKNA 4LHLA 5KXBA 4Y7BB 3ZXJA 1LOCA 1LENA 4GKYA 3SCGA 2XJVA 2FLGA 1TMF3 3WG1A 1U8CB 1G2MB 3TYJA 4B29A 5F1RA 4HSLA 1PGEA 4AQSA 4AGGA 2UYAA 4N9HA 2YXSA 1PM7A 4R9BA 2P3JA 4HPKA 2FLRL 1U67A 4R4ZA 1PK6A 5T5PA 4AFCA 1SQ4A 1GYKA 3NO8A 1TME2 4JDMA 1NCQA 2CGNA 1BK1A 3PVBB 4MMYB 2AYLA 5L2YL 2GNTA 1RJ7A 3BODA 4QPGC 1PO23 3W58A 1QQP2 4XW3A 4DRVA 1LHUA 1CR7A 1LPKA 5AC92 4JQRA 3V56A 2XKOA 3MEPA 3AX4A 3BPZA 3GNEA 4D0FA 4YGEA 5BNPC 2RM21 4IV1B 5A32B 1DU3D 2EAAA 4I30A 5E89A 3GCWE 4AFAA 5KBFA 1S55A 2ZKNA 4LA3A 1N3PA 4DRRA 1V6OA 3S30A 4L8QA 3CEWA 4XHBA 3G7DA 1N1TA 4DMIA 2BQ6A 1IPKA 3EBRA 4AEMA 4A7IA 1NQLB 4NHLA 4A94C 1PIV2 3MDLA 3IKWA 3MI8A 3B5LB 3PVEA 4QPGB 5JSOA 3O5SA 4CSYA 4YM2A 2WZR2 3KMHA 4H7LA 4H7MA 3BTAA 5CISA 1FATA 4KWKA 4YM1A 1VBE3 3MGUA 1IQIL 3VKFC 1I3HA 3NV4A 2TNFA 4UW6A 1DQBA 2RS52 1AX2A 1RMU1 2WPKE 1XU1A 2WNVA 1XNCA 2Q30A 4HN1A 1XKBA 4YT6L 5EWSA 4XIKA 1X50A 1XNBA 4RUTA 1G6NA 3IM0A 3HT1A 4ZXKA 1GFF2 1AXZA 2W26B 2WPME 1RVF3 3TNQA 2RS11 2D43A 4G9SB 4I3PA 4ZHAB 4LBOA 1CGPA 4LHNA 2A6VA 2SLIA 1A78A 5FOJB 1EAIC 3ZSLA 1ZM1A 2VOWA 3WVJA 4RHV3 2X29A 2JG8A 3AYDA 1NA1A 4XILA 1X8MA 2HWC2 3FFQA 4JC1A 1ULEA 1POV0 4XXAA 2D6OX 2W08A 2BOHA 2VVUL 2CWSA