3ASIA

Alpha-neurexin-1 ectodomain fragment; lns5-egf3-lns6
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
395
structure length
395
Chain Sequence
ADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Neurexin-1-alpha
publication title Structural Basis for Variant-Specific Neuroligin-Binding by alpha-Neurexin
pubmed doi rcsb
source organism Bos taurus
total genus 92
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3asiA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3asiA01
5CKNA 2D3RA 1DQ6A 3M2MA 2VW2A 1RINA 5DUUA 2E51A 5FRAA 4BPZA 2XG3A 3VKOA 1EPGA 4YT7L 5DUVA 3WUDA 2JKHL 3O0VA 1H9WA 2WT0A 3TH3L 4FPEA 3PGHA 1TLEA 4R9BA 1CVWL 2EI8B 2DU0A 1TOZA 2UWOB 3WG4A 3AYAA 4Y1ZA 2Y7ZB 1YO8A 2Y82B 4NOTA 4Y1VA 3P5BL 1W6PA 4WVVA 3OLUA 4YG0A 1A3KA 3FLRA 5GLTA 4XBLA 2GMPA 1UZQA 2M74A 1NXD1 4P9WA 2J2UB 2P3TA 2DVFA 4NG9L 1A8DA 2P37A 5IK8A 1RITA 2Y38A 3BOPA 5IKTA 3SH5A 4ISIL 3NV4A 2AGSA 4H55A 2C9AA 1H9PA 4M10A 1X50A 3O5SA 1KLOA 2ES3A 1DZQA 1LOEA 1G9BA 2W86A 1URXA 4Y22B 3POWA 1IQIL 1CCVA 2OW4A 2D3PA 5CNAA 1WHEA 1O4ZA 5GALA 3AYCA 2PHUA 2AREA 1WW5A 4BTIA 4YT6L 2GMMA 1GV9A 1XKBA 3M3OA 2Y5GL 2WKKA 1G9CA 3IPVB 5JW1A 3ILRA 2MGPA 1LOBA 3WLUA 1V6OA 1MS5A 5CAZA 1PTHA 3WZ1A 1C4RA 2WPKE 2A6VA 4GXLA 3B9CA 2W52A 3V0BB 1V6MA 3KK6A 5EXOA 2P95L 3B3QE 2Y7XB 3U73A 1IQFL 1N3OA 2C5DA 2CYFA 1JYCA 4YFZA 3KQDL 6COXA 4YZ5A 3POYA 1FV3A 1SBDA 1KIGL 2UURA 5T52A 4SLIA 4LBMA 1V6LA 3NV1A 4Y24A 3WDUA 1W7XL 3PVOA 2JE7A 1PXXA 2FZZL 4CUEA 1EBVA 4YM2A 5IKQA 2KB9A 3W59A 4D69A 2ZAAA 1ENRA 3BODA 4Q8LA 1DHKB 1G86A 1ULDA 4Y7AB 1ZAQA 3ZYIB 2JDZA 1N1SA 1F0RB 4GKYA 2V73A 4FQZA 5H9QA 1UZYA 2XC5L 1SBEA 4U36A 1DIYA 4Y79B 1H30A 1IQKL 1V3XB 2DVDA 1JBUL 4Y1XA 3RMXA 1XFEA 1NQLB 5CA6A 3IPVA 5EYXA 5T50A 3FUOA 1MS8A 1YGCL 3V0AA 3NV2A 5HCFA 1FE2A 1GZWB 1UKGA 2D6PA 2ZGKA 5GJ6A 1F9KA 3AFKA 2JJ6A 1HT5A 5KXBA 1APQA 4FM5A 5GM0A 2BQWA 3ZYGA 4P9YA 1CVUA 1BXHA 2GALA 1FATA 2P3FL 4JZFL 2ZMLA 3AXEA 1LOGA 1JXNA 4XYXA 3UK9A 3WV6A 1F31A 1WLDA 2WJSA 1QOOA 2WPHE 1WHFA 2A6YA 4YW2A 1QOTA 2Y5FL 1HQLA 4LBNA 1AXYA 1HLCA 3SLIA 1HCGB 3KQEL 2A3WA 2NMOA 1KLJL 1W6OA 2FMDA 1AZDA 4RRZA 1MQ5L 1C1FA 1FSBA 2KV4A 5JLVA 2DURA 3N8WB 2ZMNA 3MPPG 3H5CB 4XTPA 4ZAEB 2ZACA 1K36A 3D4KA 3WCSA 2VXRA 4M00A 4RRXA 4XOGA 2VVUL 2CY6A 4TZDA 3MW2A 1IQEL 1HRFA 1HKDA 2P26A 4BOWA 1IJQA 3SW2A 1IQGL 2P3KA 3PVEA 4Y1YA 2PELA 1MZ5A 1DYKA 2ZGSA 1LENA 4X8VL 4XZPA 5IUQA 4YGDA 4FPHA 5H9PA 4HANA 2B7DL 4XILA 1AX0A 4YZUB 4ZH8B 2JKBA 5JOWA 2MGRA 5CKMA 2VH6B 2NYYA 4YM0A 4FP3A 2UWPB 2SLIA 4WZFA 3DGTA 1SLAA 1W6MA 3N7JA 3AX4A 4W65A 1S0EA 3NT1A 2TGFA 2VUAA 1LGNA 1V6NA 3LC5B 5JDBA 3T1LA 1CX2A 5DUXA 3HS6A 1WW7A 3TBDA 1A78A 4XBMA 4Q2FA 1NFUB 4Y71B 1RFNB 1UL9A 1NZIA 4YFWA 1DLLA 2Y5HL 2ZHLA 1Z6EL 1JHNA 4IQPA 2P3JA 3UL2A 2ZGRA 2E6VA 1I3HA 4Z6AL 4CZSA 5F9TA 4FPYA 4DFSA 1HJ7A 4OZXA 2W2QE 4M3CB 4JZEL 3N7LA 3BT2A 1G1SA 2EXKA 2ZHNA 1AVBA 1GKBA 1LTEA 5GZCA 3V64C 1JV2B 2UWBA 5LK5A 2VWMK 3AZZA 4ISHL 1S0JA 2GDFA 1ZA4A 2BOXA 1V6IA 4YZ4A 3HPTA 2GNMA 3CENL 1DVAL 3ZPYA 1FFMA 2GD4A 2Q1JB 4Z8BA 2PHWA 3B69A 5IT6A 3W58A 2TEPA 2NZ9A 3AP9A 3AZYA 1DQ2A 1G1RA 3HO5A 3OYWB 3RS6A 1QGLA 2WG4B 1AX2A 5T5JA 2GN3A 1LU2A 5FREA 2AYHA 4E1GA 3ZXJA 4UW5A 1DQ1A 2BO2A 3LSDA 3Q9OA 3WG1A 4P14A 4AQTA 5JBCE 2A70A 2EXHA 4G1MB 2YGPA 4K21A 2A6WA 4R9CA 4I30A 2BMGA 5JOYA 1MS3A 4BTTA 3WDTA 2CL2A 1NFXB 1LESA 1G9FA 2LTNA 2PUQL 2J95B 2J34B 3KQCL 3FBYA 1LHUA 3OBTA 1QMJA 1WW4A 2KM2A 3CFWA 1SLBA 1BQPA 4LBQD 1CJPA 3SOBB 3SOQA 1C1LA 3PJQA 1OKQA 1Q8OA 3UJOA 1YRZA 2FLGA 3N8ZA 1YUGA 1Q8VA 2RHPA 4Z0KB 1IS6A 2WNEA 3A0KA 1GK5A 1I1EA 2E7TA 2EF6A 3LN0A 2W39A 3ZXFA 1LGCA 2CTVA 4ATEA 1HAEA 5JMCA 1WBFA 3LTFB 1UMZA 2D6KA 2GNDA 1W0PA 1LOFA 4FPCA 1APOA 1KRIA 5IK5A 3AZXA 4LBQA 3M36L 4Y6DB 1W8BL 1VIWB 2ZKNA 2FLBL 2OVUA 2GNBA 4F83A 1N1TA 1COUA 1P0SL 1DIWA 1HT8A 4BM8A 3UJQA 2A75A 5F1AA 3WHTA 2D7FA 2NN8A 2ZMKA 5DZGA 1GZ9A 1UN1A 3ZSKA 1DX5I 1AUTL 2YZ4A 1S0DA 3D5OA 2B7YA 3GCXE 2DYCA 4C16A 3WOGA 1IS4A 2OUHA 4Z0LA 1LHVA 4FPFA 3SH3A 1EPIA 2VH9A 4XMIA 3GCWE 1PRHA 2PHTA 1EMNA 3TAYA 1SCSA 4D0FA 3IM0A 1LULA 2D1JB 1IS5A 2EIGA 5EGMB 4XXPA 1LODA 1F7EA 2DVGA 2JD4A 1JW6A 1LHWA 5GZEA 3R05A 1G9AA 2XC0L 4XJ8A 4TYSA 2AYLA 2SBAA 4Q1RA 4YW5A 1U0AA 2XC4L 2GNTA 4Y20B 3N36A 3SISA 1SBFA 1A3PA 3USUB 2ARXA 4Q26A 2WYJB 1WUVA 4Y26A 2MHPA 1OFSA 3T1MA 5GLVA 2CWSA 4XHBA 1LQDA 1YYNA 4C1XA 1GSLA 1EMOA 5JVYA 1G2MB 4AYUA 3APBA 4BDWA 2V5YA 4LBOA 4CSYA 4ZKTB 1KJRA 2ADXA 5F5QA 2WG3C 4L8QA 4PBOA 2FD6A 2R1BA 3IKWA 2DVBA 3OY8B 3RMYA 3NJPC 1Q8SA 3T2TA 2ZA9A 3TK5B 3ATGA 3I8TA 5JVVA 3DEMA 3R4UA 4Y22A 2DDUA 1QNWA 5IKVA 2A5ZA 2NMNA 1N47A 1W6QB 4LBLA 4Y76B 4ZXKA 1Q4GA 1LHNA 2DUPA 3HMYA 1HX2A 2FLRL 2H0BA 2W2NE 3AZWA 4YM3A 3NTBA 4YGEA 4AWDA 1FX5A 4YLZA 1ENSA 1MQ6L 1Q8QA 3MW4A 3B01A 4BMBA 5E8DA 2DWRA 3FUQA 2H9EL 2P93L 1IOAA 1U67A 1YIFA 4ASMB 3OGGA 1MACA 5JOZA 3KM5A 2CJIB 4XTMA 1BZWA 3U4XA 1N1YA 1IP0A 1HDKA 5KXCA 1BJQA 4K1YA 3LTGD 1Z0HA 3V0BA 1DFQA 3POSA 3LCPA 3AP4A 2OYEP 4Q1PA 1S0IA 4FOYA 3ZXKA 1CONA 4AVSA 2D44A 2WSVA 5CBLA 1CIWA 4PQ9A 5KN5C 4MMXB 1JUIA 3WHUA 1SFYA 1D2SA 1CVNA 1AJKA 3N8XA 4FP2A 2DUQA 1YXWA 2GMEA 1O5DL 1FJSL 3A4UA 3RG0A 5EYYA 1SLCA 1FNYA 1KQRA 5L73A 4XMAA 4UW3A 3NV3A 1AX1A 2JE9A 3WDYA 2A71A 1WW6A 2NM1A 3IITB 4GALA 4YG6A 3FFGL 1AXZA 1CN1A 4WVWA 3OBRA 1CPMA 1S0FA 4DS0A 5SV8A 1CEJA 1QF3A 1HAFA 2ZGUA 3VKFC 3N35A 1UZJA 2R0HA 3CNAA 1WBLA 2VY0A 1QKQA 1FF7A 5DG1A 3GNEA 3O0XA 5EWSA 3ILNA 1QNYA 4ISQA 3N8YB 4ISRA 3SOVA 3AK0A 3WVJA 4RA0A 4XL1A 3KRKA 4UW4A 1WU1B 1GZWA 3AJYA 1UX6A 4BXWA 2VJ3A 1Q8PA 1FAXL 3OLTA 5FDQA 2JECA 4YGBA 4XIOA 1N1IA 1QOSA 3JUUA 3ENSA 2E7QA 2WQZC 3C2UA 4YZ2A 1C5MF 4XE9A 2A7AA 4FOVA 4UW6A 5DUWA 1LPKA 1B9WA 1DYPA 5H9SA 1HREA 3OJBA 2K2TA 2BOUA 2YMZA 1V6KA 4O02B 3WG2A 1UAIA 2E53A 4U2AA 2CNAA 1YI7A 1KSNB 1G9DA 1M1XB 4RRYA 1CCFA 4XBNA 2A3XA 3MQEA 4YW3A 3FCSB 2OUJA 2AUYA 3N8WA 2A6ZA 1IQJL 1PZ9A 5T5PA 2J4IB 1KJLA 1ONAA 1GICA 1ULCA 3ILFA 3I4IA 1BYHA 4XXAA 1JN2P 1EQHA 1Z6CA 3FLTA 3AJZA 2BQ6A 1GNHA 1JOJA 4M01A 2YROA 1ULFA 5K0HB 2DUOA 2BQ7A 3N8YA 1U8CB 1PFXL 3LC3B 2ZABA 2W2ME 4NO4A 1LU1A 3AYDA 4NGAL 3IJEB 4FOWA 2ZGQA 2AH2A 3VV1A 3B00A 4AGVA 1CQ9A 4X8SL 5DXDA 5E89A 1QFKL 1IQHL 2NP0A 5DG2A 3HO3A 2G4IA 1SACA 2XBXL 4FOQA 3VKLA 2D3SA 1EQGA 1W6PB 3HN1A 3H0OA 3KL6B 1ATBA 3K9XA 3RQ0A 2J94B 2ZHMA 2ENRA 5L30L 1S0CA 2P16L 4AVVA 2A3YA 4M3CF 1URKA 3ENRA 3QMOA 3DUIA 5JB8E 1EGFA 1ADXA 5GLWA 2G00L 4P9XA 3N8VA 3N7MA 3VKMA 4FPOB 2XBYL 1S0GA 1YUKB 2Q5TA 4Y7BB 1QDOA 4OTYA 1Z78A 1IVOC 4XLWA 2ZGPA 4M3CA 2F9BL 2WFTA 1LPGA 1BKZA 4GWNA 1KDKA 2A6XA 3ZSLA 3N3HA 3ZXEA 1F5FA 2J38B 1EPHA 4CRQA 4PCRA 1NPEB 3WG3A 2UWAA 3WDVA 1KLIL 1R1ZA 2PHFA 2YV8A 1F7MA 3M3CA 2D43A 1IKPA 2I9BA 1MZ6A 3TB0A 1LOFC 1UZKA 5L2ZL 4K20A 3TK6B 3VKNA 2WPIE 3AP7A 1NFYB 1OB1C 1PGEA 3D6EA 3ZXLA 1GBGA 4LORA 1VALA 3ZYPA 2OYUP 2VWNL 5KXDA 1P9JA 1ULEA 4YW1A 3F1SB 4XJ9A 3OYWA 1WD3A 5GLZA 4YG3A 5T5LA 1ULGA 1EZQB 1XKAL 3BIWE 3U7UG 4JYUL 2ZGLA 1L5GB 4TGFA 2WFXB 1J9CL 1JYIA 1MS1A 1FYUA 4M3CE 2ZHKA 1ATEA 1SLLA 1LMJA 1XQNA 1CESA 4RS0A 2WT2A 5L2YL 2DV9A 1PZ8A 4DPNA 3Q3KB 2D6MA 1KDMA 1APNA 4ZXYL 1S1AA 2DTWA 2AR6A 1KITA 1IGXA 4D0EA 3M3EA 1DDXA 1G1QA 2XB6C 2DVAA 1IOXA 5GZGA 1IQML 2P28B 3L2YA 2VVVL 5KXEA 4KBBA 1VAMA 3M37L 2BOHA 3QLQA 2R49A 5IK7A 3ZYRA 1VAVA 5KIRA 2P3FN 1PZ7A 4AGGA 3TGFA 4RL7A 5CKQA 1Q56A 1V00A 1MS0A 1WLCA 1SLTA 2R16A 2D6NA 1L3YA 4BLIA 1IKQA 5I46L 3KQBL 3ASIA 5IK4A 1LPZA 2WSUA 5GZDA 1W0OA 3V0AB 3AXDA 3BTAA 2W3KB 3CS7L 3Q7DA 2P2KA 3OPZA 1IS3A 3HO4A 4ITCA 2PHXA 3WDXA 1GLHA 2ZGMA 4XJUA 2ARBA 2VW1A 2PR3B 1QU0A 4BTUA 2VU9A 4DQAA 2DTYA 3VUOA 3IN9A 2ZZJA 2EALA 1GANA 2I2SA 1FAYA 1F0SB 2XBWL 4ATFA 4LBKA 3MEPA 1EPJA 1JBCA 3SNMA 4A7IA 3IMNA 1IGZA 2AENA 5GZFA 3WDWA 3ZYJB 2R0FA 1W6NB 3SH4A 1W6OB 2P94L 1DQBA 3M1HA 4Q8KA 3AZVA 2LALA 3ZVXA 1UPSA 2D6OX 4FPGA 5T5OA 2NPRA 3NWKA 4DRRA 4ZHAB 3AP5A 3C9AC 3RRDA 4WV8A 3BT1A 1TEIA 2UWLB 5AVAA 4FPJA 4Y20A 4YZ1A 1WD4A 3ZSMA 2W2PE 3MW3A 4YZ3A 2UWCA 5DZFA 1ENQA 4PF5A 3USUA 1LHOA 3HS7A 4C1WA 3PVNA 1SCRA 1SZBA 3O12A 4OTJA 1ATAA 2ZGTA 1JL9A 3R4SA 1YUFA 3HS5A 2W2OE 1GNZA 1UZZA 4BQ1A 1NLSA 5CISA 3WNXA 2WT1A 4AGRA 3WCRA 1W6MB 1G2LB 4YM1A 1BF9A 1QDCA 1NT0A 2RA0L 4X8TL 4GWMA 3LSEA 1FAKL 4BXSA 1N1VA 1C57A 3OY8A 3A0NA 1MVEA 1Y7BA 5JBBE 1VLNA 3LAQA 1FNZA 1LJ7A 2WPME 2WLQA 1FV2A 3RSJA 1ATDA 4GA9A 4AVTA 4Y1UA 1DQ5A 1W6QA 1TPGA 1G1TA 2BOKL 2WPJE 1CQEA 1HZ8A 1W6NA 4FPLA 1MVQA 3HR9A 4XJZA 4LBJA 1G7YA 4XBQA 4PBPA 1MS4A 1UZPA 2VVCK 1LOAA 1LCLA 4DRVA 2PHRA 3F6UL 2BZ6L 4BLJA 4X8UL 2FHRA 1XDTR 2UU8A 2BQPA 2W3IB 2Y81B 1GZCA 2EI7B 1K37A 5JB9E 1OQ1A 3M3QA 2K2SB 3KCGL 2GN7A 4GKXA 4M11A 1EAIC 1J1TA 5COXA 1MOXC 2W68A 3TZIA 1G8WA 1CPNA 4XJWA 3AYEA 4LMFA 4R9AA 4XDQA 1D0HA 4ZXXL 5CB7A 1DQ0A 4JCKA 3RR3A 5T55A 1NFWB 2D6LX 1CR7A 1LGBA 3BPSE 2W08A 2Z42A 2ZGOA 3WUCA 3GISX 3LIWB 2VWOL 1N7DA 1AF9A 5E8AA 2KL7A 4XHXA 3AP6A 4RUTA 1O4YA 4MMZB 4XJAA 2XBVL 2WYGB 2P3IA 3QCWA 4RRWA 1MS9A 1RIRA 2ZGNA 5GLUA 3EGFA 1N3PA 1DGLA 1LECA 1SLIA 1S0BA 1B09A 5IKRA 1V6JA 4MMYB 3V65B 4O1ZA 4JRAA 2VW0A 4FVVA 5HCBA 3SITA 5E88A 1DQ4A 1WCSA 2PHBB 3KQRA 2CWMA 2EAKA 4NA9L 1LEMA 3PMEA 4D90A 2R1DA 5T54A 4K1ZA 2RNLA 5HCAA 5JVZA 1I0UA 3CA7A 1LEDA 2VWLL 4CTEA 1X7AL 4BDXA 4CUFA 5BYNA 3LN1A 3V64A 4PH9A 5JBAE 1GYKA 3INAA 2YXSA 4MYEA 1IQNL 2WPLE 2YGOA 3FLPA 1WLWA 1AXKA 2VH0B 2P34A 1HQWA 1DBNA 3ELAL 4XIKA 3ZSJA 4CUDA 2P3UA 4LBQB 4BMEA 5F19A 1LOCA 4HL0A 1IQLL 4Q27A 3GALA 4R9DA 4YW4A 3O0WA 4YGCA 4JZDL 3N7KA 3NTGA 1MR5A 5DZEA 5JOXA 2EI6B 3JU9A 5H9RA 2I9AA 2DU1A 2W26B 2ERFA 1EPWA 4COXA 4FPKA 2EXIA 2ZBJA 2EXJA 2Y80B 3FFZA 4JC1A 1IOEL 3MDLA 3QH0A 1AJOA 3V65A 2HYKA 2YY1A 4FQ4A 1ZM1A 1N3QA 4JYVL
chains in the Genus database with same CATH superfamily
5CKNA 3VZJA 2D3RA 1ZRCA 1JU3A 2ET7A 1DQ6A 4Q0UA 3NL1A 4ZS3A 3VBOC 3T08A 3M2MA 4QXCA 3B7MA 2D40A 3H3ZA 4NR1A 3GXUA 2VW2A 1RINA 5DUUA 1C5IA 2E51A 5FRAA 4BPZA 3GCWA 2XG3A 1JS9A 1CZVA 1RUH3 2WBKA 3VKOA 1EPGA 1WWYA 3WQBA 4YT7L 2VCAA 3NAPB 3VB9A 4OUMA 5DUVA 3WUDA 2JKHL 2BOJA 3O0VA 4ES8A 3I2JA 5FMOL 5C7GA 1H9WA 4YVWC 3ES1A 2WT0A 3TH3L 1RJ7A 2DCJA 4FPEA 3PGHA 1TLEA 4LPLA 2XBO2 1WCQA 5FWJA 3SXWA 4R9BA 2X5IC 5FZ3A 1TQ5A 3IDCB 2W47A 2QFEA 5FZOB 4NAMA 5CZKA 3ZO0B 1CVWL 1GZTA 3GM8A 2EIBA 2BUKA 2XL9A 4RGGA 3SCGA 2EI8B 1PVC3 1NYWA 2DU0A 2LROA 4MGSA 1TOZA 2UWOB 5A7WB 2C0ZA 3LIGA 2HWF2 2WAOA 2WNVC 4QGMA 3WG4A 3DYPA 3AYAA 1PK6B 4Y1ZA 4ZY9A 2J1EA 1UY0A 2VQ0A 5FP7A 3CO2A 3E1F1 2Y7ZB 2XLGA 1YO8A 4HBNA 3LOBA 2Y82B 4MVTA 3KCCA 4NOTA 5FWEA 4IGOA 4Y1VA 4GH4B 4RYDA 3WDYA 2RM21 4S2FA 4C91A 3O1MA 3P5BL 1W6PA 3C7EA 3KZ4C 4RS5A 2BDRA 4WVVA 3OLUA 4YG0A 1A3KA 2E32A 3FLRA 5GLTA 5JXGA 5DDJ2 4QQ2A 1XXNA 1QJX3 4FXKB 2GMPA 3BU7A 4XBLA 5FPXA 1UZQA 2M74A 3AKRA 1NXD1 4P9WA 4K6BA 2J2UB 2P3TA 2DVFA 1XNTA 4HG6B 5C9AB 1FXZA 4NG9L 1A8DA 4CDXA 2KA3A 1UPIA 2PFWA 3A21A 3GBFA 4HSLA 1IGOA 2P37A 4RQPC 5IK8A 3USSA 3DPRB 1RITA 2Y38A 3BOPA 5IKTA 4Q4W2 1O3TA 4KL1A 1NE4A 4ISIL 3SH5A 2YC2A 4Z2AA 1PMJX 5CFCB 3CLPA 3LEMA 4AXOA 4CDQA 3NV4A 4OUEA 4XVHA 2AGSA 1XBFA 3LZZA 4H55A 2C9AA 4KH9A 4E4DX 2JX9A 5L9BA 2Z79A 2Y0IA 1OMIA 4D8MA 1H9PA 3GZAA 4M10A 1X50A 1FI2A 2GP3A 3LGRA 2R7EB 4N53C 2ZEXA 2VBBA 3O5SA 4IE5A 5JSRA 3THCA 1YFYA 2JD9A 4KGGA 3VHNA 4A7YA 1AR73 1KLOA 1GOHA 1UO9A 2ES3A 4JAAA 4LULA 3OUHA 4N53A 1DZQA 1UNBA 4X6QB 1LOEA 1ZX5A 1G9BA 3VZKA 2W86A 1JTZX 4RD7A 4DNYA 1ZRFA 2TBVA 2VNOA 1BEV3 1URXA 2XKPA 4Y22B 3POWA 1IQIL 3VDDB 1CCVA 2C9KA 4AEDB 3DN7A 2QZ3A 3GDBA 5A32A 1V0AA 2OW4A 2XBO1 3ORJA 2CU5A 2D3PA 5CNAA 3WX5A 2QUOA 5LASA 2V09A 1ND2C 2OZ6A 1WHEA 2C26A 3J7LA 1VBB3 1O4ZA 4JQTA 5GALA 4OCTA 1Y9MA 3MO4A 4CDXB 4HN1A 1NQJA 2HWF1 3H8UA 5CADA 3OBZA 3NMBA 3PUIA 1QH6A 3AYCA 5K8SA 2PHUA 2AREA 3ZN5A 1WW5A 4BTIA 1DYOA 4YT6L 2QQNA 3M3IA 3E5XA 4W50A 4N43A 1W2NA 2FMYA 2K0GA 4IEPA 5FIXA 5BXXA 1F15A 3OF1A 4FXGB 3THTA 2GMMA 2AEZA 1IQAA 2OXBA 3ST7A 1GV9A 4XCAA 1XKBA 3VZOA 2VZSA 2EICA 5CFDB 3M3OA 3SQOA 2BT8A 3ZPOA 4ASLA 2Y5GL 2WKKA 2JXAA 2Y6HA 3RVHA 4A7KA 5DDJ1 1G9CA 4UF0A 1QWRA 5JZGB 2G9ZA 1CAWA 3IPVB 1VJ2A 4FAGA 5FZ1A 5JW1A 3ILRA 5L7OB 1VB2A 1RUH2 2MGPA 3BU0A 1EUUA 1LOBA 3OPWA 4Q4W1 1J3RA 3Q8BA 3WQ7A 1YCIA 4PJYA 4CUCA 1P8JA 3WLUA 1V6OA 3FBMA 1MS5A 2RDQA 5CAZA 1PTHA 3WZ1A 1C4RA 2WPKE 2YUEA 1JUHA 4W4ZA 4E2SA 3OG2A 4DY3A 3H8RA 5EJ3A 5F2SA 4CCEA 4DO0A 1G6NA 1IG3A 1UYZA 2WABA 4P00B 2VAUA 4YWAA 2A6VA 2JENA 4EYUA 4GXLA 1PVC2 2W52A 3B9CA 1JYNA 2WN2A 3V0BB 1RC6A 1V6MA 2X53S 2VECA 3KK6A 4HK9A 1LKNA 3VLBB 5EXOA 2RS33 4GZ9A 2P95L 3B3QE 2Y7XB 3U73A 1IQFL 4QB6A 1N3OA 1H0BA 2C5DA 2J1VA 1B35A 2BVBA 5F5IA 3J7MA 1NCRA 3IDEA 2CYFA 2PAEA 3ECQA 1JYCA 1PX4A 1WZXA 1XNAA 5A3WA 4AFAA 3S5AA 1CAXA 4YFZA 5LZ6A 1NX9A 1AR83 4KWUA 5CYYA 5FFOC 2PQSA 3VN4A 2WFPA 3KQDL 6COXA 1QJX2 2WC2A 4YZ5A 3POYA 1OOPB 2V72A 4UFLA 1FV3A 1SBDA 1SHWB 1KIGL 1UYXA 2J22A 2UURA 5T52A 3SEPA 3T0AA 1RYYA 2WO3A 4SLIA 4FFHA 4LBMA 3H7YA 4LHNA 4B7KA 3LE0A 4AEMA 1V6LA 1OD5A 1PO11 3NV1A 4Y24A 3WDUA 4WM8A 1W7XL 2PQQA 3PVOA 2IC1A 2JE7A 5LEJA 4UT5A 1PXXA 2FZZL 4CUEA 1EBVA 4RSUA 4YM2A 5A70A 5IKQA 1H6YA 5FZHA 2R32A 2KB9A 1LRHA 3FWEA 3VBFB 3W59A 4D69A 1ZZBA 5IVEA 2ZAAA 4UBGA 3C7FA 4CU6A 4L11A 1ENRA 4RN5A 3BIEA 3BODA 4Q8LA 5FY7A 1DHKB 1AR72 1G86A 1ULDA 4Y7AB 4W6XA 3PTYA 1X9TA 1RUH1 1ZAQA 2VR4A 3VZLA 4B8EA 3ZYIB 3LA2A 2JDZA 4GJYA 1C8M2 1N1SA 3KVAA 1ZZ6A 1F0RB 1F2NA 2VOWA 3I7DA 4GKYA 5FZ6A 2V73A 4FQZA 5H9QA 3IAQA 4CCCA 1OF4A 1X8EA 4HLTA 1SQ4A 1SDDB 1XRUA 5KHGA 1UZYA 2XC5L 4PLOA 1W2TA 4DEQA 2XGXA 1SBEA 4U36A 1YFWA 1DIYA 4ONUA 4A6OA 3JD73 4EE2A 1CGPA 1VBB2 2VXJA 4Y79B 4EN8B 4EROA 1PVC1 1R083 1H30A 1IQKL 3KQ4B 1V3XB 4LITA 1CZSA 4DUXA 4COZA 3GBWA 4BQWA 3M7AA 1NA1B 1L7LA 2DVDA 3LIHA 2XPJA 2WZR3 5FYHA 4IXLA 1JBUL 4Y1XA 3RMXA 1XFEA 3IZOA 3R4DB 1W05A 1NQLB 5LRSA 2PLV3 4E4ZA 5CA6A 3IPVA 3MLJA 2VRSA 5EYXA 5T50A 4UI9L 2HJIA 2ETEA 2A73B 3FUOA 4H14A 5F6KA 2IZWA 5L7OA 2PTMA 1U12A 1MS8A 5AFEA 4YARA 2J1AA 1YGCL 1QJEA 4N9IA 2WO2A 1QJX1 2JDAA 4XW3A 3NV2A 5HCFA 3V0AA 1FE2A 4JGZC 5M0TA 1TG7A 3VDCA 4X6RB 1GZWB 1UKGA 2CAVA 2D6PA 2ZGKA 5GJ6A 3FMGA 5IVVA 5K7PA 1F9KA 4LQRA 3AFKA 5FYBA 4OZOA 2ZX1A 2IFWA 2K46A 2JJ6A 1OFNA 3H1WA 3H8XA 1OVPA 3RYRA 1HT5A 5EHDA 5KXBA 1W9FA 1APQA 4FM5A 1KEXA 3ZN4A 1ZZ7A 2Q8OA 1XJAA 5D8AC 5GM0A 3SMHA 2BQWA 1ND3B 4CP9B 1NQDA 2HBUA 2WAAA 4MHUA 5C70A 3ZYGA 3MBWA 1CVUA 4P9YA 1BXHA 3WP3A 2QVSB 5FBZA 1ODMA 2OZJA 5BNNC 2GALA 3ACFA 5BUVA 1FATA 2P3FL 4ZU5A 4RR3C 5J09A 4BIOA 4CCMA 4JZFL 1AR71 2RS32 2ZXQA 3OEBA 2ZMLA 1U5YA 3AXEA 3H3UA 1LOGA 4HPKA 4AFBA 4D6RA 3ZFFA 3C7HA 1HV1A 1JXNA 2X29A 4XYXA 3FJSA 3UK9A 3WV6A 4MV2A 1IHMA 2IXIA 1F31A 1WLDA 2G9GA 5C4WB 2WJSA 2FZ2A 1H8TB 3O1PA 2WS92 1QOOA 2WPHE 1WHFA 2A6YA 4YW2A 5IFTA 2XR4A 4ZPIA 5F3EA 1QOTA 1PIV3 2Y5FL 3AVRA 4NPMA 4ARYA 1HQLA 2WINB 1YQ6A 4LBNA 2X09A 1AXYA 1MZFA 1HLCA 4KBZA 1QEXA 4JX0A 3SLIA 1HCGB 4Y3OA 2XHKA 4Z1VA 1VBB1 3KQEL 4XAAA 4QDQA 3VD7A 1D4M2 2PAMA 3GZUC 1J84A 1OLQA 2A3WA 2XONA 2IVJA 1F35A 2NMOA 1KLJL 3J26N 4Y5TA 2VQTA 3VBFA 3SC7X 2ORZA 1W6OA 2FMDA 1AZDA 1YQCA 3HD8B 4RRZA 2VZUA 3MFAA 3TWIA 3UETA 1NLRA 3I49A 2IXKA 1MQ5L 1C1FA 5F39A 4MGZE 2BWAA 1FSBA 4P9IA 2KV4A 5FJHA 1QH7A 2QKDA 5ISLA 5JLVA 1VAKA 2HWB3 2ARCA 4A7ZA 3CZUA 5FP9A 2DURA 3AKPA 4BWOA 1YJKA 3N8WB 5F5CA 3WNNA 5IATA 1US3A 3FL7A 1GOGA 1E5SA 1WMDA 2TNFA 3ZMNA 2ZMNA 1AL0G 1NCQB 1O8PA 1NY72 1UIJA 3MPPG 3LA3A 4IV1A 3H5CB 2VUJA 1JZ7A 4LHSA 4JKLA 4XTPA 4MSVA 3KGZA 2W46A 4ZAEB 5F6LB 5A6ZA 4JGYC 4LO4B 2ZACA 1Q43A 3OGSA 1OHFA 1K36A 3D4KA 4IEXA 2VXRA 4JHZA 4M00A 3WCSA 4DUVA 2PXJA 1ZZ8A 4BE3A 4RRXA 1JI6A 3LDKA 4XOGA 2VVUL 4HKOA 4W6WA 4AI1A 2CY6A 2D5FA 1O5UA 1RVF3 3NJYA 3MW2A 1IQEL 1HRFA 2WDBA 3PURA 1HKDA 2JWPA 4W6YA 2P26A 3JD72 3JCIA 4IETA 4BOWA 1IJQA 3SW2A 1IQGL 2P3KA 3PVEA 4Y1YA 2PELA 1MZ5A 1ACCA 1DYKA 2ZGSA 1LENA 2Z5WA 1RUE3 5D2AA 4X8VL 1GMMA 1VBA3 4MHRA 4XZPA 2H6BA 5IUQA 4YGDA 2RS53 2RS31 4FPHA 1W04A 2WZR2 5H9PA 5BNPB 5J48A 1C28A 4HANA 3W5NA 2B7DL 5J1XA 4XILA 1AX0A 5LATA 4YZUB 4ZH8B 2PLV2 5KHIA 2JKBA 5JOWA 5KHJA 2MGRA 5CKMA 2VH6B 2NYYA 3LFIA 3P5BA 4YM0A 4D7TA 4DY5A 1PHMA 1EY2A 2VBDA 4FP3A 1AR81 4XFGA 2UWPB 1QXPA 1E5IA 2SLIA 4GWIA 4WZFA 3VHOA 3DGTA 3J8F3 2QQMA 1SLAA 4FFFA 4MADA 4NHMA 1W6MA 3H7JA 3AX4A 2BBAA 3K4DA 3N7JA 4KI5M 1XB9A 2BGOA 4W65A 3ZFGA 5ABJA 4D3WA 3K51A 1S0EA 1OI6A 4A3XA 3NT1A 1D4M1 2TGFA 2VUAA 3PU3A 5AFBA 1LGNA 3O7OA 4TWTA 3BTYA 1K45A 1H1AA 2WFF3 1POQA 3LC5B 1V6NA 2IUWA 1T6GC 3I3DA 3ZN6A 5JDBA 4NROA 2VZRA 3T1LA 5LA1A 1CX2A 5DUXA 2YC0A 3HS6A 1WW7A 2QQPA 3TBDA 3AC0A 1A78A 4XBMA 4HVRA 1NFUB 4Y71B 4I0BA 4Q2FA 5A33A 4H7LA 4XZUG 4IE4A 1RFNB 4OFGA 3UGGA 4NRPA 1DU3D 1UL9A 4C0BA 1NZIA 2XH6A 3JXSA 4G9SB 4JKMA 4R8HA 4YFWA 5C4WA 5LBBA 1OUXA 3ZMOA 5DAQA 1UF2C 4BXSV 4MH0E 5JIAA 1DLLA 1OPOA 1NY71 2Y5HL 2D98A 4YVSC 2HWD3 4DMIA 1RUG2 2ZHLA 3FHIB 2VVDA 1MEC2 1Z6EL 1JHNA 3KVBA 4QMAA 1GQHA 3MUZ1 5LA9A 4GQ7A 4IQPA 3WP4A 4QT6A 3UGHA 2P3JA 2JICA 2RS13 2IXCA 1H4GA 2GC2A 4WM7A 4YW7A 3SCFA 3K77A 3UL2A 1KS4A 3LB9A 4TTGA 2ZGRA 4QX8A 3CJXA 2E6VA 5FMCA 1PIV2 1I3HA 4XACA 2W1SA 4Z6AL 1JYXA 1Y4WA 5I0RA 4CZSA 5F9TA 3LA7A 4FPYA 2FDHA 4KU7A 3JD71 4I0AA 1AYM3 1R081 4DFSA 5F3CA 1HJ7A 4OZXA 2QQUA 4BHPA 2W2QE 2WO7A 4IDZA 4M3CB 5BNOB 1GP4A 4JZEL 2IXLA 3I2FA 5FTTC 3U10A 5C5UA 2WZR1 4E27A 3FX3A 3N7LA 3BT2A 1ASJ3 4QM9A 3WP5A 3FHAA 4A44A 1QJZA 1G1SA 2PLV1 4E9KA 1UU5A 4LLOA 2VZPA 4L97A 2JIJA 1PMHX 1XE8A 2EXKA 4QXHA 2TUNA 2ZHNA 1ZZCA 2XJSA 1AVBA 1GKBA 1LTEA 4NHLA 5ANQA 4CA9A 2HLEA 2HWB2 2BGPA 3V64C 3HN3A 3A7QA 3DKQA 4UXAA 1JV2B 5GZCA 3JQWA 4QPIA 5FO9B 2UWBA 3H3LA 5LK5A 2VWMK 2XL7A 2BOIA 5FR3A 4QQHA 3AZZA 1FOD2 4ISHL 4NWWA 5JXIA 1STMA 3ZDSA 4QXBA 3ACLA 1GP5A 4LO8A 1S0JA 1W9YA 2UYAA 2GDFA 1TE1B 1ZA4A 2OYZA 2BOXA 3VBOB 1V6IA 4EN6B 1VBC3 4YZ4A 3HPTA 2N7GA 3K48A 3RJRA 1UOFA 3VBUB 2GNMA 3CENL 1DVAL 2WR9A 3M8LA 4QU1A 2R043 1RVF2 3ZPYA 4OQ9A 1FFMA 5K4LA 4E8DA 3GJBA 5C8WA 4ARXA 5LK7B 2GD4A 2Q1JB 3ZYBA 4BIFA 5I8SA 4Z8BA 2D5HA 2D97A 4KG8A 4XETA 4YVWB 3VBRC 4EWAA 3KB5A 5A7OA 1RUE2 3CU7A 2VMFA 2PHWA 4OUSA 4B4RA 2W3JA 3B69A 4KGQA 1Y9QA 2VMHA 2RS52 4JQRA 3I2OA 1Z7S3 1X7NA 2X5IB 3W58A 4AI0A 5IT6A 2TEPA 3HPNA 2NZ9A 4HOOA 1JZ5A 3AP9A 2ZKLA 1MQTB 4Q4X3 4AI9A 1XYOA 4ZU7A 4OI0A 5I0UA 5G04L 2Y6LA 3AZYA 4LJHA 5FPAA 3KF5A 1DQ2A 1G1RA 3HO5A 2WNVB 3CJIB 3OYWB 3K2OA 5EV7A 3RS6A 4BYYA 1QGLA 1PIV1 2X05A 3KV9A 3VBHC 2WG4B 3J8F2 1AX2A 1K5JA 2GN3A 5T5JA 4G3YC 1LU2A 3MPBA 5FZ8A 2Y26A 4XF0A 1XSQA 3PIJA 2ZEYA 5FREA 3VGIA 3CBNA 5A3NA 2ZX3A 2CHHA 4QX2A 2AYHA 4TLFA 4E1GA 2PN5A 4QGLA 3ZXJA 4UW5A 2WFF2 1REDA 3KV6A 2Q1FA 1US2A 1DQ1A 1H1IA 2BO2A 5CU1A 4BH9A 3LSDA 2JKXA 1QJU3 3Q9OA 1OH4A 3WG1A 2PMWB 4P14A 4EJRA 1VMHA 4D6SA 3IDAA 4AQTA 5JBCE 2WIIB 2A70A 1JMUB 2ZX2A 2VOXA 2EXHA 2QTWB 4J1XA 4OI1A 2F4LA 2XUMA 4G1MB 4RQPB 5A1LA 2YGPA 4PDWA 2HWB1 4N90A 4XUQA 1QY4A 4PIZA 5HI0A 3DV8A 4K21A 2A6WA 4CE8A 1GU3A 4CP0A 4R9CA 1XNBA 1I5ZA 1VRH2 5J98B 4I30A 2P3YA 2BMGA 4ZU4A 1W28A 1V1IA 5JOYA 1WMEA 1MS3A 4BTTA 1CIYA 1R093 4DOUA 1JZ3A 5C8CA 3UT0A 1UOJA 1DP0A 2G19A 1OLMA 4PLNA 3SHRA 3WDTA 1SFNA 3PTRB 2CL2A 3CL1A 1NFXB 3A23A 2RS12 1JYWA 1LESA 1G9FA 2IFRA 2LTNA 3AB0A 4NIAA 4LKEA 2PUQL 2XJVA 4AVCA 4CEYB 2J95B 4K7JA 2J34B 3KQCL 3FBYA 1LHUA 1RVF1 3OBTA 3VBSC 1QMJA 2A1XA 1GQPA 5K0UC 1SEFA 1AYM2 1WW4A 2KM2A 3CFWA 5A3MA 1SLBA 2FDIA 1BQPA 4LBQD 1CJPA 4S2HA 3SOBB 3SOQA 3KD4A 4E2QA 1C1LA 1RUE1 3VBSA 5C3SA 3QOPA 1O5LA 3PJQA 1VBA1 3S7IA 1PGL2 1OKQA 1W8WA 5FYCA 3IWZA 2RS51 5K0UA 5A80A 1POV3 1Q8OA 4Q0QA 1YRZA 3UJOA 1JU4A 2FLGA 3N8ZA 1UIKA 1YUGA 1GUIA 2RHPA 1HRI3 4Z0KB 1ND2B 1Q8VA 4QKBA 1IS6A 2WNEA 4CVUA 2WL1A 5FZIA 1UU6A 3A0KA 1GK5A 4QX7A 1I1EA 4CDWA 2E7TA 1CAVA 2EF6A 3LN0A 4F3JA 4EN7B 4EN9B 2W39A 3ZXFA 2ADEA 3ZX7A 2ET1A 4LO6B 1LGCA 5IVYA 4UFMA 5FLHA 2CTVA 2VQAA 2KR2A 3J8F1 4MZUA 4HZFA 3ACHA 3WNOA 4ATEA 4CDXC 1HAEA 2GP5A 2WN3A 5JMCA 3HT1A 4HMZA 2WWSA 1WBFA 4RS5C 3RGBA 2OPWA 3VBUA 5L36A 3LTFB 5EJ1B 1UMZA 2D6KA 2GNDA 4KQ7A 3N9PA 3VL9A 4CDUC 4OHYA 1W0PA 5J36A 1LOFA 4E2GA 4ES9A 2WFF1 4NWVA 1HV0A 1ZREA 4FPCA 1APOA 1KRIA 1VRBA 5IK5A 1NZCA 4NAOA 4CDUA 1O3SA 2YBPA 3AZXA 4LBQA 1K42A 2BNMA 3M36L 4Y6DB 3D0SA 1W8BL 1VIWB 2VPVA 3EMRA 4NHXA 2YG0A 4PI2A 2ZKNA 1A6CA 4JRLA 5FMDA 2FLBL 2CV6A 3I2IA 1OA2A 2R042 2JJLA 2OVUA 2GNBA 1EAH3 4F83A 3I2HA 4CDQC 3LDBA 4QXKA 1N1TA 2WNUA 1COUA 1P0SL 1DIWA 1HT8A 4BM8A 3TYJA 3UJQA 1VRH1 2A75A 3MV01 1RUI3 5F1AA 2ID4A 3WW2A 3ZIXA 3BI3A 2V4VA 3WHTA 2D7FA 2HWD1 2NN8A 2ZMKA 5DZGA 3HNMA 1GZ9A 2UY9A 2VOTA 4IEYA 1O8SA 1LR5A 1UN1A 4IV3B 4Q4X2 1DX5I 2YYOA 3OB8A 1AUTL 3ZSKA 2JG8A 3U14A 2RS11 2YZ4A 1S0DA 3D5OA 5IVFA 4URAA 2B7YA 4P02B 4CU8A 3GCXE 4K8FA 4PIXA 5HBAA 5LEKA 4Z92B 4KWLA 1OBNA 3THPA 2DYCA 1RB8G 1GNYA 3VZMA 5A3OA 4LO5B 4C16A 1AYN3 3WOGA 1MPXA 1IS4A 4HK8A 4UFJA 4Q29A 1AYM1 2QDRA 2YBKA 2OUHA 5LRRA 5SV5A 3N4MA 1UYYA 2K9ZA 2J1TA 3TNQA 5F1RA 4Z0LA 3KHBA 3HQXA 5CG8A 1LHVA 4FPFA 1PGL1 4COUA 1NAEA 2VJXA 3SH3A 3ZIWA 1EPIA 5FY4A 2VTFA 1ASJ1 2VH9A 3U75A 4XMIA 3GCWE 3ZXGA 5JSOA 1PRHA 1CD3G 1ZRRA 2PHTA 4Y4YA 1EMNA 1ENXA 1RGSA 1SCSA 4D0FA 3IM0A 1LULA 3TAYA 4AHWA 4N43C 5FPVA 3WINE 4A4AA 2D1JB 1IS5A 4LA2A 5FYIA 1HX6A 1SPPB 2EIGA 1X33A 5IJRA 5EGMB 3FE5A 4DIQA 1O6UA 4XXPA 4CCLA 1LODA 1PO12 5FDBA 4JDMA 5I8TA 1R092 2W95A 4KWKA 4F8AA 1F7EA 1UCXA 1AUYA 2DVGA 2Q1MA 4NUBA 1GFF2 3HQUA 4QX5A 5F3GA 4CCDA 3MF6A 2JD4A 1JW6A 1YEWA 3NAPA 4IERA 4UYBA 3KLSA 4XUPA 1XOYA 1RHI3 1LHWA 5GZEA 1VBC1 2FDJA 3U4SA 3R05A 1BCXA 2XC0L 1G9AA 5B4NA 2DF7A 2AZ5A 4W8JA 4XJ8A 4TYSA 3ALQA 2OQ6A 2AYLA 3IBMA 2GZWA 2R041 2SBAA 2VMDA 2W9XA 4J1WA 4Q1RA 4YW5A 2QNKA 1GWLA 1YQ2A 4QHZA 4XDPA 5FZOA 2XWJB 1U0AA 3KF3A 1EUTA 4URTA 4Y4RA 4E8CA 3NKGA 2XC4L 3OBAA 2GNTA 1PVXA 3AL5A 1H8VA 1RUC3 4PHZA 2CAUA 4Y20B 3N36A 1PK6A 2XJUA 4O61A 3NW4A 4GH4C 2BRTA 4EQVA 1Z7S1 5L19A 3NNLA 2WQ4A 5LWBA 3D82A 3OUIA 5BPXA 3POGA 2P5BA 3SISA 4Q4X1 1DGWA 5FO8B 4QPWA 4BQ5A 4NRQA 2JB4A 4A41A 4C90A 1SBFA 1A3PA 3OGVA 5EP9A 4GH4A 3USUB 2ARXA 3QD6A 4Q26A 2WYJB 2QQIA 4Z2WA 5C9AC 1B35C 1BK0A 1TME3 4MXWB 5FOJB 1O7FA 5I0DA 1NCRC 1OD3A 1WUVA 2MPFA 3EHKA 3H8OA 2W94A 4Y26A 5CG9A 2Q30A 2MHPA 3P3PA 1OFSA 1AR63 3DPRC 4P9GA 3T1MA 5GLVA 4HT1T 4O7XA 5C9AA 3GGLA 2CDPA 2ZEZA 4Z07A 3GF6A 2ADDA 2E31A 2VZQA 1W0NA 1XYNA 2CWSA 5A6YA 3MZHA 2VE1A 4XHBA 5HV4A 1LQDA 1YYNA 4C1XA 1EV13 1GSLA 3DPRA 4IE7A 4KG0A 1EMOA 5JVYA 4KU8A 5FYVA 3T3YA 1ZRIA 3E6CC 1QJU1 1RJ8A 4MLOA 4ZZ5A 1G2MB 4AYUA 2VNVA 2HH9A 3APBA 4BDWA 2RDSA 3BPZA 3CHXA 4JGZB 5FJKA 2V5YA 4QX0A 5CFCA 4LBOA 4CSYA 4AEKA 4BQ4A 5IVBA 4ZKTB 5T3NA 1YI9A 1KJRA 1ZYBA 4TXWA 3MIFA 1K5MB 2VUCA 2RVAA 4Y5Z0 1EAH2 1YLLA 2XQRA 4FAHA 2ADXA 5F5QA 3OGJA 4WM8C 2WG3C 2PHDA 4XUTA 4INDA 4L8QA 5FAXA 1D4VB 4Q4V3 2Q4SA 5F5AA 2JDPA 4PBOA 3AKTA 2FD6A 1RUI2 1VMFA 2DVBA 2R1BA 2XJTA 3IKWA 3NKTA 3OY8B 3Q8CA 5D8AB 4CCKA 1R091 2C24A 1BHGA 3RMYA 2XVKA 4I01A 3NJPC 1Q8SA 5KHHA 3T2TA 2ZA9A 3TK5B 2Y8KA 4AEDC 1R64A 3URFA 5JI7A 3ATGA 3I8TA 5BNNB 4K40A 5JVVA 3DEMA 1RMU3 3R4UA 4NPRA 4RR3B 2DDUA 4Y22A 3VDDA 1QNWA 1W2AX 3H1YA 4AEDA 2VZ1A 2E63A 1YFUA 5IKVA 2B9VA 1RUJ3 1AYN2 3BOWA 4DXZA 5JUVA 4Q0VA 1S55A 2A5ZA 2NMNA 1HIXA 1N47A 1ZVFA 1W6QB 3AVSA 4Y76B 3NSTA 4LBLA 3KT7A 1Q4GA 3LEIA 2VC9A 4N9HA 4UFHA 1S4CA 5FZFA 5JMOA 4LKFA 1LHNA 1CAUB 2DUPA 2YPJA 3HMYA 1HX2A 4J6GA 4IEUA 3RDIA 2FLRL 3N9NA 4BQYA 1BEV2 2DCYA 1BBT3 1NLQA 2H0BA 2CDOA 1POV1 3D3AA 1UWWA 3E6BA 2W2NE 1HRI1 3AZWA 2XVGA 2W5FA 4YM3A 3NTBA 4YGEA 1L7RA 1O3QA 1DGRA 3I97A 4AWDA 1FX5A 2GU9A 4YLZA 1ENSA 3M4FA 1MQ6L 1Q8QA 2GC1A 2JB8A 3ETQA 3MW4A 4OULA 4XFFA 1H2NA 4LXLA 4EZHA 3B01A 4BMBA 2B8MA 5DABA 5CFDA 1PM4A 4OHVA 5HXMA 5L7OC 4I02A 4RGKA 5E8DA 3J4UH 4WVMB 2DWRA 3FUQA 5JZGA 4NVPA 3NNJA 2JDKA 4NJ4A 2H9EL 4QD2A 5FYSA 5FZAA 5A3LA 3W21A 3LFMA 4LIVA 3ZM8A 4DEVA 2P93L 1IOAA 1U67A 1YIFA 3N9OA 3T09A 2Q8CA 3OGGA 4ASMB 4L99A 5IW0A 1MACA 1RHI2 5JOZA 3JB4C 2VZTA 3KM5A 3WQ0A 2CJIB 5C33A 5FMBA 2P6CA 3ZYFA 4XTMA 3AMQA 1UZ0A 2HEYF 1BZWA 1DLCA 2E26A 3U4XA 3Q8AA 1FMD3 1N1YA 2YU2A 2F6BA 3Q8FA 1EAH1 4LE4A 1IP0A 1HDKA 2VNGA 3H50A 4JGYB 1BJQA 4MGQA 4B4PA 1BVP1 5KXCA 5FXXA 4K1YA 2HWC3 4IEWA 3ZXAC 3LTGD 1Z0HA 4M4RA 5LY1A 3V0BA 1DFQA 3POSA 3I54A 4R4ZA 3LCPA 4MXWA 3AP4A 1RUI1 2XDVA 4QX1A 2E33A 1JZ2A 5FZ7A 2BNOA 4IEZA 2OYEP 4Q1PA 2HBTA 4L92A 1S0IA 2O1QA 3WF3A 4FOYA 3HJRA 3ZXKA 1R1A3 5KC6A 1CONA 2BFUS 2KNIA 3LQCA 4AVSA 4BJ0A 4LTAA 2D44A 3IMMA 4IGQA 5I8YA 3ZFFC 5A7SA 4CEWB 2WSVA 4V2VA 5CBLA 1TME2 1CIWA 1V70A 3AM2A 3EYPA 4LHLA 1UU4A 1D2QA 4CUAA 4PQ9A 5KN5C 5L9VA 1AYN1 1QIQA 2C6SA 1AR62 1OOPA 2VNRA 4MMXB 3AKQA 1BVVA 1UX7A 3EO6A 4XC9A 5FLJA 1OUSA 1JUIA 3WHUA 1K5MA 3H42B 5FO7B 5F37A 1SFYA 1D2SA 1BEV1 1AJKA 3N8XA 1CVNA 1EV12 4FP2A 2XKOA 1AR82 1TZOA 2HOXA 1O91A 4G4FA 1PGW2 4ZXEA 4N7IA 2FD8A 2DUQA 1YXWA 2GMEA 1LMMA 1O5DL 2FCUA 3E6DA 1UMHA 3VBFC 5J7MA 4D7YA 2R063 1FJSL 1VBD3 3A4UA 4QB2A 3RG0A 3S7EA 4B3NA 3DF0A 4LO7A 1SLCA 5EYYA 1FNYA 4BQ3A 1XYPA 4RFRB 2VMIA 1KQRA 5L73A 4XMAA 2XMLA 5FQ0B 2QQKA 4NE9A 4Q4V2 1JZ8A 1L7QA 4UW3A 3HIFA 3L9JT 3NV3A 3H1MA 1AX1A 1OVSA 2JE9A 2HWE3 2A71A 4JTNA 1C3HA 2EIEA 3KSCA 1K12A 1C5HA 1WW6A 5CIRA 2Q8DA 5JI9A 2VMEA 1GWMA 5FK7A 3GZTB 3UYJA 1QJY3 2NM1A 5EPAA 3IITB 1W9SA 4GALA 4YG6A 5FYZA 1OQEA 3WF1A 2IXJA 3TEZA 3FFGL 3T4VA 1AXZA 4IV1C 1CN1A 1RHI1 2VBPA 3IAPA 3W9AA 1GWKA 1RMU2 3D8CA 2XHNA 4WVWA 5IVJA 3T4HB 3OBRA 1RUJ2 4BXFA 2ATFA 1CPMA 1S0FA 2RJ2A 4DS0A 3CZJA 5SV8A 1CEJA 1UZWA 2AACA 3OOXA 1QF3A 1HAFA 2ZGUA 2X8KA 3SCHA 3VKFC 3N35A 1UZJA 2R0HA 2VCCA 1RUC1 3UNPA 4ZHNA 4A45A 2WYSA 3VD4A 3CNAA 1NA1A 5FYTA 4OI4A 3THDA 5EQUA 2WNOA 1WBLA 3ACIA 2VL4A 3PLQA 5GKAC 3MLKA 1UYPA 3ZYHA 3BTZA 2VY0A 1SG3A 1QKQA 2UY8A 5A3PA 1FF7A 4GU4A 1UY4A 1REEA 5DG1A 3B94A 3GNEA 4O9GA 3ZR6A 3O0XA 1R082 1NXMA 5EWSA 4F7ZA 4HVQA 3ILNA 4IW3A 1PMIA 2YHJA 1D0GA 1TME1 1QNYA 4ISQA 3N8YB 2FQPA 4ISRA 4B4QA 3SOVA 3AK0A 3C7GA 3MICA 4N7UA 3WVJA 4RA0A 1AR61 4XL1A 3KRKA 1ZBA3 4UW4A 2CGOA 1WU1B 4FSJA 1XPWA 3MIDA 3IIIA 1GZWA 3AJYA 4A2UA 1YFXA 1UX6A 3ZFGC 2JIGA 3MFCA 1HB2A 5ABJC 3LEKA 1EV11 4BXWA 2VJ3A 4JTOA 3ZR5A 1PGW1 2VD7A 1Q8PA 2J1SA 1ND3C 2Q1ZB 1H2KA 1NG0A 1J58A 1FAXL 4ZS2A 3OLTA 5FDQA 2OS2A 1YQ5A 4L2NA 4OMCA 2JECA 3AMHA 1OKOA 3JQXA 1UXZA 4YGBA 1BMV2 1FMD2 4K8RB 4UBHA 1ND3A 4XIOA 3LPFA 1KD7A 4BDVB 4CP9A 2BPA2 1N1IA 1QOSA 5E6HA 4CP1A 2VVFA 2HWC2 3JUUA 2RMU3 4Q4V1 3ENSA 2E7QA 2WQZC 2WQ8A 3C2UA 3G6JB 4YZ2A 4J25A 1C5MF 1UXXX 3U37A 5C4WC 3RWKX 1VP6A 4LLFA 4QDSA 2B9UA 4XE9A 3ZDVA 3UKNA 2A7AA 4FOVA 4I09A 1W8NA 3LAGA 4UW6A 4FI9A 1YIPA 3O1UA 4LT5A 3ZFEB 4NPLA 5DUWA 2FDGA 4BK4A 1LPKA 1R1A2 4MX3A 3F95A 1B9WA 1DYPA 4IUGA 3S5QA 3VBRB 5H9SA 4LOSA 1HREA 1H8TA 4CUGA 1OH3A 3OJBA 1QHDA 1RMU1 3MHZA 2K2TA 3POJA 1Y3TA 1SMVA 2WUHA 4UFIA 2BOUA 4WM7C 3OD0A 2NPIA 1A34A 2YMZA 1HB3A 1DF0A 1RUJ1 2B42B 4SBVA 4H2AA 4LKDA 2H0VA 1V6KA 2DFCA 3E5UA 3GHMA 4V1PA 4O02B 4COVA 1CWPA 5FY5A 1XC6A 3WG2A 4META 3WT3A 5DAPA 4EN0A 1XU1A 3EB7A 3DYOA 3VD3A 3POEA 1BBT1 3NNGA 4PLMA 2BTVC 3VBHB 1UAIA 2E53A 2I45A 4U2AA 1HB1A 2CNAA 1YI7A 5IFPA 1KSNB 2ZZQA 2RR13 1OURA 4FCAA 4HETA 4QPGB 1G9DA 1M1XB 4RRYA 4OHZA 1ULPA 2VZ3A 3K75B 2R062 1CCFA 2JE8A 4QHBA 1VBD2 4GULA 4I2OA 4XBNA 4CU9A 2A3XA 1OSGA 3PDQA 5TSWA 3VD5A 3U11A 3MQEA 1NCQC 3NNFA 4YW3A 3FCSB 2OUJA 3HQRA 5K9YA 3N9QA 2AUYA 3N8WA 2GH2A 2A6ZA 1O59A 3I2KA 4AVBA 1REFA 2BERA 4XUNA 4JDNA 1IQJL 3RZHA 2RJKA 1PZ9A 2HWE2 2JG9B 1NCQA 3OPTA 4QPIC 5T5PA 2J4IB 1KJLA 3JBG3 1ONAA 1ULOA 1FPN3 1D7PM 2VTXJ 3EBRA 1GICA 1POV0 1ULCA 3ILFA 3I4IA 5AC93 2GSYA 2ZTNA 1BYHA 5I91A 4XAEA 1JN2P 2J42A 4XXAA 4XFIA 1EQHA 5ERLA 1Z6CA 1W9TA 3HAGA 5LBFA 3FLTA 3AJZA 1Q3EA 4XQDA 5FXZA 2BQ6A 2XLAA 2ZEWA 2O14A 3GHNA 1JOBA 4AEJA 5IAXA 1FMD1 3WQ1A 1BMV1 1IPSA 1GNHA 1RUF3 3O1OA 1JOJA 4HSJA 3EQEA 4LUMA 4M01A 4HKLA 4CUBA 1BLZA 2HWC1 5B2GB 3NRUA 1CX1A 2YPDA 2YROA 1ULFA 5K0HB 2DUOA 5DQ0A 2BQ7A 2RV9A 4TSVA 3N8YA 2P4EA 1U8CB 1PFXL 3LC3B 2ZABA 3L2HA 5DMYA 2B5HA 3NO8A 2DBIA 3TEYA 2W2ME 5BNPA 2JDHA 1U5IA 2ZCWA 4NO4A 2QE3A 1LU1A 2WWUA 3AKSA 4L9BA 3K3NA 3IDBB 3AYDA 4NGAL 5FZEA 1R1A1 5JXHA 5LA2A 1WCUA 3IJEB 4FOWA 4M0HA 3KCXA 1F5JA 3GBGA 1VBA2 1PO23 2ZGQA 2AH2A 2PYTA 4GMP3 3VV1A 3MIEA 5DPNA 4B1LA 1HJGA 3B00A 1CQ9A 4X8SL 1VBE3 1ZBA2 4QQPA 5DXDA 5E89A 4AGVA 1YQ8A 1QFKL 2VVEA 1IQHL 1WA4A 3O1VA 2NP0A 5DG2A 3HO3A 1H4HA 3R6SA 2G4IA 1M06G 4QKFA 2XJPA 5JWPA 1SACA 3O1SA 2XBXL 5DAXA 1PX3A 4FOQA 5A3UA 3KMHA 3VKLA 2FDKA 2HORA 2D3SA 1EQGA 2LS6A 1W6PB 1XE0A 5FZLA 3HN1A 3OD4A 5JPNB 2ZPXA 3H0OA 3KL6B 1RTVA 2R061 1ATBA 2YBSA 1XSRA 3F2ZA 4QKDA 1VBD1 3K9XA 2RDNA 5DAVA 5EFUA 2O0OA 3RQ0A 2J94B 1J3PA 2ZHMA 3PU8A 4XUOA 1JZ6A 1WCDJ 3AMNA 1QJFA 4LOTA 2ENRA 1QQP3 1LAJA 5L30L 1S0CA 2OT7A 1JODA 2RMU2 4OI2A 2P16L 3W20A 3I3BA 4P9JA 1ST8A 4AVVA 5HV0A 2A3YA 5FCCA 1LK9A 4PDWC 5FY8A 1HB4A 4M3CF 1URKA 3ENRA 3QMOA 2HWE1 3DUIA 5JB8E 4DZGA 1EGFA 1ADXA 4XABA 5FP8A 5GLWA 2G00L 2DFBA 3HNBM 3N8VA 4P9XA 4NIIA 3N7MA 4CDQB 3VKMA 2P17A 1H2MA 5BNOA 5FYYA 1X82A 1W8FA 4FPOB 2XBYL 5C8CC 1S0GA 1YUKB 2J1RA 1C8NA 2Q5TA 4Y7BB 1OQDA 1QDOA 2X10A 4NIGA 1J83A 2DCTA 2IWGB 4OTYA 1Z78A 4QPGA 4XCBA 2HWD2 4UWDA 1I6XA 2RE9A 1WA6X 4CU7A 2R073 4XDOA 5EJZB 2XJRA 3CDZB 1AR93 1OPMA 1AL23 1IVOC 4XLWA 1RXGA 4N53B 2ZGPA 4BQ2A 2YB7A 1GR3A 2EAAA 1RUD3 2Y0OA 4M3CA 2F9BL 2WFTA 2F17A 5E1RA 1LPGA 3ABZA 5I93A 1BKZA 3C3VA 2ARAA 4GWNA 3UKTA 3KT1A 3T30A 1KDKA 4GB33 2A6XA 2RR12 5FP3A 4YPJA 3TN93 3ZSLA 2JG9A 2C1FA 3GZEA 3N3HA 1YWKA 3ZXEA 1F5FA 1JOPA 2J38B 1EPHA 5HCHA 1I9RA 4AL9A 2HEVF 4CRQA 2H9EC 3DCQA 1WGPA 3IT8A 3P3NA 2DCKA 1NPEB 3CEWA 4PCRA 4HN0A 5IAVA 4CDWC 2BVVA 1OT5A 3WG3A 1IZ3A 2UWAA 3WDVA 4XQ4A 3SKVA 1KLIL 1R1ZA 1EPZA 1ASJ2 1ZBA1 2PHFA 2W1UA 5J3UA 2QQLA 2YV8A 1F7MA 3KWVA 3M3CA 2GC3A 3JBG2 4NRMA 4N43B 1F4HA 1FPN2 1VPHA 3WW4A 2D43A 4Q4Y3 1IKPA 1VE0A 3VBUC 4JDOA 5D21A 2XOMA 2I9BA 5AC92 5DAWA 1Y43B 1MZ6A 4NIHA 2OKXA 3RZLA 3TB0A 2OX0A 3VBOA 1V9U3 1LOFC 3CMGA 1LNSA 4TLGA 4EZ4A 1UZKA 1NOVA 5L2ZL 1W39A 4K20A 2JDNA 1UMIA 5A7PA 3TK6B 4UF0B 3VKNA 1F4AA 1RUF2 2WPIE 2V4AA 3V56A 1CAWB 3AP7A 1NFYB 1OB1C 2MEV3 3POIA 1PGEA 2RMU1 3A22A 4XF4A 3D6EA 3ZXLA 1PM7A 5EZWA 4YVWA 1MQTC 5FPUA 1VBC2 1GBGA 4LORA 1NUKA 2D93A 2WNUC 1VALA 2Y33A 3CJIC 2WYFA 4YRDA 5I0TA 1JYVA 1GOFA 3KS7A 3ZYPA 2X5IA 5FXVA 2OYUP 2VWNL 2O8OA 4DXRA 5KXDA 2BP6A 5L9RA 1P9JA 1ULEA 4KNCA 1JH5A 1MQTA 3F1SB 4YW1A 4YYOA 4BK5A 4N8MA 2FCVA 4AQ2A 2JDMA 4XJ9A 4CCNA 3MLLA 4DXTA 4AGGA 3LF7A 4B29A 3CJIA 3OYWA 2WNVA 3ACGA 4ET7A 2ZX4A 2BT7A 1WD3A 5GLZA 4YG3A 1W8ZA 2JG8C 2JDYA 3X29B 1PO22 5T5LA 3HBZA 3CQOA 1CZTA 2WA3A 4QHOA 5LY2A 4YNIA 1Z7S2 1W90A 1ULGA 1VBE2 1XNDA 1EZQB 4MXVA 4A6SA 5FMOS 3NJVA 2VZVA 3BB6A 4B1MA 4AG4A 2XXZA 1XKAL 1B35B 5C6CA 3BIWE 1RUNA 3U7UG 4WBBA 1NCRB 4AFMA 3I3EA 4IEQA 4JYUL 2Y6JA 3RZZA 1ZA7A 1CAXB 1L5GB 2ZGLA 3NJZA 4OYUA 4TGFA 1O4TA 2RR11 2WFXB 4LUKA 1J9CL 4UFKA 4AHXA 1MS1A 5JAXA 1JYIA 1OLME 1PGSA 3DL3A 4ZXKA 4COWA 3ZKYA 5JR2A 2Z4FA 4IEVA 4MGIE 4R52A 1FYUA 4M3CE 3I3QA 4RQPA 2I74A 5I0SA 2ZHKA 5A1FA 3M70A 4Q0PA 2B4KA 4LNVA 1QQP2 2BWCA 3JB8A 1ATEA 1SLLA 1LMJA 1QJU2 1XQNA 1CESA 4A94C 5FKBA 2C4XA 1JHJA 4RS0A 2WT2A 2YGLA 1GP6A 1Y9GA 5L2YL 2DV9A 3U78A 1PZ8A 3KGLA 4DPNA 3Q3KB 2D6MA 3JBG1 1FPN1 2RJLA 3ON7A 1KDMA 4GU3A 1APNA 4QKNA 4ZXYL 3VD9A 5KC5A 4WM8B 1J59A 3HWJA 2QQOA 4CPBD 2BGCA 4Y33A 4CEYC 5AC91 1GQGA 3DXUA 1S1AA 2DTWA 2DCZA 1H2LA 4NN0A 5EIYB 5JR7B 1C8M3 2AR6A 2J7MA 4Z82A 1KITA 1IGXA 5JCTA 3I59B 1W3VA 3NAPC 4D0EA 4PI0A 4FO9A 2QDNA 3M3EA 4CEYA 1DDXA 4COYA 4XFAA 1RUF1 2V5DA 1G1QA 1OF3A 4NMIA 1ZRDA 2EIDA 2R072 3ZKUA 2WWJA 2XB6C 2DVAA 4LK6A 1AR92 4QWNA 5KHKA 1AL22 3FN9A 1IOXA 3CF6E 5GZGA 1IQML 1DZTA 1RUD2 3K3OA 3WY6A 1OA3A 3MF9A 2P28B 3PMSA 5FP4A 3J9SA 3L2YA 3PUQA 4AHYA 5IWFA 4CP2A 2VVVL 4ZZ8A 2PAKA 5FKCA 3T2QA 4XFCA 5KXEA 4GB32 1TNFA 3J7HA 3ME2A 5JIUA 1ND2A 3UESA 4KBBA 1VAMA 3M37L 3TN92 4IE0A 1PK6C 4QAWA 5FZGA 3QACA 2BOHA 3FZ3A 2GC0A 3QLQA 3O1RA 2R49A 5IK7A 5FYMA 3WF4A 4LE3A 3NQHA 3ZYRA 4CPBA 4AFDA 1PO21 5FXWA 4GMP1 1YJLA 1VAVA 4GIQA 5KIRA 4LR4A 1T6BX 3T2OA 4CXXA 5AVPA 2P3FN 3RZGA 1QXJA 1HN0A 1PZ7A 1HRI2 1VBE1 2AC1A 5LBCA 3MGUA 4QU2A 3TGFA 4ZONA 1IQDC 4RL7A 1W8UA 3ELNA 5CKQA 4XF9A 1Q56A 3D0JA 3VDBA 3WNMA 4Q4Y2 1V00A 2QZ2A 1MS0A 2J1UA 1WLCA 1E5HA 3B9IA 1SLTA 1W8TA 1HXS3 2R16A 2D6NA 3BGAA 1L3YA 1V9U2 1Q5OA 1IKQA 5I46L 3KQBL 3ASIA 3OCPA 4JV4A 4OVEA 4BLIA 1YUDA 5IK4A 1LPZA 2WSUA 3I2GA 5IVCA 5GZDA 1W0OA 1S2EA 3WSOA 2ZS6B 3V0AB 2YGMA 1X36A 3AXDA 1WMFA 5CFCC 1NE6A 2F4PA 1QQP1 3KHCA 2MEV2 2B46X 2XWBB 5FZ0A 5HXVA 1VB4A 3LD8A 2WLPA 4IV3C 3BTAA 2W3KB 3CS7L 4XFBA 4XF1A 4MO3M 3Q7DA 2HKXA 4FBFA 2KXLA 2P2KA 3OPZA 5ACA3 3LDRA 1IS3A 4LIUA 4Y5SA 3SEEA 3S30A 3N9LA 4IV3A 4HONA 1DZRA 3U1XA 4M0NA 4BB3A 4K3UA 4D7SA 3H9AA 1OXCA 3HO4A 1UQXA 4P5HA 5LBEA 1CX4A 4ITCA 4AI8A 3C7OA 3HT2A 1PNFA 2PHXA 2VQUA 3WDXA 3VHPA 2WS93 1GLHA 3WW3A 5BNQA 3ZSEA 2ZGMA 4XJUA 5DN2A 2ARBA 3S6PA 2R071 4XQWA 3RYPA 1TVGA 2VW1A 3VDDC 1AR91 2PR3B 1AL21 3ES4A 1QU0A 4HPKB 1RUD1 4BTUA 2VU9A 1M4WA 3MIBA 2DTYA 2W1QA 4IEOA 3ZFFB 4DQAA 3VUOA 1X8MA 1D4M3 4CSWA 5FPZA 3IN9A 3PHMA 2ZZJA 5FUPA 3WNKA 2EALA 1GANA 2I2SA 2VOKA 4GB31 4PQQA 1U5ZA 4UOJA 1FAYA 1F0SB 2P1BA 2XBWL 2BJSA 4LHKA 3TN91 3UGFA 4FTSA 4ATFA 4NIDA 2Q0AA 2RDRA 1A8MA 1OC1A 1QXRA 1EPJA 2VMGA 2VMCA 3MEPA 4LBKA 1JBCA 2Y6GA 3HNYM 3SNMA 4A7IA 2OQ7A 5C3PA 2VO5A 2Y64A 3IMNA 4XF3A 1YHFA 1IGZA 2AENA 2NQYA 2QBXA 5GZFA 4OMDA 3WDWA 1ZZ9A 4QM8A 3ZYJB 2R0FA 1W6NB 4X8NA 5JPMB 1SPPA 5CVRA 4AHZA 1XU2A 4XFHA 1NKGA 3SH4A 5CFDC 3I59A 1ZBE3 5FZMA 1W6OB 2P94L 5FZ9A 4A42A 2ILMA 3MIHA 1DQBA 4RHV3 4I0WB 2FBEA 3M1HA 1J1LA 4Q4Y1 3K46A 5A6XA 4Q8KA 3AZVA 4HKWA 3RWNA 3WF0A 2LALA 4AQ6A 3HBKA 3ZVXA 5HPOA 5JZGC 5FY9A 2YDEA 1UPSA 2D6OX 5KR7A 3NVCA 4FPGA 5T5OA 3ZOIA 2NPRA 1V9U1 3NWKA 2FDFA 3OGRA 4I3GA 1DCSA 3AMPA 4DRRA 4ZHAB 3AP5A 1W2UA 4JHTA 2XJQA 3C9AC 3B93A 3RRDA 2BFUL 1UY2A 4WV8A 4QGNA 3BT1A 2R6QA 4QB1A 2MEV1 1TEIA 4DB5A 4IE6A 4IV1B 5C3QA 2UWLB 1PNGA 4C8DA 3POBA 5AVAA 5FV3A 5J96B 5LB6A 4AR2A 3DXTA 4FPJA 4Y20A 1WMXA 4JVAA 2VCBA 1WCKA 4H7MA 4YZ1A 3PUAA 1WD4A 3WP6A 1TMF3 5APAA 5B4XA 3RJ2X 3ZSMA 3MUY1 1IG0A 2W2PE 2VM9A 2VULA 4OQ8A 3MW3A 4YZ3A 4YSFA 1AHSA 2UWCA 1DG6A 1EP0A 2O8QA 1ENQA 5DZFA 2BBVA 2W0XA 4LA3A 5FYUA 3KV5A 4PF5A 2BYVE 3USUA 4BU2A 1LHOA 1W8OA 3ITQA 3HS7A 4GJZA 4C1WA 3PVNA 1RUC2 1SCRA 2W92A 1SZBA 1COV3 5F7UA 5F2WA 1XE7A 2VTXA 4IESA 1UKRA 4FT8A 3O12A 2LRPA 2YU1A 4OTJA 1ATAA 2OPKA 2IXHA 2W1WA 2ZGTA 4CYDA 1JL9A 2CGPA 1WLTA 1QIUA 1KS5A 1YUFA 3R4SA 1OOPC 2XQXA 3PJYA 4QQLA 5LW9A 3HS5A 2EA7A 1HXS2 4B7EA 2W2OE 3TRSB 1K5MC 1GNZA 4LEJA 3WNPA 1UZZA 4JGZA 4BQ1A 1NLSA 2W87A 5CISA 3WNXA 1KGYA 2WT1A 4AGRA 3WCRA 1DGWX 1W6MB 3ZFGB 4UAPA 5ABJB 1UOBA 1HN1A 1W9WA 1G2LB 3S6XA 4V2WA 4YM1A 4FTEA 1SDWA 4AF9A 1BF9A 1QDCA 2Z69A 4S2GA 1NT0A 2Q8EA 4AVAA 2RA0L 3O14A 2VOVA 2G1MA 1T2XA 4X8TL 3KV4A 3LSEA 4GWMA 1FAKL 1IPJA 1SFPA 3VZNA 4BXSA 1N1VA 5A7WA 3ZN6B 1C57A 3OY8A 3A0NA 3NNMA 2QJVA 5D8AA 5FK8A 1MVEA 1Y7BA 5JBBE 3UV9A 4MOAA 2BEOA 4QDRA 5ACA2 5KWRA 4CXYA 1VLNA 3BKZA 4LKSA 5A33B 5FY1A 3AMMA 4AQSA 1H1MA 2LW8A 2AEYA 1RUG3 3B5LB 3LAQA 1ALYA 1DGRN 1FNZA 1W8HA 1X9PA 2LUWA 1LJ7A 5FPLA 2WPME 1MEC3 2WLQA 5G05L 5BNNA 1FV2A 4GD4A 3RSJA 1C8M1 2Y34A 4HVOA 4AI3A 1ATDA 1U5XA 2EVXA 3BPSA 3K4AA 4RR3A 2YFZA 3WD5A 5FZDA 4WZCA 4GA9A 4AVTA 1ODNA 5JXJA 3PL0A 4Y1UA 1DQ5A 1KXGA 5BV6A 1YC61 3B02A 3RPQA 4A3ZA 1W6QA 3VHRA 4BCUA 1HRV3 4QPYA 1TPGA 1CAUA 2WZPP 2XLFA 3OTFA 1G1TA 2WO1A 2BOKL 2DBNA 2P6HA 2WPJE 1CQEA 1HZ8A 2YFUA 3DKWA 4KWJA 1KKEA 4WM7B 4XURA 1W6NA 4RFT0 3WR0A 4YVSB 2VUDA 1E5RA 3RNSA 5C3RA 3PUSA 3EJKA 4TN7A 2WA4A 4FPLA 4PF1A 4C0HA 5C3OA 1NA1C 3KCYA 1MVQA 1TNRA 3LEGA 3HR9A 3BN6A 4XJZA 4O65A 4LBJA 4NHKA 2OA2A 1VR3A 1WKYA 4PIYA 1G7YA 3PVBB 4M4PA 1BBT2 2JDUA 5FOBB 5FUIA 4MGYE 5FZKA 3W5MA 4XBQA 4PBPA 1OLRA 4WVMA 1ZBE2 2VZOA 2MHFA 3P1IA 1MS4A 4RHV2 4EWEA 1UZPA 2VVCK 1LOAA 1I5PA 3BVCA 1FOD3 4D6QA 4E4SA 5JSPA 5C71A 4DUWA 1LCLA 1HXS1 2IVIB 1VMJA 4O9EA 2PHRA 3T0BA 4DRVA 2CGNA 2W91A 1LB2A 3CKHA 3F6UL 2BZ6L 3R0RA 3BCWA 4QPIB 4BLJA 4X8UL 2FHRA 2VG9A 5LCWL 4I3PA 1K3IA 3BTXA 4TZDA 1XDTR 2UU8A 3BALA 1RUOA 2JEMA 2BQPA 2W3IB 3VL8A 3QH6A 3P6BA 4JGYA 3WEZA 2Y81B 1GZCA 1W06A 4GMP0 2EI7B 2FZ1A 5FLIA 1K37A 5JB9E 2I07B 1OQ1A 4IL7A 4P5YA 3DYMA 3VDAA 4DXSA 5LA0A 3M3QA 2K2SB 3KCGL 2GN7A 4GKXA 2YC4A 4QQOA 1HQNA 4M11A 1JYTA 2MNGA 4MG2A 1DDLA 1EAIC 1J1TA 5COXA 1TMF2 1MOXC 2W68A 3TZIA 3AL6A 3U07A 5ACA1 4CEWC 1G8WA 1UD1A 3JZVA 5A6QA 4MGKE 1YNAA 2BZDA 1CPNA 3IIAA 4XJWA 2ORXA 4LMFA 3AYEA 3E5QA 4KMQA 4R9AA 1S2BA 2BU9A 4XDQA 1O3RA 1J3QA 1D0HA 4ZXXL 4ORFA 5CB7A 4AOCA 4CEWA 2BW8A 5A1AA 4RGAA 4GWJA 2WS91 3Q8EA 3FHQA 1DQ0A 4EV0A 1COV2 3I2DA 1H8TC 2B39A 4AAPA 4JCKA 4AK3A 3RR3A 5T55A 2Z2SB 3TOJA 1NFWB 1UZVA 4WVZA 2D6LX 4OLLA 1CR7A 5FZBA 4CCJA 1LGBA 2Y6KA 4L0PA 3MDPA 2ZAHA 3LPGA 4FFIA 3BPSE 2WZ8A 2W08A 2Z42A 1W99A 5FY0A 3CIHA 4XEZA 4AE2A 2ZGOA 5FZ4A 3WUCA 2PA7A 2RM23 3E97A 3FC0A 3LWCA 3GISX 3LIWB 2VWOL 1N7DA 3IB3A 3NJXA 1AF9A 5E8AA 4K9SA 1W03A 2KL7A 3QH7A 4XHXA 5A7QA 4Q5OA 2QQJA 5E16A 3AP6A 4RUTA 5FQ0A 3QBQA 2KD7A 5FZCA 2WRAA 4Q0SA 2E9QA 4XPVA 1ZBE1 1O4YA 4LK7A 3ROUA 1ZNPA 1BK1A 4BA6A 3I3MA 4MMZB 4XJAA 2XBVL 4RHV1 2WYGB 1VRH3 4QX3A 4H3WA 4AW7A 2P3IA 2ZOEB 3QCWA 4RRWA 1MS9A 3EXUA 1RIRA 1HW5A 4R4XA 3PIGA 5J37A 2ZGNA 1E57A 4P08A 5GLUA 3EGFA 1N3PA 3HVDA 4PDWB 2YGQA 2OIIA 2XVLA 4ASKA 5FBJA 5IHRA 4YVSA 1DGLA 1LECA 3HOBA 3ZXDA 1SLIA 3FFQA 1S0BA 2B45X 2QQVA 1B09A 5IKRA 1W2OA 2VGDA 3RI8A 1V6JA 3AFGA 2ZJCA 4X8PA 4MMYB 3O1TA 3V65B 2BV4A 1QJY2 5FUNA 5C8CB 3WNLA 1HRV2 4O1ZA 4JRAA 2VW0A 4FVVA 5HCBA 3SITA 4AAXA 3S0MA 4FTBA 1TMF1 1DQ4A 1WCSA 2L9LA 5E88A 5ANNA 3LKJA 2PHBB 4GAZA 3KQRA 2CWMA 3S57A 2EAKA 3T0DA 4NA9L 1LEMA 4FFGA 3PMEA 2XBO3 5BNPC 5A3TA 4D90A 1KFXL 5F3IA 2PHLA 2R1DA 5T54A 3T2PA 4K1ZA 4OHXA 3ZLIA 2RNLA 4IGPA 5JVZA 3BYWA 4E4HA 5HCAA 2WZEA 4AZZA 3RZMA 1COV1 3WF2A 1L3JA 1XNCA 2QQWA 1I0UA 3CA7A 1LEDA 2CSGA 2HWF3 3VBSB 4CCOA 2VWLL 2GAUA 4CTEA 3KT4A 1X7AL 5K0UB 3ETPA 3MIGA 4BDXA 4CUFA 2G9FA 2GH8A 3MYXA 3MI8A 5BYNA 2BSFA 3LN1A 2LM3A 3V64A 4PH9A 4HXCA 4CDWB 1CAVB 5JBAE 1RL3A 2NLRA 1GYKA 3INAA 3N9MA 3PUHA 2K2SA 2YXSA 4MYEA 1JZ4A 1IQNL 2WPLE 2YGOA 3FLPA 1WLWA 3RI9A 1AXKA 3POFA 1FT9A 2VH0B 4NHYA 5DDJ3 2P34A 1UOGA 3MV11 1HQWA 4JZRA 3K4ZA 2Y6FA 3RFRA 1W3XA 1DBNA 2E7AA 5CEHA 3ELAL 3ZFEC 4XIKA 3ZSJA 1UY3A 5FPBA 4CUDA 2P3UA 1OA4A 3RZKA 4Q4W3 4RS5B 5C5TA 3J7NA 3TNPB 4D0QA 4CDUB 4LBQB 2UYBA 4BMEA 3U0ZA 3DECA 5F19A 1LOCA 4HL0A 1F8VA 5F8PA 3ZFEA 1RUG1 1EYBA 1IQLL 1RXFA 1IPKA 5F32A 1MEC1 4Q27A 3GALA 3VBRA 2QCSB 4BISA 2HYXA 4R9DA 4BQXA 2HEWF 4YW4A 5BNOC 2WNUB 3O0WA 4YGCA 3UKVA 4JZDL 4S2DA 3N7KA 4MUVA 4PT6A 5IYYA 4CXWA 3NTGA 1MR5A 5DZEA 3BUCA 4DINB 3SKJE 1QJY1 4JKKA 2R30A 3OSDA 4QPGC 1HRV1 4BZ4A 4AI2A 5JOXA 3TEWA 2EI6B 2JG8B 3JU9A 3C8XA 3TEXA 5D1IA 5H9RA 2I9AA 2DU1A 3VBHA 4HFSA 3GYDA 2RM22 4EWDA 2W26B 2ERFA 3HEIA 4D94A 4AFCA 4MGTA 3GJAA 1V1HA 1S2KA 1EPWA 1XNKA 2JG9C 3G7DA 4COXA 2ZX0A 2XUEA 4FPKA 2EXIA 2ZBJA 4OHWA 1UY1A 4YW6A 2EXJA 2VCMA 2Y80B 2W2IA 3LOIA 1CJDA 2BNNA 3FFZA 1HJFA 3RZJA 4JC1A 1IOEL 5A32B 5KBFA 2Y60A 3WW1A 3OUJA 3MDLA 1PO13 3GCXA 3OEAA 3QH0A 1AJOA 1FOD1 1MZEA 2H6CA 3V65A 2RG4A 2HYKA 4P9LA 3PNAA 3RYKA 2YY1A 5A7NA 1H6XA 4FQ4A 1KFUL 1ZM1A 3WXPA 1UW8A 2FCTA 1N3QA 4JYVL 5BY5A
chains in the Genus database with same CATH topology
5CKNA 3VZJA 2D3RA 1ZRCA 2ET7A 1DQ6A 4Q0UA 3NL1A 3VBOC 3M2MA 3B7MA 2D40A 3H3ZA 4NR1A 2VW2A 1RINA 5DUUA 1C5IA 2E51A 5FRAA 4BPZA 2XG3A 1RUH3 3VKOA 1EPGA 4YT7L 3NAPB 4OUMA 5DUVA 3WUDA 2JKHL 3O0VA 4ES8A 5FMOL 1H9WA 4YVWC 3ES1A 2WT0A 3TH3L 1RJ7A 2DCJA 4FPEA 3PGHA 1TLEA 2XBO2 3SXWA 4R9BA 2X5IC 1TQ5A 3IDCB 3ZO0B 2QFEA 1CVWL 4RGGA 2BUKA 2XL9A 3SCGA 2EI8B 1PVC3 1NYWA 2DU0A 1TOZA 2UWOB 2C0ZA 3WG4A 2HWF2 2WNVC 4QGMA 3AYAA 1PK6B 4Y1ZA 2VQ0A 3CO2A 2Y7ZB 2XLGA 1YO8A 4HBNA 3LOBA 2Y82B 4MVTA 3KCCA 4NOTA 4Y1VA 4GH4B 4C91A 2RM21 4S2FA 3P5BL 1W6PA 3KZ4C 4RS5A 4WVVA 3OLUA 4YG0A 1A3KA 3FLRA 5GLTA 5DDJ2 4QQ2A 1XXNA 1QJX3 4FXKB 2GMPA 3BU7A 4XBLA 5FPXA 1UZQA 2M74A 3AKRA 1NXD1 4P9WA 4K6BA 2J2UB 2P3TA 2DVFA 5C9AB 1FXZA 4NG9L 1A8DA 2KA3A 1UPIA 2PFWA 3GBFA 4HSLA 1IGOA 2P37A 4RQPC 5IK8A 3USSA 3DPRB 1RITA 2Y38A 3BOPA 5IKTA 4Q4W2 1O3TA 4KL1A 1NE4A 4ISIL 3SH5A 5CFCB 3CLPA 4AXOA 4CDQA 3NV4A 2AGSA 3LZZA 4H55A 2C9AA 4KH9A 4E4DX 2JX9A 2Z79A 2Y0IA 1OMIA 1H9PA 3GZAA 4M10A 1X50A 1FI2A 3LGRA 4N53C 3O5SA 5JSRA 1YFYA 4KGGA 3VHNA 4A7YA 4AQ2A 1AR73 1KLOA 4JAAA 2ES3A 4LULA 4N53A 1DZQA 4X6QB 1LOEA 1ZX5A 1G9BA 3VZKA 2W86A 1JTZX 4RD7A 4DNYA 1ZRFA 2TBVA 2VNOA 1BEV3 1URXA 2XKPA 4Y22B 3POWA 1IQIL 3VDDB 1CCVA 4AEDB 3DN7A 2QZ3A 5A32A 2XBO1 2OW4A 3WX5A 2D3PA 5CNAA 2QUOA 2V09A 1ND2C 2OZ6A 1WHEA 1VBB3 1O4ZA 5GALA 4CDXB 4HN1A 1NQJA 2HWF1 3H8UA 5CADA 1QH6A 3AYCA 5K8SA 2PHUA 2AREA 3ZN5A 1WW5A 4BTIA 3M3IA 4YT6L 3E5XA 4N43A 4IEPA 2FMYA 2K0GA 5BXXA 3OF1A 4FXGB 3THTA 2GMMA 1IQAA 3ST7A 1GV9A 1XKBA 3VZOA 5CFDB 3M3OA 4ASLA 2Y5GL 2WKKA 2JXAA 4A7KA 5DDJ1 1G9CA 1QWRA 5JZGB 1CAWA 3IPVB 1VJ2A 4FAGA 5JW1A 3ILRA 5L7OB 1VB2A 1RUH2 2MGPA 1LOBA 4Q4W1 1J3RA 3WQ7A 1YCIA 4PJYA 3WLUA 1V6OA 3FBMA 1MS5A 5CAZA 1PTHA 3WZ1A 1C4RA 2WPKE 2YUEA 1JUHA 4E2SA 4DY3A 5EJ3A 1G6NA 2A6VA 2JENA 4GXLA 1PVC2 2W52A