3SOBB

The structure of the first ywtd beta propeller domain of lrp6 in complex with a fab
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
305
structure length
305
Chain Sequence
APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/immune system
molecule keywords antibody light chain
total genus 77
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
B PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3sobB02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3sobB01
3WW9A 1IQNL 1G1TA 1J9CL 4BTTA 4X8UL 1IGZA 3N8XA 2Y5HL 2W8BA 1IJQA 2V91A 4C16A 1LMJA 1IGXA 3DASA 1NFYB 3LN0A 1YUGA 2QE8A 2FLBL 1C9UA 4NA9L 4MMYB 3CFWA 2BOXA 2WG4B 2WPLE 2UWOB 1C5KA 1F7EA 1EGFA 3DR2A 4GNAA 2Y80B 1LPKA 2W26B 1G1RA 2ISMA 2VWLL 3IAXA 3KQEL 5KIRA 1CRUA 2IVZA 2WYGB 3SOVA 2BMGA 2BQWA 1QLGA 3ZYJB 1IQGL 1ATBA 5GX1A 3R05A 4LORA 3O4PA 3HO3A 2FLGA 2FLRL 2P3FN 1CQEA 2Y7XB 3MDLA 2KB9A 5L2ZL 3V64C 1EAIC 1QFKL 2W2ME 5JBAE 1HJ7A 3OLTA 4Y76B 4D0EA 2FP9A 2ADXA 3TH3L 1ATAA 2GHSA 4IYGA 2FZZL 2GD4A 2IASA 3BYCA 3N8YA 5F19A 2DG0A 2Y7ZB 2W3KB 2IAUA 5E8DA 5GX3A 2POOA 4GN9A 2WFXB 5KN5C 3H5CB 4OTYA 1N7DA 4FM5A 2VH0B 2NPRA 3N8ZA 2J4IB 3IITB 4RRXA 1IQKL 1CX2A 5D9BA 5I46L 2UWLB 1LQDA 3HS6A 1YGCL 5JVZA 3LI3A 1V04A 4ZXYL 1FAKL 5JB8E 3KRKA 1FFMA 4HW6A 2GVVA 3KK6A 5JVYA 1MQ5L 3G4HA 3V1SA 3CA7A 1JV2B 3NJPC 3Q6PA 4PWZA 3ZYIB 3TZIA 2RNLA 3LI4A 3KQCL 2DG1A 2PHBB 1RWLA 2J95B 5JB9E 4XLWA 1YO8A 2XC0L 2FPBA 2IAQA 2XC4L 2W2OE 5EGMB 3M36L 2KV4A 1KLOA 2RHPA 3TC9A 5FWWA 4GN8A 4HHQA 1IOEL 1TOZA 1HAEA 2VVUL 2P26A 3FVZA 3LAQA 4GNCA 1KIGL 4D0FA 3HLHA 3OLUA 2IARA 1GK5A 5D9DA 1ATDA 1G2MB 2XC5L 2P28B 3K9XA 3KQDL 4CUDA 1UZQA 2XBWL 3FFGL 1X7AL 4YZUB 1RWIA 1FAXL 3GISX 2BOHA 1W8BL 1COUA 1G2LB 1EZQB 2I9BA 1POOA 4MMZB 4Z0KB 1Q7FA 5FDQA 4XL1A 2MGRA 2HQSA 4ZLRA 3DEMA 3ENSA 1EPIA 1CRZA 2FD6A 3LC5B 1DDXA 3AMRA 1F7MA 4BTUA 1IQEL 1IP0A 1AUTL 3HS5A 3NTGA 3P5BL 2MHPA 5JBBE 3HLIA 1ADXA 1DX5I 3N8WA 2PUQL 2EI6B 2Y82B 1M1XB 2IAXA 1PFXL 1G1SA 2BZ6L 2WPJE 4YT6L 2VWNL 2DDUA 2XBVL 3HRPA 3U0SA 2P3TA 4A7IA 4O1ZA 1KLIL 3KYAA 2K2TA 2TGFA 1IVOC 4ISHL 1EQGA 3HS7A 1UZJA 3WWAA 2W2NE 1CCFA 4X8SL 3BT1A 5D9CA 3U7UG 1JL9A 3KCGL 1WHFA 3N8WB 3PGHA 3Q3KB 2BQ7A 2IAVA 2P4OA 4O02B 1HAFA 1CVUA 4XBMA 1TLEA 2DSOA 1P0SL 1PXXA 3F1SB 1CQ1A 2YGOA 4RS0A 4M10A 4BTIA 1IQFL 1IQIL 1EQHA 1HT8A 4ZHAB 2P94L 4GN7A 4Y79B 2D1JB 3A9HA 3S2KA 2VWMK 3LTGD 1HRFA 1HX2A 3F6UL 4NGAL 1B9WA 2G8SA 1XFEA 1IQLL 4Y71B 2J94B 2W3IB 2H9EL 2J2UB 4COXA 1OB1C 1P9JA 3Q6KA 3NT1A 2VVCK 2Y5GL 2WYJB 1NZIA 3A9GA 1EMNA 1U67A 2W8BB 4A0PA 3TK5B 2IAWA 3CENL 1YUKB 1G1QA 4YT7L 4BXSA 3LN1A 2B7DL 3LTFB 1HCGB 2WPKE 4LMFA 4X8TL 3HPTA 4CUFA 1PRHA 3C9AC 2GVUA 4RRWA 1DQBA 1YUFA 5GX4A 1CEJA 1F0RB 1PGEA 1BF9A 2I9AA 4Y7BB 2F9BL 2BOUA 4CSYA 3M37L 2OYEP 4CUEA 2P3FL 3HO4A 2WG3C 3IJEB 1EPJA 2MGPA 4NG9L 3SREA 1L3YA 2K2SB 3KGGA 3S8VA 2WPHE 3U73A 2YGPA 1LPGA 5K0HB 5CKQA 4HHOA 1EPHA 4TGFA 4X8VL 2Y81B 2XBXL 2W86A 2WPME 2XBYL 1RFNB 2VWOL 1FF7A 5L30L 3CS7L 3QH0A 2J38B 6COXA 2OYUP 2W2PE 2PR3B 5L2YL 1SZBA 5CISA 2WPIE 4JZEL 1HREA 2IAPA 3FW0A 3S94A 3LC3B 4ISIL 5CKNA 3NTBA 1DIYA 2EI8B 2RA0L 5JBCE 5GX5A 2WFTA 3G4EA 2VVVL 4D90A 1HZ8A 1WHEA 4Q1UA 2EI7B 5CKMA 1APQA 1EBVA 2IAOA 4AQTA 4Z6AL 3E5ZA 3Q7DA 3ELAL 4GNBA 1MOXC 1APOA 4M11A 3LIWB 2GVWA 4O5SA 1JBUL 3MQEA 1MQ6L 1HT5A 1NPEA 5IKQA 3EGFA 3Q6TA 2Y38A 3TGFA 2IATA 4ZH8B 4Z0LA 5EX7A 1LPZA 1L5GB 1NT0A 2GVXA 2UWPB 2W2QE 4ZAEB 4OTJA 3SOBB 2BOKL 1C5MF 3N8VA 5F1AA 3POYA 1CCVA 1URKA 1KSNB 2FP8A 4JYUL 1Q4GA 4JYVL 3BT2A 4RRZA 1EPGA 1IQJL 1I0UA 1V3XB 1NQLB 1U8CB 2VJ3A 2CJIB 2P3UA 5GTQA 3GCWE 2BO2A 3BPSE 4R40A 3QCWA 1EMOA 2OJHA 3TK6B 2Y5FL 5GX2A 4G1MB 3KQBL 2BQ6A 2J34B 3ZYGA 1IQML 3S8ZA 4E1GA 1H6LA 3SW2A 1FSBA 1O5DL 2Q1JB 2AYLA 4BDXA 4BDWA 3ASIA 5IKRA 1PTHA 2P16L 1ATEA 4BXWA 2P95L 1N1IA 4DG6A 4Y7AB 1KLJL 4IMBA 4ZXXL 1Z6EL 4Y6DB 1Z6CA 4PH9A 3RR3A 1IQHL 2G00L 3LI5A 1F0SB 2JKHL 4O5TA 4RUTA 2FPCA 1XDTR 1K37A 1QBIA 1XKAL 4JZDL 1E1AA 1CVWL 1DVAL 1IOXA 1UZPA 4RRYA 3TBDA 1FE2A 3V65B 1CVMA 1PJXA 3QMOA 2VAQA 3KL6B 1NPEB 1A3PA 5JW1A 2VH6B 1NFXB 3SOQA 3FCSB 3FBYA 4JMLA 1UZKA 5COXA 1ZAQA 5IKTA 3HO5A 2M74A 1TPGA 5IKVA 1W7XL 3SRGA 4MMXB 2KL7A 2P93L 3I1CA 1NFUB 3AMSA 1XKBA 3GCXE 3N8YB 1WU1B 4JZFL 1NFWB 1K36A 1FJSL
chains in the Genus database with same CATH superfamily
3WW9A 4QN6A 1IQNL 1G1TA 2H2NA 2WOZA 1J9CL 4BTTA 1WP5A 3O9JA 4H53A 4KS5A 4X8UL 1IGZA 3N8XA 1NNCA 2BT8A 1X2JA 2Y5HL 3TIAA 2W8BA 3NO0A 1IJQA 2V91A 1S0JA 4GZWA 4C16A 4WA5A 1LMJA 1IGXA 4ASCA 3DASA 4WA3A 1V3EA 1NFYB 4JF7A 4MWWA 3LN0A 1YUGA 1MZ5A 2QE8A 2FLBL 1C9UA 4NA9L 1XOEA 4MMYB 4HZZA 4MWJA 4MJUA 3CFWA 4CPOA 1Z4WA 2BOXA 2WG4B 3VNHA 1NCDN 2WPLE 4XJUA 2UWOB 2HTUA 4YW1A 1V0EA 2KNIA 3CL2A 1C5KA 1F7EA 2QWFA 1EGFA 3DR2A 2F0ZA 1USRA 4XMIA 4GU3A 4GNAA 2Y80B 1LPKA 4H52A 2W26B 1G1RA 2ISMA 2VWLL 3IAXA 3KQEL 1KITA 5KIRA 1CRUA 4BBWA 2F25A 4M4NA 2YDPA 1INWA 2IVZA 3CYEA 1W8NA 2WYGB 4FPHA 3SOVA 2BMGA 2BQWA 2CMLA 1QLGA 2VW0A 3ZYJB 1N1TA 4KS4A 2VSKA 1IQGL 1ATBA 5GX1A 3R05A 2HT5A 4K3YA 3H72A 4LORA 2HTRA 3O4PA 3HO3A 2FLGA 2FLRL 2QWJA 2P3FN 4GJTA 1CQEA 2Y7XB 4XHXA 4FZHA 3MDLA 2KB9A 4D4UA 1IVCA 1MS9A 5L2ZL 3V64C 1Z50A 1EAIC 1QFKL 2W2ME 5JBAE 1N1VA 1NSBA 3TIBA 3ZGCA 4AGTA 3ALXA 4QN5A 1HJ7A 3OLTA 1F8CA 4Y76B 4D0EA 2FP9A 2ADXA 3TH3L 1ATAA 2GHSA 4IYGA 1L7GA 1Z4ZA 1IVDA 2FZZL 1L7HA 4FVKA 1N1SA 2GD4A 2SLIA 2HORA 4K1IA 1W0PA 2IASA 3BYCA 3N8YA 4K1KA 1INGA 5F19A 2DG0A 2VSMA 2Y7ZB 4K1HA 2W3KB 2IAUA 5E8DA 4FOVA 5GX3A 4FPYA 4G3NA 4NN9A 1INHA 2POOA 1MS5A 4GN9A 2WFXB 5KN5C 1MS3A 4FPGA 3H5CB 1W0OA 4NCSA 5M1ZA 4OTYA 4FPCA 1VCUA 1Z4YA 3NSSA 1N7DA 4FM5A 2VH0B 2NPRA 3N8ZA 2J4IB 1EUSA 3IITB 3H6JA 4RRXA 1IQKL 1CX2A 1SO7A 4QN7A 4FJ6A 5D9BA 2QWGA 5I46L 4MWXA 2UWLB 1LQDA 1NNAA 4YW5A 3HS6A 4D52C 1YGCL 4XJRA 4GZSA 5JVZA 3LI3A 1V04A 4ZXYL 1FAKL 2W38A 3B7EA 5JB8E 3KRKA 1FFMA 3PJQA 4HW6A 3K36A 2GVVA 2BF6A 4GEZA 2XZJA 3KK6A 5JVYA 1MQ5L 3G4HA 3V1SA 4XJ9A 3CA7A 2DYHA 1JV2B 3NJPC 2SIMA 3Q6PA 3ZYIB 3TZIA 2W5NA 4PWZA 2RNLA 1SLLA 4XMAA 3LI4A 3KQCL 2DG1A 2PHBB 4AGIA 1RWLA 2J95B 1LMMA 2YGQA 1ZGKA 5JB9E 2BT7A 2ZB6A 4XLWA 1YO8A 2XC0L 2FPBA 2IAQA 4MWQA 1MS0A 4CPNA 4A94C 4MZAA 2XC4L 2W2OE 5EGMB 3M36L 4CHBA 2KV4A 1KLOA 1SUUA 3T1EA 5F9TA 2RHPA 3TC9A 4IQKA 2VPJA 4GN8A 5FWWA 4HHQA 1EUUA 4XMBA 1IOEL 4GZTA 1B9SA 2XCYA 1TOZA 1HAEA 4B7RA 4FOWA 4XILA 4XJZA 2VVUL 4CPYA 4M3MA 2P26A 3FVZA 3LAQA 2VVZA 2ZWAA 4GNCA 1KIGL 4D0FA 4N1BA 3HLHA 3OLUA 1XOGA 1U6DX 2YA7A 2IARA 4WEGA 7NN9A 1GK5A 4C1YA 3D11A 1ATDA 5D9DA 1G2MB 2XC5L 3UC1A 2P28B 3K9XA 2ZZKA 5B2CA 3KQDL 4CUDA 2YA8A 3D12A 1UZQA 2XBWL 3FFGL 2ZB5A 1X7AL 4YZUB 3TI5A 5FNRA 1RWIA 1Z4VA 2YA4A 4GDIA 5NN9A 1FAXL 3TI8A 3GISX 1EURA 2BOHA 1W8BL 1COUA 2HTVA 1G2LB 1EZQB 2I9BA 1POOA 4YW3A 3K38A 4MMZB 4Z0KB 1OFZA 1Q7FA 3ZGDA 5FDQA 4XL1A 2MGRA 2XZKA 2HQSA 4ZLRA 2F28A 3DEMA 3ENSA 1N6EA 1A4GA 1USXA 1EPIA 1CRZA 4FPJA 2FD6A 3LC5B 1DDXA 2QWKA 1F7MA 3AMRA 4IFJA 1SLIA 4BTUA 4GZPA 4YZ3A 1IQEL 2HOXA 1NMCA 4GZOA 1NN2A 2QWDA 4FPFA 1WCQA 1IP0A 1AUTL 3HS5A 3NTGA 3P5BL 2MHPA 5JBBE 1WCSA 1ADXA 2C4AA 2VK6A 1DX5I 2HTYA 3N8WA 1LK9A 1E8VA 1MR5A 4D52A 2PUQL 1E8TA 2EI6B 3BEQA 2HTWA 3INBA 2Y82B 1M1XB 2IAXA 4M4VA 1PFXL 1G1SA 4XHBA 2BZ6L 1DILA 1IUCA 2WPJE 1IVFA 4YT6L 2VWNL 2DDUA 2XBVL 1V0ZA 3HRPA 4IN4A 3U0SA 2P3TA 4A7IA 4O1ZA 1KLIL 2FHRA 3KYAA 4YZ4A 2K2TA 4UOUA 2TGFA 2YA6A 1IVOC 1MS8A 4ISHL 1EQGA 3HS7A 2Z32A 4XJWA 1UZJA 3ADEA 2W2NE 1CCFA 3WWAA 4X8SL 3BT1A 1W8OA 5D9CA 3U7UG 1V3BA 1JL9A 3KCGL 1WHFA 2HT7A 3N8WB 3PGHA 1V1HA 3Q3KB 2BQ7A 2IAVA 2P4OA 4O02B 4ZY3A 1HAFA 1CVUA 4XBMA 1TLEA 2DSOA 5HUNA 1P0SL 1MZ6A 1PXXA 3F1SB 1CQ1A 2YGOA 4RS0A 1F8BA 4M10A 4BTIA 1W21A 1IQFL 1ZI0A 2AEPA 3II7A 5FNUA 1IQIL 1EQHA 1HT8A 4XIOA 4ZHAB 4GZXA 2P94L 4C1YB 1VCJA 1K32A 4Y79B 4GN7A 2D1JB 3A9HA 3S2KA 2VWMK 3LTGD 2JKBA 3A71A 1HRFA 1HX2A 4KS1A 1BJIA 3F6UL 2QWBA 4NGAL 4XIKA 4XYXA 1B9WA 2BERA 2G8SA 5EO8A 1XFEA 1IQLL 2YA5A 4Y71B 4D8SA 2F27A 2J94B 2W3IB 2H9EL 2J2UB 4COXA 1DIMA 4IFNX 2AGSA 1OB1C 1V1IA 1P9JA 3TI3A 3Q6KA 2BATA 3NT1A 1S1DA 2VVCK 2AEQA 2JJLA 2Y5GL 2WYJB 1NZIA 3A9GA 4MZEA 1EMNA 4UF7A 1U67A 2W8BB 4A0PA 3JU4A 2C4LA 2F24A 3TK5B 1MS4A 1Z4XA 4MWVA 2IAWA 4QN4A 4CPZA 3CENL 1YUKB 2VK5A 2QWEA 1G1QA 4YT7L 5HUGA 4BXSA 3LN1A 1NCAN 2B7DL 3LTFB 1HCGB 2WPKE 4LMFA 5FNTA 4YZ1A 4GU4A 4X8TL 3HPTA 4CUFA 1PRHA 2QWAA 3TI4A 3C9AC 1V3DA 2GVUA 4RRWA 2SILA 5FNQA 4XJAA 3TICA 1EUTA 4FPEA 4KS3A 4J9TA 1DQBA 2X9MA 1YUFA 4CH9A 1CEJA 1IVEA 5GX4A 1F0RB 1PGEA 1BF9A 2I9AA 4Y7BB 2F9BL 2BOUA 4CSYA 2F10A 4IFLX 3GVLA 3SILA 3M37L 2OYEP 4CUEA 5FZNA 2P3FL 4YY8A 3WDZA 3HO4A 2WG3C 3IJEB 1EPJA 2MGPA 4FP2A 4NG9L 1MS1A 4Q6KA 3SREA 4HZYA 1L3YA 2K2SB 3CKZA 3KGGA 2WPHE 3S8VA 2BZDA 2W5OA 3GVJA 3U73A 2YGPA 1LPGA 5K0HB 4FOYA 3GVKA 5CKQA 1NNBA 4I00A 2RKCA 4HHOA 1EPHA 4L7BA 4TGFA 2F29A 4GDJA 4B7NA 4X8VL 2XZIA 4X4AA 4AHAA 1V3CA 3TI6A 2HU0A 5HX0A 2Y81B 2XBXL 2W86A 2WPME 2XBYL 1RFNB 2VWOL 4B7MA 5B2DA 1FF7A 5L30L 3CS7L 3QH0A 2J38B 4SLIA 6NN9A 3S6XA 6COXA 2ZW9A 2OYUP 4MJVA 4XJ8A 2W2PE 2PR3B 5L2YL 1SZBA 5CISA 2WPIE 4JZEL 3L6VA 1HREA 2IAPA 3FW0A 3S94A 4X49A 3LC3B 4ISIL 5CKNA 3NTBA 1DIYA 2EI8B 2RA0L 1S0IA 5JBCE 2F13A 2VK7A 2XN4A 2WFTA 4HZWA 3G4EA 4XJQA 5GX5A 2VVVL 4D90A 1HZ8A 3SALA 4QN3A 1WHEA 2VW2A 4Q1UA 5JYYA 1W20A 4MWLA 2EI7B 5CKMA 1MWEA 1APQA 1EBVA 2IAOA 4GB1A 4AQTA 4Z6AL 1NCCN 3E5ZA 3Q7DA 3ELAL 4B7QA 4GNBA 1MOXC 1APOA 1S18A 4M11A 3LIWB 2GVWA 4O5SA 4YZ2A 1JBUL 3MQEA 1MQ6L 4CPMA 1HT5A 1NPEA 5IKQA 3K39A 1V2IA 1E8UA 1KKEA 3EGFA 3Q6TA 2QWHA 1B9TA 2Y38A 3TGFA 2F12A 2IATA 1IVGA 4ZH8B 4Z0LA 3H71A 5EX7A 4FPLA 1LPZA 4XE9A 4DGRA 1L5GB 1L7FA 4GZQA 4WEFA 1NT0A 2GVXA 2UWPB 2W2QE 4ZAEB 4OTJA 3SOBB 2BOKL 4M4UA 1C5MF 3N8VA 2HT8A 5F1AA 3POYA 1NSCA 1CCVA 1URKA 4FOQA 1X2RA 1KSNB 2FP8A 4JYUL 1Q4GA 1F8EA 4JYVL 1N6DA 3BT2A 4RRZA 3NN9A 1EPGA 4NC5A 5HUKA 1INFA 1IQJL 1NMAN 1I0UA 3W09A 1V3XB 1NQLB 1U8CB 2VJ3A 1SNTA 2F11A 5F72C 2CJIB 2P3UA 5GTQA 3GCWE 2BO2A 3BPSE 4R40A 1NCBN 4YW2A 3QCWA 4B7JA 1EMOA 2OJHA 3TK6B 1N6FA 2Y5FL 4YZ5A 5GX2A 4G1MB 1NSDA 3VNGA 3KQBL 3A72A 2BQ6A 4MX0A 5FNSA 2J34B 3ZYGA 2W20A 1IQML 3HLIA 1INVA 4X47A 5CGJA 4FPOB 4MC7A 4MWYA 1N1YA 4E1GA 3S8ZA 1H6LA 5H47A 1INYA 3SW2A 1FSBA 1O5DL 4X6KA 2Q1JB 2BSFA 2AYLA 4BDXA 4BDWA 4FQ4A 4L7DA 3SLIA 3ASIA 5IKRA 4WA4A 4D52B 1PTHA 2P16L 4KS2A 1ATEA 4BXWA 3K37A 2P95L 1N1IA 2H2UA 4CSDA 4DG6A 4Y7AB 1W1XA 1KLJL 2B8HA 4IMBA 2AH2A 4ZXXL 1Z6EL 4Y6DB 1Z6CA 4PH9A 2HU4A 2H9EC 3RR3A 5HUMA 4XOGA 1QIUA 1IQHL 2YDTA 4HZVA 4K1JA 5FZJA 2G00L 1A4QA 2WZPP 2QWIA 4ZGCA 1F8DA 4CPLA 3LI5A 3K3AA 1F0SB 2JKHL 1IUBA 4RUTA 2FPCA 4O5TA 1XDTR 1K37A 1QBIA 1XKAL 2F26A 3ALWA 4JZDL 1E1AA 1CVWL 1DVAL 1IOXA 1IVBA 2VW1A 1UZPA 3OPZA 5EO7A 4RRYA 3TBDA 1FE2A 3V65B 1CVMA 1PJXA 1V0FA 2FLUX 2QWCA 3QMOA 2VAQA 3CL0A 3KL6B 1NPEB 1A3PA 5JW1A 4FPKA 1B9VA 4HZXA 2VH6B 1INXA 1NFXB 3SOQA 4QNPA 3FCSB 4HIZA 3FBYA 4JMLA 1UZKA 5COXA 1A14N 4L7CA 1ZAQA 5IKTA 4YW4A 3HO5A 3WN7A 2M74A 1TPGA 3O9KA 2VRSA 5IKVA 1W7XL 2VWDA 2A75A 3SRGA 4MMXB 2KL7A 2P93L 3H73A 3I1CA 1NFUB 3AMSA 1XKBA 3GCXE 3N8YB 2HTQA 3B69A 4FP3A 4MWUA 4AH4A 1WU1B 4JZFL 1NMBN 3SANA 1NFWB 1K36A 4MWRA 1FJSL
chains in the Genus database with same CATH topology
3WW9A 1IQNL 1G1TA 1J9CL 4BTTA 4X8UL 1IGZA 3N8XA 2Y5HL 2W8BA 1IJQA 2V91A 4C16A 1LMJA 1IGXA 3DASA 1NFYB 3LN0A 1YUGA 2QE8A 2FLBL 1C9UA 4NA9L 4MMYB 3CFWA 2BOXA 2WG4B 2WPLE 2UWOB 2KNIA 1C5KA 1F7EA 1EGFA 3DR2A 4GNAA 2Y80B 1LPKA 2W26B 1G1RA 2ISMA 2VWLL 3IAXA 3KQEL 5KIRA 1CRUA 2IVZA 2WYGB 3SOVA 2BMGA 2BQWA 1QLGA 3ZYJB 1IQGL 1ATBA 5GX1A 3R05A 4LORA 3O4PA 3HO3A 2FLGA 2FLRL 2P3FN 1CQEA 2Y7XB 3MDLA 2KB9A 5L2ZL 3V64C 1EAIC 1QFKL 2W2ME 5JBAE 1HJ7A 3OLTA 4Y76B 4D0EA 2FP9A 2ADXA 3TH3L 1ATAA 2GHSA 4IYGA 2FZZL 2GD4A 2IASA 3BYCA 3N8YA 5F19A 2DG0A 2Y7ZB 2W3KB 2IAUA 5E8DA 5GX3A 2POOA 4GN9A 2WFXB 5KN5C 3H5CB 4OTYA 1N7DA 4FM5A 2VH0B 2NPRA 3N8ZA 2J4IB 3IITB 4RRXA 1IQKL 1CX2A 5D9BA 5I46L 2UWLB 1LQDA 3HS6A 1YGCL 5JVZA 3LI3A 1V04A 4ZXYL 1FAKL 5JB8E 3KRKA 1FFMA 4HW6A 2GVVA 3KK6A 5JVYA 1MQ5L 3G4HA 3V1SA 3CA7A 1JV2B 3NJPC 3Q6PA 4PWZA 3ZYIB 3TZIA 2RNLA 3LI4A 3KQCL 2DG1A 2PHBB 1RWLA 2J95B 1LMMA 2YGQA 5JB9E 4XLWA 1YO8A 2XC0L 2FPBA 2IAQA 4A94C 2XC4L 2W2OE 5EGMB 3M36L 2KV4A 1KLOA 2RHPA 3TC9A 5FWWA 4GN8A 4HHQA 1IOEL 1TOZA 1HAEA 2VVUL 2P26A 3FVZA 3LAQA 4GNCA 1KIGL 4D0FA 3HLHA 3OLUA 2IARA 1GK5A 5D9DA 1ATDA 1G2MB 2XC5L 2P28B 3K9XA 3KQDL 4CUDA 1UZQA 2XBWL 3FFGL 1X7AL 4YZUB 1RWIA 1FAXL 3GISX 2BOHA 1W8BL 1COUA 1G2LB 1EZQB 2I9BA 1POOA 4MMZB 4Z0KB 1Q7FA 5FDQA 4XL1A 2MGRA 2HQSA 4ZLRA 3DEMA 3ENSA 1EPIA 1CRZA 2FD6A 3LC5B 1DDXA 3AMRA 1F7MA 4BTUA 1IQEL 1IP0A 1AUTL 3HS5A 3NTGA 3P5BL 2MHPA 5JBBE 3HLIA 1ADXA 1DX5I 3N8WA 2PUQL 2EI6B 2Y82B 1M1XB 2IAXA 1PFXL 1G1SA 2BZ6L 2WPJE 4YT6L 2VWNL 2DDUA 2XBVL 3HRPA 3U0SA 2P3TA 4A7IA 4O1ZA 1KLIL 3KYAA 2K2TA 2TGFA 1IVOC 4ISHL 1EQGA 3HS7A 1UZJA 3WWAA 2W2NE 1CCFA 4X8SL 3BT1A 5D9CA 3U7UG 1JL9A 3KCGL 1WHFA 3N8WB 3PGHA 3Q3KB 2BQ7A 2IAVA 2P4OA 4O02B 1HAFA 1CVUA 4XBMA 1TLEA 2DSOA 1P0SL 1PXXA 3F1SB 1CQ1A 2YGOA 4RS0A 4M10A 4BTIA 1IQFL 1IQIL 1EQHA 1HT8A 4ZHAB 2P94L 4GN7A 4Y79B 2D1JB 3A9HA 3S2KA 2VWMK 3LTGD 1HRFA 1HX2A 3F6UL 4NGAL 1B9WA 2G8SA 1XFEA 1IQLL 4Y71B 2J94B 2W3IB 2H9EL 2J2UB 4COXA 1OB1C 1P9JA 3Q6KA 3NT1A 2VVCK 2Y5GL 2WYJB 1NZIA 3A9GA 1EMNA 1U67A 2W8BB 4A0PA 3TK5B 2IAWA 3CENL 1YUKB 1G1QA 4YT7L 4BXSA 3LN1A 2B7DL 3LTFB 1HCGB 2WPKE 4LMFA 4X8TL 3HPTA 4CUFA 1PRHA 3C9AC 2GVUA 4RRWA 1DQBA 1YUFA 5GX4A 1CEJA 1F0RB 1PGEA 1BF9A 2I9AA 4Y7BB 2F9BL 2BOUA 4CSYA 3M37L 2OYEP 4CUEA 2P3FL 3HO4A 2WG3C 3IJEB 1EPJA 2MGPA 4NG9L 3SREA 1L3YA 2K2SB 3KGGA 3S8VA 2WPHE 3U73A 2YGPA 1LPGA 5K0HB 5CKQA 4HHOA 1EPHA 4TGFA 4X8VL 2Y81B 2XBXL 2W86A 2WPME 2XBYL 1RFNB 2VWOL 1FF7A 5L30L 3CS7L 3QH0A 2J38B 3S6XA 6COXA 2OYUP 2W2PE 2PR3B 5L2YL 1SZBA 5CISA 2WPIE 4JZEL 1HREA 2IAPA 3FW0A 3S94A 3LC3B 4ISIL 5CKNA 3NTBA 1DIYA 2EI8B 2RA0L 5JBCE 5GX5A 2WFTA 3G4EA 2VVVL 4D90A 1HZ8A 1WHEA 4Q1UA 2EI7B 5CKMA 1APQA 1EBVA 2IAOA 4AQTA 4Z6AL 3E5ZA 3Q7DA 3ELAL 4GNBA 1MOXC 1APOA 4M11A 3LIWB 2GVWA 4O5SA 1JBUL 3MQEA 1MQ6L 1HT5A 1NPEA 5IKQA 3EGFA 3Q6TA 2Y38A 3TGFA 2IATA 4ZH8B 4Z0LA 5EX7A 1LPZA 1L5GB 1NT0A 2GVXA 2UWPB 2W2QE 4ZAEB 4OTJA 3SOBB 2BOKL 1C5MF 3N8VA 5F1AA 3POYA 1CCVA 1URKA 1KSNB 2FP8A 4JYUL 1Q4GA 4JYVL 3BT2A 4RRZA 1EPGA 1IQJL 1I0UA 1V3XB 1NQLB 1U8CB 2VJ3A 2CJIB 2P3UA 5GTQA 3GCWE 2BO2A 3BPSE 4R40A 3QCWA 1EMOA 2OJHA 3TK6B 2Y5FL 5GX2A 4G1MB 3KQBL 2BQ6A 2J34B 3ZYGA 1IQML 3S8ZA 4E1GA 1H6LA 3SW2A 1FSBA 1O5DL 2Q1JB 2AYLA 4BDXA 4BDWA 3ASIA 5IKRA 1PTHA 2P16L 1ATEA 4BXWA 2P95L 1N1IA 4DG6A 4Y7AB 1KLJL 4IMBA 4ZXXL 1Z6EL 4Y6DB 1Z6CA 4PH9A 2H9EC 3RR3A 1IQHL 2G00L 2WZPP 3LI5A 1F0SB 2JKHL 4O5TA 4RUTA 2FPCA 1XDTR 1K37A 1QBIA 1XKAL 4JZDL 1E1AA 1CVWL 1DVAL 1IOXA 1UZPA 4RRYA 3TBDA 1FE2A 3V65B 1CVMA 1PJXA 3QMOA 2VAQA 3KL6B 1NPEB 1A3PA 5JW1A 2VH6B 1NFXB 3SOQA 3FCSB 3FBYA 4JMLA 1UZKA 5COXA 1ZAQA 5IKTA 3HO5A 2M74A 1TPGA 5IKVA 1W7XL 3SRGA 4MMXB 2KL7A 2P93L 3I1CA 1NFUB 3AMSA 1XKBA 3GCXE 3N8YB 1WU1B 4JZFL 1NFWB 1K36A 1FJSL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WW9 A;  1IQN L;  1G1T A;  1J9C L;  4BTT A;  4X8U L;  1IGZ A;  3N8X A;  2Y5H L;  2W8B A;  1IJQ A;  2V91 A;  4C16 A;  1LMJ A;  1IGX A;  3DAS A;  1NFY B;  3LN0 A;  1YUG A;  2QE8 A;  2FLB L;  1C9U A;  4NA9 L;  4MMY B;  3CFW A;  2BOX A;  2WG4 B;  2WPL E;  2UWO B;  1C5K A;  1F7E A;  1EGF A;  3DR2 A;  4GNA A;  2Y80 B;  1LPK A;  2W26 B;  1G1R A;  2ISM A;  2VWL L;  3IAX A;  3KQE L;  5KIR A;  1CRU A;  2IVZ A;  2WYG B;  3SOV A;  2BMG A;  2BQW A;  1QLG A;  3ZYJ B;  1IQG L;  1ATB A;  5GX1 A;  3R05 A;  4LOR A;  3O4P A;  3HO3 A;  2FLG A;  2FLR L;  2P3F N;  1CQE A;  2Y7X B;  3MDL A;  2KB9 A;  5L2Z L;  3V64 C;  1EAI C;  1QFK L;  2W2M E;  5JBA E;  1HJ7 A;  3OLT A;  4Y76 B;  4D0E A;  2FP9 A;  2ADX A;  3TH3 L;  1ATA A;  2GHS A;  4IYG A;  2FZZ L;  2GD4 A;  2IAS A;  3BYC A;  3N8Y A;  5F19 A;  2DG0 A;  2Y7Z B;  2W3K B;  2IAU A;  5E8D A;  5GX3 A;  2POO A;  4GN9 A;  2WFX B;  5KN5 C;  3H5C B;  4OTY A;  1N7D A;  4FM5 A;  2VH0 B;  2NPR A;  3N8Z A;  2J4I B;  3IIT B;  4RRX A;  1IQK L;  1CX2 A;  5D9B A;  5I46 L;  2UWL B;  1LQD A;  3HS6 A;  1YGC L;  5JVZ A;  3LI3 A;  1V04 A;  4ZXY L;  1FAK L;  5JB8 E;  3KRK A;  1FFM A;  4HW6 A;  2GVV A;  3KK6 A;  5JVY A;  1MQ5 L;  3G4H A;  3V1S A;  3CA7 A;  1JV2 B;  3NJP C;  3Q6P A;  4PWZ A;  3ZYI B;  3TZI A;  2RNL A;  3LI4 A;  3KQC L;  2DG1 A;  2PHB B;  1RWL A;  2J95 B;  5JB9 E;  4XLW A;  1YO8 A;  2XC0 L;  2FPB A;  2IAQ A;  2XC4 L;  2W2O E;  5EGM B;  3M36 L;  2KV4 A;  1KLO A;  2RHP A;  3TC9 A;  5FWW A;  4GN8 A;  4HHQ A;  1IOE L;  1TOZ A;  1HAE A;  2VVU L;  2P26 A;  3FVZ A;  3LAQ A;  4GNC A;  1KIG L;  4D0F A;  3HLH A;  3OLU A;  2IAR A;  1GK5 A;  5D9D A;  1ATD A;  1G2M B;  2XC5 L;  2P28 B;  3K9X A;  3KQD L;  4CUD A;  1UZQ A;  2XBW L;  3FFG L;  1X7A L;  4YZU B;  1RWI A;  1FAX L;  3GIS X;  2BOH A;  1W8B L;  1COU A;  1G2L B;  1EZQ B;  2I9B A;  1POO A;  4MMZ B;  4Z0K B;  1Q7F A;  5FDQ A;  4XL1 A;  2MGR A;  2HQS A;  4ZLR A;  3DEM A;  3ENS A;  1EPI A;  1CRZ A;  2FD6 A;  3LC5 B;  1DDX A;  3AMR A;  1F7M A;  4BTU A;  1IQE L;  1IP0 A;  1AUT L;  3HS5 A;  3NTG A;  3P5B L;  2MHP A;  5JBB E;  3HLI A;  1ADX A;  1DX5 I;  3N8W A;  2PUQ L;  2EI6 B;  2Y82 B;  1M1X B;  2IAX A;  1PFX L;  1G1S A;  2BZ6 L;  2WPJ E;  4YT6 L;  2VWN L;  2DDU A;  2XBV L;  3HRP A;  3U0S A;  2P3T A;  4A7I A;  4O1Z A;  1KLI L;  3KYA A;  2K2T A;  2TGF A;  1IVO C;  4ISH L;  1EQG A;  3HS7 A;  1UZJ A;  3WWA A;  2W2N E;  1CCF A;  4X8S L;  3BT1 A;  5D9C A;  3U7U G;  1JL9 A;  3KCG L;  1WHF A;  3N8W B;  3PGH A;  3Q3K B;  2BQ7 A;  2IAV A;  2P4O A;  4O02 B;  1HAF A;  1CVU A;  4XBM A;  1TLE A;  2DSO A;  1P0S L;  1PXX A;  3F1S B;  1CQ1 A;  2YGO A;  4RS0 A;  4M10 A;  4BTI A;  1IQF L;  1IQI L;  1EQH A;  1HT8 A;  4ZHA B;  2P94 L;  4GN7 A;  4Y79 B;  2D1J B;  3A9H A;  3S2K A;  2VWM K;  3LTG D;  1HRF A;  1HX2 A;  3F6U L;  4NGA L;  1B9W A;  2G8S A;  1XFE A;  1IQL L;  4Y71 B;  2J94 B;  2W3I B;  2H9E L;  2J2U B;  4COX A;  1OB1 C;  1P9J A;  3Q6K A;  3NT1 A;  2VVC K;  2Y5G L;  2WYJ B;  1NZI A;  3A9G A;  1EMN A;  1U67 A;  2W8B B;  4A0P A;  3TK5 B;  2IAW A;  3CEN L;  1YUK B;  1G1Q A;  4YT7 L;  4BXS A;  3LN1 A;  2B7D L;  3LTF B;  1HCG B;  2WPK E;  4LMF A;  4X8T L;  3HPT A;  4CUF A;  1PRH A;  3C9A C;  2GVU A;  4RRW A;  1DQB A;  1YUF A;  5GX4 A;  1CEJ A;  1F0R B;  1PGE A;  1BF9 A;  2I9A A;  4Y7B B;  2F9B L;  2BOU A;  4CSY A;  3M37 L;  2OYE P;  4CUE A;  2P3F L;  3HO4 A;  2WG3 C;  3IJE B;  1EPJ A;  2MGP A;  4NG9 L;  3SRE A;  1L3Y A;  2K2S B;  3KGG A;  3S8V A;  2WPH E;  3U73 A;  2YGP A;  1LPG A;  5K0H B;  5CKQ A;  4HHO A;  1EPH A;  4TGF A;  4X8V L;  2Y81 B;  2XBX L;  2W86 A;  2WPM E;  2XBY L;  1RFN B;  2VWO L;  1FF7 A;  5L30 L;  3CS7 L;  3QH0 A;  2J38 B;  6COX A;  2OYU P;  2W2P E;  2PR3 B;  5L2Y L;  1SZB A;  5CIS A;  2WPI E;  4JZE L;  1HRE A;  2IAP A;  3FW0 A;  3S94 A;  3LC3 B;  4ISI L;  5CKN A;  3NTB A;  1DIY A;  2EI8 B;  2RA0 L;  5JBC E;  5GX5 A;  2WFT A;  3G4E A;  2VVV L;  4D90 A;  1HZ8 A;  1WHE A;  4Q1U A;  2EI7 B;  5CKM A;  1APQ A;  1EBV A;  2IAO A;  4AQT A;  4Z6A L;  3E5Z A;  3Q7D A;  3ELA L;  4GNB A;  1MOX C;  1APO A;  4M11 A;  3LIW B;  2GVW A;  4O5S A;  1JBU L;  3MQE A;  1MQ6 L;  1HT5 A;  1NPE A;  5IKQ A;  3EGF A;  3Q6T A;  2Y38 A;  3TGF A;  2IAT A;  4ZH8 B;  4Z0L A;  5EX7 A;  1LPZ A;  1L5G B;  1NT0 A;  2GVX A;  2UWP B;  2W2Q E;  4ZAE B;  4OTJ A;  3SOB B;  2BOK L;  1C5M F;  3N8V A;  5F1A A;  3POY A;  1CCV A;  1URK A;  1KSN B;  2FP8 A;  4JYU L;  1Q4G A;  4JYV L;  3BT2 A;  4RRZ A;  1EPG A;  1IQJ L;  1I0U A;  1V3X B;  1NQL B;  1U8C B;  2VJ3 A;  2CJI B;  2P3U A;  5GTQ A;  3GCW E;  2BO2 A;  3BPS E;  4R40 A;  3QCW A;  1EMO A;  2OJH A;  3TK6 B;  2Y5F L;  5GX2 A;  4G1M B;  3KQB L;  2BQ6 A;  2J34 B;  3ZYG A;  1IQM L;  3S8Z A;  4E1G A;  1H6L A;  3SW2 A;  1FSB A;  1O5D L;  2Q1J B;  2AYL A;  4BDX A;  4BDW A;  3ASI A;  5IKR A;  1PTH A;  2P16 L;  1ATE A;  4BXW A;  2P95 L;  1N1I A;  4DG6 A;  4Y7A B;  1KLJ L;  4IMB A;  4ZXX L;  1Z6E L;  4Y6D B;  1Z6C A;  4PH9 A;  3RR3 A;  1IQH L;  2G00 L;  3LI5 A;  1F0S B;  2JKH L;  4O5T A;  4RUT A;  2FPC A;  1XDT R;  1K37 A;  1QBI A;  1XKA L;  4JZD L;  1E1A A;  1CVW L;  1DVA L;  1IOX A;  1UZP A;  4RRY A;  3TBD A;  1FE2 A;  3V65 B;  1CVM A;  1PJX A;  3QMO A;  2VAQ A;  3KL6 B;  1NPE B;  1A3P A;  5JW1 A;  2VH6 B;  1NFX B;  3SOQ A;  3FCS B;  3FBY A;  4JML A;  1UZK A;  5COX A;  1ZAQ A;  5IKT A;  3HO5 A;  2M74 A;  1TPG A;  5IKV A;  1W7X L;  3SRG A;  4MMX B;  2KL7 A;  2P93 L;  3I1C A;  1NFU B;  3AMS A;  1XKB A;  3GCX E;  3N8Y B;  1WU1 B;  4JZF L;  1NFW B;  1K36 A;  1FJS L; 
#chains in the Genus database with same CATH topology
 3WW9 A;  4QN6 A;  1IQN L;  1G1T A;  2H2N A;  2WOZ A;  1J9C L;  4BTT A;  1WP5 A;  3O9J A;  4H53 A;  4KS5 A;  4X8U L;  1IGZ A;  3N8X A;  1NNC A;  2BT8 A;  1X2J A;  2Y5H L;  3TIA A;  2W8B A;  3NO0 A;  1IJQ A;  2V91 A;  1S0J A;  4GZW A;  4C16 A;  4WA5 A;  1LMJ A;  1IGX A;  4ASC A;  3DAS A;  4WA3 A;  1V3E A;  1NFY B;  4JF7 A;  4MWW A;  3LN0 A;  1YUG A;  1MZ5 A;  2QE8 A;  2FLB L;  1C9U A;  4NA9 L;  1XOE A;  4MMY B;  4HZZ A;  4MWJ A;  4MJU A;  3CFW A;  4CPO A;  1Z4W A;  2BOX A;  2WG4 B;  3VNH A;  1NCD N;  2WPL E;  4XJU A;  2UWO B;  2HTU A;  4YW1 A;  1V0E A;  2KNI A;  3CL2 A;  1C5K A;  1F7E A;  2QWF A;  1EGF A;  3DR2 A;  2F0Z A;  1USR A;  4XMI A;  4GU3 A;  4GNA A;  2Y80 B;  1LPK A;  4H52 A;  2W26 B;  1G1R A;  2ISM A;  2VWL L;  3IAX A;  3KQE L;  1KIT A;  5KIR A;  1CRU A;  4BBW A;  2F25 A;  4M4N A;  2YDP A;  1INW A;  2IVZ A;  3CYE A;  1W8N A;  2WYG B;  4FPH A;  3SOV A;  2BMG A;  2BQW A;  2CML A;  1QLG A;  2VW0 A;  3ZYJ B;  1N1T A;  4KS4 A;  2VSK A;  1IQG L;  1ATB A;  5GX1 A;  3R05 A;  2HT5 A;  4K3Y A;  3H72 A;  4LOR A;  2HTR A;  3O4P A;  3HO3 A;  2FLG A;  2FLR L;  2QWJ A;  2P3F N;  4GJT A;  1CQE A;  2Y7X B;  4XHX A;  4FZH A;  3MDL A;  2KB9 A;  4D4U A;  1IVC A;  1MS9 A;  5L2Z L;  3V64 C;  1Z50 A;  1EAI C;  1QFK L;  2W2M E;  5JBA E;  1N1V A;  1NSB A;  3TIB A;  3ZGC A;  4AGT A;  3ALX A;  4QN5 A;  1HJ7 A;  3OLT A;  1F8C A;  4Y76 B;  4D0E A;  2FP9 A;  2ADX A;  3TH3 L;  1ATA A;  2GHS A;  4IYG A;  1L7G A;  1Z4Z A;  1IVD A;  2FZZ L;  1L7H A;  4FVK A;  1N1S A;  2GD4 A;  2SLI A;  2HOR A;  4K1I A;  1W0P A;  2IAS A;  3BYC A;  3N8Y A;  4K1K A;  1ING A;  5F19 A;  2DG0 A;  2VSM A;  2Y7Z B;  4K1H A;  2W3K B;  2IAU A;  5E8D A;  4FOV A;  5GX3 A;  4FPY A;  4G3N A;  4NN9 A;  1INH A;  2POO A;  1MS5 A;  4GN9 A;  2WFX B;  5KN5 C;  1MS3 A;  4FPG A;  3H5C B;  1W0O A;  4NCS A;  5M1Z A;  4OTY A;  4FPC A;  1VCU A;  1Z4Y A;  3NSS A;  1N7D A;  4FM5 A;  2VH0 B;  2NPR A;  3N8Z A;  2J4I B;  1EUS A;  3IIT B;  3H6J A;  4RRX A;  1IQK L;  1CX2 A;  1SO7 A;  4QN7 A;  4FJ6 A;  5D9B A;  2QWG A;  5I46 L;  4MWX A;  2UWL B;  1LQD A;  1NNA A;  4YW5 A;  3HS6 A;  4D52 C;  1YGC L;  4XJR A;  4GZS A;  5JVZ A;  3LI3 A;  1V04 A;  4ZXY L;  1FAK L;  2W38 A;  3B7E A;  5JB8 E;  3KRK A;  1FFM A;  3PJQ A;  4HW6 A;  3K36 A;  2GVV A;  2BF6 A;  4GEZ A;  2XZJ A;  3KK6 A;  5JVY A;  1MQ5 L;  3G4H A;  3V1S A;  4XJ9 A;  3CA7 A;  2DYH A;  1JV2 B;  3NJP C;  2SIM A;  3Q6P A;  3ZYI B;  3TZI A;  2W5N A;  4PWZ A;  2RNL A;  1SLL A;  4XMA A;  3LI4 A;  3KQC L;  2DG1 A;  2PHB B;  4AGI A;  1RWL A;  2J95 B;  1LMM A;  2YGQ A;  1ZGK A;  5JB9 E;  2BT7 A;  2ZB6 A;  4XLW A;  1YO8 A;  2XC0 L;  2FPB A;  2IAQ A;  4MWQ A;  1MS0 A;  4CPN A;  4A94 C;  4MZA A;  2XC4 L;  2W2O E;  5EGM B;  3M36 L;  4CHB A;  2KV4 A;  1KLO A;  1SUU A;  3T1E A;  5F9T A;  2RHP A;  3TC9 A;  4IQK A;  2VPJ A;  4GN8 A;  5FWW A;  4HHQ A;  1EUU A;  4XMB A;  1IOE L;  4GZT A;  1B9S A;  2XCY A;  1TOZ A;  1HAE A;  4B7R A;  4FOW A;  4XIL A;  4XJZ A;  2VVU L;  4CPY A;  4M3M A;  2P26 A;  3FVZ A;  3LAQ A;  2VVZ A;  2ZWA A;  4GNC A;  1KIG L;  4D0F A;  4N1B A;  3HLH A;  3OLU A;  1XOG A;  1U6D X;  2YA7 A;  2IAR A;  4WEG A;  7NN9 A;  1GK5 A;  4C1Y A;  3D11 A;  1ATD A;  5D9D A;  1G2M B;  2XC5 L;  3UC1 A;  2P28 B;  3K9X A;  2ZZK A;  5B2C A;  3KQD L;  4CUD A;  2YA8 A;  3D12 A;  1UZQ A;  2XBW L;  3FFG L;  2ZB5 A;  1X7A L;  4YZU B;  3TI5 A;  5FNR A;  1RWI A;  1Z4V A;  2YA4 A;  4GDI A;  5NN9 A;  1FAX L;  3TI8 A;  3GIS X;  1EUR A;  2BOH A;  1W8B L;  1COU A;  2HTV A;  1G2L B;  1EZQ B;  2I9B A;  1POO A;  4YW3 A;  3K38 A;  4MMZ B;  4Z0K B;  1OFZ A;  1Q7F A;  3ZGD A;  5FDQ A;  4XL1 A;  2MGR A;  2XZK A;  2HQS A;  4ZLR A;  2F28 A;  3DEM A;  3ENS A;  1N6E A;  1A4G A;  1USX A;  1EPI A;  1CRZ A;  4FPJ A;  2FD6 A;  3LC5 B;  1DDX A;  2QWK A;  1F7M A;  3AMR A;  4IFJ A;  1SLI A;  4BTU A;  4GZP A;  4YZ3 A;  1IQE L;  2HOX A;  1NMC A;  4GZO A;  1NN2 A;  2QWD A;  4FPF A;  1WCQ A;  1IP0 A;  1AUT L;  3HS5 A;  3NTG A;  3P5B L;  2MHP A;  5JBB E;  1WCS A;  1ADX A;  2C4A A;  2VK6 A;  1DX5 I;  2HTY A;  3N8W A;  1LK9 A;  1E8V A;  1MR5 A;  4D52 A;  2PUQ L;  1E8T A;  2EI6 B;  3BEQ A;  2HTW A;  3INB A;  2Y82 B;  1M1X B;  2IAX A;  4M4V A;  1PFX L;  1G1S A;  4XHB A;  2BZ6 L;  1DIL A;  1IUC A;  2WPJ E;  1IVF A;  4YT6 L;  2VWN L;  2DDU A;  2XBV L;  1V0Z A;  3HRP A;  4IN4 A;  3U0S A;  2P3T A;  4A7I A;  4O1Z A;  1KLI L;  2FHR A;  3KYA A;  4YZ4 A;  2K2T A;  4UOU A;  2TGF A;  2YA6 A;  1IVO C;  1MS8 A;  4ISH L;  1EQG A;  3HS7 A;  2Z32 A;  4XJW A;  1UZJ A;  3ADE A;  2W2N E;  1CCF A;  3WWA A;  4X8S L;  3BT1 A;  1W8O A;  5D9C A;  3U7U G;  1V3B A;  1JL9 A;  3KCG L;  1WHF A;  2HT7 A;  3N8W B;  3PGH A;  1V1H A;  3Q3K B;  2BQ7 A;  2IAV A;  2P4O A;  4O02 B;  4ZY3 A;  1HAF A;  1CVU A;  4XBM A;  1TLE A;  2DSO A;  5HUN A;  1P0S L;  1MZ6 A;  1PXX A;  3F1S B;  1CQ1 A;  2YGO A;  4RS0 A;  1F8B A;  4M10 A;  4BTI A;  1W21 A;  1IQF L;  1ZI0 A;  2AEP A;  3II7 A;  5FNU A;  1IQI L;  1EQH A;  1HT8 A;  4XIO A;  4ZHA B;  4GZX A;  2P94 L;  4C1Y B;  1VCJ A;  1K32 A;  4Y79 B;  4GN7 A;  2D1J B;  3A9H A;  3S2K A;  2VWM K;  3LTG D;  2JKB A;  3A71 A;  1HRF A;  1HX2 A;  4KS1 A;  1BJI A;  3F6U L;  2QWB A;  4NGA L;  4XIK A;  4XYX A;  1B9W A;  2BER A;  2G8S A;  5EO8 A;  1XFE A;  1IQL L;  2YA5 A;  4Y71 B;  4D8S A;  2F27 A;  2J94 B;  2W3I B;  2H9E L;  2J2U B;  4COX A;  1DIM A;  4IFN X;  2AGS A;  1OB1 C;  1V1I A;  1P9J A;  3TI3 A;  3Q6K A;  2BAT A;  3NT1 A;  1S1D A;  2VVC K;  2AEQ A;  2JJL A;  2Y5G L;  2WYJ B;  1NZI A;  3A9G A;  4MZE A;  1EMN A;  4UF7 A;  1U67 A;  2W8B B;  4A0P A;  3JU4 A;  2C4L A;  2F24 A;  3TK5 B;  1MS4 A;  1Z4X A;  4MWV A;  2IAW A;  4QN4 A;  4CPZ A;  3CEN L;  1YUK B;  2VK5 A;  2QWE A;  1G1Q A;  4YT7 L;  5HUG A;  4BXS A;  3LN1 A;  1NCA N;  2B7D L;  3LTF B;  1HCG B;  2WPK E;  4LMF A;  5FNT A;  4YZ1 A;  4GU4 A;  4X8T L;  3HPT A;  4CUF A;  1PRH A;  2QWA A;  3TI4 A;  3C9A C;  1V3D A;  2GVU A;  4RRW A;  2SIL A;  5FNQ A;  4XJA A;  3TIC A;  1EUT A;  4FPE A;  4KS3 A;  4J9T A;  1DQB A;  2X9M A;  1YUF A;  4CH9 A;  1CEJ A;  1IVE A;  5GX4 A;  1F0R B;  1PGE A;  1BF9 A;  2I9A A;  4Y7B B;  2F9B L;  2BOU A;  4CSY A;  2F10 A;  4IFL X;  3GVL A;  3SIL A;  3M37 L;  2OYE P;  4CUE A;  5FZN A;  2P3F L;  4YY8 A;  3WDZ A;  3HO4 A;  2WG3 C;  3IJE B;  1EPJ A;  2MGP A;  4FP2 A;  4NG9 L;  1MS1 A;  4Q6K A;  3SRE A;  4HZY A;  1L3Y A;  2K2S B;  3CKZ A;  3KGG A;  2WPH E;  3S8V A;  2BZD A;  2W5O A;  3GVJ A;  3U73 A;  2YGP A;  1LPG A;  5K0H B;  4FOY A;  3GVK A;  5CKQ A;  1NNB A;  4I00 A;  2RKC A;  4HHO A;  1EPH A;  4L7B A;  4TGF A;  2F29 A;  4GDJ A;  4B7N A;  4X8V L;  2XZI A;  4X4A A;  4AHA A;  1V3C A;  3TI6 A;  2HU0 A;  5HX0 A;  2Y81 B;  2XBX L;  2W86 A;  2WPM E;  2XBY L;  1RFN B;  2VWO L;  4B7M A;  5B2D A;  1FF7 A;  5L30 L;  3CS7 L;  3QH0 A;  2J38 B;  4SLI A;  6NN9 A;  3S6X A;  6COX A;  2ZW9 A;  2OYU P;  4MJV A;  4XJ8 A;  2W2P E;  2PR3 B;  5L2Y L;  1SZB A;  5CIS A;  2WPI E;  4JZE L;  3L6V A;  1HRE A;  2IAP A;  3FW0 A;  3S94 A;  4X49 A;  3LC3 B;  4ISI L;  5CKN A;  3NTB A;  1DIY A;  2EI8 B;  2RA0 L;  1S0I A;  5JBC E;  2F13 A;  2VK7 A;  2XN4 A;  2WFT A;  4HZW A;  3G4E A;  4XJQ A;  5GX5 A;  2VVV L;  4D90 A;  1HZ8 A;  3SAL A;  4QN3 A;  1WHE A;  2VW2 A;  4Q1U A;  5JYY A;  1W20 A;  4MWL A;  2EI7 B;  5CKM A;  1MWE A;  1APQ A;  1EBV A;  2IAO A;  4GB1 A;  4AQT A;  4Z6A L;  1NCC N;  3E5Z A;  3Q7D A;  3ELA L;  4B7Q A;  4GNB A;  1MOX C;  1APO A;  1S18 A;  4M11 A;  3LIW B;  2GVW A;  4O5S A;  4YZ2 A;  1JBU L;  3MQE A;  1MQ6 L;  4CPM A;  1HT5 A;  1NPE A;  5IKQ A;  3K39 A;  1V2I A;  1E8U A;  1KKE A;  3EGF A;  3Q6T A;  2QWH A;  1B9T A;  2Y38 A;  3TGF A;  2F12 A;  2IAT A;  1IVG A;  4ZH8 B;  4Z0L A;  3H71 A;  5EX7 A;  4FPL A;  1LPZ A;  4XE9 A;  4DGR A;  1L5G B;  1L7F A;  4GZQ A;  4WEF A;  1NT0 A;  2GVX A;  2UWP B;  2W2Q E;  4ZAE B;  4OTJ A;  3SOB B;  2BOK L;  4M4U A;  1C5M F;  3N8V A;  2HT8 A;  5F1A A;  3POY A;  1NSC A;  1CCV A;  1URK A;  4FOQ A;  1X2R A;  1KSN B;  2FP8 A;  4JYU L;  1Q4G A;  1F8E A;  4JYV L;  1N6D A;  3BT2 A;  4RRZ A;  3NN9 A;  1EPG A;  4NC5 A;  5HUK A;  1INF A;  1IQJ L;  1NMA N;  1I0U A;  3W09 A;  1V3X B;  1NQL B;  1U8C B;  2VJ3 A;  1SNT A;  2F11 A;  5F72 C;  2CJI B;  2P3U A;  5GTQ A;  3GCW E;  2BO2 A;  3BPS E;  4R40 A;  1NCB N;  4YW2 A;  3QCW A;  4B7J A;  1EMO A;  2OJH A;  3TK6 B;  1N6F A;  2Y5F L;  4YZ5 A;  5GX2 A;  4G1M B;  1NSD A;  3VNG A;  3KQB L;  3A72 A;  2BQ6 A;  4MX0 A;  5FNS A;  2J34 B;  3ZYG A;  2W20 A;  1IQM L;  3HLI A;  1INV A;  4X47 A;  5CGJ A;  4FPO B;  4MC7 A;  4MWY A;  1N1Y A;  4E1G A;  3S8Z A;  1H6L A;  5H47 A;  1INY A;  3SW2 A;  1FSB A;  1O5D L;  4X6K A;  2Q1J B;  2BSF A;  2AYL A;  4BDX A;  4BDW A;  4FQ4 A;  4L7D A;  3SLI A;  3ASI A;  5IKR A;  4WA4 A;  4D52 B;  1PTH A;  2P16 L;  4KS2 A;  1ATE A;  4BXW A;  3K37 A;  2P95 L;  1N1I A;  2H2U A;  4CSD A;  4DG6 A;  4Y7A B;  1W1X A;  1KLJ L;  2B8H A;  4IMB A;  2AH2 A;  4ZXX L;  1Z6E L;  4Y6D B;  1Z6C A;  4PH9 A;  2HU4 A;  2H9E C;  3RR3 A;  5HUM A;  4XOG A;  1QIU A;  1IQH L;  2YDT A;  4HZV A;  4K1J A;  5FZJ A;  2G00 L;  1A4Q A;  2WZP P;  2QWI A;  4ZGC A;  1F8D A;  4CPL A;  3LI5 A;  3K3A A;  1F0S B;  2JKH L;  1IUB A;  4RUT A;  2FPC A;  4O5T A;  1XDT R;  1K37 A;  1QBI A;  1XKA L;  2F26 A;  3ALW A;  4JZD L;  1E1A A;  1CVW L;  1DVA L;  1IOX A;  1IVB A;  2VW1 A;  1UZP A;  3OPZ A;  5EO7 A;  4RRY A;  3TBD A;  1FE2 A;  3V65 B;  1CVM A;  1PJX A;  1V0F A;  2FLU X;  2QWC A;  3QMO A;  2VAQ A;  3CL0 A;  3KL6 B;  1NPE B;  1A3P A;  5JW1 A;  4FPK A;  1B9V A;  4HZX A;  2VH6 B;  1INX A;  1NFX B;  3SOQ A;  4QNP A;  3FCS B;  4HIZ A;  3FBY A;  4JML A;  1UZK A;  5COX A;  1A14 N;  4L7C A;  1ZAQ A;  5IKT A;  4YW4 A;  3HO5 A;  3WN7 A;  2M74 A;  1TPG A;  3O9K A;  2VRS A;  5IKV A;  1W7X L;  2VWD A;  2A75 A;  3SRG A;  4MMX B;  2KL7 A;  2P93 L;  3H73 A;  3I1C A;  1NFU B;  3AMS A;  1XKB A;  3GCX E;  3N8Y B;  2HTQ A;  3B69 A;  4FP3 A;  4MWU A;  4AH4 A;  1WU1 B;  4JZF L;  1NMB N;  3SAN A;  1NFW B;  1K36 A;  4MWR A;  1FJS L; 
#chains in the Genus database with same CATH homology
 3WW9 A;  1IQN L;  1G1T A;  1J9C L;  4BTT A;  4X8U L;  1IGZ A;  3N8X A;  2Y5H L;  2W8B A;  1IJQ A;  2V91 A;  4C16 A;  1LMJ A;  1IGX A;  3DAS A;  1NFY B;  3LN0 A;  1YUG A;  2QE8 A;  2FLB L;  1C9U A;  4NA9 L;  4MMY B;  3CFW A;  2BOX A;  2WG4 B;  2WPL E;  2UWO B;  2KNI A;  1C5K A;  1F7E A;  1EGF A;  3DR2 A;  4GNA A;  2Y80 B;  1LPK A;  2W26 B;  1G1R A;  2ISM A;  2VWL L;  3IAX A;  3KQE L;  5KIR A;  1CRU A;  2IVZ A;  2WYG B;  3SOV A;  2BMG A;  2BQW A;  1QLG A;  3ZYJ B;  1IQG L;  1ATB A;  5GX1 A;  3R05 A;  4LOR A;  3O4P A;  3HO3 A;  2FLG A;  2FLR L;  2P3F N;  1CQE A;  2Y7X B;  3MDL A;  2KB9 A;  5L2Z L;  3V64 C;  1EAI C;  1QFK L;  2W2M E;  5JBA E;  1HJ7 A;  3OLT A;  4Y76 B;  4D0E A;  2FP9 A;  2ADX A;  3TH3 L;  1ATA A;  2GHS A;  4IYG A;  2FZZ L;  2GD4 A;  2IAS A;  3BYC A;  3N8Y A;  5F19 A;  2DG0 A;  2Y7Z B;  2W3K B;  2IAU A;  5E8D A;  5GX3 A;  2POO A;  4GN9 A;  2WFX B;  5KN5 C;  3H5C B;  4OTY A;  1N7D A;  4FM5 A;  2VH0 B;  2NPR A;  3N8Z A;  2J4I B;  3IIT B;  4RRX A;  1IQK L;  1CX2 A;  5D9B A;  5I46 L;  2UWL B;  1LQD A;  3HS6 A;  1YGC L;  5JVZ A;  3LI3 A;  1V04 A;  4ZXY L;  1FAK L;  5JB8 E;  3KRK A;  1FFM A;  4HW6 A;  2GVV A;  3KK6 A;  5JVY A;  1MQ5 L;  3G4H A;  3V1S A;  3CA7 A;  1JV2 B;  3NJP C;  3Q6P A;  4PWZ A;  3ZYI B;  3TZI A;  2RNL A;  3LI4 A;  3KQC L;  2DG1 A;  2PHB B;  1RWL A;  2J95 B;  1LMM A;  2YGQ A;  5JB9 E;  4XLW A;  1YO8 A;  2XC0 L;  2FPB A;  2IAQ A;  4A94 C;  2XC4 L;  2W2O E;  5EGM B;  3M36 L;  2KV4 A;  1KLO A;  2RHP A;  3TC9 A;  5FWW A;  4GN8 A;  4HHQ A;  1IOE L;  1TOZ A;  1HAE A;  2VVU L;  2P26 A;  3FVZ A;  3LAQ A;  4GNC A;  1KIG L;  4D0F A;  3HLH A;  3OLU A;  2IAR A;  1GK5 A;  5D9D A;  1ATD A;  1G2M B;  2XC5 L;  2P28 B;  3K9X A;  3KQD L;  4CUD A;  1UZQ A;  2XBW L;  3FFG L;  1X7A L;  4YZU B;  1RWI A;  1FAX L;  3GIS X;  2BOH A;  1W8B L;  1COU A;  1G2L B;  1EZQ B;  2I9B A;  1POO A;  4MMZ B;  4Z0K B;  1Q7F A;  5FDQ A;  4XL1 A;  2MGR A;  2HQS A;  4ZLR A;  3DEM A;  3ENS A;  1EPI A;  1CRZ A;  2FD6 A;  3LC5 B;  1DDX A;  3AMR A;  1F7M A;  4BTU A;  1IQE L;  1IP0 A;  1AUT L;  3HS5 A;  3NTG A;  3P5B L;  2MHP A;  5JBB E;  3HLI A;  1ADX A;  1DX5 I;  3N8W A;  2PUQ L;  2EI6 B;  2Y82 B;  1M1X B;  2IAX A;  1PFX L;  1G1S A;  2BZ6 L;  2WPJ E;  4YT6 L;  2VWN L;  2DDU A;  2XBV L;  3HRP A;  3U0S A;  2P3T A;  4A7I A;  4O1Z A;  1KLI L;  3KYA A;  2K2T A;  2TGF A;  1IVO C;  4ISH L;  1EQG A;  3HS7 A;  1UZJ A;  3WWA A;  2W2N E;  1CCF A;  4X8S L;  3BT1 A;  5D9C A;  3U7U G;  1JL9 A;  3KCG L;  1WHF A;  3N8W B;  3PGH A;  3Q3K B;  2BQ7 A;  2IAV A;  2P4O A;  4O02 B;  1HAF A;  1CVU A;  4XBM A;  1TLE A;  2DSO A;  1P0S L;  1PXX A;  3F1S B;  1CQ1 A;  2YGO A;  4RS0 A;  4M10 A;  4BTI A;  1IQF L;  1IQI L;  1EQH A;  1HT8 A;  4ZHA B;  2P94 L;  4GN7 A;  4Y79 B;  2D1J B;  3A9H A;  3S2K A;  2VWM K;  3LTG D;  1HRF A;  1HX2 A;  3F6U L;  4NGA L;  1B9W A;  2G8S A;  1XFE A;  1IQL L;  4Y71 B;  2J94 B;  2W3I B;  2H9E L;  2J2U B;  4COX A;  1OB1 C;  1P9J A;  3Q6K A;  3NT1 A;  2VVC K;  2Y5G L;  2WYJ B;  1NZI A;  3A9G A;  1EMN A;  1U67 A;  2W8B B;  4A0P A;  3TK5 B;  2IAW A;  3CEN L;  1YUK B;  1G1Q A;  4YT7 L;  4BXS A;  3LN1 A;  2B7D L;  3LTF B;  1HCG B;  2WPK E;  4LMF A;  4X8T L;  3HPT A;  4CUF A;  1PRH A;  3C9A C;  2GVU A;  4RRW A;  1DQB A;  1YUF A;  5GX4 A;  1CEJ A;  1F0R B;  1PGE A;  1BF9 A;  2I9A A;  4Y7B B;  2F9B L;  2BOU A;  4CSY A;  3M37 L;  2OYE P;  4CUE A;  2P3F L;  3HO4 A;  2WG3 C;  3IJE B;  1EPJ A;  2MGP A;  4NG9 L;  3SRE A;  1L3Y A;  2K2S B;  3KGG A;  3S8V A;  2WPH E;  3U73 A;  2YGP A;  1LPG A;  5K0H B;  5CKQ A;  4HHO A;  1EPH A;  4TGF A;  4X8V L;  2Y81 B;  2XBX L;  2W86 A;  2WPM E;  2XBY L;  1RFN B;  2VWO L;  1FF7 A;  5L30 L;  3CS7 L;  3QH0 A;  2J38 B;  3S6X A;  6COX A;  2OYU P;  2W2P E;  2PR3 B;  5L2Y L;  1SZB A;  5CIS A;  2WPI E;  4JZE L;  1HRE A;  2IAP A;  3FW0 A;  3S94 A;  3LC3 B;  4ISI L;  5CKN A;  3NTB A;  1DIY A;  2EI8 B;  2RA0 L;  5JBC E;  5GX5 A;  2WFT A;  3G4E A;  2VVV L;  4D90 A;  1HZ8 A;  1WHE A;  4Q1U A;  2EI7 B;  5CKM A;  1APQ A;  1EBV A;  2IAO A;  4AQT A;  4Z6A L;  3E5Z A;  3Q7D A;  3ELA L;  4GNB A;  1MOX C;  1APO A;  4M11 A;  3LIW B;  2GVW A;  4O5S A;  1JBU L;  3MQE A;  1MQ6 L;  1HT5 A;  1NPE A;  5IKQ A;  3EGF A;  3Q6T A;  2Y38 A;  3TGF A;  2IAT A;  4ZH8 B;  4Z0L A;  5EX7 A;  1LPZ A;  1L5G B;  1NT0 A;  2GVX A;  2UWP B;  2W2Q E;  4ZAE B;  4OTJ A;  3SOB B;  2BOK L;  1C5M F;  3N8V A;  5F1A A;  3POY A;  1CCV A;  1URK A;  1KSN B;  2FP8 A;  4JYU L;  1Q4G A;  4JYV L;  3BT2 A;  4RRZ A;  1EPG A;  1IQJ L;  1I0U A;  1V3X B;  1NQL B;  1U8C B;  2VJ3 A;  2CJI B;  2P3U A;  5GTQ A;  3GCW E;  2BO2 A;  3BPS E;  4R40 A;  3QCW A;  1EMO A;  2OJH A;  3TK6 B;  2Y5F L;  5GX2 A;  4G1M B;  3KQB L;  2BQ6 A;  2J34 B;  3ZYG A;  1IQM L;  3S8Z A;  4E1G A;  1H6L A;  3SW2 A;  1FSB A;  1O5D L;  2Q1J B;  2AYL A;  4BDX A;  4BDW A;  3ASI A;  5IKR A;  1PTH A;  2P16 L;  1ATE A;  4BXW A;  2P95 L;  1N1I A;  4DG6 A;  4Y7A B;  1KLJ L;  4IMB A;  4ZXX L;  1Z6E L;  4Y6D B;  1Z6C A;  4PH9 A;  2H9E C;  3RR3 A;  1IQH L;  2G00 L;  2WZP P;  3LI5 A;  1F0S B;  2JKH L;  4O5T A;  4RUT A;  2FPC A;  1XDT R;  1K37 A;  1QBI A;  1XKA L;  4JZD L;  1E1A A;  1CVW L;  1DVA L;  1IOX A;  1UZP A;  4RRY A;  3TBD A;  1FE2 A;  3V65 B;  1CVM A;  1PJX A;  3QMO A;  2VAQ A;  3KL6 B;  1NPE B;  1A3P A;  5JW1 A;  2VH6 B;  1NFX B;  3SOQ A;  3FCS B;  3FBY A;  4JML A;  1UZK A;  5COX A;  1ZAQ A;  5IKT A;  3HO5 A;  2M74 A;  1TPG A;  5IKV A;  1W7X L;  3SRG A;  4MMX B;  2KL7 A;  2P93 L;  3I1C A;  1NFU B;  3AMS A;  1XKB A;  3GCX E;  3N8Y B;  1WU1 B;  4JZF L;  1NFW B;  1K36 A;  1FJS L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...