3SOBB

The structure of the first ywtd beta propeller domain of lrp6 in complex with a fab
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
305
structure length
305
Chain Sequence
b'APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody light chain
publication title Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/immune system
total genus 77
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
B PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3sobB02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3sobB01
4ISIL 4D0EA 2GD4A 1X7AL 3LAQA 2FLGA 1KLIL 4RRXA 2AYLA 2TGFA 2CJIB 1PJXA 4JMLA 2XC0L 4Z0LA 2ISMA 1EMOA 5FWWA 1CEJA 5GX4A 4RS0A 2YGPA 5EGMB 4GN9A 3HLIA 1KLJL 2F9BL 3RR3A 2DDUA 3BT2A 3KRKA 2FD6A 4Y79B 3OLUA 1EAIC 4ZLRA 2Q1JB 2DSOA 1IOEL 2BMGA 2WPHE 3NTGA 4XBMA 2BOHA 1FFMA 5COXA 2W3KB 1QFKL 1PFXL 6COXA 1W7XL 3N8XA 3A9GA 3SRGA 1NQLB 3U0SA 1HZ8A 1WHEA 1EBVA 1DIYA 1I0UA 1KIGL 2P4OA 1C5KA 2FP8A 3N8YB 2XBVL 4NGAL 2IAPA 4X8VL 4C16A 3NT1A 1O5DL 2GVVA 1URKA 5L2YL 2UWLB 1CVWL 1HX2A 1EZQB 1FF7A 1EPGA 1V04A 1JL9A 1K37A 1M1XB 1F7MA 4O1ZA 4YT6L 2VWNL 5CISA 2J2UB 1EPHA 4MMXB 1L5GB 2Y5GL 3KL6B 5D9BA 1P9JA 1CX2A 3KQCL 1NFWB 1P0SL 2WPME 1CQ1A 1JBUL 4XLWA 1IQFL 3BPSE 3Q7DA 3I1CA 3SOBB 2I9AA 3ZYGA 4ZXYL 2BO2A 4PWZA 2G8SA 3HS7A 3V1SA 2XBWL 3N8VA 1NZIA 1IJQA 2P26A 1V3XB 5JVYA 2XC4L 3SOVA 4X8SL 3HLHA 4DG6A 1NPEB 3NTBA 2W8BA 1HJ7A 2VVCK 5JBCE 2DG1A 4Y7BB 1BF9A 1DX5I 5JBAE 2FZZL 1APQA 4BTIA 4ISHL 1IQNL 1G1TA 2W2PE 1EQGA 3DEMA 2V91A 1U67A 2BQ7A 3TK6B 1IGXA 1HREA 4BTUA 2G00L 1GK5A 3A9HA 4BDWA 3HRPA 4O02B 1HT8A 3OLTA 4Y7AB 1IQJL 2IAQA 4CUDA 5GX5A 2PHBB 3M36L 5CKNA 3MQEA 2P95L 3K9XA 1Z6CA 2KV4A 5L30L 2XC5L 1Q7FA 2GVWA 2WFXB 1C9UA 2BOKL 3ZYJB 3F1SB 1G1QA 1DDXA 1G1SA 1LQDA 2IAUA 3V65B 2P94L 2MGPA 3CA7A 3TC9A 5GX2A 1U8CB 3ZYIB 1IGZA 1YUKB 3IITB 3N8WA 2VH6B 1EPIA 1FAXL 2WFTA 5E8DA 3F6UL 1MOXC 1EGFA 3U73A 3FVZA 2DG0A 3V64C 3TGFA 2Y7ZB 3O4PA 1PTHA 1PRHA 2IATA 2UWOB 1IQKL 3KCGL 2EI6B 2P3UA 3EGFA 1CRUA 1LPZA 4OTJA 5GX3A 2WYGB 1HAEA 1EQHA 2OJHA 2Y82B 2MGRA 3S8VA 1KSNB 1CVMA 4JZFL 3CS7L 1MQ5L 3LTFB 4X8UL 2YGOA 2IAVA 2IAXA 1RWIA 3S8ZA 2XBXL 1YO8A 5I46L 3AMSA 2M74A 3LC3B 1IQML 2Y5FL 2VJ3A 1IQEL 1NT0A 3PGHA 4CUEA 1PGEA 2P93L 4CSYA 2H9EL 2IAOA 2J34B 5F19A 4A7IA 1K36A 2WYJB 4TGFA 3IAXA 1G2LB 1TOZA 3Q6KA 3KQEL 4RRYA 2IASA 2J94B 1NFYB 1EMNA 4GNCA 1LPGA 1UZJA 3TZIA 5GX1A 1HAFA 2OYEP 3M37L 2RA0L 1CVUA 1DVAL 1IQHL 2J95B 2XBYL 1LPKA 4O5TA 1IQIL 4JYUL 3ENSA 3C9AC 2WPKE 1FE2A 3FFGL 1C5MF 1XKBA 2WG3C 2PUQL 3LN1A 1NFUB 4R40A 4GN7A 4IYGA 4BDXA 3QMOA 1COUA 1YUFA 2HQSA 1CRZA 4MMYB 2P3FL 4M10A 2VWMK 5IKRA 1FAKL 2WPJE 3HS6A 2JKHL 4GNAA 5JW1A 1ATDA 2VH0B 2FP9A 3SOQA 4A0PA 3WW9A 2EI8B 3LI3A 3N8YA 3KYAA 2RHPA 5D9DA 3AMRA 1FSBA 2W2OE 1G2MB 2PR3B 2FLRL 3LI5A 1HRFA 1IVOC 2D1JB 4JYVL 3BT1A 3TK5B 2OYUP 1YGCL 2BQ6A 1W8BL 4NG9L 5JVZA 1QBIA 2KB9A 1IQGL 1TPGA 2Y81B 3H5CB 5D9CA 3Q6PA 1J9CL 1UZPA 4NA9L 3HO4A 2VWLL 4BXSA 5JB8E 4LORA 1QLGA 1Q4GA 4RRWA 5EX7A 2I9BA 1HT5A 3LIWB 3FBYA 3LTGD 4Y6DB 3SW2A 4BXWA 1XDTR 4MMZB 3IJEB 3GCXE 4HHOA 3GISX 2GVXA 4O5SA 1G1RA 1IP0A 2W2QE 5F1AA 1ZAQA 2Y80B 4RUTA 3P5BL 2WG4B 3SREA 1OB1C 1NPEA 4LMFA 2GHSA 1UZQA 3S2KA 1PXXA 1A3PA 4HW6A 2W8BB 1H6LA 3FCSB 2GVUA 5CKQA 2W2NE 1FJSL 4PH9A 5KN5C 2K2TA 4Y71B 3FW0A 1XFEA 5IKVA 1WHFA 2FLBL 3HO3A 3NJPC 1IQLL 4RRZA 2EI7B 4X8TL 1E1AA 3GCWE 5CKMA 3KQBL 2POOA 2QE8A 3WWAA 1YUGA 5IKTA 2IARA 1DQBA 2IAWA 1HCGB 3HO5A 4JZEL 3ELAL 5JB9E 4HHQA 2BQWA 1AUTL 2B7DL 2MHPA 2W3IB 1F0RB 3E5ZA 3R05A 4YT7L 3KGGA 1L3YA 5L2ZL 4ZH8B 1Z6EL 2VWOL 3CENL 5FDQA 2RNLA 4D90A 3QCWA 2J4IB 1F7EA 1N1IA 4Z6AL 4XL1A 2WPLE 5GTQA 2VVVL 2P28B 2FPBA 1NFXB 3HS5A 4Q1UA 3MDLA 4BTTA 1B9WA 4ZHAB 1CCFA 2BOUA 1MQ6L 3TBDA 4M11A 1XKAL 3LC5B 4D0FA 5JBBE 1IOXA 2VAQA 4GNBA 4IMBA 2W86A 3Q3KB 3G4HA 2P3TA 3CFWA 1CQEA 3N8WB 4FM5A 3DR2A 2P3FN 3LI4A 1APOA 2VVUL 3G4EA 2W2ME 4Z0KB 1TLEA 4G1MB 1RWLA 5IKQA 2NPRA 2Y5HL 1ATAA 4Y76B 1SZBA 4COXA 1JV2B 2BOXA 2Y7XB 3LN0A 3KQDL 3TH3L 2FPCA 2K2SB 2BZ6L 3HPTA 4JZDL 1N7DA 2IVZA 2KL7A 2UWPB 1POOA 1WU1B 3N8ZA 4GN8A 3ASIA 2P16L 4CUFA 4E1GA 3S94A 2Y38A 4AQTA 2J38B 4YZUB 1CCVA 1RFNB 3QH0A 2ADXA 4ZAEB 3BYCA 1UZKA 3DASA 4OTYA 1EPJA 1ADXA 5K0HB 1LMJA 3POYA 1ATBA 2W26B 3KK6A 2WPIE 1ATEA 1KLOA 3U7UG 5KIRA 4ZXXL 3Q6TA 1F0SB
chains in the Genus database with same CATH superfamily
3O9JA 4ISIL 4D0EA 2VK5A 2GD4A 4MWWA 1X7AL 3LAQA 2FLGA 1IVFA 3CYEA 2ZZKA 1KLIL 4RRXA 3ALWA 2AYLA 2TGFA 2CJIB 1PJXA 4YW2A 4JMLA 2XC0L 4Z0LA 3T1EA 4XOGA 2FLUX 1INYA 1EMOA 2ISMA 5FWWA 1CEJA 5GX4A 4RS0A 3VNGA 2YGPA 2SIMA 1MS5A 1IVGA 4IFJA 5EGMB 4GN9A 1INGA 3HLIA 1KLJL 2F9BL 4HZZA 3RR3A 2DDUA 1W0PA 3BT2A 3KRKA 2FD6A 4Y79B 4ZY3A 3OLUA 4AH4A 1EAIC 3WDZA 4ZLRA 2Q1JB 2DSOA 1IOEL 2BMGA 2WPHE 3NTGA 4XBMA 1WCQA 4GDJA 2BOHA 2F13A 2W5NA 2DYHA 1FFMA 5COXA 1F8EA 2W3KB 2HU0A 4MWVA 4QN3A 4C1YA 1QFKL 2B8HA 1PFXL 6COXA 1W7XL 1N1TA 4L7BA 3N8XA 4KS4A 3A9GA 1VCJA 3SRGA 1N6FA 6NN9A 1IVCA 4MJUA 1NQLB 5FZJA 1XOGA 3U0SA 1HZ8A 2QWGA 1WHEA 7NN9A 1EBVA 1DIYA 1I0UA 1KIGL 2P4OA 1C5KA 5HUMA 2FP8A 2JJLA 1MWEA 3N8YB 1X2JA 4D52B 5HUKA 2XBVL 5M1ZA 4NGAL 1ZGKA 3CL0A 2H9EC 1NMAN 1F8CA 2IAPA 4X8VL 4C16A 3NT1A 1O5DL 3H72A 4FOQA 2GVVA 1URKA 1IUBA 5EO7A 5L2YL 1INVA 2UWLB 1CVWL 1HX2A 5FNTA 5F72C 1EZQB 1FF7A 2HT5A 1EPGA 1V04A 4M4NA 1JL9A 1K37A 1M1XB 1F7MA 4O1ZA 1Z50A 4FPCA 4YT6L 4MWRA 2SLIA 4G3NA 2VWNL 5CISA 2FHRA 4IN4A 2W5OA 2J2UB 2ZB5A 1A4GA 1S1DA 1EPHA 4MMXB 1L5GB 2Y5GL 3KL6B 1E8TA 2BERA 2QWJA 2W20A 2XZKA 3K37A 5D9BA 3TI6A 4CHBA 2HT8A 1P9JA 5B2CA 1CX2A 4YZ1A 3KQCL 4YZ4A 1MS3A 1NFWB 1P0SL 4H53A 1V3BA 2HTVA 2BT7A 2WPME 3A72A 4X47A 3WN7A 1W0OA 1CQ1A 1JBUL 4AHAA 4XLWA 1IQFL 3BPSE 1EURA 1L7GA 3Q7DA 3D12A 4QN4A 3I1CA 3SOBB 4CPYA 2I9AA 3ZYGA 4ZXYL 2BO2A 1VCUA 2H2NA 4M3MA 4PWZA 3TI4A 2AH2A 2G8SA 3HS7A 3V1SA 1MZ5A 2XBWL 3N8VA 2VK7A 1NZIA 1IJQA 2H2UA 1V3EA 2P26A 1V3XB 5JVYA 4MC7A 2XC4L 3SOVA 3W09A 4X8SL 3HLHA 4DG6A 1NPEB 3NTBA 1B9TA 4GEZA 2W8BA 4FJ6A 1SLLA 1HJ7A 2VVCK 5JBCE 2DG1A 4Y7BB 1BF9A 1NNCA 2BT8A 4MWUA 1DX5I 4YZ2A 5JBAE 1MR5A 2FZZL 1APQA 4BTIA 4ISHL 1IQNL 2XCYA 4FPLA 1MS1A 1G1TA 2W2PE 1MS4A 1V3DA 1MZ6A 1EQGA 3DEMA 4QN7A 4ZGCA 2V91A 1U67A 2BQ7A 2HORA 3TK6B 3UC1A 1IGXA 4YW4A 3ALXA 4K3YA 1HREA 4BTUA 2G00L 1GK5A 1EUUA 3A9HA 4BDWA 4J9TA 4XJUA 3HRPA 4FPOB 4O02B 4NCSA 1WP5A 2F27A 1HT8A 3OLTA 4Y7AB 1S18A 1IQJL 2IAQA 4Q6KA 4CUDA 5GX5A 2PHBB 2W38A 3M36L 5CKNA 3MQEA 2BATA 2YA6A 2P95L 2VSMA 2HTWA 3K9XA 5FNSA 1Z6CA 2KV4A 5L30L 2XC5L 2HTQA 4GZSA 1Q7FA 1A14N 2GVWA 2WFXB 2F12A 1BJIA 2BSFA 4I00A 1C9UA 2BOKL 1IUCA 3ZYJB 3F1SB 2QWEA 4WEGA 1G1QA 3A71A 4DGRA 1DDXA 1G1SA 2VPJA 3ZGCA 1LQDA 2IAUA 4HZXA 3V65B 1NNBA 4D8SA 5EO8A 1W8OA 4YZ5A 2P94L 4FVKA 2MGPA 3CA7A 4QN6A 3TC9A 2YDPA 5GX2A 4L7CA 4X6KA 4AGTA 1U8CB 4GB1A 4YY8A 3D11A 4FZHA 4MWQA 3S6XA 3K36A 3ZYIB 4UOUA 3TIBA 1IGZA 1YUKB 2HTYA 3IITB 1B9SA 2VH6B 1EPIA 3N8WA 4QN5A 1FAXL 2WFTA 5E8DA 1OFZA 2AEQA 4UF7A 3F6UL 2AEPA 4M4VA 4GZXA 3K39A 1MOXC 1EGFA 1W20A 1EUSA 3U73A 3FVZA 2DG0A 2BF6A 1V1IA 3V64C 1NCBN 3TGFA 2ZB6A 3H6JA 2X9MA 4XMAA 2Y7ZB 3O4PA 1PTHA 1PRHA 1NMBN 4GZQA 4NC5A 2IATA 2VW0A 2UWOB 5B2DA 1IQKL 3KCGL 2EI6B 1SNTA 1USRA 2P3UA 3TI5A 3EGFA 1CRUA 1MS8A 1LPZA 4JF7A 3BEQA 4OTJA 5GX3A 2WYGB 3PJQA 1HAEA 1EQHA 2C4AA 2QWHA 4IFLX 2OJHA 2Y82B 2MGRA 4HIZA 3S8VA 1Z4ZA 1KSNB 2F24A 4KS1A 4A94C 1N6EA 4XMIA 1CVMA 4JZFL 3CS7L 1MQ5L 3LTFB 4FPEA 4X8UL 2YGOA 2IAVA 2IAXA 1RWIA 2VW2A 4GZOA 3S8ZA 2XBXL 2KNIA 1NCCN 1YO8A 5I46L 3AMSA 4GDIA 2M74A 1W8NA 3LC3B 1IQML 2Y5FL 2WZPP 2VJ3A 3II7A 1IQEL 1NT0A 3PGHA 1F8DA 4CUEA 3NO0A 1PGEA 2P93L 4K1JA 2YDTA 4CSYA 1INWA 2H9EL 2IAOA 2J34B 4FPJA 5F19A 4A7IA 2YA7A 1K36A 4KS3A 2WYJB 2YGQA 4TGFA 3IAXA 1G2LB 5HX0A 1NMCA 1ZI0A 1TOZA 4WA5A 1Z4XA 3Q6KA 3KQEL 4RRYA 2CMLA 2F28A 2J94B 1NFYB 2IASA 1EMNA 4K1HA 4XE9A 4FPGA 1V0EA 4GNCA 4HZVA 4HZWA 1LPGA 1UZJA 4GZPA 3TZIA 4X49A 5GX1A 1HAFA 2OYEP 3M37L 4XYXA 2RA0L 1INHA 4FOYA 4MWJA 5NN9A 1LMMA 1CVUA 1DVAL 2HOXA 1IQHL 2QWCA 2J95B 1LK9A 2XBYL 1IVBA 1B9VA 1LPKA 4O5TA 1NNAA 1IQIL 4ASCA 4JYUL 3ENSA 3C9AC 2WPKE 1FE2A 1V1HA 2XZIA 3FFGL 1C5MF 4CPMA 1N1VA 1XKBA 2WG3C 2PUQL 3LN1A 1NFUB 4R40A 4GN7A 2HU4A 2RKCA 4IYGA 2VSKA 4GJTA 4BDXA 3QMOA 1COUA 1YUFA 2HQSA 1CRZA 4MMYB 4YZ3A 2P3FL 5F9TA 4M10A 2VWMK 5IKRA 1USXA 1FAKL 4GZTA 4N1BA 4C1YB 4K1KA 2WPJE 3HS6A 2JKHL 4GNAA 5JW1A 1ATDA 2VH0B 2FP9A 3SOQA 4NN9A 1L7HA 3GVLA 4XJZA 4B7NA 4A0PA 2JKBA 3WW9A 5FZNA 2EI8B 3LI3A 3N8YA 4D52A 1NSDA 3KYAA 4WA3A 2RHPA 5D9DA 3AMRA 1FSBA 1W1XA 2W2OE 4XMBA 1G2MB 4B7JA 4D4UA 2PR3B 4HZYA 2FLRL 1NCDN 1HRFA 3LI5A 1IVOC 2D1JB 4JYVL 2YA4A 3BT1A 1IVDA 3TK5B 2VVZA 4XJ8A 1N1SA 2OYUP 1YGCL 2BQ6A 1W8BL 4NG9L 4GU3A 1XOEA 5JVZA 1QBIA 2HT7A 2KB9A 5FNRA 2C4LA 1IQGL 1NSBA 3ADEA 1TPGA 2Y81B 3H5CB 4FOVA 4MJVA 3Q6PA 5D9CA 4CPOA 1J9CL 1UZPA 2QWFA 4XJRA 1NCAN 4NA9L 3HO4A 2VWLL 1SUUA 5JYYA 4BXSA 4QNPA 1S0JA 1DIMA 4FPFA 5JB8E 4LORA 1N6DA 4MWLA 1QLGA 2YA8A 1Q4GA 4RRWA 4CSDA 4XJQA 5EX7A 2I9BA 1E8VA 1HT5A 4FQ4A 3LIWB 3FBYA 3LTGD 4Y6DB 3SW2A 4BXWA 5H47A 4YW3A 1XDTR 1NN2A 4MMZB 2QWKA 3SILA 3IJEB 4XHXA 4YW5A 3GCXE 4HHOA 3GISX 2VWDA 1F8BA 4CPLA 4KS5A 2GVXA 4O5SA 1G1RA 4KS2A 3L6VA 1IP0A 2W2QE 3B69A 5F1AA 1ZAQA 5HUNA 2Y80B 4RUTA 2ZW9A 3P5BL 3SANA 2WG4B 3SREA 1OB1C 1NPEA 4LMFA 4WA4A 4IFNX 2GHSA 1UZQA 3S2KA 5CGJA 3GVJA 1PXXA 1A3PA 4HW6A 4L7DA 2W8BB 4B7RA 1H6LA 2HTUA 3FCSB 1NSCA 2GVUA 5CKQA 2W2NE 1Z4VA 1FJSL 4PH9A 5KN5C 2K2TA 4Y71B 2ZWAA 4AGIA 3FW0A 2XN4A 4XJAA 5FNUA 1XFEA 5IKVA 1WHFA 2FLBL 3HO3A 3NN9A 3NJPC 1IQLL 2F10A 3TIAA 4RRZA 1A4QA 2EI7B 4X8TL 1E1AA 3GCWE 5CKMA 3KQBL 1S0IA 2POOA 2QE8A 1E8UA 2VK6A 3WWAA 1YUGA 5IKTA 2AGSA 4WEFA 2IARA 1DQBA 4GU4A 2IAWA 4XJWA 2VRSA 1HCGB 3HO5A 4JZEL 3ELAL 5JB9E 4HHQA 3CL2A 2BQWA 1AUTL 2B7DL 2BZDA 3H71A 5FNQA 2MHPA 1WCSA 4M4UA 2W3IB 4FP3A 1F0RB 1INXA 3E5ZA 3R05A 4YT7L 3KGGA 1L3YA 3TI3A 1SO7A 5L2ZL 4XIOA 1V3CA 4ZH8B 1Z6EL 4SLIA 2VWOL 3CENL 5FDQA 2RNLA 4D90A 3QCWA 2J4IB 1F7EA 2F11A 3H73A 4FPYA 4FPKA 1Z4YA 1N1IA 4Z6AL 4XL1A 4FP2A 2WPLE 2SILA 2VVVL 4MX0A 5GTQA 2P28B 4D52C 2FPBA 4IQKA 1NFXB 4XILA 3HS5A 4K1IA 1QIUA 4Q1UA 3MDLA 4BTTA 1V0FA 1B9WA 1X2RA 4ZHAB 1CCFA 4X4AA 1V0ZA 2BOUA 1MQ6L 2QWIA 3TBDA 4XIKA 4M11A 1XKAL 3LC5B 4D0FA 5JBBE 1IOXA 1U6DX 2VAQA 4GNBA 2QWBA 3GVKA 4XHBA 3VNHA 2QWAA 4IMBA 2W86A 3Q3KB 3G4HA 4BBWA 2P3TA 4YW1A 3CFWA 1CQEA 3N8WB 4FM5A 3DR2A 4XJ9A 4FPHA 2P3FN 3B7EA 1APOA 2VVUL 3LI4A 1MS0A 2F0ZA 4B7QA 3G4EA 4FOWA 2W2ME 4Z0KB 1TLEA 1MS9A 1KKEA 4MZEA 3ZGDA 2WOZA 4G1MB 1RWLA 2F29A 5IKQA 2NPRA 2XZJA 2YA5A 2Y5HL 4CH9A 1ATAA 2VW1A 4Y76B 1SZBA 4COXA 1JV2B 2BOXA 2Y7XB 3LN0A 3INBA 4CPZA 1K32A 3KQDL 3TH3L 3TI8A 2FPCA 2K2SB 2BZ6L 3CKZA 3HPTA 4JZDL 4MWXA 1N7DA 1L7FA 2IVZA 2KL7A 2UWPB 1POOA 1WU1B 3N8ZA 1SLIA 4GN8A 3SLIA 4B7MA 3ASIA 1IVEA 4MWYA 2P16L 4CUFA 4E1GA 3S94A 2Y38A 2HTRA 4AQTA 3OPZA 2J38B 4YZUB 1CCVA 1V2IA 1W21A 4GZWA 4MZAA 1RFNB 3QH0A 2ADXA 4ZAEB 3BYCA 1UZKA 2QWDA 4OTYA 3DASA 1KITA 3SALA 1EPJA 3NSSA 1ADXA 1DILA 2Z32A 5HUGA 2F26A 5K0HB 1INFA 3K38A 1LMJA 4CPNA 1Z4WA 3TICA 3POYA 1ATBA 2W26B 3KK6A 2WPIE 1ATEA 3O9KA 3JU4A 4H52A 1KLOA 3U7UG 5KIRA 4ZXXL 1EUTA 2A75A 3K3AA 2F25A 3Q6TA 1N1YA 1F0SB
chains in the Genus database with same CATH topology
4ISIL 4D0EA 2GD4A 1X7AL 3LAQA 2FLGA 1KLIL 4RRXA 2AYLA 2TGFA 2CJIB 1PJXA 4JMLA 2XC0L 4Z0LA 2ISMA 1EMOA 5FWWA 1CEJA 5GX4A 4RS0A 2YGPA 5EGMB 4GN9A 3HLIA 1KLJL 2F9BL 3RR3A 2DDUA 3BT2A 3KRKA 2FD6A 4Y79B 3OLUA 1EAIC 4ZLRA 2Q1JB 2DSOA 1IOEL 2BMGA 2WPHE 3NTGA 4XBMA 2BOHA 1FFMA 5COXA 2W3KB 1QFKL 1PFXL 6COXA 1W7XL 3N8XA 3A9GA 3SRGA 1NQLB 3U0SA 1HZ8A 1WHEA 1EBVA 1DIYA 1I0UA 1KIGL 2P4OA 1C5KA 2FP8A 3N8YB 2XBVL 4NGAL 2H9EC 2IAPA 4X8VL 4C16A 3NT1A 1O5DL 2GVVA 1URKA 5L2YL 2UWLB 1CVWL 1HX2A 1EZQB 1FF7A 1EPGA 1V04A 1JL9A 1K37A 1M1XB 1F7MA 4O1ZA 4YT6L 2VWNL 5CISA 2J2UB 1EPHA 4MMXB 1L5GB 2Y5GL 3KL6B 5D9BA 1P9JA 1CX2A 3KQCL 1NFWB 1P0SL 2WPME 1CQ1A 1JBUL 4XLWA 1IQFL 3BPSE 3Q7DA 3I1CA 3SOBB 2I9AA 3ZYGA 4ZXYL 2BO2A 4PWZA 2G8SA 3HS7A 3V1SA 2XBWL 3N8VA 1NZIA 1IJQA 2P26A 1V3XB 5JVYA 2XC4L 3SOVA 4X8SL 3HLHA 4DG6A 1NPEB 3NTBA 2W8BA 1HJ7A 2VVCK 5JBCE 2DG1A 4Y7BB 1BF9A 1DX5I 5JBAE 2FZZL 1APQA 4BTIA 4ISHL 1IQNL 1G1TA 2W2PE 1EQGA 3DEMA 2V91A 1U67A 2BQ7A 3TK6B 1IGXA 1HREA 4BTUA 2G00L 1GK5A 3A9HA 4BDWA 3HRPA 4O02B 1HT8A 3OLTA 4Y7AB 1IQJL 2IAQA 4CUDA 5GX5A 2PHBB 3M36L 5CKNA 3MQEA 2P95L 3K9XA 1Z6CA 2KV4A 5L30L 2XC5L 1Q7FA 2GVWA 2WFXB 1C9UA 2BOKL 3ZYJB 3F1SB 1G1QA 1DDXA 1G1SA 1LQDA 2IAUA 3V65B 2P94L 2MGPA 3CA7A 3TC9A 5GX2A 1U8CB 3S6XA 3ZYIB 1IGZA 1YUKB 3IITB 2VH6B 1EPIA 3N8WA 1FAXL 2WFTA 5E8DA 3F6UL 1MOXC 1EGFA 3U73A 3FVZA 2DG0A 3V64C 3TGFA 2Y7ZB 3O4PA 1PTHA 1PRHA 2IATA 2UWOB 1IQKL 3KCGL 2EI6B 2P3UA 3EGFA 1CRUA 1LPZA 4OTJA 5GX3A 2WYGB 1HAEA 1EQHA 2OJHA 2Y82B 2MGRA 3S8VA 1KSNB 4A94C 1CVMA 4JZFL 3CS7L 1MQ5L 3LTFB 4X8UL 2YGOA 2IAVA 2IAXA 1RWIA 3S8ZA 2XBXL 2KNIA 1YO8A 5I46L 3AMSA 2M74A 3LC3B 1IQML 2Y5FL 2WZPP 2VJ3A 1IQEL 1NT0A 3PGHA 4CUEA 1PGEA 2P93L 4CSYA 2H9EL 2IAOA 2J34B 5F19A 4A7IA 1K36A 2WYJB 2YGQA 4TGFA 3IAXA 1G2LB 1TOZA 3Q6KA 3KQEL 4RRYA 2IASA 2J94B 1NFYB 1EMNA 4GNCA 1LPGA 1UZJA 3TZIA 5GX1A 1HAFA 2OYEP 3M37L 2RA0L 1LMMA 1CVUA 1DVAL 1IQHL 2J95B 2XBYL 1LPKA 4O5TA 1IQIL 4JYUL 3ENSA 3C9AC 2WPKE 1FE2A 3FFGL 1C5MF 1XKBA 2WG3C 2PUQL 3LN1A 1NFUB 4R40A 4GN7A 4IYGA 4BDXA 3QMOA 1COUA 1YUFA 2HQSA 1CRZA 4MMYB 2P3FL 4M10A 2VWMK 5IKRA 1FAKL 2WPJE 3HS6A 2JKHL 4GNAA 5JW1A 1ATDA 2VH0B 2FP9A 3SOQA 4A0PA 3WW9A 2EI8B 3LI3A 3N8YA 3KYAA 2RHPA 5D9DA 3AMRA 1FSBA 2W2OE 1G2MB 2PR3B 2FLRL 3LI5A 1HRFA 1IVOC 2D1JB 4JYVL 3BT1A 3TK5B 2OYUP 1YGCL 2BQ6A 1W8BL 4NG9L 5JVZA 1QBIA 2KB9A 1IQGL 1TPGA 2Y81B 3H5CB 5D9CA 3Q6PA 1J9CL 1UZPA 4NA9L 3HO4A 2VWLL 4BXSA 5JB8E 4LORA 1QLGA 1Q4GA 4RRWA 5EX7A 2I9BA 1HT5A 3LIWB 3FBYA 3LTGD 4Y6DB 3SW2A 4BXWA 1XDTR 4MMZB 3IJEB 3GCXE 4HHOA 3GISX 2GVXA 4O5SA 1G1RA 1IP0A 2W2QE 5F1AA 1ZAQA 2Y80B 4RUTA 3P5BL 2WG4B 3SREA 1OB1C 1NPEA 4LMFA 2GHSA 1UZQA 3S2KA 1PXXA 1A3PA 4HW6A 2W8BB 1H6LA 3FCSB 2GVUA 5CKQA 2W2NE 1FJSL 4PH9A 5KN5C 2K2TA 4Y71B 3FW0A 1XFEA 5IKVA 1WHFA 2FLBL 3HO3A 3NJPC 1IQLL 4RRZA 2EI7B 4X8TL 1E1AA 3GCWE 5CKMA 3KQBL 2POOA 2QE8A 3WWAA 1YUGA 5IKTA 2IARA 1DQBA 2IAWA 1HCGB 3HO5A 4JZEL 3ELAL 5JB9E 4HHQA 2BQWA 1AUTL 2B7DL 2MHPA 2W3IB 1F0RB 3E5ZA 3R05A 4YT7L 3KGGA 1L3YA 5L2ZL 4ZH8B 1Z6EL 2VWOL 3CENL 5FDQA 2RNLA 4D90A 3QCWA 2J4IB 1F7EA 1N1IA 4Z6AL 4XL1A 2WPLE 5GTQA 2VVVL 2P28B 2FPBA 1NFXB 3HS5A 4Q1UA 3MDLA 4BTTA 1B9WA 4ZHAB 1CCFA 2BOUA 1MQ6L 3TBDA 4M11A 1XKAL 3LC5B 4D0FA 5JBBE 1IOXA 2VAQA 4GNBA 4IMBA 2W86A 3Q3KB 3G4HA 2P3TA 3CFWA 1CQEA 3N8WB 4FM5A 3DR2A 2P3FN 3LI4A 1APOA 2VVUL 3G4EA 2W2ME 4Z0KB 1TLEA 4G1MB 1RWLA 5IKQA 2NPRA 2Y5HL 1ATAA 4Y76B 1SZBA 4COXA 1JV2B 2BOXA 2Y7XB 3LN0A 3KQDL 3TH3L 2FPCA 2K2SB 2BZ6L 3HPTA 4JZDL 1N7DA 2IVZA 2KL7A 2UWPB 1POOA 1WU1B 3N8ZA 4GN8A 3ASIA 2P16L 4CUFA 4E1GA 3S94A 2Y38A 4AQTA 2J38B 4YZUB 1CCVA 1RFNB 3QH0A 2ADXA 4ZAEB 3BYCA 1UZKA 3DASA 4OTYA 1EPJA 1ADXA 5K0HB 1LMJA 3POYA 1ATBA 2W26B 3KK6A 2WPIE 1ATEA 1KLOA 3U7UG 5KIRA 4ZXXL 3Q6TA 1F0SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISI L;  4D0E A;  2GD4 A;  1X7A L;  3LAQ A;  2FLG A;  1KLI L;  4RRX A;  2AYL A;  2TGF A;  2CJI B;  1PJX A;  4JML A;  2XC0 L;  4Z0L A;  2ISM A;  1EMO A;  5FWW A;  1CEJ A;  5GX4 A;  4RS0 A;  2YGP A;  5EGM B;  4GN9 A;  3HLI A;  1KLJ L;  2F9B L;  3RR3 A;  2DDU A;  3BT2 A;  3KRK A;  2FD6 A;  4Y79 B;  3OLU A;  1EAI C;  4ZLR A;  2Q1J B;  2DSO A;  1IOE L;  2BMG A;  2WPH E;  3NTG A;  4XBM A;  2BOH A;  1FFM A;  5COX A;  2W3K B;  1QFK L;  1PFX L;  6COX A;  1W7X L;  3N8X A;  3A9G A;  3SRG A;  1NQL B;  3U0S A;  1HZ8 A;  1WHE A;  1EBV A;  1DIY A;  1I0U A;  1KIG L;  2P4O A;  1C5K A;  2FP8 A;  3N8Y B;  2XBV L;  4NGA L;  2IAP A;  4X8V L;  4C16 A;  3NT1 A;  1O5D L;  2GVV A;  1URK A;  5L2Y L;  2UWL B;  1CVW L;  1HX2 A;  1EZQ B;  1FF7 A;  1EPG A;  1V04 A;  1JL9 A;  1K37 A;  1M1X B;  1F7M A;  4O1Z A;  4YT6 L;  2VWN L;  5CIS A;  2J2U B;  1EPH A;  4MMX B;  1L5G B;  2Y5G L;  3KL6 B;  5D9B A;  1P9J A;  1CX2 A;  3KQC L;  1NFW B;  1P0S L;  2WPM E;  1CQ1 A;  1JBU L;  4XLW A;  1IQF L;  3BPS E;  3Q7D A;  3I1C A;  3SOB B;  2I9A A;  3ZYG A;  4ZXY L;  2BO2 A;  4PWZ A;  2G8S A;  3HS7 A;  3V1S A;  2XBW L;  3N8V A;  1NZI A;  1IJQ A;  2P26 A;  1V3X B;  5JVY A;  2XC4 L;  3SOV A;  4X8S L;  3HLH A;  4DG6 A;  1NPE B;  3NTB A;  2W8B A;  1HJ7 A;  2VVC K;  5JBC E;  2DG1 A;  4Y7B B;  1BF9 A;  1DX5 I;  5JBA E;  2FZZ L;  1APQ A;  4BTI A;  4ISH L;  1IQN L;  1G1T A;  2W2P E;  1EQG A;  3DEM A;  2V91 A;  1U67 A;  2BQ7 A;  3TK6 B;  1IGX A;  1HRE A;  4BTU A;  2G00 L;  1GK5 A;  3A9H A;  4BDW A;  3HRP A;  4O02 B;  1HT8 A;  3OLT A;  4Y7A B;  1IQJ L;  2IAQ A;  4CUD A;  5GX5 A;  2PHB B;  3M36 L;  5CKN A;  3MQE A;  2P95 L;  3K9X A;  1Z6C A;  2KV4 A;  5L30 L;  2XC5 L;  1Q7F A;  2GVW A;  2WFX B;  1C9U A;  2BOK L;  3ZYJ B;  3F1S B;  1G1Q A;  1DDX A;  1G1S A;  1LQD A;  2IAU A;  3V65 B;  2P94 L;  2MGP A;  3CA7 A;  3TC9 A;  5GX2 A;  1U8C B;  3ZYI B;  1IGZ A;  1YUK B;  3IIT B;  3N8W A;  2VH6 B;  1EPI A;  1FAX L;  2WFT A;  5E8D A;  3F6U L;  1MOX C;  1EGF A;  3U73 A;  3FVZ A;  2DG0 A;  3V64 C;  3TGF A;  2Y7Z B;  3O4P A;  1PTH A;  1PRH A;  2IAT A;  2UWO B;  1IQK L;  3KCG L;  2EI6 B;  2P3U A;  3EGF A;  1CRU A;  1LPZ A;  4OTJ A;  5GX3 A;  2WYG B;  1HAE A;  1EQH A;  2OJH A;  2Y82 B;  2MGR A;  3S8V A;  1KSN B;  1CVM A;  4JZF L;  3CS7 L;  1MQ5 L;  3LTF B;  4X8U L;  2YGO A;  2IAV A;  2IAX A;  1RWI A;  3S8Z A;  2XBX L;  1YO8 A;  5I46 L;  3AMS A;  2M74 A;  3LC3 B;  1IQM L;  2Y5F L;  2VJ3 A;  1IQE L;  1NT0 A;  3PGH A;  4CUE A;  1PGE A;  2P93 L;  4CSY A;  2H9E L;  2IAO A;  2J34 B;  5F19 A;  4A7I A;  1K36 A;  2WYJ B;  4TGF A;  3IAX A;  1G2L B;  1TOZ A;  3Q6K A;  3KQE L;  4RRY A;  2IAS A;  2J94 B;  1NFY B;  1EMN A;  4GNC A;  1LPG A;  1UZJ A;  3TZI A;  5GX1 A;  1HAF A;  2OYE P;  3M37 L;  2RA0 L;  1CVU A;  1DVA L;  1IQH L;  2J95 B;  2XBY L;  1LPK A;  4O5T A;  1IQI L;  4JYU L;  3ENS A;  3C9A C;  2WPK E;  1FE2 A;  3FFG L;  1C5M F;  1XKB A;  2WG3 C;  2PUQ L;  3LN1 A;  1NFU B;  4R40 A;  4GN7 A;  4IYG A;  4BDX A;  3QMO A;  1COU A;  1YUF A;  2HQS A;  1CRZ A;  4MMY B;  2P3F L;  4M10 A;  2VWM K;  5IKR A;  1FAK L;  2WPJ E;  3HS6 A;  2JKH L;  4GNA A;  5JW1 A;  1ATD A;  2VH0 B;  2FP9 A;  3SOQ A;  4A0P A;  3WW9 A;  2EI8 B;  3LI3 A;  3N8Y A;  3KYA A;  2RHP A;  5D9D A;  3AMR A;  1FSB A;  2W2O E;  1G2M B;  2PR3 B;  2FLR L;  3LI5 A;  1HRF A;  1IVO C;  2D1J B;  4JYV L;  3BT1 A;  3TK5 B;  2OYU P;  1YGC L;  2BQ6 A;  1W8B L;  4NG9 L;  5JVZ A;  1QBI A;  2KB9 A;  1IQG L;  1TPG A;  2Y81 B;  3H5C B;  5D9C A;  3Q6P A;  1J9C L;  1UZP A;  4NA9 L;  3HO4 A;  2VWL L;  4BXS A;  5JB8 E;  4LOR A;  1QLG A;  1Q4G A;  4RRW A;  5EX7 A;  2I9B A;  1HT5 A;  3LIW B;  3FBY A;  3LTG D;  4Y6D B;  3SW2 A;  4BXW A;  1XDT R;  4MMZ B;  3IJE B;  3GCX E;  4HHO A;  3GIS X;  2GVX A;  4O5S A;  1G1R A;  1IP0 A;  2W2Q E;  5F1A A;  1ZAQ A;  2Y80 B;  4RUT A;  3P5B L;  2WG4 B;  3SRE A;  1OB1 C;  1NPE A;  4LMF A;  2GHS A;  1UZQ A;  3S2K A;  1PXX A;  1A3P A;  4HW6 A;  2W8B B;  1H6L A;  3FCS B;  2GVU A;  5CKQ A;  2W2N E;  1FJS L;  4PH9 A;  5KN5 C;  2K2T A;  4Y71 B;  3FW0 A;  1XFE A;  5IKV A;  1WHF A;  2FLB L;  3HO3 A;  3NJP C;  1IQL L;  4RRZ A;  2EI7 B;  4X8T L;  1E1A A;  3GCW E;  5CKM A;  3KQB L;  2POO A;  2QE8 A;  3WWA A;  1YUG A;  5IKT A;  2IAR A;  1DQB A;  2IAW A;  1HCG B;  3HO5 A;  4JZE L;  3ELA L;  5JB9 E;  4HHQ A;  2BQW A;  1AUT L;  2B7D L;  2MHP A;  2W3I B;  1F0R B;  3E5Z A;  3R05 A;  4YT7 L;  3KGG A;  1L3Y A;  5L2Z L;  4ZH8 B;  1Z6E L;  2VWO L;  3CEN L;  5FDQ A;  2RNL A;  4D90 A;  3QCW A;  2J4I B;  1F7E A;  1N1I A;  4Z6A L;  4XL1 A;  2WPL E;  5GTQ A;  2VVV L;  2P28 B;  2FPB A;  1NFX B;  3HS5 A;  4Q1U A;  3MDL A;  4BTT A;  1B9W A;  4ZHA B;  1CCF A;  2BOU A;  1MQ6 L;  3TBD A;  4M11 A;  1XKA L;  3LC5 B;  4D0F A;  5JBB E;  1IOX A;  2VAQ A;  4GNB A;  4IMB A;  2W86 A;  3Q3K B;  3G4H A;  2P3T A;  3CFW A;  1CQE A;  3N8W B;  4FM5 A;  3DR2 A;  2P3F N;  3LI4 A;  1APO A;  2VVU L;  3G4E A;  2W2M E;  4Z0K B;  1TLE A;  4G1M B;  1RWL A;  5IKQ A;  2NPR A;  2Y5H L;  1ATA A;  4Y76 B;  1SZB A;  4COX A;  1JV2 B;  2BOX A;  2Y7X B;  3LN0 A;  3KQD L;  3TH3 L;  2FPC A;  2K2S B;  2BZ6 L;  3HPT A;  4JZD L;  1N7D A;  2IVZ A;  2KL7 A;  2UWP B;  1POO A;  1WU1 B;  3N8Z A;  4GN8 A;  3ASI A;  2P16 L;  4CUF A;  4E1G A;  3S94 A;  2Y38 A;  4AQT A;  2J38 B;  4YZU B;  1CCV A;  1RFN B;  3QH0 A;  2ADX A;  4ZAE B;  3BYC A;  1UZK A;  3DAS A;  4OTY A;  1EPJ A;  1ADX A;  5K0H B;  1LMJ A;  3POY A;  1ATB A;  2W26 B;  3KK6 A;  2WPI E;  1ATE A;  1KLO A;  3U7U G;  5KIR A;  4ZXX L;  3Q6T A;  1F0S B; 
#chains in the Genus database with same CATH topology
 3O9J A;  4ISI L;  4D0E A;  2VK5 A;  2GD4 A;  4MWW A;  1X7A L;  3LAQ A;  2FLG A;  1IVF A;  3CYE A;  2ZZK A;  1KLI L;  4RRX A;  3ALW A;  2AYL A;  2TGF A;  2CJI B;  1PJX A;  4YW2 A;  4JML A;  2XC0 L;  4Z0L A;  3T1E A;  4XOG A;  2FLU X;  1INY A;  1EMO A;  2ISM A;  5FWW A;  1CEJ A;  5GX4 A;  4RS0 A;  3VNG A;  2YGP A;  2SIM A;  1MS5 A;  1IVG A;  4IFJ A;  5EGM B;  4GN9 A;  1ING A;  3HLI A;  1KLJ L;  2F9B L;  4HZZ A;  3RR3 A;  2DDU A;  1W0P A;  3BT2 A;  3KRK A;  2FD6 A;  4Y79 B;  4ZY3 A;  3OLU A;  4AH4 A;  1EAI C;  3WDZ A;  4ZLR A;  2Q1J B;  2DSO A;  1IOE L;  2BMG A;  2WPH E;  3NTG A;  4XBM A;  1WCQ A;  4GDJ A;  2BOH A;  2F13 A;  2W5N A;  2DYH A;  1FFM A;  5COX A;  1F8E A;  2W3K B;  2HU0 A;  4MWV A;  4QN3 A;  4C1Y A;  1QFK L;  2B8H A;  1PFX L;  6COX A;  1W7X L;  1N1T A;  4L7B A;  3N8X A;  4KS4 A;  3A9G A;  1VCJ A;  3SRG A;  1N6F A;  6NN9 A;  1IVC A;  4MJU A;  1NQL B;  5FZJ A;  1XOG A;  3U0S A;  1HZ8 A;  2QWG A;  1WHE A;  7NN9 A;  1EBV A;  1DIY A;  1I0U A;  1KIG L;  2P4O A;  1C5K A;  5HUM A;  2FP8 A;  2JJL A;  1MWE A;  3N8Y B;  1X2J A;  4D52 B;  5HUK A;  2XBV L;  5M1Z A;  4NGA L;  1ZGK A;  3CL0 A;  2H9E C;  1NMA N;  1F8C A;  2IAP A;  4X8V L;  4C16 A;  3NT1 A;  1O5D L;  3H72 A;  4FOQ A;  2GVV A;  1URK A;  1IUB A;  5EO7 A;  5L2Y L;  1INV A;  2UWL B;  1CVW L;  1HX2 A;  5FNT A;  5F72 C;  1EZQ B;  1FF7 A;  2HT5 A;  1EPG A;  1V04 A;  4M4N A;  1JL9 A;  1K37 A;  1M1X B;  1F7M A;  4O1Z A;  1Z50 A;  4FPC A;  4YT6 L;  4MWR A;  2SLI A;  4G3N A;  2VWN L;  5CIS A;  2FHR A;  4IN4 A;  2W5O A;  2J2U B;  2ZB5 A;  1A4G A;  1S1D A;  1EPH A;  4MMX B;  1L5G B;  2Y5G L;  3KL6 B;  1E8T A;  2BER A;  2QWJ A;  2W20 A;  2XZK A;  3K37 A;  5D9B A;  3TI6 A;  4CHB A;  2HT8 A;  1P9J A;  5B2C A;  1CX2 A;  4YZ1 A;  3KQC L;  4YZ4 A;  1MS3 A;  1NFW B;  1P0S L;  4H53 A;  1V3B A;  2HTV A;  2BT7 A;  2WPM E;  3A72 A;  4X47 A;  3WN7 A;  1W0O A;  1CQ1 A;  1JBU L;  4AHA A;  4XLW A;  1IQF L;  3BPS E;  1EUR A;  1L7G A;  3Q7D A;  3D12 A;  4QN4 A;  3I1C A;  3SOB B;  4CPY A;  2I9A A;  3ZYG A;  4ZXY L;  2BO2 A;  1VCU A;  2H2N A;  4M3M A;  4PWZ A;  3TI4 A;  2AH2 A;  2G8S A;  3HS7 A;  3V1S A;  1MZ5 A;  2XBW L;  3N8V A;  2VK7 A;  1NZI A;  1IJQ A;  2H2U A;  1V3E A;  2P26 A;  1V3X B;  5JVY A;  4MC7 A;  2XC4 L;  3SOV A;  3W09 A;  4X8S L;  3HLH A;  4DG6 A;  1NPE B;  3NTB A;  1B9T A;  4GEZ A;  2W8B A;  4FJ6 A;  1SLL A;  1HJ7 A;  2VVC K;  5JBC E;  2DG1 A;  4Y7B B;  1BF9 A;  1NNC A;  2BT8 A;  4MWU A;  1DX5 I;  4YZ2 A;  5JBA E;  1MR5 A;  2FZZ L;  1APQ A;  4BTI A;  4ISH L;  1IQN L;  2XCY A;  4FPL A;  1MS1 A;  1G1T A;  2W2P E;  1MS4 A;  1V3D A;  1MZ6 A;  1EQG A;  3DEM A;  4QN7 A;  4ZGC A;  2V91 A;  1U67 A;  2BQ7 A;  2HOR A;  3TK6 B;  3UC1 A;  1IGX A;  4YW4 A;  3ALX A;  4K3Y A;  1HRE A;  4BTU A;  2G00 L;  1GK5 A;  1EUU A;  3A9H A;  4BDW A;  4J9T A;  4XJU A;  3HRP A;  4FPO B;  4O02 B;  4NCS A;  1WP5 A;  2F27 A;  1HT8 A;  3OLT A;  4Y7A B;  1S18 A;  1IQJ L;  2IAQ A;  4Q6K A;  4CUD A;  5GX5 A;  2PHB B;  2W38 A;  3M36 L;  5CKN A;  3MQE A;  2BAT A;  2YA6 A;  2P95 L;  2VSM A;  2HTW A;  3K9X A;  5FNS A;  1Z6C A;  2KV4 A;  5L30 L;  2XC5 L;  2HTQ A;  4GZS A;  1Q7F A;  1A14 N;  2GVW A;  2WFX B;  2F12 A;  1BJI A;  2BSF A;  4I00 A;  1C9U A;  2BOK L;  1IUC A;  3ZYJ B;  3F1S B;  2QWE A;  4WEG A;  1G1Q A;  3A71 A;  4DGR A;  1DDX A;  1G1S A;  2VPJ A;  3ZGC A;  1LQD A;  2IAU A;  4HZX A;  3V65 B;  1NNB A;  4D8S A;  5EO8 A;  1W8O A;  4YZ5 A;  2P94 L;  4FVK A;  2MGP A;  3CA7 A;  4QN6 A;  3TC9 A;  2YDP A;  5GX2 A;  4L7C A;  4X6K A;  4AGT A;  1U8C B;  4GB1 A;  4YY8 A;  3D11 A;  4FZH A;  4MWQ A;  3S6X A;  3K36 A;  3ZYI B;  4UOU A;  3TIB A;  1IGZ A;  1YUK B;  2HTY A;  3IIT B;  1B9S A;  2VH6 B;  1EPI A;  3N8W A;  4QN5 A;  1FAX L;  2WFT A;  5E8D A;  1OFZ A;  2AEQ A;  4UF7 A;  3F6U L;  2AEP A;  4M4V A;  4GZX A;  3K39 A;  1MOX C;  1EGF A;  1W20 A;  1EUS A;  3U73 A;  3FVZ A;  2DG0 A;  2BF6 A;  1V1I A;  3V64 C;  1NCB N;  3TGF A;  2ZB6 A;  3H6J A;  2X9M A;  4XMA A;  2Y7Z B;  3O4P A;  1PTH A;  1PRH A;  1NMB N;  4GZQ A;  4NC5 A;  2IAT A;  2VW0 A;  2UWO B;  5B2D A;  1IQK L;  3KCG L;  2EI6 B;  1SNT A;  1USR A;  2P3U A;  3TI5 A;  3EGF A;  1CRU A;  1MS8 A;  1LPZ A;  4JF7 A;  3BEQ A;  4OTJ A;  5GX3 A;  2WYG B;  3PJQ A;  1HAE A;  1EQH A;  2C4A A;  2QWH A;  4IFL X;  2OJH A;  2Y82 B;  2MGR A;  4HIZ A;  3S8V A;  1Z4Z A;  1KSN B;  2F24 A;  4KS1 A;  4A94 C;  1N6E A;  4XMI A;  1CVM A;  4JZF L;  3CS7 L;  1MQ5 L;  3LTF B;  4FPE A;  4X8U L;  2YGO A;  2IAV A;  2IAX A;  1RWI A;  2VW2 A;  4GZO A;  3S8Z A;  2XBX L;  2KNI A;  1NCC N;  1YO8 A;  5I46 L;  3AMS A;  4GDI A;  2M74 A;  1W8N A;  3LC3 B;  1IQM L;  2Y5F L;  2WZP P;  2VJ3 A;  3II7 A;  1IQE L;  1NT0 A;  3PGH A;  1F8D A;  4CUE A;  3NO0 A;  1PGE A;  2P93 L;  4K1J A;  2YDT A;  4CSY A;  1INW A;  2H9E L;  2IAO A;  2J34 B;  4FPJ A;  5F19 A;  4A7I A;  2YA7 A;  1K36 A;  4KS3 A;  2WYJ B;  2YGQ A;  4TGF A;  3IAX A;  1G2L B;  5HX0 A;  1NMC A;  1ZI0 A;  1TOZ A;  4WA5 A;  1Z4X A;  3Q6K A;  3KQE L;  4RRY A;  2CML A;  2F28 A;  2J94 B;  1NFY B;  2IAS A;  1EMN A;  4K1H A;  4XE9 A;  4FPG A;  1V0E A;  4GNC A;  4HZV A;  4HZW A;  1LPG A;  1UZJ A;  4GZP A;  3TZI A;  4X49 A;  5GX1 A;  1HAF A;  2OYE P;  3M37 L;  4XYX A;  2RA0 L;  1INH A;  4FOY A;  4MWJ A;  5NN9 A;  1LMM A;  1CVU A;  1DVA L;  2HOX A;  1IQH L;  2QWC A;  2J95 B;  1LK9 A;  2XBY L;  1IVB A;  1B9V A;  1LPK A;  4O5T A;  1NNA A;  1IQI L;  4ASC A;  4JYU L;  3ENS A;  3C9A C;  2WPK E;  1FE2 A;  1V1H A;  2XZI A;  3FFG L;  1C5M F;  4CPM A;  1N1V A;  1XKB A;  2WG3 C;  2PUQ L;  3LN1 A;  1NFU B;  4R40 A;  4GN7 A;  2HU4 A;  2RKC A;  4IYG A;  2VSK A;  4GJT A;  4BDX A;  3QMO A;  1COU A;  1YUF A;  2HQS A;  1CRZ A;  4MMY B;  4YZ3 A;  2P3F L;  5F9T A;  4M10 A;  2VWM K;  5IKR A;  1USX A;  1FAK L;  4GZT A;  4N1B A;  4C1Y B;  4K1K A;  2WPJ E;  3HS6 A;  2JKH L;  4GNA A;  5JW1 A;  1ATD A;  2VH0 B;  2FP9 A;  3SOQ A;  4NN9 A;  1L7H A;  3GVL A;  4XJZ A;  4B7N A;  4A0P A;  2JKB A;  3WW9 A;  5FZN A;  2EI8 B;  3LI3 A;  3N8Y A;  4D52 A;  1NSD A;  3KYA A;  4WA3 A;  2RHP A;  5D9D A;  3AMR A;  1FSB A;  1W1X A;  2W2O E;  4XMB A;  1G2M B;  4B7J A;  4D4U A;  2PR3 B;  4HZY A;  2FLR L;  1NCD N;  1HRF A;  3LI5 A;  1IVO C;  2D1J B;  4JYV L;  2YA4 A;  3BT1 A;  1IVD A;  3TK5 B;  2VVZ A;  4XJ8 A;  1N1S A;  2OYU P;  1YGC L;  2BQ6 A;  1W8B L;  4NG9 L;  4GU3 A;  1XOE A;  5JVZ A;  1QBI A;  2HT7 A;  2KB9 A;  5FNR A;  2C4L A;  1IQG L;  1NSB A;  3ADE A;  1TPG A;  2Y81 B;  3H5C B;  4FOV A;  4MJV A;  3Q6P A;  5D9C A;  4CPO A;  1J9C L;  1UZP A;  2QWF A;  4XJR A;  1NCA N;  4NA9 L;  3HO4 A;  2VWL L;  1SUU A;  5JYY A;  4BXS A;  4QNP A;  1S0J A;  1DIM A;  4FPF A;  5JB8 E;  4LOR A;  1N6D A;  4MWL A;  1QLG A;  2YA8 A;  1Q4G A;  4RRW A;  4CSD A;  4XJQ A;  5EX7 A;  2I9B A;  1E8V A;  1HT5 A;  4FQ4 A;  3LIW B;  3FBY A;  3LTG D;  4Y6D B;  3SW2 A;  4BXW A;  5H47 A;  4YW3 A;  1XDT R;  1NN2 A;  4MMZ B;  2QWK A;  3SIL A;  3IJE B;  4XHX A;  4YW5 A;  3GCX E;  4HHO A;  3GIS X;  2VWD A;  1F8B A;  4CPL A;  4KS5 A;  2GVX A;  4O5S A;  1G1R A;  4KS2 A;  3L6V A;  1IP0 A;  2W2Q E;  3B69 A;  5F1A A;  1ZAQ A;  5HUN A;  2Y80 B;  4RUT A;  2ZW9 A;  3P5B L;  3SAN A;  2WG4 B;  3SRE A;  1OB1 C;  1NPE A;  4LMF A;  4WA4 A;  4IFN X;  2GHS A;  1UZQ A;  3S2K A;  5CGJ A;  3GVJ A;  1PXX A;  1A3P A;  4HW6 A;  4L7D A;  2W8B B;  4B7R A;  1H6L A;  2HTU A;  3FCS B;  1NSC A;  2GVU A;  5CKQ A;  2W2N E;  1Z4V A;  1FJS L;  4PH9 A;  5KN5 C;  2K2T A;  4Y71 B;  2ZWA A;  4AGI A;  3FW0 A;  2XN4 A;  4XJA A;  5FNU A;  1XFE A;  5IKV A;  1WHF A;  2FLB L;  3HO3 A;  3NN9 A;  3NJP C;  1IQL L;  2F10 A;  3TIA A;  4RRZ A;  1A4Q A;  2EI7 B;  4X8T L;  1E1A A;  3GCW E;  5CKM A;  3KQB L;  1S0I A;  2POO A;  2QE8 A;  1E8U A;  2VK6 A;  3WWA A;  1YUG A;  5IKT A;  2AGS A;  4WEF A;  2IAR A;  1DQB A;  4GU4 A;  2IAW A;  4XJW A;  2VRS A;  1HCG B;  3HO5 A;  4JZE L;  3ELA L;  5JB9 E;  4HHQ A;  3CL2 A;  2BQW A;  1AUT L;  2B7D L;  2BZD A;  3H71 A;  5FNQ A;  2MHP A;  1WCS A;  4M4U A;  2W3I B;  4FP3 A;  1F0R B;  1INX A;  3E5Z A;  3R05 A;  4YT7 L;  3KGG A;  1L3Y A;  3TI3 A;  1SO7 A;  5L2Z L;  4XIO A;  1V3C A;  4ZH8 B;  1Z6E L;  4SLI A;  2VWO L;  3CEN L;  5FDQ A;  2RNL A;  4D90 A;  3QCW A;  2J4I B;  1F7E A;  2F11 A;  3H73 A;  4FPY A;  4FPK A;  1Z4Y A;  1N1I A;  4Z6A L;  4XL1 A;  4FP2 A;  2WPL E;  2SIL A;  2VVV L;  4MX0 A;  5GTQ A;  2P28 B;  4D52 C;  2FPB A;  4IQK A;  1NFX B;  4XIL A;  3HS5 A;  4K1I A;  1QIU A;  4Q1U A;  3MDL A;  4BTT A;  1V0F A;  1B9W A;  1X2R A;  4ZHA B;  1CCF A;  4X4A A;  1V0Z A;  2BOU A;  1MQ6 L;  2QWI A;  3TBD A;  4XIK A;  4M11 A;  1XKA L;  3LC5 B;  4D0F A;  5JBB E;  1IOX A;  1U6D X;  2VAQ A;  4GNB A;  2QWB A;  3GVK A;  4XHB A;  3VNH A;  2QWA A;  4IMB A;  2W86 A;  3Q3K B;  3G4H A;  4BBW A;  2P3T A;  4YW1 A;  3CFW A;  1CQE A;  3N8W B;  4FM5 A;  3DR2 A;  4XJ9 A;  4FPH A;  2P3F N;  3B7E A;  1APO A;  2VVU L;  3LI4 A;  1MS0 A;  2F0Z A;  4B7Q A;  3G4E A;  4FOW A;  2W2M E;  4Z0K B;  1TLE A;  1MS9 A;  1KKE A;  4MZE A;  3ZGD A;  2WOZ A;  4G1M B;  1RWL A;  2F29 A;  5IKQ A;  2NPR A;  2XZJ A;  2YA5 A;  2Y5H L;  4CH9 A;  1ATA A;  2VW1 A;  4Y76 B;  1SZB A;  4COX A;  1JV2 B;  2BOX A;  2Y7X B;  3LN0 A;  3INB A;  4CPZ A;  1K32 A;  3KQD L;  3TH3 L;  3TI8 A;  2FPC A;  2K2S B;  2BZ6 L;  3CKZ A;  3HPT A;  4JZD L;  4MWX A;  1N7D A;  1L7F A;  2IVZ A;  2KL7 A;  2UWP B;  1POO A;  1WU1 B;  3N8Z A;  1SLI A;  4GN8 A;  3SLI A;  4B7M A;  3ASI A;  1IVE A;  4MWY A;  2P16 L;  4CUF A;  4E1G A;  3S94 A;  2Y38 A;  2HTR A;  4AQT A;  3OPZ A;  2J38 B;  4YZU B;  1CCV A;  1V2I A;  1W21 A;  4GZW A;  4MZA A;  1RFN B;  3QH0 A;  2ADX A;  4ZAE B;  3BYC A;  1UZK A;  2QWD A;  4OTY A;  3DAS A;  1KIT A;  3SAL A;  1EPJ A;  3NSS A;  1ADX A;  1DIL A;  2Z32 A;  5HUG A;  2F26 A;  5K0H B;  1INF A;  3K38 A;  1LMJ A;  4CPN A;  1Z4W A;  3TIC A;  3POY A;  1ATB A;  2W26 B;  3KK6 A;  2WPI E;  1ATE A;  3O9K A;  3JU4 A;  4H52 A;  1KLO A;  3U7U G;  5KIR A;  4ZXX L;  1EUT A;  2A75 A;  3K3A A;  2F25 A;  3Q6T A;  1N1Y A;  1F0S B; 
#chains in the Genus database with same CATH homology
 4ISI L;  4D0E A;  2GD4 A;  1X7A L;  3LAQ A;  2FLG A;  1KLI L;  4RRX A;  2AYL A;  2TGF A;  2CJI B;  1PJX A;  4JML A;  2XC0 L;  4Z0L A;  2ISM A;  1EMO A;  5FWW A;  1CEJ A;  5GX4 A;  4RS0 A;  2YGP A;  5EGM B;  4GN9 A;  3HLI A;  1KLJ L;  2F9B L;  3RR3 A;  2DDU A;  3BT2 A;  3KRK A;  2FD6 A;  4Y79 B;  3OLU A;  1EAI C;  4ZLR A;  2Q1J B;  2DSO A;  1IOE L;  2BMG A;  2WPH E;  3NTG A;  4XBM A;  2BOH A;  1FFM A;  5COX A;  2W3K B;  1QFK L;  1PFX L;  6COX A;  1W7X L;  3N8X A;  3A9G A;  3SRG A;  1NQL B;  3U0S A;  1HZ8 A;  1WHE A;  1EBV A;  1DIY A;  1I0U A;  1KIG L;  2P4O A;  1C5K A;  2FP8 A;  3N8Y B;  2XBV L;  4NGA L;  2H9E C;  2IAP A;  4X8V L;  4C16 A;  3NT1 A;  1O5D L;  2GVV A;  1URK A;  5L2Y L;  2UWL B;  1CVW L;  1HX2 A;  1EZQ B;  1FF7 A;  1EPG A;  1V04 A;  1JL9 A;  1K37 A;  1M1X B;  1F7M A;  4O1Z A;  4YT6 L;  2VWN L;  5CIS A;  2J2U B;  1EPH A;  4MMX B;  1L5G B;  2Y5G L;  3KL6 B;  5D9B A;  1P9J A;  1CX2 A;  3KQC L;  1NFW B;  1P0S L;  2WPM E;  1CQ1 A;  1JBU L;  4XLW A;  1IQF L;  3BPS E;  3Q7D A;  3I1C A;  3SOB B;  2I9A A;  3ZYG A;  4ZXY L;  2BO2 A;  4PWZ A;  2G8S A;  3HS7 A;  3V1S A;  2XBW L;  3N8V A;  1NZI A;  1IJQ A;  2P26 A;  1V3X B;  5JVY A;  2XC4 L;  3SOV A;  4X8S L;  3HLH A;  4DG6 A;  1NPE B;  3NTB A;  2W8B A;  1HJ7 A;  2VVC K;  5JBC E;  2DG1 A;  4Y7B B;  1BF9 A;  1DX5 I;  5JBA E;  2FZZ L;  1APQ A;  4BTI A;  4ISH L;  1IQN L;  1G1T A;  2W2P E;  1EQG A;  3DEM A;  2V91 A;  1U67 A;  2BQ7 A;  3TK6 B;  1IGX A;  1HRE A;  4BTU A;  2G00 L;  1GK5 A;  3A9H A;  4BDW A;  3HRP A;  4O02 B;  1HT8 A;  3OLT A;  4Y7A B;  1IQJ L;  2IAQ A;  4CUD A;  5GX5 A;  2PHB B;  3M36 L;  5CKN A;  3MQE A;  2P95 L;  3K9X A;  1Z6C A;  2KV4 A;  5L30 L;  2XC5 L;  1Q7F A;  2GVW A;  2WFX B;  1C9U A;  2BOK L;  3ZYJ B;  3F1S B;  1G1Q A;  1DDX A;  1G1S A;  1LQD A;  2IAU A;  3V65 B;  2P94 L;  2MGP A;  3CA7 A;  3TC9 A;  5GX2 A;  1U8C B;  3S6X A;  3ZYI B;  1IGZ A;  1YUK B;  3IIT B;  2VH6 B;  1EPI A;  3N8W A;  1FAX L;  2WFT A;  5E8D A;  3F6U L;  1MOX C;  1EGF A;  3U73 A;  3FVZ A;  2DG0 A;  3V64 C;  3TGF A;  2Y7Z B;  3O4P A;  1PTH A;  1PRH A;  2IAT A;  2UWO B;  1IQK L;  3KCG L;  2EI6 B;  2P3U A;  3EGF A;  1CRU A;  1LPZ A;  4OTJ A;  5GX3 A;  2WYG B;  1HAE A;  1EQH A;  2OJH A;  2Y82 B;  2MGR A;  3S8V A;  1KSN B;  4A94 C;  1CVM A;  4JZF L;  3CS7 L;  1MQ5 L;  3LTF B;  4X8U L;  2YGO A;  2IAV A;  2IAX A;  1RWI A;  3S8Z A;  2XBX L;  2KNI A;  1YO8 A;  5I46 L;  3AMS A;  2M74 A;  3LC3 B;  1IQM L;  2Y5F L;  2WZP P;  2VJ3 A;  1IQE L;  1NT0 A;  3PGH A;  4CUE A;  1PGE A;  2P93 L;  4CSY A;  2H9E L;  2IAO A;  2J34 B;  5F19 A;  4A7I A;  1K36 A;  2WYJ B;  2YGQ A;  4TGF A;  3IAX A;  1G2L B;  1TOZ A;  3Q6K A;  3KQE L;  4RRY A;  2IAS A;  2J94 B;  1NFY B;  1EMN A;  4GNC A;  1LPG A;  1UZJ A;  3TZI A;  5GX1 A;  1HAF A;  2OYE P;  3M37 L;  2RA0 L;  1LMM A;  1CVU A;  1DVA L;  1IQH L;  2J95 B;  2XBY L;  1LPK A;  4O5T A;  1IQI L;  4JYU L;  3ENS A;  3C9A C;  2WPK E;  1FE2 A;  3FFG L;  1C5M F;  1XKB A;  2WG3 C;  2PUQ L;  3LN1 A;  1NFU B;  4R40 A;  4GN7 A;  4IYG A;  4BDX A;  3QMO A;  1COU A;  1YUF A;  2HQS A;  1CRZ A;  4MMY B;  2P3F L;  4M10 A;  2VWM K;  5IKR A;  1FAK L;  2WPJ E;  3HS6 A;  2JKH L;  4GNA A;  5JW1 A;  1ATD A;  2VH0 B;  2FP9 A;  3SOQ A;  4A0P A;  3WW9 A;  2EI8 B;  3LI3 A;  3N8Y A;  3KYA A;  2RHP A;  5D9D A;  3AMR A;  1FSB A;  2W2O E;  1G2M B;  2PR3 B;  2FLR L;  3LI5 A;  1HRF A;  1IVO C;  2D1J B;  4JYV L;  3BT1 A;  3TK5 B;  2OYU P;  1YGC L;  2BQ6 A;  1W8B L;  4NG9 L;  5JVZ A;  1QBI A;  2KB9 A;  1IQG L;  1TPG A;  2Y81 B;  3H5C B;  5D9C A;  3Q6P A;  1J9C L;  1UZP A;  4NA9 L;  3HO4 A;  2VWL L;  4BXS A;  5JB8 E;  4LOR A;  1QLG A;  1Q4G A;  4RRW A;  5EX7 A;  2I9B A;  1HT5 A;  3LIW B;  3FBY A;  3LTG D;  4Y6D B;  3SW2 A;  4BXW A;  1XDT R;  4MMZ B;  3IJE B;  3GCX E;  4HHO A;  3GIS X;  2GVX A;  4O5S A;  1G1R A;  1IP0 A;  2W2Q E;  5F1A A;  1ZAQ A;  2Y80 B;  4RUT A;  3P5B L;  2WG4 B;  3SRE A;  1OB1 C;  1NPE A;  4LMF A;  2GHS A;  1UZQ A;  3S2K A;  1PXX A;  1A3P A;  4HW6 A;  2W8B B;  1H6L A;  3FCS B;  2GVU A;  5CKQ A;  2W2N E;  1FJS L;  4PH9 A;  5KN5 C;  2K2T A;  4Y71 B;  3FW0 A;  1XFE A;  5IKV A;  1WHF A;  2FLB L;  3HO3 A;  3NJP C;  1IQL L;  4RRZ A;  2EI7 B;  4X8T L;  1E1A A;  3GCW E;  5CKM A;  3KQB L;  2POO A;  2QE8 A;  3WWA A;  1YUG A;  5IKT A;  2IAR A;  1DQB A;  2IAW A;  1HCG B;  3HO5 A;  4JZE L;  3ELA L;  5JB9 E;  4HHQ A;  2BQW A;  1AUT L;  2B7D L;  2MHP A;  2W3I B;  1F0R B;  3E5Z A;  3R05 A;  4YT7 L;  3KGG A;  1L3Y A;  5L2Z L;  4ZH8 B;  1Z6E L;  2VWO L;  3CEN L;  5FDQ A;  2RNL A;  4D90 A;  3QCW A;  2J4I B;  1F7E A;  1N1I A;  4Z6A L;  4XL1 A;  2WPL E;  5GTQ A;  2VVV L;  2P28 B;  2FPB A;  1NFX B;  3HS5 A;  4Q1U A;  3MDL A;  4BTT A;  1B9W A;  4ZHA B;  1CCF A;  2BOU A;  1MQ6 L;  3TBD A;  4M11 A;  1XKA L;  3LC5 B;  4D0F A;  5JBB E;  1IOX A;  2VAQ A;  4GNB A;  4IMB A;  2W86 A;  3Q3K B;  3G4H A;  2P3T A;  3CFW A;  1CQE A;  3N8W B;  4FM5 A;  3DR2 A;  2P3F N;  3LI4 A;  1APO A;  2VVU L;  3G4E A;  2W2M E;  4Z0K B;  1TLE A;  4G1M B;  1RWL A;  5IKQ A;  2NPR A;  2Y5H L;  1ATA A;  4Y76 B;  1SZB A;  4COX A;  1JV2 B;  2BOX A;  2Y7X B;  3LN0 A;  3KQD L;  3TH3 L;  2FPC A;  2K2S B;  2BZ6 L;  3HPT A;  4JZD L;  1N7D A;  2IVZ A;  2KL7 A;  2UWP B;  1POO A;  1WU1 B;  3N8Z A;  4GN8 A;  3ASI A;  2P16 L;  4CUF A;  4E1G A;  3S94 A;  2Y38 A;  4AQT A;  2J38 B;  4YZU B;  1CCV A;  1RFN B;  3QH0 A;  2ADX A;  4ZAE B;  3BYC A;  1UZK A;  3DAS A;  4OTY A;  1EPJ A;  1ADX A;  5K0H B;  1LMJ A;  3POY A;  1ATB A;  2W26 B;  3KK6 A;  2WPI E;  1ATE A;  1KLO A;  3U7U G;  5KIR A;  4ZXX L;  3Q6T A;  1F0S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...