1LMJA

Nmr study of the fibrillin-1 cbegf12-13 pair of ca2+ binding epidermal growth factor-like domains
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
TDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Dynamics of a Calcium Binding Epidermal Growth Factor-like Domain Pair from the Neonatal Region of Human Fibrillin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords fibrillin 1
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07645 EGF_CA Calcium-binding EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1lmjA00
1W8BL 1IQKL 4XBMA 1GK5A 2P16L 4Y6DB 1HCGB 2P93L 2VWLL 3RR3A 1IQFL 1NFWB 1G2MB 3TGFA 4XL1A 1G2LB 3BT1A 4FM5A 5IKTA 3KCGL 2VH6B 3BPSE 3NT1A 5K0HB 2Y7XB 2M74A 2WPJE 1W7XL 1I0UA 1K37A 3LAQA 4TGFA 3HPTA 3KQBL 3BT2A 1JV2B 5L2YL 3N8YA 2XBYL 4M10A 5CKNA 4ZH8B 3FBYA 1WHEA 3LC5B 4RRYA 4Y79B 4BDXA 4BDWA 3HO5A 1AUTL 3PGHA 4Z0LA 2CJIB 4JZDL 2NPRA 4RS0A 4OTJA 1CCFA 2FLBL 3KL6B 2I9AA 2BQ6A 4O1ZA 2VWOL 2K2TA 1NZIA 2VWNL 2Y38A 3FCSB 4AQTA 1QFKL 3KQEL 4Y71B 2VJ3A 5CISA 5KIRA 2WFTA 2BOUA 5IKVA 3QH0A 3QMOA 2K2SB 1B9WA 3SOQA 4OTYA 2Y5FL 1G1SA 4RRZA 5F1AA 1LPZA 2PUQL 3K9XA 1EPGA 2WPME 1APOA 2Y81B 2VVUL 2XC4L 3H5CB 3F6UL 3KK6A 1EQHA 3ZYGA 3LTGD 1YO8A 2VH0B 1U8CB 2BOXA 4CSYA 3OLUA 3TK6B 1TLEA 3MDLA 4X8TL 5JVYA 1YUFA 1FF7A 1ADXA 2BOKL 4C16A 4BTIA 2I9BA 1PXXA 2EI8B 2P3TA 1KIGL 2P3FL 4RRXA 3SOBB 1FAXL 3R05A 1RFNB 1EQGA 2MHPA 1Q4GA 2WG3C 4ISIL 1ATEA 1CEJA 3OLTA 4NA9L 2J95B 1YUKB 2W2OE 2G00L 2RHPA 5CKMA 3HS5A 1IP0A 3LTFB 1MQ6L 4BTTA 3KRKA 1HAEA 3IITB 1WU1B 4Z0KB 1NFXB 2J4IB 2EI6B 3C9AC 3MQEA 1IQNL 5IKQA 3HO4A 3LC3B 2WPKE 1X7AL 3LIWB 1EAIC 1LPKA 1DIYA 1NT0A 4PH9A 1IQJL 3N8VA 5EGMB 1ATBA 2J38B 3SW2A 5FDQA 2KV4A 1O5DL 1ATDA 4LORA 4YT6L 1P0SL 1CCVA 1C5MF 1IQLL 3N8XA 1CQEA 3SOVA 3V65B 3ZYIB 2KL7A 2XBVL 5JBCE 3TZIA 1PFXL 1KSNB 1G1QA 2WFXB 1UZPA 2P95L 1ZAQA 3TH3L 4COXA 3IJEB 4X8VL 4X8UL 2XBXL 4ZXYL 3GCXE 2BMGA 4JZEL 1CVUA 1BF9A 1HREA 4BXSA 1FE2A 1MOXC 2FLRL 1N7DA 1XKAL 2JKHL 2MGRA 3NTBA 1HAFA 1UZKA 1G1TA 1IVOC 1JBUL 4D90A 2OYUP 2WYGB 4ZAEB 5L30L 1XFEA 1SZBA 2RNLA 1TOZA 3QCWA 2BQ7A 3POYA 1N1IA 1L5GB 5CKQA 4MMZB 2UWLB 2Y5HL 1IQGL 4MMYB 2J34B 5COXA 1YUGA 2BO2A 4CUEA 4JYUL 3CFWA 2Y82B 4MMXB 4JYVL 1IQIL 3V64C 3HS6A 5JVZA 2YGOA 5JBBE 5E8DA 4ZHAB 1WHFA 2H9EL 1DDXA 1XKBA 1HT5A 4E1GA 1G1RA 4Y76B 1FFMA 1FJSL 1F0SB 3HO3A 1FAKL 3M36L 2RA0L 1XDTR 2FLGA 2TGFA 1COUA 2W26B 2XC5L 1EMNA 2EI7B 5JB8E 1IOXA 3LN0A 1IOEL 1NFYB 2W86A 1J9CL 1EPJA 2P3FN 2F9BL 1NQLB 1KLJL 1DVAL 1OB1C 2KB9A 2BQWA 1F0RB 1EZQB 1IQHL 1F7MA 4NG9L 1ATAA 1IQEL 1HT8A 1LMJA 2VVVL 4RUTA 3CENL 1MQ5L 4CUDA 5L2ZL 2W3IB 4ISHL 3CS7L 2PHBB 4BTUA 3F1SB 2WPIE 3GCWE 4Z6AL 2DDUA 1A3PA 3HS7A 2WYJB 3KQDL 3ELAL 2PR3B 2J2UB 1PRHA 3CA7A 4YZUB 2W3KB 1IGZA 2ADXA 3N8ZA 2W2PE 1UZQA 1Z6CA 5KN5C 2MGPA 3ASIA 1DX5I 1EMOA 4O02B 3U73A 2WG4B 1IJQA 5JW1A 4A7IA 2P28B 2OYEP 1HRFA 2BZ6L 2AYLA 1TPGA 3U7UG 3NTGA 2W2ME 4D0EA 2VWMK 1KLIL 1LQDA 1HJ7A 2B7DL 4G1MB 2XC0L 4LMFA 2XBWL 3TK5B 1V3XB 2Y80B 3ENSA 3N8WB 1U67A 1P9JA 3GISX 2FZZL 1APQA 1IQML 3DEMA 4BXWA 2D1JB 2WPLE 1YGCL 1CVWL 2GD4A 4CUFA 2UWOB 2YGPA 5JBAE 4NGAL 4Y7AB 5F19A 1PTHA 1IGXA 1HX2A 1FSBA 3LN1A 2WPHE 3N8YB 1M1XB 5IKRA 1JL9A 2J94B 1KLOA 3P5BL 3FFGL 1EPHA 2P26A 4D0FA 4Y7BB 1F7EA 1URKA 4ZXXL 2BOHA 1K36A 5I46L 1EBVA 1Z6EL 2P94L 2Y7ZB 5JB9E 2W2NE 3KQCL 1NPEB 1CX2A 1PGEA 2VVCK 3TBDA 3NJPC 1L3YA 1NFUB 2Q1JB 1UZJA 2FD6A 3N8WA 4JZFL 4RRWA 4X8SL 2P3UA 1EGFA 3Q3KB 4XLWA 2UWPB 3EGFA 3M37L 1HZ8A 4YT7L 3ZYJB 6COXA 1DQBA 1EPIA 3Q7DA 2W2QE 1LPGA 2Y5GL 4M11A
chains in the Genus database with same CATH superfamily
1W8BL 1IQKL 4XBMA 1GK5A 2P16L 4Y6DB 1HCGB 2P93L 2VWLL 3RR3A 1IQFL 1NFWB 1G2MB 3TGFA 4XL1A 1G2LB 3BT1A 4FM5A 5IKTA 3KCGL 2VH6B 3BPSE 3NT1A 5K0HB 2Y7XB 2M74A 2WPJE 1W7XL 1I0UA 1K37A 3LAQA 4TGFA 3HPTA 3KQBL 3BT2A 1JV2B 5L2YL 3N8YA 2XBYL 4M10A 5CKNA 4ZH8B 3FBYA 1WHEA 3LC5B 4RRYA 4Y79B 4BDXA 4BDWA 3HO5A 1AUTL 3PGHA 4Z0LA 2CJIB 4JZDL 2NPRA 4RS0A 4OTJA 1CCFA 2FLBL 3KL6B 2I9AA 2BQ6A 4O1ZA 2VWOL 2K2TA 1NZIA 2VWNL 2Y38A 3FCSB 4AQTA 2JJLA 1QFKL 3KQEL 4Y71B 2VJ3A 5CISA 5KIRA 2WFTA 2BOUA 5IKVA 3QH0A 3QMOA 2K2SB 1B9WA 3SOQA 4OTYA 2Y5FL 1G1SA 4RRZA 5F1AA 1LPZA 2PUQL 3K9XA 1EPGA 2WPME 1V1IA 1APOA 4GU4A 2Y81B 2VVUL 2XC4L 3H5CB 3F6UL 3KK6A 1EQHA 1KKEA 2KNIA 4GU3A 3ZYGA 3LTGD 1V1HA 1YO8A 2VH0B 1U8CB 2BOXA 4CSYA 3OLUA 3TK6B 1TLEA 3MDLA 4X8TL 5JVYA 1YUFA 1FF7A 1ADXA 2BOKL 4C16A 4BTIA 2I9BA 1PXXA 2EI8B 2P3TA 1KIGL 2P3FL 4RRXA 3SOBB 1FAXL 3R05A 1RFNB 1EQGA 2MHPA 1Q4GA 2WG3C 4ISIL 1ATEA 1CEJA 3OLTA 4NA9L 2J95B 1YUKB 2W2OE 2G00L 2RHPA 5CKMA 3HS5A 1IP0A 3LTFB 1MQ6L 4BTTA 3KRKA 1HAEA 3IITB 1WU1B 4Z0KB 1NFXB 2J4IB 2EI6B 3C9AC 3MQEA 1IQNL 5IKQA 3HO4A 3LC3B 2WPKE 1X7AL 3LIWB 1EAIC 1LPKA 1DIYA 1NT0A 4PH9A 3N8VA 1IQJL 5EGMB 1ATBA 2J38B 3SW2A 5FDQA 2KV4A 1O5DL 1ATDA 4LORA 4YT6L 1P0SL 1CCVA 1C5MF 1IQLL 3N8XA 1CQEA 3SOVA 3V65B 3ZYIB 2KL7A 2XBVL 5JBCE 3TZIA 1PFXL 1KSNB 1G1QA 2WFXB 1UZPA 2P95L 1ZAQA 3TH3L 4COXA 3IJEB 4X8VL 4X8UL 2XBXL 4ZXYL 3GCXE 2BMGA 4JZEL 1CVUA 3S6XA 1HREA 4BXSA 1BF9A 1FE2A 1MOXC 2FLRL 1N7DA 1QIUA 1XKAL 2JKHL 2MGRA 3NTBA 1HAFA 1UZKA 1G1TA 1IVOC 1JBUL 4D90A 2OYUP 2WYGB 4ZAEB 5L30L 1XFEA 1SZBA 2RNLA 1TOZA 3QCWA 2BQ7A 3POYA 1N1IA 1L5GB 5CKQA 4MMZB 2UWLB 2Y5HL 1IQGL 4MMYB 2J34B 5COXA 1YUGA 2BO2A 4CUEA 4JYUL 3CFWA 2Y82B 4MMXB 4JYVL 1IQIL 1LMMA 3V64C 3HS6A 5JVZA 2YGOA 2HORA 2YGQA 5JBBE 5E8DA 4ZHAB 1WHFA 2H9EL 1DDXA 1XKBA 1HT5A 4E1GA 1G1RA 4Y76B 1FFMA 1FJSL 1F0SB 3HO3A 1FAKL 3M36L 2RA0L 1XDTR 2FLGA 2TGFA 1COUA 2W26B 2XC5L 1EMNA 2EI7B 5JB8E 1IOXA 3LN0A 1IOEL 1NFYB 2W86A 1J9CL 1EPJA 2P3FN 2F9BL 1NQLB 1KLJL 1DVAL 1OB1C 2KB9A 2BQWA 1F0RB 1EZQB 1IQHL 1F7MA 4NG9L 1IQEL 2VRSA 1HT8A 1LMJA 2VVVL 4RUTA 2BT7A 3CENL 1MQ5L 4CUDA 5L2ZL 2W3IB 4ISHL 3CS7L 2PHBB 4BTUA 3F1SB 2WPIE 3GCWE 4Z6AL 2DDUA 2BT8A 1A3PA 3HS7A 2WYJB 3KQDL 3ELAL 2PR3B 2J2UB 1PRHA 3CA7A 4YZUB 2W3KB 1IGZA 2ADXA 3N8ZA 2W2PE 4M11A 1UZQA 1Z6CA 5KN5C 2MGPA 3ASIA 1DX5I 1EMOA 4O02B 3U73A 2WG4B 1IJQA 5JW1A 4A7IA 2P28B 2OYEP 1HRFA 2BZ6L 2AYLA 1TPGA 3U7UG 3NTGA 1LK9A 2W2ME 4D0EA 2VWMK 1KLIL 1LQDA 1HJ7A 2B7DL 2H9EC 4G1MB 2XC0L 4LMFA 2XBWL 3TK5B 1V3XB 2Y80B 3ENSA 3N8WB 1U67A 1P9JA 3GISX 2FZZL 1APQA 1IQML 3DEMA 4BXWA 2D1JB 2WPLE 1YGCL 1CVWL 2GD4A 4CUFA 2UWOB 2YGPA 5JBAE 4NGAL 4Y7AB 5F19A 1PTHA 1IGXA 1HX2A 1FSBA 3LN1A 2WPHE 3N8YB 1M1XB 5IKRA 1JL9A 2J94B 1KLOA 3P5BL 3FFGL 1EPHA 2WZPP 2P26A 4D0FA 4Y7BB 1F7EA 1URKA 4ZXXL 2HOXA 2BOHA 1K36A 5I46L 1EBVA 1Z6EL 2P94L 2Y7ZB 4A94C 5JB9E 2W2NE 3KQCL 1NPEB 1CX2A 1PGEA 2VVCK 3TBDA 3NJPC 1L3YA 1NFUB 2Q1JB 1UZJA 2FD6A 3N8WA 4JZFL 4RRWA 4X8SL 2P3UA 1EGFA 3Q3KB 4XLWA 2UWPB 3EGFA 3M37L 1HZ8A 4YT7L 3ZYJB 2BSFA 6COXA 1DQBA 1EPIA 3Q7DA 2W2QE 1LPGA 2Y5GL 1ATAA
chains in the Genus database with same CATH topology
1W8BL 1IQKL 4XBMA 1GK5A 2P16L 4Y6DB 1HCGB 2P93L 2VWLL 3RR3A 1IQFL 1NFWB 1G2MB 3TGFA 4XL1A 1G2LB 3BT1A 4FM5A 5IKTA 3KCGL 2VH6B 3BPSE 3NT1A 5K0HB 2Y7XB 2M74A 2WPJE 1W7XL 1I0UA 1K37A 3LAQA 4TGFA 3HPTA 3KQBL 3BT2A 1JV2B 5L2YL 3N8YA 2XBYL 4M10A 5CKNA 4ZH8B 3FBYA 1WHEA 3LC5B 4RRYA 4Y79B 4BDXA 4BDWA 3HO5A 1AUTL 3PGHA 4Z0LA 2CJIB 4JZDL 2NPRA 4RS0A 4OTJA 1CCFA 2FLBL 3KL6B 2I9AA 2BQ6A 4O1ZA 2VWOL 2K2TA 1NZIA 2VWNL 2Y38A 3FCSB 4AQTA 1QFKL 3KQEL 4Y71B 2VJ3A 5CISA 5KIRA 2WFTA 2BOUA 5IKVA 3QH0A 3QMOA 2K2SB 1B9WA 3SOQA 4OTYA 2Y5FL 1G1SA 4RRZA 5F1AA 1LPZA 2PUQL 3K9XA 1EPGA 2WPME 1APOA 2Y81B 2VVUL 2XC4L 3H5CB 3F6UL 3KK6A 1EQHA 2KNIA 3ZYGA 3LTGD 1YO8A 2VH0B 1U8CB 2BOXA 4CSYA 3OLUA 3TK6B 1TLEA 3MDLA 4X8TL 5JVYA 1YUFA 1FF7A 1ADXA 2BOKL 4C16A 4BTIA 2I9BA 1PXXA 2EI8B 2P3TA 1KIGL 2P3FL 4RRXA 3SOBB 1FAXL 3R05A 1RFNB 1EQGA 2MHPA 1Q4GA 2WG3C 4ISIL 1ATEA 1CEJA 3OLTA 4NA9L 2J95B 1YUKB 2W2OE 2G00L 2RHPA 5CKMA 3HS5A 1IP0A 3LTFB 1MQ6L 4BTTA 3KRKA 1HAEA 3IITB 1WU1B 4Z0KB 1NFXB 2J4IB 2EI6B 3C9AC 3MQEA 1IQNL 5IKQA 3HO4A 3LC3B 2WPKE 1X7AL 3LIWB 1EAIC 1LPKA 1DIYA 1NT0A 4PH9A 1IQJL 3N8VA 5EGMB 1ATBA 2J38B 3SW2A 5FDQA 2KV4A 1O5DL 1ATDA 4LORA 4YT6L 1P0SL 1CCVA 1C5MF 1IQLL 3N8XA 1CQEA 3SOVA 3V65B 3ZYIB 2KL7A 2XBVL 5JBCE 3TZIA 1PFXL 1KSNB 1G1QA 2WFXB 1UZPA 2P95L 1ZAQA 3TH3L 4COXA 3IJEB 4X8VL 4X8UL 2XBXL 4ZXYL 3GCXE 2BMGA 4JZEL 1CVUA 3S6XA 1HREA 4BXSA 1BF9A 1FE2A 1MOXC 2FLRL 1N7DA 1XKAL 2JKHL 2MGRA 3NTBA 1HAFA 1UZKA 1G1TA 1IVOC 1JBUL 4D90A 2OYUP 2WYGB 4ZAEB 5L30L 1XFEA 1SZBA 2RNLA 1TOZA 3QCWA 2BQ7A 3POYA 1N1IA 1L5GB 5CKQA 4MMZB 2UWLB 2Y5HL 1IQGL 4MMYB 2J34B 5COXA 1YUGA 2BO2A 4CUEA 4JYUL 3CFWA 2Y82B 4MMXB 4JYVL 1IQIL 1LMMA 3V64C 3HS6A 5JVZA 2YGOA 2YGQA 5JBBE 5E8DA 4ZHAB 1WHFA 2H9EL 1DDXA 1XKBA 1HT5A 4E1GA 1G1RA 4Y76B 1FFMA 1FJSL 1F0SB 3HO3A 1FAKL 3M36L 2RA0L 1XDTR 2FLGA 2TGFA 1COUA 2W26B 2XC5L 1EMNA 2EI7B 5JB8E 1IOXA 3LN0A 1IOEL 1NFYB 2W86A 1J9CL 1EPJA 2P3FN 2F9BL 1NQLB 1KLJL 1DVAL 1OB1C 2KB9A 2BQWA 1F0RB 1EZQB 1IQHL 1F7MA 4NG9L 1ATAA 1IQEL 1HT8A 1LMJA 2VVVL 4RUTA 3CENL 1MQ5L 4CUDA 5L2ZL 2W3IB 4ISHL 3CS7L 2PHBB 4BTUA 3F1SB 2WPIE 3GCWE 4Z6AL 2DDUA 1A3PA 3HS7A 2WYJB 3KQDL 3ELAL 2PR3B 2J2UB 1PRHA 3CA7A 4YZUB 2W3KB 1IGZA 2ADXA 3N8ZA 2W2PE 1UZQA 1Z6CA 5KN5C 2MGPA 3ASIA 1DX5I 1EMOA 4O02B 3U73A 2WG4B 1IJQA 5JW1A 4A7IA 2P28B 2OYEP 1HRFA 2BZ6L 2AYLA 1TPGA 3U7UG 3NTGA 2W2ME 4D0EA 2VWMK 1KLIL 1LQDA 1HJ7A 2B7DL 2H9EC 4G1MB 2XC0L 4LMFA 2XBWL 3TK5B 1V3XB 2Y80B 3ENSA 3N8WB 1U67A 1P9JA 3GISX 2FZZL 1APQA 1IQML 3DEMA 4BXWA 2D1JB 2WPLE 1YGCL 1CVWL 2GD4A 4CUFA 2UWOB 2YGPA 5JBAE 4NGAL 4Y7AB 5F19A 1PTHA 1IGXA 1HX2A 1FSBA 3LN1A 2WPHE 3N8YB 1M1XB 5IKRA 1JL9A 2J94B 1KLOA 3P5BL 3FFGL 1EPHA 2WZPP 2P26A 4D0FA 4Y7BB 1F7EA 1URKA 4ZXXL 2BOHA 1K36A 5I46L 1EBVA 1Z6EL 2P94L 2Y7ZB 4A94C 5JB9E 2W2NE 3KQCL 1NPEB 1CX2A 1PGEA 2VVCK 3TBDA 3NJPC 1L3YA 1NFUB 2Q1JB 1UZJA 2FD6A 3N8WA 4JZFL 4RRWA 4X8SL 2P3UA 1EGFA 3Q3KB 4XLWA 2UWPB 3EGFA 3M37L 1HZ8A 4YT7L 3ZYJB 6COXA 1DQBA 1EPIA 3Q7DA 2W2QE 1LPGA 2Y5GL 4M11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8B L;  1IQK L;  4XBM A;  1GK5 A;  2P16 L;  4Y6D B;  1HCG B;  2P93 L;  2VWL L;  3RR3 A;  1IQF L;  1NFW B;  1G2M B;  3TGF A;  4XL1 A;  1G2L B;  3BT1 A;  4FM5 A;  5IKT A;  3KCG L;  2VH6 B;  3BPS E;  3NT1 A;  5K0H B;  2Y7X B;  2M74 A;  2WPJ E;  1W7X L;  1I0U A;  1K37 A;  3LAQ A;  4TGF A;  3HPT A;  3KQB L;  3BT2 A;  1JV2 B;  5L2Y L;  3N8Y A;  2XBY L;  4M10 A;  5CKN A;  4ZH8 B;  3FBY A;  1WHE A;  3LC5 B;  4RRY A;  4Y79 B;  4BDX A;  4BDW A;  3HO5 A;  1AUT L;  3PGH A;  4Z0L A;  2CJI B;  4JZD L;  2NPR A;  4RS0 A;  4OTJ A;  1CCF A;  2FLB L;  3KL6 B;  2I9A A;  2BQ6 A;  4O1Z A;  2VWO L;  2K2T A;  1NZI A;  2VWN L;  2Y38 A;  3FCS B;  4AQT A;  1QFK L;  3KQE L;  4Y71 B;  2VJ3 A;  5CIS A;  5KIR A;  2WFT A;  2BOU A;  5IKV A;  3QH0 A;  3QMO A;  2K2S B;  1B9W A;  3SOQ A;  4OTY A;  2Y5F L;  1G1S A;  4RRZ A;  5F1A A;  1LPZ A;  2PUQ L;  3K9X A;  1EPG A;  2WPM E;  1APO A;  2Y81 B;  2VVU L;  2XC4 L;  3H5C B;  3F6U L;  3KK6 A;  1EQH A;  3ZYG A;  3LTG D;  1YO8 A;  2VH0 B;  1U8C B;  2BOX A;  4CSY A;  3OLU A;  3TK6 B;  1TLE A;  3MDL A;  4X8T L;  5JVY A;  1YUF A;  1FF7 A;  1ADX A;  2BOK L;  4C16 A;  4BTI A;  2I9B A;  1PXX A;  2EI8 B;  2P3T A;  1KIG L;  2P3F L;  4RRX A;  3SOB B;  1FAX L;  3R05 A;  1RFN B;  1EQG A;  2MHP A;  1Q4G A;  2WG3 C;  4ISI L;  1ATE A;  1CEJ A;  3OLT A;  4NA9 L;  2J95 B;  1YUK B;  2W2O E;  2G00 L;  2RHP A;  5CKM A;  3HS5 A;  1IP0 A;  3LTF B;  1MQ6 L;  4BTT A;  3KRK A;  1HAE A;  3IIT B;  1WU1 B;  4Z0K B;  1NFX B;  2J4I B;  2EI6 B;  3C9A C;  3MQE A;  1IQN L;  5IKQ A;  3HO4 A;  3LC3 B;  2WPK E;  1X7A L;  3LIW B;  1EAI C;  1LPK A;  1DIY A;  1NT0 A;  4PH9 A;  1IQJ L;  3N8V A;  5EGM B;  1ATB A;  2J38 B;  3SW2 A;  5FDQ A;  2KV4 A;  1O5D L;  1ATD A;  4LOR A;  4YT6 L;  1P0S L;  1CCV A;  1C5M F;  1IQL L;  3N8X A;  1CQE A;  3SOV A;  3V65 B;  3ZYI B;  2KL7 A;  2XBV L;  5JBC E;  3TZI A;  1PFX L;  1KSN B;  1G1Q A;  2WFX B;  1UZP A;  2P95 L;  1ZAQ A;  3TH3 L;  4COX A;  3IJE B;  4X8V L;  4X8U L;  2XBX L;  4ZXY L;  3GCX E;  2BMG A;  4JZE L;  1CVU A;  1BF9 A;  1HRE A;  4BXS A;  1FE2 A;  1MOX C;  2FLR L;  1N7D A;  1XKA L;  2JKH L;  2MGR A;  3NTB A;  1HAF A;  1UZK A;  1G1T A;  1IVO C;  1JBU L;  4D90 A;  2OYU P;  2WYG B;  4ZAE B;  5L30 L;  1XFE A;  1SZB A;  2RNL A;  1TOZ A;  3QCW A;  2BQ7 A;  3POY A;  1N1I A;  1L5G B;  5CKQ A;  4MMZ B;  2UWL B;  2Y5H L;  1IQG L;  4MMY B;  2J34 B;  5COX A;  1YUG A;  2BO2 A;  4CUE A;  4JYU L;  3CFW A;  2Y82 B;  4MMX B;  4JYV L;  1IQI L;  3V64 C;  3HS6 A;  5JVZ A;  2YGO A;  5JBB E;  5E8D A;  4ZHA B;  1WHF A;  2H9E L;  1DDX A;  1XKB A;  1HT5 A;  4E1G A;  1G1R A;  4Y76 B;  1FFM A;  1FJS L;  1F0S B;  3HO3 A;  1FAK L;  3M36 L;  2RA0 L;  1XDT R;  2FLG A;  2TGF A;  1COU A;  2W26 B;  2XC5 L;  1EMN A;  2EI7 B;  5JB8 E;  1IOX A;  3LN0 A;  1IOE L;  1NFY B;  2W86 A;  1J9C L;  1EPJ A;  2P3F N;  2F9B L;  1NQL B;  1KLJ L;  1DVA L;  1OB1 C;  2KB9 A;  2BQW A;  1F0R B;  1EZQ B;  1IQH L;  1F7M A;  4NG9 L;  1ATA A;  1IQE L;  1HT8 A;  1LMJ A;  2VVV L;  4RUT A;  3CEN L;  1MQ5 L;  4CUD A;  5L2Z L;  2W3I B;  4ISH L;  3CS7 L;  2PHB B;  4BTU A;  3F1S B;  2WPI E;  3GCW E;  4Z6A L;  2DDU A;  1A3P A;  3HS7 A;  2WYJ B;  3KQD L;  3ELA L;  2PR3 B;  2J2U B;  1PRH A;  3CA7 A;  4YZU B;  2W3K B;  1IGZ A;  2ADX A;  3N8Z A;  2W2P E;  1UZQ A;  1Z6C A;  5KN5 C;  2MGP A;  3ASI A;  1DX5 I;  1EMO A;  4O02 B;  3U73 A;  2WG4 B;  1IJQ A;  5JW1 A;  4A7I A;  2P28 B;  2OYE P;  1HRF A;  2BZ6 L;  2AYL A;  1TPG A;  3U7U G;  3NTG A;  2W2M E;  4D0E A;  2VWM K;  1KLI L;  1LQD A;  1HJ7 A;  2B7D L;  4G1M B;  2XC0 L;  4LMF A;  2XBW L;  3TK5 B;  1V3X B;  2Y80 B;  3ENS A;  3N8W B;  1U67 A;  1P9J A;  3GIS X;  2FZZ L;  1APQ A;  1IQM L;  3DEM A;  4BXW A;  2D1J B;  2WPL E;  1YGC L;  1CVW L;  2GD4 A;  4CUF A;  2UWO B;  2YGP A;  5JBA E;  4NGA L;  4Y7A B;  5F19 A;  1PTH A;  1IGX A;  1HX2 A;  1FSB A;  3LN1 A;  2WPH E;  3N8Y B;  1M1X B;  5IKR A;  1JL9 A;  2J94 B;  1KLO A;  3P5B L;  3FFG L;  1EPH A;  2P26 A;  4D0F A;  4Y7B B;  1F7E A;  1URK A;  4ZXX L;  2BOH A;  1K36 A;  5I46 L;  1EBV A;  1Z6E L;  2P94 L;  2Y7Z B;  5JB9 E;  2W2N E;  3KQC L;  1NPE B;  1CX2 A;  1PGE A;  2VVC K;  3TBD A;  3NJP C;  1L3Y A;  1NFU B;  2Q1J B;  1UZJ A;  2FD6 A;  3N8W A;  4JZF L;  4RRW A;  4X8S L;  2P3U A;  1EGF A;  3Q3K B;  4XLW A;  2UWP B;  3EGF A;  3M37 L;  1HZ8 A;  4YT7 L;  3ZYJ B;  6COX A;  1DQB A;  1EPI A;  3Q7D A;  2W2Q E;  1LPG A;  2Y5G L;  4M11 A; 
#chains in the Genus database with same CATH topology
 1W8B L;  1IQK L;  4XBM A;  1GK5 A;  2P16 L;  4Y6D B;  1HCG B;  2P93 L;  2VWL L;  3RR3 A;  1IQF L;  1NFW B;  1G2M B;  3TGF A;  4XL1 A;  1G2L B;  3BT1 A;  4FM5 A;  5IKT A;  3KCG L;  2VH6 B;  3BPS E;  3NT1 A;  5K0H B;  2Y7X B;  2M74 A;  2WPJ E;  1W7X L;  1I0U A;  1K37 A;  3LAQ A;  4TGF A;  3HPT A;  3KQB L;  3BT2 A;  1JV2 B;  5L2Y L;  3N8Y A;  2XBY L;  4M10 A;  5CKN A;  4ZH8 B;  3FBY A;  1WHE A;  3LC5 B;  4RRY A;  4Y79 B;  4BDX A;  4BDW A;  3HO5 A;  1AUT L;  3PGH A;  4Z0L A;  2CJI B;  4JZD L;  2NPR A;  4RS0 A;  4OTJ A;  1CCF A;  2FLB L;  3KL6 B;  2I9A A;  2BQ6 A;  4O1Z A;  2VWO L;  2K2T A;  1NZI A;  2VWN L;  2Y38 A;  3FCS B;  4AQT A;  2JJL A;  1QFK L;  3KQE L;  4Y71 B;  2VJ3 A;  5CIS A;  5KIR A;  2WFT A;  2BOU A;  5IKV A;  3QH0 A;  3QMO A;  2K2S B;  1B9W A;  3SOQ A;  4OTY A;  2Y5F L;  1G1S A;  4RRZ A;  5F1A A;  1LPZ A;  2PUQ L;  3K9X A;  1EPG A;  2WPM E;  1V1I A;  1APO A;  4GU4 A;  2Y81 B;  2VVU L;  2XC4 L;  3H5C B;  3F6U L;  3KK6 A;  1EQH A;  1KKE A;  2KNI A;  4GU3 A;  3ZYG A;  3LTG D;  1V1H A;  1YO8 A;  2VH0 B;  1U8C B;  2BOX A;  4CSY A;  3OLU A;  3TK6 B;  1TLE A;  3MDL A;  4X8T L;  5JVY A;  1YUF A;  1FF7 A;  1ADX A;  2BOK L;  4C16 A;  4BTI A;  2I9B A;  1PXX A;  2EI8 B;  2P3T A;  1KIG L;  2P3F L;  4RRX A;  3SOB B;  1FAX L;  3R05 A;  1RFN B;  1EQG A;  2MHP A;  1Q4G A;  2WG3 C;  4ISI L;  1ATE A;  1CEJ A;  3OLT A;  4NA9 L;  2J95 B;  1YUK B;  2W2O E;  2G00 L;  2RHP A;  5CKM A;  3HS5 A;  1IP0 A;  3LTF B;  1MQ6 L;  4BTT A;  3KRK A;  1HAE A;  3IIT B;  1WU1 B;  4Z0K B;  1NFX B;  2J4I B;  2EI6 B;  3C9A C;  3MQE A;  1IQN L;  5IKQ A;  3HO4 A;  3LC3 B;  2WPK E;  1X7A L;  3LIW B;  1EAI C;  1LPK A;  1DIY A;  1NT0 A;  4PH9 A;  3N8V A;  1IQJ L;  5EGM B;  1ATB A;  2J38 B;  3SW2 A;  5FDQ A;  2KV4 A;  1O5D L;  1ATD A;  4LOR A;  4YT6 L;  1P0S L;  1CCV A;  1C5M F;  1IQL L;  3N8X A;  1CQE A;  3SOV A;  3V65 B;  3ZYI B;  2KL7 A;  2XBV L;  5JBC E;  3TZI A;  1PFX L;  1KSN B;  1G1Q A;  2WFX B;  1UZP A;  2P95 L;  1ZAQ A;  3TH3 L;  4COX A;  3IJE B;  4X8V L;  4X8U L;  2XBX L;  4ZXY L;  3GCX E;  2BMG A;  4JZE L;  1CVU A;  3S6X A;  1HRE A;  4BXS A;  1BF9 A;  1FE2 A;  1MOX C;  2FLR L;  1N7D A;  1QIU A;  1XKA L;  2JKH L;  2MGR A;  3NTB A;  1HAF A;  1UZK A;  1G1T A;  1IVO C;  1JBU L;  4D90 A;  2OYU P;  2WYG B;  4ZAE B;  5L30 L;  1XFE A;  1SZB A;  2RNL A;  1TOZ A;  3QCW A;  2BQ7 A;  3POY A;  1N1I A;  1L5G B;  5CKQ A;  4MMZ B;  2UWL B;  2Y5H L;  1IQG L;  4MMY B;  2J34 B;  5COX A;  1YUG A;  2BO2 A;  4CUE A;  4JYU L;  3CFW A;  2Y82 B;  4MMX B;  4JYV L;  1IQI L;  1LMM A;  3V64 C;  3HS6 A;  5JVZ A;  2YGO A;  2HOR A;  2YGQ A;  5JBB E;  5E8D A;  4ZHA B;  1WHF A;  2H9E L;  1DDX A;  1XKB A;  1HT5 A;  4E1G A;  1G1R A;  4Y76 B;  1FFM A;  1FJS L;  1F0S B;  3HO3 A;  1FAK L;  3M36 L;  2RA0 L;  1XDT R;  2FLG A;  2TGF A;  1COU A;  2W26 B;  2XC5 L;  1EMN A;  2EI7 B;  5JB8 E;  1IOX A;  3LN0 A;  1IOE L;  1NFY B;  2W86 A;  1J9C L;  1EPJ A;  2P3F N;  2F9B L;  1NQL B;  1KLJ L;  1DVA L;  1OB1 C;  2KB9 A;  2BQW A;  1F0R B;  1EZQ B;  1IQH L;  1F7M A;  4NG9 L;  1IQE L;  2VRS A;  1HT8 A;  1LMJ A;  2VVV L;  4RUT A;  2BT7 A;  3CEN L;  1MQ5 L;  4CUD A;  5L2Z L;  2W3I B;  4ISH L;  3CS7 L;  2PHB B;  4BTU A;  3F1S B;  2WPI E;  3GCW E;  4Z6A L;  2DDU A;  2BT8 A;  1A3P A;  3HS7 A;  2WYJ B;  3KQD L;  3ELA L;  2PR3 B;  2J2U B;  1PRH A;  3CA7 A;  4YZU B;  2W3K B;  1IGZ A;  2ADX A;  3N8Z A;  2W2P E;  4M11 A;  1UZQ A;  1Z6C A;  5KN5 C;  2MGP A;  3ASI A;  1DX5 I;  1EMO A;  4O02 B;  3U73 A;  2WG4 B;  1IJQ A;  5JW1 A;  4A7I A;  2P28 B;  2OYE P;  1HRF A;  2BZ6 L;  2AYL A;  1TPG A;  3U7U G;  3NTG A;  1LK9 A;  2W2M E;  4D0E A;  2VWM K;  1KLI L;  1LQD A;  1HJ7 A;  2B7D L;  2H9E C;  4G1M B;  2XC0 L;  4LMF A;  2XBW L;  3TK5 B;  1V3X B;  2Y80 B;  3ENS A;  3N8W B;  1U67 A;  1P9J A;  3GIS X;  2FZZ L;  1APQ A;  1IQM L;  3DEM A;  4BXW A;  2D1J B;  2WPL E;  1YGC L;  1CVW L;  2GD4 A;  4CUF A;  2UWO B;  2YGP A;  5JBA E;  4NGA L;  4Y7A B;  5F19 A;  1PTH A;  1IGX A;  1HX2 A;  1FSB A;  3LN1 A;  2WPH E;  3N8Y B;  1M1X B;  5IKR A;  1JL9 A;  2J94 B;  1KLO A;  3P5B L;  3FFG L;  1EPH A;  2WZP P;  2P26 A;  4D0F A;  4Y7B B;  1F7E A;  1URK A;  4ZXX L;  2HOX A;  2BOH A;  1K36 A;  5I46 L;  1EBV A;  1Z6E L;  2P94 L;  2Y7Z B;  4A94 C;  5JB9 E;  2W2N E;  3KQC L;  1NPE B;  1CX2 A;  1PGE A;  2VVC K;  3TBD A;  3NJP C;  1L3Y A;  1NFU B;  2Q1J B;  1UZJ A;  2FD6 A;  3N8W A;  4JZF L;  4RRW A;  4X8S L;  2P3U A;  1EGF A;  3Q3K B;  4XLW A;  2UWP B;  3EGF A;  3M37 L;  1HZ8 A;  4YT7 L;  3ZYJ B;  2BSF A;  6COX A;  1DQB A;  1EPI A;  3Q7D A;  2W2Q E;  1LPG A;  2Y5G L;  1ATA A; 
#chains in the Genus database with same CATH homology
 1W8B L;  1IQK L;  4XBM A;  1GK5 A;  2P16 L;  4Y6D B;  1HCG B;  2P93 L;  2VWL L;  3RR3 A;  1IQF L;  1NFW B;  1G2M B;  3TGF A;  4XL1 A;  1G2L B;  3BT1 A;  4FM5 A;  5IKT A;  3KCG L;  2VH6 B;  3BPS E;  3NT1 A;  5K0H B;  2Y7X B;  2M74 A;  2WPJ E;  1W7X L;  1I0U A;  1K37 A;  3LAQ A;  4TGF A;  3HPT A;  3KQB L;  3BT2 A;  1JV2 B;  5L2Y L;  3N8Y A;  2XBY L;  4M10 A;  5CKN A;  4ZH8 B;  3FBY A;  1WHE A;  3LC5 B;  4RRY A;  4Y79 B;  4BDX A;  4BDW A;  3HO5 A;  1AUT L;  3PGH A;  4Z0L A;  2CJI B;  4JZD L;  2NPR A;  4RS0 A;  4OTJ A;  1CCF A;  2FLB L;  3KL6 B;  2I9A A;  2BQ6 A;  4O1Z A;  2VWO L;  2K2T A;  1NZI A;  2VWN L;  2Y38 A;  3FCS B;  4AQT A;  1QFK L;  3KQE L;  4Y71 B;  2VJ3 A;  5CIS A;  5KIR A;  2WFT A;  2BOU A;  5IKV A;  3QH0 A;  3QMO A;  2K2S B;  1B9W A;  3SOQ A;  4OTY A;  2Y5F L;  1G1S A;  4RRZ A;  5F1A A;  1LPZ A;  2PUQ L;  3K9X A;  1EPG A;  2WPM E;  1APO A;  2Y81 B;  2VVU L;  2XC4 L;  3H5C B;  3F6U L;  3KK6 A;  1EQH A;  2KNI A;  3ZYG A;  3LTG D;  1YO8 A;  2VH0 B;  1U8C B;  2BOX A;  4CSY A;  3OLU A;  3TK6 B;  1TLE A;  3MDL A;  4X8T L;  5JVY A;  1YUF A;  1FF7 A;  1ADX A;  2BOK L;  4C16 A;  4BTI A;  2I9B A;  1PXX A;  2EI8 B;  2P3T A;  1KIG L;  2P3F L;  4RRX A;  3SOB B;  1FAX L;  3R05 A;  1RFN B;  1EQG A;  2MHP A;  1Q4G A;  2WG3 C;  4ISI L;  1ATE A;  1CEJ A;  3OLT A;  4NA9 L;  2J95 B;  1YUK B;  2W2O E;  2G00 L;  2RHP A;  5CKM A;  3HS5 A;  1IP0 A;  3LTF B;  1MQ6 L;  4BTT A;  3KRK A;  1HAE A;  3IIT B;  1WU1 B;  4Z0K B;  1NFX B;  2J4I B;  2EI6 B;  3C9A C;  3MQE A;  1IQN L;  5IKQ A;  3HO4 A;  3LC3 B;  2WPK E;  1X7A L;  3LIW B;  1EAI C;  1LPK A;  1DIY A;  1NT0 A;  4PH9 A;  1IQJ L;  3N8V A;  5EGM B;  1ATB A;  2J38 B;  3SW2 A;  5FDQ A;  2KV4 A;  1O5D L;  1ATD A;  4LOR A;  4YT6 L;  1P0S L;  1CCV A;  1C5M F;  1IQL L;  3N8X A;  1CQE A;  3SOV A;  3V65 B;  3ZYI B;  2KL7 A;  2XBV L;  5JBC E;  3TZI A;  1PFX L;  1KSN B;  1G1Q A;  2WFX B;  1UZP A;  2P95 L;  1ZAQ A;  3TH3 L;  4COX A;  3IJE B;  4X8V L;  4X8U L;  2XBX L;  4ZXY L;  3GCX E;  2BMG A;  4JZE L;  1CVU A;  3S6X A;  1HRE A;  4BXS A;  1BF9 A;  1FE2 A;  1MOX C;  2FLR L;  1N7D A;  1XKA L;  2JKH L;  2MGR A;  3NTB A;  1HAF A;  1UZK A;  1G1T A;  1IVO C;  1JBU L;  4D90 A;  2OYU P;  2WYG B;  4ZAE B;  5L30 L;  1XFE A;  1SZB A;  2RNL A;  1TOZ A;  3QCW A;  2BQ7 A;  3POY A;  1N1I A;  1L5G B;  5CKQ A;  4MMZ B;  2UWL B;  2Y5H L;  1IQG L;  4MMY B;  2J34 B;  5COX A;  1YUG A;  2BO2 A;  4CUE A;  4JYU L;  3CFW A;  2Y82 B;  4MMX B;  4JYV L;  1IQI L;  1LMM A;  3V64 C;  3HS6 A;  5JVZ A;  2YGO A;  2YGQ A;  5JBB E;  5E8D A;  4ZHA B;  1WHF A;  2H9E L;  1DDX A;  1XKB A;  1HT5 A;  4E1G A;  1G1R A;  4Y76 B;  1FFM A;  1FJS L;  1F0S B;  3HO3 A;  1FAK L;  3M36 L;  2RA0 L;  1XDT R;  2FLG A;  2TGF A;  1COU A;  2W26 B;  2XC5 L;  1EMN A;  2EI7 B;  5JB8 E;  1IOX A;  3LN0 A;  1IOE L;  1NFY B;  2W86 A;  1J9C L;  1EPJ A;  2P3F N;  2F9B L;  1NQL B;  1KLJ L;  1DVA L;  1OB1 C;  2KB9 A;  2BQW A;  1F0R B;  1EZQ B;  1IQH L;  1F7M A;  4NG9 L;  1ATA A;  1IQE L;  1HT8 A;  1LMJ A;  2VVV L;  4RUT A;  3CEN L;  1MQ5 L;  4CUD A;  5L2Z L;  2W3I B;  4ISH L;  3CS7 L;  2PHB B;  4BTU A;  3F1S B;  2WPI E;  3GCW E;  4Z6A L;  2DDU A;  1A3P A;  3HS7 A;  2WYJ B;  3KQD L;  3ELA L;  2PR3 B;  2J2U B;  1PRH A;  3CA7 A;  4YZU B;  2W3K B;  1IGZ A;  2ADX A;  3N8Z A;  2W2P E;  1UZQ A;  1Z6C A;  5KN5 C;  2MGP A;  3ASI A;  1DX5 I;  1EMO A;  4O02 B;  3U73 A;  2WG4 B;  1IJQ A;  5JW1 A;  4A7I A;  2P28 B;  2OYE P;  1HRF A;  2BZ6 L;  2AYL A;  1TPG A;  3U7U G;  3NTG A;  2W2M E;  4D0E A;  2VWM K;  1KLI L;  1LQD A;  1HJ7 A;  2B7D L;  2H9E C;  4G1M B;  2XC0 L;  4LMF A;  2XBW L;  3TK5 B;  1V3X B;  2Y80 B;  3ENS A;  3N8W B;  1U67 A;  1P9J A;  3GIS X;  2FZZ L;  1APQ A;  1IQM L;  3DEM A;  4BXW A;  2D1J B;  2WPL E;  1YGC L;  1CVW L;  2GD4 A;  4CUF A;  2UWO B;  2YGP A;  5JBA E;  4NGA L;  4Y7A B;  5F19 A;  1PTH A;  1IGX A;  1HX2 A;  1FSB A;  3LN1 A;  2WPH E;  3N8Y B;  1M1X B;  5IKR A;  1JL9 A;  2J94 B;  1KLO A;  3P5B L;  3FFG L;  1EPH A;  2WZP P;  2P26 A;  4D0F A;  4Y7B B;  1F7E A;  1URK A;  4ZXX L;  2BOH A;  1K36 A;  5I46 L;  1EBV A;  1Z6E L;  2P94 L;  2Y7Z B;  4A94 C;  5JB9 E;  2W2N E;  3KQC L;  1NPE B;  1CX2 A;  1PGE A;  2VVC K;  3TBD A;  3NJP C;  1L3Y A;  1NFU B;  2Q1J B;  1UZJ A;  2FD6 A;  3N8W A;  4JZF L;  4RRW A;  4X8S L;  2P3U A;  1EGF A;  3Q3K B;  4XLW A;  2UWP B;  3EGF A;  3M37 L;  1HZ8 A;  4YT7 L;  3ZYJ B;  6COX A;  1DQB A;  1EPI A;  3Q7D A;  2W2Q E;  1LPG A;  2Y5G L;  4M11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...