2YGPA

Wif domain-egf-like domain 1 met77trp of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
174
Chain Sequence
TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRWPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords WNT INHIBITORY FACTOR 1
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygpA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygpA01
2WFXB 1HT8A 4JYVL 4YT6L 4BDXA 1PRHA 2BQWA 4BXSA 3BT1A 2XC4L 3GISX 1V3XB 4ISHL 1IQGL 2BOUA 1IQJL 3PGHA 2W2ME 5JVZA 2P16L 2RNLA 4ZH8B 1NQLB 1JV2B 2W2PE 1OB1C 2KL7A 2UWOB 1FSBA 1DDXA 1CCVA 1KSNB 4MMYB 5KIRA 1UZQA 4BTUA 2EI6B 1IOEL 4CUFA 2EI7B 3FBYA 2J94B 2J95B 4XLWA 1X7AL 2P94L 2P3FN 2D3JA 2VWMK 3N8WB 4JZFL 3SOQA 1TLEA 5KN5C 2BMGA 2YGQA 5K0HB 3N8ZA 5JB8E 4BDWA 3ENSA 4RUTA 1IQHL 1CQEA 1CVUA 3M37L 3CENL 1DQBA 2D1JB 4MMZB 1EPJA 3GCWE 1IQFL 4XL1A 1F7EA 4CSYA 3LIWB 1YUKB 1W8BL 1O5DL 2UWPB 3TGFA 2YGNA 3EGFA 5E8DA 4D0FA 1EAIC 4Y7AB 2YGOA 1EPHA 2XBYL 3H5CB 3NTBA 4ZHAB 1APQA 3HS6A 2W2NE 2FZZL 4A7IA 1KLJL 1DVAL 4Y79B 4RRXA 2W26B 4XBMA 2PUQL 4OTYA 1IQKL 1XKAL 1CCFA 3TK5B 4M10A 4Z0LA 1WHFA 1YUGA 2WPJE 2WPKE 1LMJA 5IKVA 5JBBE 4YT7L 2W2OE 1PGEA 1CEJA 2MHPA 3SOBB 1ATEA 2UWLB 3KK6A 1L5GB 1NFYB 1U8CB 4COXA 2OYUP 3QMOA 4ZAEB 2FLGA 2W2QE 1F0RB 4X8UL 3ZYJB 3BT2A 1HRFA 3IITB 4O1ZA 2NPRA 3LC5B 1W7XL 2P3UA 5IKTA 2VVUL 2XBVL 2VWLL 1MOXC 1P0SL 1RFNB 1NPEB 2JKHL 3LAQA 1FE2A 3LN0A 3CS7L 1CX2A 1ZAQA 3KQCL 1NZIA 1NFXB 3HO3A 1HJ7A 1HCGB 5CKMA 4G1MB 1EPIA 1EZQB 2TGFA 2BZ6L 3N8XA 1KLOA 2VWOL 4Y7BB 1A3PA 2Y80B 1CVWL 5I46L 2Y7XB 4AQTA 3QCWA 1EMNA 5L30L 1TOZA 1HREA 4X8VL 1EQHA 1FAXL 1KLIL 3GCXE 2P93L 2EI8B 1IQNL 2G00L 2XBWL 1ATAA 1LQDA 5EGMB 3TH3L 4LORA 2K2TA 3FFGL 1FF7A 1I0UA 2RHPA 2Y5HL 4NA9L 1IQIL 3FCSB 3KQBL 2K2SB 3CA7A 1B9WA 1P9JA 1J9CL 4ZXYL 5L2ZL 4D0EA 4Z0KB 1KIGL 2H9EL 3MDLA 3N8VA 3U73A 3F6UL 2KB9A 1YO8A 2FLRL 2Y82B 4Y76B 3N8YA 1XFEA 2WPHE 3POYA 1WU1B 2VH0B 3KRKA 4PH9A 2RA0L 1FAKL 3K9XA 2PHBB 3KL6B 2WPME 2W86A 1AUTL 1Z6CA 1EMOA 1MQ5L 3DEMA 5JW1A 1DX5I 2WFTA 4RS0A 4FM5A 2W3KB 2W3IB 2WPIE 5CKQA 2J38B 3LTFB 4LMFA 4ZXXL 1UZJA 1XDTR 4O02B 1HX2A 3IJEB 1EGFA 2Y7ZB 2Y5FL 3NT1A 2WG3C 3ELAL 2XC5L 5CKNA 3MQEA 1IQML 4RRZA 5FDQA 1FJSL 1G2MB 4Y6DB 1PTHA 5JBCE 3SW2A 1UZPA 3HS5A 4M11A 1EBVA 2Y38A 1G1SA 1L3YA 4JZDL 4X8TL 1F0SB 2BQ7A 2XC0L 3U7UG 2P3FL 2Y5GL 4JYUL 2I9BA 1NT0A 1IQEL 2BO2A 1NFWB 1DIYA 4NG9L 1ATDA 3M36L 1ADXA 1YUFA 1MQ6L 2CJIB 2FD6A 1K37A 2XBXL 1HZ8A 3N8YB 1G1QA 3HO5A 2I9AA 3HPTA 1C5MF 4MMXB 3V65B 4CUDA 1EPGA 2J2UB 4E1GA 3SOVA 4BXWA 4TGFA 2PR3B 5CISA 3KCGL 3LC3B 1U67A 4X8SL 3HO4A 5L2YL 3ZYGA 1Z6EL 3C9AC 1ATBA 1LPZA 1JL9A 1IGZA 2VH6B 3F1SB 2WG4B 4ISIL 3QH0A 2Q1JB 1LPKA 2VVCK 1IJQA 6COXA 1EQGA 1M1XB 5IKQA 1K36A 3KQEL 3OLTA 5COXA 3ASIA 2OYEP 1IQLL 2BQ6A 1QFKL 2VWNL 3NTGA 4NGAL 4RRWA 3CFWA 1N7DA 1PXXA 2KV4A 5JB9E 4JZEL 1JBUL 1URKA 4Y71B 2M74A 2P26A 2F9BL 1SZBA 2YGPA 3RR3A 2DDUA 3TK6B 1Q4GA 2ADXA 2FLBL 3P5BL 2WYGB 1G2LB 1WHEA 4YZUB 3V64C 1GK5A 2P95L 1YGCL 5JVYA 2J4IB 3LTGD 2BOXA 3ZYIB 3R05A 3OLUA 4OTJA 3Q7DA 2VVVL 1F7MA 2WPLE 3KQDL 3LN1A 1IGXA 2BOHA 2Y81B 3HS7A 5JBAE 3BPSE 4RRYA 3N8WA 1HT5A 1G1RA 2WYJB 1APOA 1COUA 3TZIA 1XKBA 1IOXA 1HAEA 1IVOC 5F1AA 1TPGA 2B7DL 3NJPC 1LPGA 1HAFA 1BF9A 5F19A 1FFMA 2P28B 4D90A 4CUEA 2MGPA 1PFXL 2J34B 4BTTA 3TBDA 1N1IA 4C16A 2P3TA 3Q3KB 4BTIA 2MGRA 2AYLA 5IKRA 1NFUB 2VJ3A 4Z6AL 1IP0A 2GD4A 1UZKA 1G1TA 2BOKL
chains in the Genus database with same CATH superfamily
3LN9A 5AFAA 2NR6A 3TJHC 4NBYB 3S8GB 4IOFC 5I26A 1RUAL 1U8PB 4ISHL 1IM9B 3VAEA 3WNJA 4WUUD 4WI5A 2VABB 1PEWA 1VACA 3QHZH 1NZRA 2P16L 1NKGA 3L1OL 4B41A 1D5ZA 3PWPE 5T5NF 3QIWA 4HUCA 2NW3A 1H6TA 3VRLF 4YPGA 4JZJA 4U6XB 2X6AA 4GFXA 4J1UB 1JWSB 3WY2A 4C4BA 1IAOB 3MRIA 1CZ8H 4Y4HB 3KPRD 4Z3TA 4RISL 1KSNB 1CU4H 5CCKL 3C5SB 3UZVB 3GIZH 1KN4L 4GH7B 2I60H 2JKSA 1JWMA 4QTIH 2CLRA 4HUUA 4UQDA 4MCZB 2AV7B 4OLYL 4X5WA 3A6BH 2I5YL 2P3FN 4UTAH 2PO6B 4YK4C 2WINB 4N20A 4G82A 1P9MA 1RZGA 2KKQA 1EEZB 3K72A 1MDAA 1WV7T 1SXAA 3NCWA 5DQJA 1G9ML 4Z78B 1UH2A 4OB5L 1KKEA 1MCKA 5DJCB 1IILE 1A9BB 2VDLL 5IMOB 3IGKA 4KKBD 4ZS6D 1XSKA 3K0YA 5KJRH 4GG6E 1NCUA 4NUQA 3DPDA 3NFPB 4IOIB 4E9RA 1RJZA 4ADJA 1KACB 3FUNA 3FRPA 2FJHA 4CSYA 4AV4A 5C0EA 5LQBH 3IVKB 4R7XA 2J8UB 3VYPA 1X9QA 5FUOL 4N2EA 4G1MA 1C7SA 3U82B 4GIPD 4YDNA 3VFOA 5GGUB 4OLVL 3T1FB 2E8YA 1D7BA 5C3TA 2IH8A 3U79A 1E28A 4K3JH 5IY5B 2IOIA 1WFJA 4DETA 1USQA 2NNFA 2YGOA 5CN1A 4CILA 2YEQA 1S7XB 4ZMPA 1HSAA 3QUMB 4RAUB 3QCUH 1QUNB 4JFVA 1APQA 1HQRB 1LNUB 4LLYB 2YD8A 1QI5A 4NZRL 4JO4L 3M86A 3BC9A 4KY1H 3BWAA 4ODUB 1TVBB 3LKQA 1AGDB 3FCBA 4X8JB 4BYHA 2W9DH 3JWDC 2L7QA 2AJZB 2DL2A 3B9EA 4Q52A 3VWJC 2VSCA 1ACXA 3HAEA 4FP8L 5HHPA 5LCVL 1N0LA 4JFDB 4OF5A 4YHOH 3EHBB 2OYLA 1G94A 2L3BA 1BQHG 2BY2A 3MV01 1JWUA 4BKLB 1H8NA 1YY9C 1CGXA 4JG1H 5F96H 1E4WL 3KXFB 5LBVA 3FOLA 1XGZA 5IKVA 2HLEB 1P6AB 3KYOB 4A1RA 2W2OE 1ZHKB 3BMVA 2FO1A 3JUZA 2R8SH 1EUUA 1OCWH 3WFCL 1P5VA 4RLDA 3HG5A 3NRQA 3CFEA 4PJEE 3FCUB 3FN0H 1SY6A 2FQEA 4WV1B 1KPVA 1ZLEA 25C8H 2NMSA 3LHPL 3BT2A 3HUJE 5EU6A 4OUUB 3RWJA 1MCHA 5HVHC 5EUOA 5E4IA 5F1IB 4DPBX 4TNGA 4JK0D 3LN5A 4F8TA 2AXJA 2XWTA 3LAQA 1W9XA 4LMQE 1L9RA 4N0CC 1N67A 2W9EL 2YRLA 3O2DA 4L3ED 4GKNA 3NPSB 3LB6C 1YNKL 2IANE 4XE5B 1DFBL 3DTUB 5MEOA 1OT2A 1CN4A 3P4OA 2P5WE 3KQCL 2E74C 4CSZA 1CS6A 4B0MM 3UTSB 1A3ZA 2PTTB 4HK0B 3UO1H 4BKSC 2P46B 5AG8A 3RY5A 2AEOA 4ZTOH 4OCLC 2NNCA 4ZNEA 1F11B 1ZA3B 2K70A 3LAFA 1J0IA 5DZJA 3WNNA 2DYPA 4X6BB 1SJEA 1NUDA 3F7VA 1OD9A 5JIIA 3AG3B 4Y7BB 2MQCA 3ROOA 2IMNA 1H0DA 1MFBL 2Y80B 2BNUA 1CVWL 3OKMB 3HNTH 5C0CD 6PCYA 4P9HC 4OCSL 2N56A 3CIQA 3DSNA 2V9RA 3U4EA 2A9BA 1EX0A 2DQFB 2NZIA 3QXAB 4ANUA 5I1EH 3T0EA 2WXOA 5DURD 3VFNB 4AGLA 3GCXE 1RJLB 1JD7A 1X5YA 2I9LA 2NY0C 4OI9A 5IP4A 5TDNA 1CPUA 2K6WA 2WWMD 1XEDA 2Y9RT 5D1XC 5CWSA 2R69L 4YR6B 5IFHL 4AKQA 1KJ2A 4EEEA 1HWGB 3LEXA 1ED3A 3INUL 1I85C 1B2WL 5DQ9A 1LP9E 3ZMEA 3ZY7A 1I0UA 4NA9L 5D2NE 4BXSV 3TURA 1IC4H 2YKLL 4FQXD 3C6SA 4A6YB 3PNRB 4I2XE 3FT4B 4MRBA 3U2JA 3VG0L 3ELAT 2DIEA 1P9JA 2DI7A 5T3XD 1UKSA 1MFCL 4D0EA 4KKPA 3ZHLA 4Z0KB 1PD0A 2Y25A 4PWEA 1AZNA 4M7JL 2AV1A 4NRXB 4RCAA 4GAJL 1PX4A 5E7FA 2BP0B 4OZHE 5IM7A 3QEHB 4QRRE 4UILL 5EFIA 4W70A 4HVBA 3SDCC 1KB5H 2ORBL 3W0WE 4L3CA 2EADA 3RBGA 4A7SA 3QZPA 2DJ4A 3GJFA 3WJJC 3Q6FA 1OD7A 3PJLA 5AVWB 1FFOB 4LOEA 4OTXH 1U8OB 1DN0A 3L9EA 2ESVA 3O6FA 5IQMA 3NIFE 3US1A 3NJFA 3UTTD 4Y2OA 1QTYT 3DUUB 1IM3A 4U1NB 5EZLA 4MSWB 5T5NG 4FL4C 1G9NL 2R1XA 3SKNB 1EMOA 2O6PA 1I7UB 3BFOA 1K72A 4X7DC 4KUZL 1U92A 5T1MA 1E42A 2JXMA 3GS7A 3GUFA 4HJSA 4IOFD 4YHNA 1OP3K 3PIQB 4AM0Q 1HKLH 4LMFA 3U6XA 5B8CB 2IAMB 2XXFA 2E6JA 1ZJAA 4G9FD 1THCA 4KUCD 3O4OB 1A4CA 4X9HA 3WXVH 1MHHA 3L3DB 2CBMA 1B6DA 1EDHA 3FONA 1IIIA 1CLYH 1BSIA 1F4YH 5F7WC 3OGOE 3VXPA 4MJIA 2XQYK 2AK4D 4YSPA 1NC4B 1NFAA 3ELAL 2NXYD 3PHOA 2VRSA 4U7KA 4YSUA 1CDYA 4OCRL 1JF5A 1A64A 1KLGA 5I30L 4P2RA 1BM3L 4WRLA 1IB5A 3RKDC 2NR6D 5DD1L 2P8MA 2EDBA 5EU5A 2FNWA 4Y6DB 2WKOF 3V4PL 2IDQA 1PZ5B 3CQPA 2BIQA 1ETJA 2QPDB 1NEZB 1U8IB 2CBQA 5A7EA 1S5HA 3EJQA 1CTOA 1X4ZA 5IJCC 2VDRL 3B43A 1RP8A 2E86A 3KHQA 3I75B 4HX1A 3ARDA 3QNYA 5DMGD 3BN9D 4YZFE 4FTVA 3K1KC 5GGRY 1DUYB 2BO2A 4GRWF 2XRAH 2HP4A 3VDCA 1QSZA 4EE2A 5CEXA 3RUGE 3MR9A 3P4MA 1A7PH 2KC0A 3NQKA 4JFFB 5C0FB 2OR8A 1M2VB 4MVBC 1FH5L 1WIPA 2FD6A 1K37A 4KKNA 2X4TA 1OPGH 3C8KA 3ZO0A 4GBXA 3OJDB 1F4AA 4POYA 1J1PH 4EI0A 4PJIE 1XGTA 1FO0L 2OMTB 4HPOH 4Y2DD 1NLDH 3VFTB 5FF6A 2HT2C 1ZE3C 2XIIA 3B7SA 2P5EB 1LE9A 4XP5L 4PRIE 3WELA 3NFNB 1JNNH 3TONA 1TTGA 2H8PA 2B39A 4EBQL 2CIKA 3PQYD 4JM2C 2JE8A 4TSBH 3KYAA 3MJ7A 5EIQA 4LSUL 1BDYA 3UAJC 1KCRH 3EUUA 3PWNA 5LGHH 1J5OL 4NWUL 4J7RA 6CGTA 3HC4L 2CO7A 4O02L 4JJ5A 4JZOA 4RA0C 4K9EC 1NGQH 4ZO8A 3KCGL 3EGDB 4X8SL 1KFAH 2FIKB 3VGAC 3WO3B 2Y3NA 1ATBA 2ZOLA 3UX9B 3GZPA 3I9GL 1V1IA 3NTCL 2AXWA 1L3NA 1F42A 3T5WA 4NQCE 5G5DB 2IBBA 2F18A 2MCMA 4JO5A 4OCWL 3SO3B 1YUHB 4U1HB 3ARBC 1IZKA 1ZS8B 3AY2A 3RZCB 4NUGL 1JTTA 1SJMA 1ETZB 2HG5B 5TGBA 2BP8A 4OGYL 2KPNA 1C12A 5IKQA 1CL7L 1GHFL 1PZ3A 1IJ9A 1KJMB 3BSZH 3FUIA 4WU7B 4AXWB 4YXHH 4LHUD 1NFDA 1XT5A 1AKJA 5ACZB 2YOAA 4WY7L 5CINL 4L37A 4RZCB 3O9WB 4X98B 5T5FA 4X4YB 3SGKA 1ZV2A 4JZEL 4EUPB 1K4CB 4LMQI 4Y4KB 4N2DA 4Y5YC 3OWEA 3QR1A 2HMIC 1E5CA 2M74A 3SBQA 4R7LA 4IJ3B 1SZBA 5CU5A 3HMWL 3Q5TA 4URKA 3M17A 5DS8B 1RKRA 2N4IA 1INEH 3F7LA 4Y1TA 3ZKXB 1KTDB 2ADXA 2VM4A 1HHGB 3E6HA 4Q6IB 2BXZA 3ZTJG 2X38A 3SBWA 1RPUA 4HSCX 3ZTJH 3LB6D 4FLSA 5C97A 1BWMA 4DWHA 1HINH 2F7PA 3K5SA 4UUJA 1JUFB 2COQA 5HYIA 1GK5A 1ZA6A 1X6NA 5F3FA 3B8YA 1DQMH 3BZ4B 5D93B 5D2LE 5LN4A 1H5BA 3RY6C 4YHLL 1J1OH 3FO2B 4S1QL 4TNEA 5E99L 3TYGH 2OCJA 5HDBF 3ZZ1A 5GRUL 5T33H 5I9QC 1EZVX 4TL4A 1YECH 3CZJA 2WPLE 4DIXA 1J8RA 4F33B 1LO5B 4N6QA 3V7AG 3QRFM 3P73A 5IIEB 2H0PA 3M8OL 2MIZA 3IGAB 2CQVA 1YEKL 5T3XL 1G1KA 2DKSA 1UWYA 4M1CC 2AJUL 3HC2A 1D5MB 4YL4A 3ILQC 2NY0D 2BW5A 1OSPL 4QRFA 2G2PA 3CLFH 3D50A 5D1XD 1S7UB 1ZLVH 3UTPD 4D8PB 1IE4A 1YG9A 4N0YL 4DAGL 3SDAA 2VXSL 5ABZA 4WUUE 3W57A 4WEBH 3RA7H 4U1LA 3VSUA 3VU2A 2P28B 1P4BL 2NY3C 5AAMA 3GXNA 1L9SA 3LJ3A 1ADQH 4G5ZL 4BFNA 4LP8A 3OKKB 3WFZA 3QO0B 2UZIL 4G7QB 2H32A 3P02A 1YEDB 2P3TA 5KYNA 4ZSOA 3SYPA 1A6TA 1JK8B 2CNYA 4UTBL 1ZK9A 2FT6A 1MHCA 1HFUA 2CR0A 5ITFB 1I8UA 3E6FA 4H5SA 3SDCD 4EOWL 3PREA 3SPGA 1ORSB 2WTPA 4NYLA 1UZKA 4TVPH 4ZFOA 1QHPA 1S4IA 2CBOA 2DWYA 1FPTH 3QEQA 3EOTH 3TVMA 1RUML 4YLQT 1EHNA 2VH5H 3TIEA 1QATA 5KVEH 3MOBH 2XC4L 3GISX 2E7BA 3F7RA 3WFBL 5BZDB 3UH8A 1QFUL 3PP4L 3UOAB 1SBSH 1ADWA 1L7IH 5I8CB 3QWQB 4LVOB 3HG0A 3OXRB 5CS7A 4W9IC 1SF3A 2X09A 1AXIB 3MBXL 4PGCB 3B4NA 4BH7B 2XQBH 2DDQL 1DDXA 4MJ5B 2W38A 3MGOA 2B59A 4Z5RA 4JPIA 1OAZL 2C4XA 1IOEL 4Y5VB 5D8JH 4Q9QH 2ESVD 3HE6A 5F7EH 2EIBA 5CEZH 4TLTA 2AJXL 4B9KC 2G0KA 1YDPA 4Y4FA 2BVUA 2WXGA 3BWZA 5MEPA 2UY6A 3HS0B 3TJPA 1HILB 1DBKH 3GXUB 2VDQB 5F88A 1EK3A 2XX1A 2AF2A 3WNPA 2NYZA 2YFOA 3V5HB 3MRCA 3WJLC 1JNLL 4HHGA 3UBXG 2QPFA 5IR1B 1QKZH 1UM5L 2P48B 1IZJA 3IEAA 5ALCL 3H2WA 4N8CH 4B50A 4OZFA 1OE2A 1WD9A 3SOTA 5ISZB 4HF5H 5TF1L 1UD2A 2NY7H 4GAGL 5EIIG 5HHVH 4YVNA 3VDAA 1KF9B 1P5UC 2XVLA 5BRZA 3SY6A 4BFBD 3U4BL 1U4EA 4K5NA 4NKIL 3LIWB 3AM8A 4WW2B 4XP4H 1ASQA 1HT6A 4JHWH 5KVMC 2WLJA 5FWQA 4OIFA 4JO2L 4N4YB 2NY4B 2GUOB 3D08A 4EI5B 3MRQA 5HI5D 3GBMH 4OLZL 3DDFA 1ZKAA 5C09D 2JJLA 1G4RA 5KYXA 5AZEL 1BMWA 1CWVA 3C5ZA 1T5XA 5EO0B 2FB4L 5A2KH 4H8QA 5MEQB 3MUGA 4YN3A 2VR4A 4Q4EA 1B4TA 3JWDL 3O45A 4J3TA 2VKXA 2XCMC 3W3BA 2OCCB 1J5IA 3BCDA 3W38A 2IDUA 2HT2D 4TN9A 4G70B 3WIHA 4KV5E 4PJ5D 3QAZC 1NMAL 1Q9KB 2LU4A 3S5LG 1UQSB 2CWRA 2GTWB 3PJSB 4JM2D 4ODBD 3ISYA 3MLWH 4DGYL 1P4IL 4ZW3A 1MI5D 2I27N 5DD5H 1XKAL 3BYTA 4HIHB 4XMWA 3T0AA 4LSSL 4TUOB 5DHEA 4AQOA 1YUGA 4UTAA 4UQ2A 5AYTA 2D3VA 1LMJA 5DWUH 2C9AA 4R26L 3S9DB 4F8NA 2ZYRA 4OZGB 3RWHB 1LM8V 2DH3A 1ZVYA 3FDWA 1BOGA 4IU2A 3ZSSA 5DJYB 4XE0A 4JN1H 5IVZA 3X11A 3CLWA 1C16A 1XF2B 1MNNA 4QHKJ 2Y3AA 4G7YH 1I9RH 3ZKNC 2FATH 5D6DA 5C0CE 5HI4C 4MAYD 1EAJA 1GZHC 1UZ6E 1KTKE 1MAJA 3DOHA 3GYRA 3L3JA 5K59E 4O1ZA 3GJEA 1LEKB 4FKEA 4DEWA 2W88A 5CJBA 2BPBA 5DK0B 3QISA 3A6CL 2QTEA 3CX2A 4LLQB 3LZFH 2ZT9C 3QJVB 2DLHA 4UZGA 5DJ0B 4FG0A 2J2ZB 3LV3A 2WBXA 3CDCA 4WW1B 5A16A 1EFXB 1U42A 3DUHA 3OB8A 4HXBL 3IDNA 2E7MA 3O3EB 1Z66A 3QWOA 4Z7VE 5TE6H 1NCGA 3BT2L 3U25A 2D3LA 2WSKA 5DD0L 2CXGA 4IU3B 1L0XA 2HMID 4N5EC 4PJXE 5T3XE 1YPZB 4FFYL 4N1EA 1SN2A 1BZ7A 4DVBA 4PJAF 2X89D 5DYFA 5ABDE 1C5CH 2H1LM 3HN8A 3P3RA 3L81A 4Z7OF 4XCFH 2YEZB 2D2OA 2NLJA 4HZLB 1HE8A 1NICA 4NSKA 1AKJD 1TMCB 4OJEH 1BP3B 2WYIA 3OHMB 3MDJA 3I84A 4U3HA 4XHQA 5HGHA 3DV6B 1G7PB 4DTGL 4Y16C 3QHTC 1EMTL 2X88A 1BQHA 3BIKA 3MCYA 3ARGB 5KYWB 4XO9A 3V6OA 5CGYC 2ZX9A 1J0HA 3M46A 3NEEA 1JPSH 1AZVA 3QULB 2D31B 3V8CA 4K5MA 1I7TB 1O7VA 2G9HB 3F7YA 2O61B 3NIDB 1ATAA 1N6QH 1E9QA 4V2BA 4GU4A 1BZOA 3IE9A 3I02B 4YUEH 4JPVH 1J8KA 3ZDZF 3SJVA 2E75C 4ETQA 5I8KH 3VXUA 3ULVF 4AM0A 3ILQD 2UUDH 4M6OL 1YMME 4ZXYL 3PWPB 5ETUA 5TD4A 4IEFB 3VSQA 4MFHA 3IS1X 2G4EA 3AGWA 2DL9A 3H1ZA 1OM9A 3F6UL 5AYQA 4OLXH 4BFEA 2NY3D 1XF5B 1VKXA 4BFIB 1U91B 2DLIA 3BPOC 3UYOD 4G8GE 1TOXA 1U41A 1ZT1A 2DQHH 3KL5A 2DMHA 3D09A 3BP5A 3OZ9H 4NT6A 2C9QA 3V5KB 4ZUUB 4LSTL 2ILLA 5LAXB 2FWSA 3ZVVA 4PBWD 3QCVL 3KPPB 2GABA 4YLBA 3DO3A 1SXZA 2Y24A 1A14L 3K9XA 3OSVA 5F1NB 5GZNC 2ZUSA 4PHZA 4XMVA 4G8FB 3B5HA 2GAZB 2MKWA 4CN4A 3GSNL 2CHXA 3HBPA 1IEBA 3EYOA 4UI2A 3FFDA 5E8DL 4RQQB 1R3IL 3ESNA 3SE4A 3QQ3B 4I5BA 1WTLA 1ZHBB 2OKMA 2XETA 3AREA 3FB8B 3O41B 5BO1L 1B0GA 5C6WH 1JI1A 5I16A 4NERA 2F54E 2XG4B 3TNMA 1T0NA 3X1EA 1OSZB 1C1EL 1MJ7H 2GK0A 4ZQKA 3REVB 5DJ8B 3E9UA 2OTUB 1PVHA 1NOFA 1RSYA 3QPXH 1I1FB 2HLAB 5F7BA 2NTSP 3X14B 1WBZA 3HG4A 1MF2H 1NAML 3VGHA 2CUHA 4JX0A 5HHOD 2OL3H 2BNRA 4WU5A 1MHEB 3TVMD 4QHMB 3CAFA 3VMNA 1PY4A 1JHLH 3GMLA 3HMXA 4NQXB 4ZTPL 3WY1A 4RGOH 1UJ3A 1AOZA 4KKQA 2RGSA 1QOKA 4P9MH 2EDYA 2CK0L 1HESA 1LO3H 2HKHL 4XNXH 4NO2A 1R9FA 3MXWH 3EOYG 2WP3O 2RCSL 4DSYA 2H7WA 3MRNA 4MD5A 5EPMB 3CCHB 4PB9L 1JCVA 1LO2H 5AOLA 4QCIB 4IBSA 1KENL 1JMXA 4JFPB 3SQBA 5JOPD 1UB6B 2A74A 4XCYB 2IQ9L 1X5LA 1L6ZA 3BYYA 4NPYA 1AZBA 2VDOL 2I9BA 4OT1L 1CBJA 2FGWH 1LGVA 4IBUA 3UJIL 4TSCL 1W72A 1IE5A 2P4AB 3KBPA 4CDGC 2FH6A 3HE6D 2AQPA 2R9HC 5J13B 1VPOL 1DEEA 4P3WA 4CN1A 5BO0D 1G0YR 4IBTA 1GOGA 1XF4A 4N0RA 4YWGH 4XOBA 3V8OA 1TQUA 3NFSH 2C5DC 4PJEB 5AW1B 1MQKL 2VL5A 2WW8A 3BAWA 2YRPA 4ZW8A 5IEHA 5JW5B 3TCXA 1CICA 2A6KA 4WO4A 1QRND 4NENA 1VENA 12E8H 5JPNC 2V2TA 2CGYA 2YUVA 3BGAA 3HUJB 3QXVA 3W9EA 4G2AA 1W0VB 5F3HB 3L5XL 3OQ3B 4MA8L 2J1XA 1UZ8A 4JY6B 5E23A 4K9EL 3RVVC 1R3LA 5ESQA 4HKXB 3QUHA 4WK0B 3K8MA 1PSKH 4HT1L 1BXVA 1CL7I 3OR6B 3S3SA 3NCFB 4FYSA 2IANB 2AGJH 4NNYA 2G2RB 4YE0A 2P5WB 4FAAB 3TPUB 1QLFB 3RIFF 3U46B 2C9UA 4LKXA 3NCJH 1XGUA 4G1EA 1IMHC 4XGZB 3EO1A 4MQXC 2H2SC 3BAEH 3AT8A 1DP0A 4Y9GA 2BC4B 1NIDA 2WTRB 4FYRA 5A43C 4UB0H 4ELKB 2DQJH 1QZNA 4R4BA 2FSEB 4PJ7F 3QDHA 2MKLC 2BIHA 4QYAA 2QKIB 2A73A 4R7NB 1F6FB 1P7QD 3MUZ1 1FV1B 1R34A 3PV7A 3W9DA 4WDIB 4NC1E 3OLTA 2C4FU 3O6KH 3UJJL 4ACPA 2PXYA 3NK3A 5ITBH 5JQHC 1T1WA 4CW1A 4RRPA 4LO9A 2B20A 3LPWA 1QFKL 1IL1B 3O3DB 4ODVL 2B7DT 4RESB 2J1KA 5EF3A 4PB0L 1U2CA 4HOWA 2YBRA 3S37X 2WXIA 3S4SG 5BVJB 4O5LH 2DLFL 5AEAA 2B9BA 3K6SA 1TQSA 4PJ8D 1LP9B 2ZYHA 5CJ8A 3WO4B 5D2NB 3DBXB 4LASL 3EKCA 2P7TB 2XVKA 5F7AA 2UWEE 4GS7C 2IFFH 3DX6A 5D1XE 2DDUA 1Z0MA 1S6NA 4XBPB 5JXEC 3VD2A 4F7TB 1WFOA 3EYFB 1RIUH 1HXMA 1PZBA 4LLVA 1AIZA 2YQBA 2W65A 1WK0A 2CKBH 4XVOA 5I74B 4PU2A 3G5XB 4N5ED 3ILDA 4IRJD 3X13A 1MCWW 4OZHB 2FDBP 3SKMA 2E27L 4K23L 4QRRB 1IEAB 3L95A 3RL2B 3QUZA 1BQRA 2Z4QA 3S2AA 3W0WB 3VTAA 4E9YA 2VLKE 5ECJE 1U93A 4KVNH 3V0JA 5TE4H 2N01B 1OLZA 1DQJA 1Q90A 1RZKH 5E4EB 2GI0A 3HZKA 1RHHA 2OBGA 4H88H 4AL8L 1ONQB 2VXUL 3E7JA 43CAB 1BZQK 3NIFB 5FM5O 5CGYD 5MI0B 1INDL 1T1ZB 3E2HB 3APNA 5EO9A 1VF5C 5DXWA 1NH6A 3BO8A 3FTZA 3LRSA 4JREC 1I8MB 1Z1WA 3LN4A 3SDXE 4QLRA 4C8XA 4N3UA 1ILSA 3CHXA 2N1TE 3BSZA 1Y7VA 3FMGH 4XCEB 2QZ5A 4HIPA 5F0MB 4F7PA 2B7DL 4YE4L 2XFXB 3LQAL 1HAFA 1FFPA 2NCEA 4E9TA 3NZ8A 4MMZA 2D7OA 3ESMA 5DA0B 3TH2T 2XN9A 5MENE 4ZX6A 5JXAH 4YXLH 3L4WA 2DWEB 3M45A 4N68A 2CIIA 5A2IH 5ADPH 1YCSA 5FGBA 3MUUA 2VDLB 1ZLUH 3A5VA 3LKNA 4APQA 4ZAKA 5HBBA 4TUKH 2WO3B 1FYTD 5C3LD 2LE9A 5D1ZA 4HJ0C 2ITDB 1N4XL 2C3GA 3RILA 5F6HJ 2Y69B 1FAIL 3X1GA 4XVJH 1E4XH 3WL9A 5JIDA 2XIBA 3SJVD 4DZBB 2WYHA 3I6SA 4P5SA 4M6MH 2WBJC 1RI8A 3GNMH 4P3CL 4BDXA 3MLYL 3FUKA 2GG1A 1PRHA 1GJIA 1QPPA 3QIUA 2VJ0A 5GZND 4KHTH 1I8LA 2HN7B 3DRTB 1KYAA 3REWB 2OX5B 3U9PL 2W2ME 3CZLA 4N8VG 3P9WB 4XP1H 2KL6A 2P80A 3PWLA 2MRYA 2X4UA 3VI3F 4HJGB 2OJZL 4YNYA 1LL1A 3RUGB 5BPPA 1CYGA 5DJ2A 3K8LA 4Z0XB 2EXWC 1D5XB 2FE0A 3B9KC 2R39A 1WYJA 2VQ1B 3TO2A 1MW3A 3B37A 2JJTC 4PJIB 4FLHA 5ABAA 3QG7H 2J4WL 1T04A 3NCBB 5GJSH 1GGBL 1BJ1J 1ZLSH 3RTQA 1NM9A 1V7ML 5IB3A 3OX8A 4PRIB 3KPQA 4J12A 4P59L 4X4XA 4XTRC 4O4YH 1OQOA 2LLNA 2C9PA 1ADQA 1OL0A 3L3IB 3MACL 3GKWL 3GZKA 5BOZG 2B3RA 4DW2L 1MCSA 1OHQA 2YGQA 3GSQB 3ZRSA 3BZ5A 4XPGL 4HG4J 1FVDA 4Y2LA 5AB1A 3BVNA 2QPEB 3ETBJ 2I69A 3ARED 3ENSA 1XGYH 3UZEA 4TNWF 1LWJA 1NIEA 4HWUA 1PAMA 3IFPB 2D1JB 4M43H 4JHAH 1AI1H 2DQCH 2A7BA 5L2KD 4XL1A 4NQCB 1D9KB 3TBWB 2J25A 1YUKB 4J8RA 2B8OT 1U58A 4UYPA 2BNRD 3JV6A 2K3TA 4HIJB 4LCWB 4O2FB 4QRUB 1GA2A 1WZMA 5CSZA 3TGFA 4M93B 2R29H 1U3ZA 4I48A 2R9HD 4D0FA 3MOAL 4QHKI 3VM5A 1X5ZA 5CU9A 3W2DL 1MJ8H 5CJOH 1FZKB 2R1WB 2EDMA 3KD4A 5IHBA 3FQXA 1F58H 1M42A 4X5QA 5D7SL 4Z8FH 2ED6A 2OMWB 3CBKB 2I9TB 3WHE1 3F01A 5EU7C 2HPOA 1MCCA 4FQHB 1GKOA 4MA3B 3GSRA 2WKOA 4XI5C 2HX9A 1WUNT 1TIUA 3OLDA 4AK2A 1U8NA 3BAJA 2O5XL 3HI1B 4FI8A 2R27A 4FMVA 2V3DA 3RVVD 2X44D 3BXNA 3OMZA 4AQZA 2KERA 5FCSH 4X5PA 2EICA 2PYFA 3EGSA 1HE7A 4JANA 2BJMH 4M10A 4K0OA 4L9LA 4WI7A 1JV5B 4A04A 1U8QA 4LKCB 3BQUA 4FMFA 4PRAA 4HBQA 3WKNA 4IMLA 4B9FA 4ZUSA 4LF3A 5ACLA 5IROD 4I85A 5JLZB 3KWXA 2C1PA 4R5XA 4PJDF 2C9SA 1PGEA 3MRJA 3DIVA 3GTVA 1MJJA 4MQXD 1MRFL 3ZN6A 3ZKMC 3POCA 1EIBA 3KMDA 4DZ8B 3N0PB 1C5BH 3N3EA 3JTTA 5EIIA 4PJHB 2F8XC 1I1AB 2YMXH 2FBJL 1K3ZA 4ZZKA 1F0RB 4MASA 4GI6A 3I9IA 3V0VA 2CLZA 4M62L 3SE3C 1VRSA 3DIDA 2F58H 4CJ1A 1LLAA 3ARTA 5L7XH 2XBVL 1KEGL 4FQCH 2BZDA 2WWKO 4PRDA 1IC7H 3FT2A 4I9WD 4OAWB 3CS7L 2EP6A 1NCJA 3O6MH 4X4ZA 1CX2A 1MCPL 2OYKA 3IDMB 2VYRE 3WIFA 4POUB 8FABA 4WUUB 2EDRA 4FQIH 3H3KA 4W4NA 3U0WH 2J8UF 3V55A 4ZI8A 3O2WL 4R83A 4ZMVA 5E6SB 5JXED 1EO8H 3CVDA 2CGZA 4LFHG 2DD8H 3WE6B 3WAJA 3OWRA 3S5LA 2VWOL 3LHAA 4QXTB 4NHUB 3SZ6A 5L88L 1DQQA 1A6PA 1Z9MA 2FJUB 4S1RH 5DRNB 3UIYA 3ZDWA 5BS0D 1ORQB 2EC8A 5CJQL 2CHWA 1A7RL 4KX7A 3QZNA 1KLFB 4K7FA 4XO8A 3FQNB 1HREA 3P0YL 2R0WH 5D7LD 5AKSA 3D51A 4A55A 4RETB 4PW3A 5HHQB 5E2TL 5FCUL 3MRFB 4X6DE 4P23C 1I7RA 3FFGL 4BH8B 2XLLA 2RHPA 1AMYA 4N85A 1Q9LA 3BCFA 2NQDA 3DHUA 4WUKL 5DMKA 1E27A 4L4VE 3FQYA 5C07A 1UH4A 2SODB 4M7ZC 2GSIA 4B9YA 3LKPB 3SKJH 4BQBA 4QIRA 4O2CA 1U33A 1JF1A 4UAOC 1AGCA 3GMQB 2ZUTA 3BW9A 4NM4H 4Z7UE 5TQ0L 1V7NH 4ZUTA 3RWIB 1A1MA 2VITA 1D6VH 4XXWC 1P7BA 2J88H 2KPWA 1JYXA 3GSWB 3PGCA 3N8YA 1MRCL 3MFGB 4JFXA 3GM8A 2VSKB 1QP1A 5KTEL 4M1GL 3N9GH 4GP8B 2DQMA 2ZSWB 1B4RA 2RA0L 4J3VA 4M5ZL 5DHVB 4NBZB 3LQZB 5HY9A 7CGTA 1SDDA 3WEMA 1MFEL 1EZVY 3CGTA 3QZBA 4O58L 1J1XL 1FG2B 4U0RB 1N64H 3N42B 2NX5A 4K5PA 5FYJD 4XPBL 1I9IL 1DVYA 2W0FA 2XN9D 2DBLH 4R7DB 1HX0A 2EE0A 2W1NA 5F1OB 1DX5I 2FEJA 2G75A 4E0RB 3AAZB 1KJVA 5IKCB 5TPWL 4CBZA 3LTFB 1FZJA 4F5CA 3G5YA 2AQNA 3ESOA 2QQNH 1WWCA 5E8PB 1MZZA 4Q9BA 1QSFD 4XAKD 4J3OF 3V6ZA 5I17B 4Z0BL 4O02B 1CCZA 3D25B 4JKPL 1P84J 3RDTA 2Z0UA 3IDIB 4ANWA 1HH6A 4FG2A 2V4LA 3X3FH 3CJJA 5CKNA 1K5NB 2EXWD 3MLSL 3BRFA 5I1AB 1QRNE 3PG2A 5D1QA 4F7MA 4L4JA 5AB0A 2CJ3A 5CFAA 2BIPA 1FJSL 4PCKA 1YEJH 2AERT 3CHPA 3PV6B 4OJAA 3OKEA 4YBQC 4AJ0A 4D0CA 1WFNA 2D2CC 2FJFA 32C2B 4XWOC 1MVYA 3BKMH 1EDYA 1KJ3H 1RZ7H 4HU8A 4HUWA 5C71A 5JPMA 2C1OB 4NQSB 4D3CH 5HYSG 1NBYA 3MYZA 4WHTB 1GYCA 1QG3A 5E6IC 2A6JA 4B9CA 2ZUQB 3HMXL 1PKQA 4I4WB 3F12B 1C08A 2ATKA 1CBVL 2HJLB 1Q72H 1JPGA 4PW4A 4HS8H 1ZLDA 4XP6L 4B9PA 2FQDA 3L3GA 3RG1C 1JYVA 2NQ3A 3U7YL 3Q48A 3H56A 3CPLA 1HQ4B 3FN3A 2ZUYA 3QYNA 4R0LA 4D9LH 1EJOL 2JIXD 5IHUL 2WKLA 2FBOJ 1SM3L 3EBHA 3IFNL 6FABH 1XH3B 4I3SH 1KTBA 3G08B 2VAAB 1BVKB 1OAXL 2ZYSA 4D2NA 5C0CB 3B7RL 4RMQA 4MMXB 4MD0B 5DEJA 2DBJA 1BZ9B 5TFSL 3PHQA 3VUAA 2FEEI 1IGIH 4NO3B 5DURB 4F58L 4X7SL 2OMZB 3AT0A 1FL6A 2JJSA 3STZB 3CFQA 1FVCB 1EAQA 2TRYA 3GHBL 1SZNA 2P43B 3B6SA 4ZPTB 3QIBC 4PMFA 1J8HD 1ETA1 1A2YB 5IVXE 2OL3A 5DEFB 4Z7VB 1CD8A 3FSAA 3EXJA 5KN5A 3KWTA 1AC0A 4GG8B 1G7HA 5IQ7H 2B0SL 4UWQB 1KLUB 2EQDA 5FS5A 1JN6B 4A2LA 4HUVB 2QV2A 2ZSVB 1TZHB 4A2HA 2ZPKH 3FHAA 1F1DA 2WG4B 3ZIMA 5AVTB 3UGUA 3HRZA 2EYSB 4GAYB 4RAVA 3TP4A 3RJOA 5C92A 3WYRA 4L05A 4O9HL 4KGLA 5E8OB 2VDNB 4Q0XL 3TOPA 3ZKMD 5D7JA 4H25B 5EH1A 4E36A 2WIIB 1ML0A 2BQ6A 1VFBA 3D1MC 4MAUH 4OJDH 3IDUA 2HT3C 4JRYD 4NGAL 1G6RL 1HXYA 2FRGP 4JG0L 1URZA 3U48A 5DFVD 1TJHH 4U1MB 4HYTB 3L3OB 1D5IL 4MNHA 2WLNA 3MNZB 5I0VA 4P2QD 3Q5OA 4XN4A 3H42L 2ZWKA 3EFDH 5LGYA 1E3XA 4KITB 1F4WL 3QZWA 4OJCA 4P46B 1HZKA 1XBDA 2VZ3A 2WQAA 2VERN 3W5MA 1XR8B 2ZXWB 2O5NA 3E80A 4OKVA 1YMMB 1IBGL 5IQ9A 4G5AA 2WUCH 3BD4A 2WYGB 3QUMH 2CM5A 4GRLA 1M05A 1I3GH 2CPUA 1HI6B 4XN1A 1Z9NA 2X42A 3P9MB 2O6EA 2X05A 2WWNA 5HDQH 2M8XA 1I53A 1B2YA 1FVEA 4G8GB 4P4RB 5EUKB 3MRBA 5I2IA 1WTGT 5B3JE 3GHEL 1KIUA 4L29A 4P2CG 3VW3L 2A9MH 2X1OA 5F7KC 1FF5A 1N68A 2Y36H 1UHVA 1F3JA 5I19L 1S7WA 2BO0A 3G5VA 3MV9A 1MFNA 2WYJB 3T4YB 4F2FA 4NXSA 4B27A 4YK4B 3QNXA 4N90E 5D5ME 5AOJA 3DX2A 1AE6H 3U2SB 1J12A 1TJIL 4J2XA 2D03L 5B1AB 1UXSA 4P23D 4Y8DC 3S88L 4HS6B 1LEGB 3LY6A 3LXBA 1PZDA 3HBGA 1KPUA 4FJZA 4PV8B 4N26A 1LO4L 2F54B 5FKPA 1MXGA 5C0BA 3FQTB 3FTUA 1UM4H 1GS8A 1ROCA 3HKZA 4M5YL 3TV3L 1LEIA 5FWRA 4HJIA 4MQTB 1D7DA 1HDMB 4NXKA 1PLCA 5D7EA 3S4SA 4PJAA 2RFXB 4HWEH 2E9BA 3I50H 5CMAA 1NBZA 1ZSDB 3NK4A 4JZNB 2FR4A 3IGLA 3IPFA 2VE6B 5J06A 4E9QA 5FYJL 2PCPB 3VFPB 4CMHC 5FUCC 1ZIBA 5DMJB 3B1TA 1PIGA 3IU4H 3UC0H 1JGEA 4I1NB 3SYCA 2Y1ZA 4Z77B 2WXQA 4KK6C 2H1XA 4LXFA 2CKBA 4AMWA 3STLA 1IKNA 1CFVL 1HT8A 4JYVL 4P5TC 5C07D 4UT7L 2FO4B 3OB0K 3QDME 1I9JL 2VDPB 4U6VH 1IQGL 1W6WA 2CUMA 4LHQB 1A7NL 4UU9A 3VXMD 5BNXD 1TZAA 3MZGB 5FIEA 3VWJB 3V5DA 1T20B 3DETC 2YXMA 1EHXA 1RUQH 5L2KE 4LP4A 2FL5A 3BP4A 3IF1B 4L9DA 3CHQA 3CUPA 3QCTL 1MVUA 4GMTL 1UUSA 4UQCA 3MJWA 1CD1B 2OTPA 5EZJA 4AEHL 4YHYC 3EJYC 3IJYB 4NQUA 3WIIH 4BFOA 3MRLA 5EBMA 4YQXL 2ZCHH 1DBJH 2J73A 4MXVF 3T0EC 2GK2A 2DMKA 3C9NB 1TMQA 3X1BA 1G9EA 1U8MB 5ALBH 4EIGB 5IF0A 4K5OA 2NX5D 5I0ZA 3MO1B 1GYWA 2D3JA 4XP9L 1JPFB 2GKIA 1EVUA 3GLDA 3SOQA 5DO2C 5C08D 4W9EC 2Z91B 2W81C 5E1AA 1E0OB 4AWJC 2IGFH 4RGNC 3PXLA 2FLMA 4U49A 1MUJB 3MXVL 2HVJA 1WZ1L 4LU5H 3QUXC 3TN0C 1YC8A 4PJ9A 4XWOD 3P0VL 5DEZA 3B2XA 3OV6A 4LEXH 5HYJA 3QH3B 3C6LA 4KZEL 2V2XB 5E6ID 4EN3C 3EOAA 4HJTA 4NUJA 3KDPB 3N50A 4WENB 2C26A 5GZOC 1HTYA 1U8HA 2KZ1B 3CZFB 4KPHH 4Y9FA 2WBWB 3LRLA 1CC3A 3IMWA 4OSUL 1E5BA 1WFIA 2EH8H 2A83A 2N1KA 1N3NB 4N8VA 1EPHA 1Z6JT 4DCQA 1X5FA 1HHJB 1KIRB 2GEEA 1EA9C 3AUVA 4OFVA 1GSMA 2MPVA 5DRZA 3B3IB 3GMMA 1T7XA 4GRMB 1U8KA 2GVYA 4P05A 4UTCA 5F1KC 3QNFA 5HYEA 1B0WA 4JL1A 4NCC2 3ZDXE 4H8VA 1WWWX 1T4KA 1JMZA 4GT7A 3D0LB 2ZAIA 3K4DA 1JP5A 2Y07H 2NY0B 4DFHA 4X6FB 2Q20A 4Q74A 3GXFA 3TX4A 4I9WE 3CFKA 4GUCA 2UWEB 4JDTL 3QRLA 5D1XB 5AB9A 3H8NA 3QIBD 1JZJA 1IT9L 1DVZA 4HKZA 1OARH 5CN2A 3AWEA 2Q86A 2YPVL 2C3HA 1OP3H 3F05A 4NZJA 3PDOB 4HW6A 4MS8C 5ENWA 1J88A 3GKZA 1J0ZA 5EG6C 4FZEH 4UANA 3D39A 1YEHL 3C8DA 1NEZG 4G71B 2VLKB 3PWVA 4FFZH 4ILDA 4PPTA 3LKOB 2IH3B 2Y06H 1CE6B 1PX3A 2VLRA 5T1KD 3GFUA 15C8L 2I07A 5EF0A 3MV7D 4WK2B 3WE1A 2AQ1A 4KDTA 4HUXA 2JK5B 2GCYB 4EXPX 1MCNA 1VIWA 5D7LE 1HK6A 3KR3L 4PSRA 2VWLL 2AEQH 3BZFB 3TO4D 2YXFA 4AENA 1P7HL 2X6MA 5DRWB 2HT3D 2R29A 3ZZQA 1PG7X 5JW4M 1T1YA 3WN5C 4YXKH 3SDXB 4NP4L 1YJDH 1TJGL 4KZDH 1MEXH 4FL4B 4PP2B 2PYEA 3FSZA 5CJ5A 1Z5HA 3NH7H 1NPNA 3NMEA 4ONHB 4WW2F 3ASWA 1NCBH 2V9UA 1ESOA 2HFEB 3MYJA 3FK3A 3PGDA 2K78A 3TBTB 3ZE1E 1R5IA 3GB7A 4OZ4B 5J1SC 2D9QB 3HB3C 5D7JD 2XBDA 2K7PA 4ZW7A 1U9KA 3HPJA 3ZL2A 3C60D 3HG1D 1T3FA 4UM9A 1ZTMA 1ANUA 1ITCA 5INCA 4PJ7A 2OXGA 4K3DH 2R4RH 5CHNA 5SX5H 4JE0A 4KWUA 5BRQA 3CDZB 5L6YL 4IBWA 2P93L 1JF6A 4ZX4A 3GHPA 1NCOA 4NRZB 4U4BA 2P9RA 2NOYA 1A8JH 2FECI 3B2VL 4F57L 3APMA 5B1JA 1NAMB 5FYJE 3FFCA 1HHKB 2GBAA 1BREA 2BLFA 3SPCA 1PYWA 1PS3A 4N0FB 2IMMA 3DVFA 4F9LC 3IMRA 3BKYL 2VLJD 4G42A 1IO4C 4LQFH 4OZGF 1K2DB 1WEJL 5EZIL 1R3HA 1MCOL 2WZ6A 3FB6A 3NGBC 2DQGL 3MGAA 2ADJB 4UBDC 2JF1A 1QSEA 5KSBB 3U73A 1QSFE 3F58H 3NJGA 1X5MA 3LPOA 4QOKE 4BEIA 3ILEA 5I1LB 1R46A 4CKQA 2ZF8A 2WAQA 3OZKA 4XXCA 3GGWA 5C09B 2VDOB 1GAFL 3EYVB 4AUUA 1BFVL 5GS1A 4JQIL 1ZWIB 2W94A 4EI6A 4IIQB 1JZ8A 4L8BA 4X83A 1E7VA 2NY1D 4AVIA 4LLUA 5I6KA 5SX4I 5EO1A 1N5YL 3VFVB 4JDVB 5DZOA 2Q8BH 4YIQB 2G60L 5DHXB 4N2BA 1KELH 5CZXC 1Z6CA 4FNPA 5H35A 2BP5M 2HLFD 2OI9B 4AQ1A 5BXFB 4G6FD 2C3VB 4TL5A 4P5TD 1MI5B 1BLNA 1YPZF 3UGXA 4BE5A 5I6XC 1KZQA 4P2OD 2J38B 2DIBA 2O4EA 5DD6A 3O3BA 3IDJA 4WTWA 3MNVA 4M3HA 5CGBA 3RY4A 3VGAB 2QSTA 5IMMB 1ZJBA 4C83B 1OWRM 2DWDA 1CLZL 1OAYL 3GBNH 2VR8A 3WDHA 4PG9B 2XWCA 1S78C 4UM8B 3ARBB 3MJ8B 3FO9A 2XWXA 1KY7A 1V05A 3ZLQC 4R6UA 4PJFE 1ZVSA 4HFUH 4PRHE 3NIDF 2GBUA 2VC2L 4QRPD 5E2VL 3RFZA 4CSTA 3X3GL 3A22A 5JBCE 3KPMA 3OHXA 3Q2CA 4M11A 1TTAA 4KJYA 2CJSA 2XZCL 2KLRA 5DO2D 4HWNA 1UATA 3VFUB 3ULVD 3HR5B 4M48H 1J8HE 3K2MC 1YAIA 4GKZA 5DI8A 5JA8B 4NNPL 3PE9A 4YDLC 3WU1A 3X12A 1AGBA 4JFOA 4Y5YB 3VXQB 4CVUA 3QUXD 3TN0D 2VZOA 1TPXC 4AYBA 4GW4B 2XNAB 1SQMA 2ZKHH 3VGFA 2R15A 3D4GA 1KN2H 1ADXA 1YUFA 1RHFA 3O8XC 4BA8A 3VI3A 4E5XB 3U9UB 4AYID 1RUKL 2NUTB 4AMKL 4CBPA 1CD9B 2YLHA 1DQLL 2OJEB 3HZVB 3H2PA 3LTVA 2X2YA 2WVTA 4JRXE 1TCRB 4KROC 3D0VA 1AYOA 5E0FA 2X2IA 4DGIH 1DJZA 1OTUD 2CK2A 1UCBH 2GFBB 3DYPA 4LQ1A 1IQWL 5I9QB 5AYUL 4PEEA 4DHLA 2F1BA 4OBRA 4ZTEA 1RZJL 4BGDA 1PG7H 5FA3B 5KYYB 1KXVC 4KK9C 1OW0A 4MNQE 1PW3A 1MRDH 1QFPA 1SXNA 5ICZA 3PPEA 4DGVH 1A9EB 1DLHA 5HYJD 4QHUA 3RTLA 2EUWA 4GXUN 2AJ3B 4P2QE 2IPKB 4JKNA 1DSWA 2FT7A 5E9DD 1EZUA 3ZDYE 4G8EB 1HU8A 4FQ2L 4U6YB 1Z9SB 3NAAH 3QC5X 4XN9A 2WUBH 3VE0B 2GJ6D 2ADIB 4KK5C 1Z6EL 1IUZA 2LABA 1LPZA 1UWXK 4WJ5A 4TPRL 1J5DA 2IWEA 1BMGA 1E8ZA 3KPSD 3QORC 1IGFH 5CNHA 1ET5A 1A4KB 3QEUA 1V10A 2VDQH 4NO0A 2XPGB 3OKOB 4HIQA 4AZUA 4BWTA 4A2FA 5HYSA 2NY3B 4MS8D 3ECQA 2ENQA 1EQGA 2YGVA 1MFAL 4R3SB 1NFIA 4Y4FC 5D55A 1EDQA 4XNYL 3DV4B 3LVEA 3Q6GH 2WLIA 3JWOL 1JPTH 1IQLL 1OAQL 3P3YA 5EC1B 4U1GC 3MLRH 4IHBA 3LH2H 4OD2A 2J12B 3UZQB 1RAMA 4E41E 4G7VL 3QWRA 1IBHA 4X6DB 2ZUVA 5DQDL 3VXSE 4ZS7H 5DHYB 4G9DA 3BAXA 4Y71B 2LT9A 3S6XA 5LXGH 5A1AA 43C9B 1QIUA 4L4VB 5F7DB 4RX4D 4PTUB 1G87A 2VABA 2V9QA 3WENA 2AEPL 3AM8C 1JE6A 3I6GB 3PP3K 4NGHL 4ZDHB 3GRWL 3U36A 4X9BA 4BRVA 4N2HA 3NCMA 3LEYL 4YDIH 4U6XA 3VI4E 1P1ZA 2B15A 3TA3A 2EDKA 4J1UA 1DBAH 1O9ZA 2V33A 1OGTB 3HLKA 5E5RB 3ZYIB 1IAOA 3ARZA 3GZQA 4PJEF 4Y4HA 4Z7UB 5EF2A 5F89B 1EFQA 3TGXA 1GMEA 4EZKA 3GXTA 4PJDA 1LD9A 3UZVA 3HB3D 4OM1L 3VYOA 1JZ7A 2VVVL 4WTQA 1XR9B 3HUJF 1SLVA 2X9XA 3ECBB 1R0AL 2CRMA 4MCZA 2AV7A 4HS3B 2HVKB 3BPSE 3HCVB 1AQ8A 2P45B 5LNEA 4XZ4A 3GIVB 2ZJSL 5FM5M 1AG6A 2ZIDA 1U30A 2RALA 1MREL 2YMOA 3MNMA 1MW1A 1V27A 1EEZA 4S1SL 1CJYA 2XI9A 4MBRA 4GU3A 4Z78A 4N87A 1K3IA 2AJSH 1HAEA 1JAEA 4L8DB 5A2LH 4MB4A 1R6VA 1V3JA 5IMOA 1A22B 1A6ZB 3ABKB 1DBMH 2E7LA 3VXME 1F4XL 3O3AB 1LPGA 2BHUA 2CRYA 4X99B 2PPDA 4M6NL 1ZANH 3KPLA 5DDHB 3JWNC 3AACA 3PUUA 3LVTA 4UM9D 1NSNH 3EYSH 3IVKA 2J34B 1RUPL 1T6VN 1P5UB 2J8UA 1DE4A 1ZCRA 2QVMA 3DX0A 2JWYA 2YUWA 3KPNB 4UBDD 1NCHA 5DZLA 2XA8H 7PAZA 4C56E 1I7ZA 4L5FL 5JO5A 2RR3A 3CVHL 1QRNB 4JFWA 4CUCA 1S7XA 1IKFL 3LCYA 4JFED 3QUMA 2ENJA 4RAUA 3QJHA 1QUNA 4LLYA 3VQ1C 1LNUA 5IBUB 1T22B 5C08E 1XSIA 2GHZA 1FIGH 3VD1A 4ODUA 1XZ0B 4PJGA 5F0PB 1LP9F 1AGDA 4XC3L 1PQZB 1HKFA 4X8JA 4D0BB 4MTMA 1TETH 2LVEA 2AJZA 3IJSB 1WBYB 3DXAE 3N40P 5B22A 4ES9A 1NLBH 5E4AA 1PX8A 4ELDA 1QA9A 3PCYA 3AS3A 5CZXD 2MCPL 3FUDA 3QAZB 3QJFB 4LP5A 4Q6KA 3RPIA 3SPVA 4JQXA 3H3PH 2EDEA 2F2HA 1AO7D 1LK3L 3R1GL 4BKLA 1VB9A 1INQB 2R59A 2Y22A 4KZCA 1WAAA 2SEBB 3KXFA 1N5AB 4OZHF 4D8OA 1FJ1A 4HEMA 4ICWA 1F00I 3HFFA 1A7QH 2JH2A 5EU3B 1SFDA 1QW8A 1ZHKA 2G3MA 4F80A 1BMZA 1NINA 4MMYB 3I6KB 1HOEA 4TNVK 2EI6B 4QF1B 2BZ7A 5C0AE 3CQQA 5HGBB 3ULVL 3CV5A 1THAA 2Z92B 2NTFB 5J7CC 5I8EB 3NIFF 3UGEA 3K91A 4WV1A 3CFBA 2DTML 3D7PA 4GO6B 1S78D 1TO4A 2EIZB 4N24A 5L4IA 1W16A 4PJBE 3JT2A 1A0QH 4HIIB 3WFDH 3GDBA 5F1IA 4D0DA 2AZAA 1WCBA 3FQ4A 4DN4L 3JVFC 5IVXB 1OAJA 1CQEA 1WH0A 4WNQB 3VDBA 1EWHA 4A94C 1JZIA 4NM8H 2NZ1A 1H3XA 4NO5B 1NMBH 1IQFL 4Z9KB 4HCRL 4TKWA 1NBVL 4FABH 2PTTA 2V17L 4ODTL 1F11A 3MKGA 5C2BL 3S96B 5HI3C 4Z76A 4X6BA 3C2AH 4CGTA 1E6OH 2AI0L 2R0KH 1F4HA 3TA4D 1ITBB 2IPUK 1S7TB 4HULB 5BW7A 3O8XD 2CU9A 2YAQA 1GYVA 3OKMA 3HI6L 2X4RB 3S34L 3MA9H 4PI2A 3QPQC 4PGZA 4ZHAB 2DQFA 2ADGB 3QXAA 4BK5C 3MV7E 1I8IB 4Y16B 2FZZL 4N6RA 4Y1AD 5MP6L 1RJLA 2V37A 1YNLH 2F5BH 1QVOB 4YH6A 5I1CL 2VDKB 1XGQB 4AYFB 5K33A 1XWVA 1N59B 2QLYA 3MZTA 4U2ZA 1HSBA 4YR6A 1T80A 1XCQB 3GPSA 2JQZA 3IB4A 4R97C 3L16A 2R0ZH 1BG9A 1JVOA 4CGUB 2NW2A 3LKRB 4OTYA 2DQIH 4K7PX 4KK9D 4YZFF 3MRHA 2Q8AH 4DPRA 1JBJA 4JO3L 5GSVB 4NIYE 3TK5B 2ENYA 2X70B 4Z0LA 4QUOA 3THMH 4FKHA 4H0LC 4MXWH 2CJUL 5BOJA 2NDGA 3RUGF 2JB6A 3D85B 4FMKA 5EULV 3ZL4H 1UWEH 3K3QA 5KBKA 2RHEA 4JO1L 4KK5D 3DYOA 3PL6C 4NRXA 2X6VA 3DVNB 4H2AA 3QRBA 2BP0A 2UWLB 3QORD 4PIRF 2F53A 4TVSa 3QEHA 4PJIF 5F2FA 4PGBB 1FNEB 2D0HA 3B83A 3GMOB 2Y1VA 3GZOA 2DI9A 1FYTB 3QI9C 4NDMB 4IRZL 4K2UL 2W2QE 5IJVA 3NEOA 4TSAL 1UJ3C 3DWTA 3BPOB 4JGNA 4R4FL 1BIIA 1FFOA 4FQJL 4K3HA 4PRPA 4UIKL 4X6EB 1KYOK 2GITB 2WQ8A 1DJSA 2FO8A 5IKTA 2VB5A 4KBPA 1KTLB 4U1NA 2IADB 1JGUL 1AQKH 4KRPC 4K3EH 1NPEB 4BDVA 4OF8A 5D5MB 4X9FA 1TO5A 1I7UA 4ZD3H 4KC3B 4ZQTA 1IV8A 1JFQH 5FK9B 3WNIA 2OZ4H 2DQDH 5AW6B 5FYLH 2APFA 3D07A 3T8MA 1IAKB 1NGWB 3PIQA 3H3BC 1K8DB 2VLJE 2BRRL 3G6DL 5T1DL 5B8CA 1NGZB 1JZ3A 5L9DL 4ZFQA 1GGIH 3OPZH 2W80C 4GOSA 4NN6C 1EZQB 5E1GA 2Y7NA 3D18B 4BINA 2B14A 3E3QC 1QLEL 5FM8A 1KUMA 1OCCB 4Q8BA 1UOVA 1NC4A 4WO4C 1T89A 2XICA 4PREB 4MZ2A 1J0YA 4KK8C 4ODWB 1XX9C 4WTZG 2O93L 4IM8A 1PZUB 2O5ZL 1QO3B 1KLIL 5FYKD 3KPOB 2EI8B 5FUCE 4FXKA 1PZ5A 4S2SB 1IM9D 2APVA 4PAZA 3S35L 1HHHB 4OQ1A 3CSPA 5EU6E 3QFJE 3GC3A 3V0WH 4BUGA 4LVNC 1NEZA 4Z7WE 1U8IA 5FFOA 5CBAB 2XQYA 3TF4A 3BAKA 1NGYA 5CSBA 4XN7A 1IBBA 4YFDB 3WLWC 3L13A 5A2CA 3UCRA 1JXKA 1RJYB 4DP9X 3I75A 2ZD0A 2AK1H 2ADFL 4R7VA 3L9RB 5L2KB 5F93C 1CYXA 1YLBB 1DUYA 4QHPA 1J87A 4XVUD 2CMRL 3FZUC 3VXNB 2QBWA 3WY3A 4ZNEE 5C0FA 2WN2A 3LSOB 4JFFA 3CVCA 4PJHF 1UA7A 2ZP8A 1N19A 2GQHA 2FLRL 2A77H 2Y82B 4ZXBA 2PO6D 4LARH 3OJDA 3VFTA 2OMTA 4DFIA 1GSKA 2VUYA 4PTTA 5A3ID 1XIWA 2ICWI 2P5EA 1LMIA 4KTGA 4PS4L 3NFNA 3TT1H 2OR9L 3RU8L 3T0EE 2HVBA 3APCA 5JPNB 3K6DA 4H1LB 4FXGC 4NWTL 1PAZA 1WS7A 3T6XA 4GP5B 3V52L 1M56B 2XZZA 3CXHJ 1L3WA 1X5JA 3DX8B 3S6CA 1RUAH 4H8WC 3FU7B 1MG2C 4RGNE 1T83A 4F8LA 3EGDA 3L1OH 2FIKA 2L0DA 1NDGA 3DHPA 2WVVB 4JY5L 3FU0A 4UT9L 2V7NB 2N7BA 1EHLL 5IEKB 5G5DA 2APBA 4P4KC 1E8YA 3L7FB 4C55A 1S46A 1YUHA 1OP4A 3QUZC 2MPAL 4RISH 5CCKH 1CE1L 3KLKA 2Y7ZB 4DESA 4MHHG 3RZCA 5AW4B 5JNYB 1KN4H 3N1PC 1ETZA 2HG5A 3NSXA 3OVUB 5D7IE 1LJMA 3RJQB 2OLDA 2XC5L 2X3CA 4RGMC 4XX5A 1N6VA 2VUOA 1J05A 3FO1B 2JKRM 3FNKA 5KWYC 3NJXA 3LRGA 3S8WA 3K2KA 4B7LA 5KVDE 4U1KB 5JYMA 1XB6A 2Y23A 2ZYIA 5ACZA 4GXVL 2APWA 4RZCA 4AW4A 3ZDXB 3O9WA 4JFDD 1NDTA 3NJJA 4OB5H 3VRJB 3SEPA 4X98A 2VDLH 2CO2A 1K4CA 3EDKA 4Y4KA 4ZPVB 4WI4A 4XPTL 3U7UG 2XKUA 5E9DE 5CCHE 4DN3L 4RA3A 5DS8A 2GJ6E 4OFQA 1KTDA 3JVGA 4Q6IA 2BWQA 1SUHA 2BVQB 3MRRB 2AXGA 1KSRA 3MREB 1ATDA 1JUFA 2ITEA 3K6IA 4TUUA 4F7CA 4Z7AA 5EEYA 3BZ4A 5GGVY 2WNKA 1KIPB 4OLVH 2XG5B 1UB5B 1ZOXA 5T1LD 4MJ6B 3FO2A 1XVSA 2PF6A 3CSYB 5D1ZC 3W11C 2ZP0T 5HI3D 3WJMB 2WQSA 3CMGA 1R24B 4MJIE 2G3NA 1L7TL 4HFWB 4JS7A 4PYHA 4GSRA 3C75A 2IH1A 4UOJA 1LK2B 4GUPB 4F33A 1DLFL 1IBZA 1LO5A 4EDWL 3WUWG 4MA1C 4PLJC 4NZRH 5AWNL 3UPAA 4JO4H 5TH2B 5D7LB 3N42F 4F93B 4AKPA 3QPQD 1W0WB 3NCYS 3N1FC 3T8VA 3CH1A 3QIUC 4FTDA 3R8QA 1IBDA 4Q14A 4FP8H 4QYOB 3UTSD 1MHPL 2CAKA 3VJ6A 1QFWL 3LC3B 5B7MA 4D8PA 4JREB 2P8LA 4FJYA 1ZGLA 1EJFA 3J7HA 3VXRE 3ZE1B 3OD3A 4AEIL 2I7SA 4NQQA 1QR1B 3GXMA 3IMUA 4KRMB 4J3OD 2H3KA 1SYVB 1OHZA 3OKKA 4AGPA 3QO0A 1P4LA 1YEDA 3AG2B 3WFCH 1IJQA 1BM7A 3PL6D 3DYMA 3MBWA 2K1MA 4ZOAA 5F0JB 4L18A 1UXWB 1GC1H 3VD5A 4NKOB 3RTQC 2IPTL 3B2PA 2Y72A 5I1GL 1MCQA 4QTHA 3LHPH 1C5DB 5E6UB 5ITFA 5DK2B 3QI9D 4IMKC 1TTUA 1ORSA 4KV5F 1TJXA 3NTGA 2BWIA 3I9PA 3F7PC 1RIVL 3X1FA 2I24N 1E5UI 1JZDC 3TU6A 1QZ1A 2W9EH 4JDZB 1NCAL 4I7ZC 5BZDA 2WBJB 1YNKH 1DFBH 4KRPD 4MB5A 4XMKL 4GI9A 2NUPB 5I8CA 5IGXL 4N9GB 1DBBL 3OXRA 3X1NA 4B9IA 3TCTA 1K6QL 4ZMNA 5C86A 2XWJA 3MUY1 2KQNA 3OTTA 1S7VB 5F8RC 1QI3A 2DJUA 5DJXB 4PGCA 3IBOA 3IK2A 3K6FA 4YBHA 2AABL 5FYKL 3VRIB 1QSFB 3U7WL 3CN2A 3QJSB 4BH7A 4QOKB 4AUYA 4PLNC 5CJXA 4MJ5A 1VAHA 1AXTL 4QTFA 3KGRA 4K5LA 4UOW1 1MFBH 4J4PD 3R4DA 1SJXA 2XWDA 4Y5VA 1AS8A 1UZ6F 4CDHA 4GEIA 4OCSH 4NEHB 5K59F 3B9KB 5DC4B 3RAJL 4Y9EA 2YAMA 4XBEL 2EKSB 1VEMA 2I60L 1YHPA 3HS0A 3J2PA 1UXLA 4KK8D 1HILA 4QTIL 4TOYL 1NFDE 3BH8B 1XGRB 2O26U 3V5HA 1SNRA 2R69H 2EE9A 5IFHH 3MJ6A 4XB7A 3INUH 5IR1A 4Z7VF 1ILUA 5JDSB 1B2WH 5DC2A 4RFNC 4ADIA 5J6HB 5JHLA 5D4IA 1HHIB 2IOMA 3F04A 2IAMD 2YKLH 4L9LC 1TDQA 3M88A 4MJJA 5EOTB 4L1LA 3VG0H 2ZQKA 3PXJA 1WS8A 4ISVB 4LDEB 4FHBD 3VFWB 1TT6A 1MFCH 1WRFA 3VB8A 1E4KC 2Z31C 1NC4D 2EABA 4WW2A 4PMEA 3BD3A 4H8PA 1ZVNA 4UILH 5HHNB 4WKZB 2JIXB 4EI5A 1I8KB 2ORBH 4EZMA 5CBEB 1MWAL 4X9GA 1CLOL 1GGCL 3FZUD 3TV8A 3MBEA 4AE1A 3MV11 4PJFB 4HALA 2VJ3A 5MEQA 3O11B 2Y2TA 2JKJA 4BHUA 4PRHB 1WIUA 4AOFA 2JNZA 2M26A 2B1HL 2BINA 1ZAGA 3MRPA 4KJQC 2BOKL 4GB9A 5DYOB 1G9NH 5D6CB 5C6TL 4YJZL 5CM1A 3H53A 1DQVA 5LG6A 1UQSA 2GTWA 1J8HB 3PJSA 5I1KL 3UAAA 4KUZH 4Y2NA 1T66C 1AZZC 2EINB 4KMTL 4BE6A 5JVZA 4Q97A 4HIHA 2O5YH 2V6HA 2XV0A 5FW7A 4TUOA 1WT5A 4KUCF 1KCKA 4JFFD 4PLKC 1A65A 4B3VA 4G72B 4YDJB 1BQSA 2O1AA 1UEYA 4OZGA 3IS0X 4HD9A 2KL7A 2AAAA 4LCCA 3QO1B 2QTVA 2PPAA 3MLXL 3CC1A 1GS7A 1CGSL 3Q2LA 1XF2A 4OCRH 3ECWA 1DQIA 3KG5A 5IW1B 5I30H 1BM3H 4A37A 4EKXA 1FNGB 5DD1H 2F74B 3FN0L 1VJSA 2E5EA 4HK3J 3V4PH 3IYLW 4X5XB 2IV8A 5EIVA 1LEKA 4TQHA 3LIZA 4G43A 3HOGA 4MNQB 5DK0A 4RDBA 4LLQA 3QEQE 1NJ9B 4L4TA 3Q2WA 5DJ0A 4P2QB 2J2ZA 5E94B 4X6CE 3G5WA 2QSVA 1EFXA 2YARA 5H94B 3TTSA 5K9KA 2VDRH 3EO0B 2XUWA 3BIBX 3ZDYB 1ZHLB 3O3EA 3PHAA 4KO5A 4ZX5A 1HCFX 1E5AA 1RK1B 4LNRB 5M7QA 3STBA 1BAWA 3S36L 5HVFB 4IU3A 2XDHA 4F2EA 3TESA 1YPZA 2PCXA 4KI1A 2DTSA 3EG9A 4FOMA 4WFHD 1F8TL 4W9LC 2H3NB 2X41A 2YEZA 3BE1L 3O3UN 4HZLA 1NMCC 1FH5H 2WGXA 1F3DJ 1EAIC 3BPLC 3QK0A 3UJTL 1AHWC 1FO0H 2WBKA 2BSCA 1VEOA 1KBVA 1AFVL 1K85A 5MERA 4OGXL 2XWZA 1BQLL 2OR7A 3VWKA 5B39B 2XN0A 1XSJA 1QBML 4MZRA 3W11D 1TQVA 2EIJB 3IFLL 4PVLA 4LOUC 4EBQH 1A6UL 5I24A 2UZYB 2ATPA 5HJ3B 2WZAA 3B8SA 3VNYA 2D31A 4LSUH 3CFIC 1DYZA 2G9HA 3ZGIA 2O61A 4E41B 4IBLT 3C8HA 4N8PA 1DVAL 4XMPL 5ACMA 4PLJD 1J5OH 3SPJA 3KJ4C 4NWUH 3VXSB 1CUOA 3HC4H 3I02A 1M2OA 4O02H 1QW9A 4X8XA 4O2EA 5HVGB 2E8ZA 1O7DC 5DA4A 4P23B 4Q2ZB 3FL7A 3CK0L 1MCBA 4OF3A 3GO1L 1GS6X 3NTCH 3PABB 2E0PA 3ARGC 2EDWA 4IEFA 1TZIA 2XXGA 4OCWH 4TVUA 4M8QA 2CO3A 1B0RB 1M71A 4HWBL 4FGMA 1XAKA 4M7ZB 3KVPA 4HGKC 1Y6MR 3NABL 3KK6A 3V0EA 3RDTC 2CD0A 5AOKA 3ASNB 5A6LA 1XF5A 1ZRUA 4BFIA 3CHSA 4OGYH 4A6YL 1K4DB 4UAOB 2EXTA 1CL7H 5J5EA 1GHFH 3V5KA 1KB5L 4CVXB 1A4BA 4ZUUA 3D4YA 4L3AA 3ZYJB 2NY2C 4WY7H 5CINH 3AXIA 4HUNB 4WWKC 4TYUA 5FYKE 3VQLA 4NN5C 2Q3XA 2E9GA 4OTXL 4QY8B 5JPMC 3RWCB 3SGDI 4G8FA 3KWVA 2VR6A 4LBAA 2GAZA 3PU7A 1DJWA 1MY5A 2YA2A 5SWZA 3HMWH 3VXMB 4CADA 5GJTL 1RZIB 4U1JA 5FECB 3QQ3A 5G4NA 2WNWA 2J6EL 3KPTA 1ZHBA 4KHXL 3O41A 4QKTA 3DJRA 3UBGA 2Z35B 1MAML 2XG4A 4TVPD 1KDIA 2H0FA 1OSZA 4H40A 4MAZA 4OFDA 5KBNC 4R0LC 5DJ8A 4YHLH 3GSXB 1MY7A 3WTSA 2FJGB 4FNUA 1KNOA 3KGSA 4YMPA 2BSSA 2A99A 3H4HA 1GGYA 4YDZA 4S1QH 3AS1A 3OKLA 2XWEA 5E99H 1I1FA 1J0JA 3WXVL 5GRUH 4RFEB 3UROR 4C56B 1IGCL 4KO9A 5C0GB 1KB9K 1CDGA 1CLYL 3F6IA 3QCWA 1GPOL 4OCNC 4POZD 3SZKC 1XSOA 1MHEA 4QHMA 2Y5EA 1PZSA 1EQHA 1RVFH 3M8OH 4NQXA 2ICWB 4KJPD 1YEKH 2HT4D 4HCGA 4YEEA 2JSFA 5C08B 5T3XH 1SGKA 4PRNB 1YMHB 5DVOA 1GCYA 1QUPA 2JJVA 4M8UA 4AIZA 2AJUH 4HCIA 2UWEF 3DXAB 1OSPH 1AMXA 1OAUL 3CCHA 2V5MA 4FG6D 3FCSB 4QCIA 4DAGH 3DX9B 4JFPA 4N0YH 1UB6A 2VXSH 5FFGA 4OCMC 3LZNA 3ZX1A 4GIAA 5JUEL 2YN3A 1KGWA 1BAGA 1P4BH 5J3HC 2WO4A 1RIHL 4TRPL 5JHDD 3IDYC 4G5ZH 4N2MA 1G7LB 2UZIH 4AW7A 2F8OA 3EYQC 1JHTB 2LTQC 2Z31D 4AGMA 3GSOB 3SKUD 4JDEB 1IARB 4DKTA 4PJEA 4UTBH 1IVLA 2BP3A 1WU1B 2VH0B 1RH8A 1VSCA 4KH9A 4EOWH 1A6VL 1OPGL 2V7HB 3AITA 3HUJA 2JTYA 5ANME 5IG7B 4H8WL 3V6OE 4LRIA 1UTDA 1W0VA 5F3HA 3EH2A 1UURA 2DJMA 2WVSA 4PJCE 1RUMH 5ISZD 5FKAB 3SDXF 1H6UA 1JNNL 3EUDA 3UP6A 4HKXA 3WFBH 4TSBL 4KJQD 1QFUH 2H2PD 3PP4H 5IHHA 1Q94B 4I88A 2A6IB 3OR6A 5IJKA 3KW8A 5LGHL 2G2RA 1QWNA 4WTZA 3TPUA 1QLFA 3U46A 2NY4D 1QNZH 2R2EB 3MBXH 1G7MA 4XGZA 1E2VA 3NA9L 2GTZA 2WLHA 3B7YA 3F00A 4FFWC 2WTRA 4PLKD 2WTOA 2DDQH 4ELKA 2EIEA 5DWPA 1HX2A 2D7TL 3GSUB 4XBGB 5LBSA 2FSEA 1OAZH 1BFTA 1YSOA 1I3RA 2QKIA 3WI9A 2AJXH 4MKMA 4R7NA 2DLTA 5AG9A 5T1KB 5JOEA 3UCQA 3B9DA 1FV1A 4GLRH 2Q1EA 3JBG7 4WDIA 4JMNA 5E6ZA 1JWMB 3MV7B 4EIUA 2CLRB 2EDJA 2X4OA 2X2HA 3ABMB 2Q3AA 1IL1A 3O3DA 3VG9C 1PTHA 1YQVL 2WZPA 1LWRA 1FL5A 2VR7A 1JNLH 4OM0L 3AW5A 4XXDA 3G6AB 2V2WB 1UM5H 4NP9A 1BYPA 1Z3RA 3K72B 4TULL 5ALCH 5BVJA 1SHMA 2Z8VC 3JQOB 1LP9A 5I5IA 5E2WL 5TF1H 1S8DA 4NCDA 4C58B 5AAWC 2Z8WC 4L8CB 1NC2B 4I0PA 1ID5I 2CZNA 2L4OA 3UADA 3U4BH 3M1BA 5AAPA 3EYFA 4NKIH 2PN5A 5I0YA 1OZUA 5KSBF 1SUJA 1RJZB 1NANH 4JO2H 3G5XA 2OSLB 4MJHA 4OZHA 4TQEL 4OLZH 1IEAA 3BEVB 4AQEB 4QRRA 2X4NA 3RL2A 3L7EB 4ZODA 3W0WA 3HG1B 3NSYA 5C0NC 5C2UB 2FB4H 3VGDA 3R7RA 3WO4C 5T33L 3JWDH 2HRLA 4HOMA 1CGYA 4HH9A 1ZGLP 1YECL 3O81A 3Q3GB 1QLRB 4WKXA 1CXEA 4EO5A 43CAA 1GTFA 2D7NA 2X40A 4JM2F 1T1ZA 1JVLA 3S3CB 1NMAH 4LOUD 3DVGB 2X9YA 3BWAB 4HJ1A 1RZKC 3LKQB 4KNTA 5B1BB 2Z0BA 1XF1A 4DGYH 5BJTB 1P4IH 4ERSL 5KS9E 3OB0H 5FO7A 3NEXA 1AQMA 2ATAA 3EJCA 4LSSH 4XCEA 5DLLA 2GJZB 3D34A 2VLJB 5IW6A 4J3BA 1Q0EA 4M00A 2WSDA 4R26H 4LHUG 3IPEA 3CSTA 1JWUB 3FT9A 3E8VA 1BXXA 4HETA 4Y19D 5E51A 1U8CA 5A40E 3HAEG 2DWEA 2QVIA 2AVGA 4IOSD 3HAEH 4WQOA 1RL1A 4ISIL 1CTMA 3FOLB 2ZOOA 3DK2A 2F08A 3ARGD 3DIFB 3D8MA 3V9EA 2J7LA 2A4ZA 3ZK0A 1FLRL 4PS8A 2JCCA 1P5VB 2CUIA 2ITDA 3CFEB 3E3QE 4R84A 2Z4TA 4UQ9A 1OCRB 1O6SB 2XOTA 1KCSL 4LIQL 5EN2B 3MODL 4W9HC 4CMHB 4S11A 1KPVB 1BYNA 3KZ8A 1U3HA 3A6CH 1C8QA 1CQYA 3ZTNH 2NY2D 5EU6B 3QFJB 3RWJB 3CSFA 4TVPL 4BA0A 4WWKD 4Z7WB 3OF6A 1FPTL 1NEPA 5D7KE 3PWPD 4HXBH 3LN5B 3CVHB 4A67A 2P26A 1HCVA 1M7DA 4PWHA 2XWTB 2X6UA 3REWA 2OX5A 4M56A 1YEFL 3BT2H 2H9GB 5KSVB 2WCSA 3TK6B 5DD0H 2PW2A 3DARA 3WUWA 1AGEA 1L7IL 2NNXA 4K7PY 4UNIA 4HJGA 3AY4C 4UNTA 1OT4A 4KMQA 1ET8A 3Q8FA 4R4NC 4Q56A 2BNQA 1A1OA 4KX8A 3E0GA 4Z0XA 1ZPLA 4G6KL 5LCVA 1D5XA 2W60A 1QABA 2B4CH 2VQ1A 2J3SA 3Q43A 1KV3A 3VFMB 4PJIA 2YQ3A 3KQDL 2VWEC 2BNUB 1U2YA 4YHYB 2EXYC 2OP4L 5D8JL 3R7QA 4E68A 4XVSL 1F18A 1NIFA 4Q9QL 5M94B 1DQDL 4PRIA 3U4EB 4XCNA 4JHZA 3T0EB 1XL6A 5I23A 1G1RA 4XO4A 3OKYA 4G7SB 1A6WL 4OY9A 2YSSB 5TDNB 4O51B 4ZOEA 2BSTB 1D2PA 3ULUC 5CWSB 3ZZSA 4RGNB 3LEXB 4OR1A 1ED3B 3DPBA 5GGSA 2ALAA 1N12A 2XTSA 5EWIL 3DX7B 4M6OH 4DEPC 4N8CL 2E9WA 3QUXB 4GSQA 4N2OA 3TN0B 2VN5A 3V6FB 1FA4A 3AU1A 4GQZA 2EE3A 2NY7L 4NQCA 1D9KA 2E76C 3QNZB 3TBWA 1PFXL 4KDVA 1FRGH 1S9VA 4G8IB 3H7BA 2EAEA 4EN3B 4UIMB 2Q6WB 3HE7A 4O2FA 2YRBA 5J3HD 4LCWA 5CGMA 3K4AA 5D7IB 4HDIB 3QDAA 4CC0A 4AKOA 5LUMA 4A2DA 3HVNA 1IP0A 4LSTH 3AC0A 2GD4A 2VXVL 3QCVH 3SKOA 4KKCD 1A14H 3HKFA 2I9TA 4NQTA 4X6DF 3ZXAC 1EBAA 3OAYH 3V0HA 4U3SB 4FQHA 4ODXB 3WFHB 2WLKA 4MA3A 4AQ8C 1NKOA 3GSNH 5KZCD 1IM3B 1FWXA 3BT1A 1AR1C 3GJFH 2A3TA 5E8DH 5E9DB 1W8OA 1R3IH 1CXIA 1EO7A 4J6IA 1RZPA 1X5XA 5I5JA 2GJ6B 5BO1H 3MLWL 1U92B 4LVEA 5T1MB 4LKCA 3VGEA 1NGPL 1JV2B 2JXMB 4NQDD 4YHNB 2CHZA 4PCSA 4Z7UF 3KNBB 4PS7A 4HJEA 2R69A 1KTJA 5JLZA 2DQUL 5KBLA 1KXQE 2E9JA 3FT3B 1WGOA 5GGRB 1UZQA 3ARYA 4DZ8A 3UDWA 3KGUA 4OBSA 3HN3A 5JW4R 1NAMH 1W2KT 4Q9RL 3N41F 4MJIB 4PJHA 1I1AA 3PHOB 4ORGA 5IHZB 4APXB 4F24A 4ZTPH 5IUCA 2WLMA 2VWMK 3EO9L 5ILTL 2CK0H 5GRJL 3GI8L 3AXLB 3ETBF 2HKHH 1O9VA 2P8MB 1U21A 5DZ9A 2IAND 5EU5B 2RCSH 3QG6A 2P5WD 3HBZA 2P42B 3B2DC 2EDDA 3A67L 2WD0A 4PB9H 3WMQA 4JFUA 3AMLA 5LVEA 1KENH 4OAWA 2XV6B 1GXEA 5FXCH 2IQ9H 3CXDL 4IYKA 2WQRA 1ZTXL 8CGTA 1EPJA 2VDOH 4R8WH 4WUUA 2DM4A 1VEPA 4OT1H 3Q44A 4HX1B 3VXRB 4NX0A 3UJIH 1FSKC 5KVGL 1VPOH 5I1IL 1FGVL 2H6PB 4L2LA 3QE5A 1TU2B 3T77B 3WE6A 1ZE3H 3KPRA 4XXCC 4AUJA 3MR9B 3P4MB 2ZX8A 4QXTA 1MQKH 2Q10A 3HB3B 3IXTB 1I1RA 5DRNA 3C8KB 4GBXB 1ORQA 4C4KT 4FNQA 1KLFA 3FQNA 3HR6A 3L5XH 2XWRA 4MA8H 1LE9B 4QAMB 5DJDB 3WD5L 1Q4NX 3WGUB 3QUYC 2CIKB 1UD8A 4RMTA 4HT1H 5HHQA 3OG4B 5CEYA 5EEXA 1HH9A 3MRFA 1JJUA 1Q0XL 4W9KC 4BH8A 1YYML 1MFDL 1JPEA 5HHMD 2M1KA 2CO7B 1ZSHA 1EH9A 1VHPA 3AROA 5I8KL 4QRRD 3LKPA 3EGXA 3GXPA 3W0WD 4QLWA 4TVPE 5LN8A 3EIFA 4PG2A 3G5ZB 4ODSH 3SOBB 2BVYA 2EYRB 1M1XA 3GMQA 4RDQG 1KCVL 2XV2A 3CXHK 4G80B 2QGBA 3NGBB 3RNKB 3RP1A 5KVEE 2ZXQA 3SE9L 1CIUA 2HWZL 4JQVA 3UJJH 3AZUA 4DKAA 3JZ7A 1WF5A 2CDGB 3WNKA 4I18C 3RFZC 2Y7LA 1HRFA 2ZSWA 3ATDA 3D6GA 3ET9F 4ODVH 1SBBA 1RXLA 3BH4A 2NPRA 5DHVA 3LQZA 4AT6B 3WS6A 5JQ6L 1NFDB 4PB0H 2UVEA 1KEML 3INOA 4JFQA 2HFFB 4TNVF 3TNNB 4F92B 1CR9L 1FG2A 5JORB 5IVXF 4QHLA 5C0JB 1NBCA 4RFOL 2BRQA 1KG0B 1BGXH 1FE2A 4E5XG 4DKFL 2B9AA 4LASH 4IKLA 1K8IB 3QARA 4R7DA 2GI7A 4XWGL 1F90L 2ZUXA 1M53A 1Z2KA 3AAZA 5CEZE 5IKCA 1IBFA 1XD0A 3QA3B 1OT1A 3PHSA 5J6SA 3NPZB 3WLBB 4HHWA 5E1IA 3WEXA 2A4CA 3E6HB 5CKMA 5E8PA 2E27H 4K23H 2EDNA 2MSPA 4FQLH 1QHQA 4PS3A 5I17A 1KWKA 4O02A 3D25A 2HZHA 2L8AA 4NUMA 3FTVA 3IDIA 5FV1L