2YGPA

Wif domain-egf-like domain 1 met77trp of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
174
Chain Sequence
b'TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRWPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WNT INHIBITORY FACTOR 1
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 30
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygpA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygpA01
3DEMA 3LN1A 1EZQB 2P3TA 4XLWA 1JBUL 1QFKL 3R05A 5JB8E 3TH3L 1DVAL 1EPJA 5F19A 2J38B 1Z6EL 1IQNL 2W2OE 4D0FA 1EAIC 2W3IB 1HT8A 2YGPA 2W2PE 2Y82B 4XBMA 5F1AA 2OYEP 1G1TA 4NG9L 4MMYB 1YUFA 1NZIA 2VH0B 3LC5B 2DDUA 3GCWE 2EI6B 3MQEA 1XDTR 1DX5I 2P28B 3Q3KB 3F6UL 3V65B 3ASIA 2I9BA 2W2ME 1C5MF 1PRHA 5IKVA 4YT7L 3BPSE 4CUEA 1IOEL 3BT1A 6COXA 1LQDA 1P9JA 2Y80B 2W3KB 5JBAE 4NA9L 1Q4GA 1ATDA 4ZXXL 3P5BL 1O5DL 3NTBA 1KLIL 1X7AL 2RHPA 1KSNB 1CX2A 3V64C 3ZYIB 3HO4A 1PFXL 3TBDA 3N8XA 4X8SL 1UZPA 2BQ7A 4JZFL 4LMFA 1URKA 3N8WB 2Y5GL 1Z6CA 1G2MB 2CJIB 1CQEA 3PGHA 1HZ8A 4BTIA 2W86A 5JW1A 3SW2A 1YO8A 1W8BL 2W2QE 2YGOA 1F0RB 5FDQA 1IJQA 3NTGA 2M74A 4YZUB 2Y7XB 1NFYB 4BTTA 2EI7B 1IQKL 1MQ5L 4ZAEB 2FD6A 2VWLL 1G1RA 4TGFA 4OTJA 2H9EL 2RNLA 1EQGA 1YUKB 4E1GA 3HO3A 3K9XA 3TZIA 3ZYGA 5JBCE 3F1SB 4MMXB 2VVCK 2J94B 2B7DL 2EI8B 1PTHA 1P0SL 3N8VA 1CVUA 2I9AA 2XC0L 1RFNB 3C9AC 1NFWB 4BDWA 4RRYA 1K36A 1FJSL 1NQLB 1COUA 1IQHL 2P26A 2ADXA 2W26B 2UWOB 1FF7A 1J9CL 3LN0A 2KB9A 1FSBA 4ISHL 1L3YA 2VVUL 1NPEB 4NGAL 1M1XB 3POYA 2RA0L 4Y6DB 2WPLE 2PHBB 1EBVA 4PH9A 5CKNA 2P16L 1LPKA 3ENSA 1IQGL 2FLGA 1MQ6L 1F0SB 2YGQA 4Z0KB 3SOBB 2WYGB 1EPGA 1TLEA 3LIWB 4ISIL 3LTFB 1UZKA 3LAQA 1L5GB 5EGMB 1EMNA 1JV2B 1EPHA 1NT0A 4RS0A 5IKTA 4C16A 2FZZL 2Y5HL 1BF9A 2WPKE 3KCGL 2FLBL 2D3JA 2VJ3A 4CUDA 2UWLB 2UWPB 3CENL 3KQEL 5JBBE 1DIYA 4RRZA 1HX2A 1WHFA 3HS6A 4BTUA 3FCSB 4CSYA 1MOXC 4JZDL 1FAKL 4BXSA 3KQBL 3GISX 2GD4A 4Y79B 2YGNA 2JKHL 2MHPA 1EMOA 2VVVL 1ADXA 2K2SB 3OLUA 5CKQA 3SOVA 2WPIE 1V3XB 1A3PA 3N8YA 2W2NE 1YUGA 2J2UB 3QMOA 1W7XL 1PXXA 4Y7BB 2XC5L 3MDLA 4MMZB 4Z0LA 2G00L 5IKQA 2Y7ZB 3TK5B 3LTGD 1GK5A 1IQEL 3M36L 1ATEA 1I0UA 1IOXA 1LMJA 1LPZA 2VH6B 3U7UG 2BQ6A 4JYVL 5CKMA 1JL9A 2FLRL 2Y81B 1NFXB 1WHEA 4Z6AL 4OTYA 2XC4L 1PGEA 1N1IA 3KRKA 1U8CB 3RR3A 1TPGA 3KQCL 2WG4B 4D90A 1G1QA 2J34B 4M11A 4Y76B 1NFUB 1APQA 1SZBA 1G1SA 4COXA 1HRFA 1N7DA 1IP0A 3N8WA 3SOQA 2MGRA 1EPIA 5KN5C 1IVOC 3HO5A 1U67A 2K2TA 1IGZA 1IQJL 2BOXA 1AUTL 1WU1B 1G2LB 1YGCL 5COXA 3H5CB 4AQTA 2P3UA 2KV4A 3HS5A 4X8VL 1HREA 1CEJA 2PR3B 3ZYJB 2MGPA 3TGFA 4JZEL 3TK6B 2AYLA 1XKAL 3QH0A 4LORA 1ZAQA 1UZQA 4M10A 1IQLL 1ATAA 5L2YL 2Y38A 1DDXA 1FAXL 1LPGA 5L2ZL 3IJEB 3N8YB 1FFMA 2P3FN 2VWNL 4Y7AB 4A7IA 2BOHA 2XBYL 4RUTA 5JVZA 1KLJL 3QCWA 3HPTA 5L30L 2WPJE 2BZ6L 4BDXA 3HS7A 3M37L 1OB1C 2XBWL 2J95B 5KIRA 1KLOA 2WPME 1IGXA 4G1MB 4JYUL 2NPRA 1HCGB 1CVWL 1DQBA 1F7MA 4BXWA 2WFXB 1K37A 1KIGL 5CISA 2XBXL 5I46L 1TOZA 3ELAL 3Q7DA 5E8DA 4O02B 4D0EA 5JVYA 1CCFA 1F7EA 2J4IB 5K0HB 1XFEA 3NJPC 3EGFA 3IITB 5JB9E 1HJ7A 2BO2A 2OYUP 3CS7L 2BMGA 2Q1JB 4O1ZA 3NT1A 2PUQL 3OLTA 1HT5A 2WYJB 2P3FL 1FE2A 3CFWA 2XBVL 3LC3B 1XKBA 4FM5A 2P95L 4RRWA 2F9BL 2WPHE 1IQFL 3KL6B 4Y71B 1EQHA 2Y5FL 2TGFA 2P94L 2KL7A 4ZHAB 1ATBA 1IQML 2BOUA 4RRXA 4ZXYL 3FFGL 4YT6L 4X8TL 4ZH8B 4CUFA 3N8ZA 2P93L 2WG3C 1APOA 3BT2A 1HAFA 2BOKL 1EGFA 4X8UL 4XL1A 3KQDL 2VWOL 3CA7A 2BQWA 2D1JB 3U73A 2WFTA 1HAEA 3GCXE 1CCVA 5IKRA 2VWMK 1B9WA 3FBYA 3KK6A 1UZJA 1IQIL
chains in the Genus database with same CATH superfamily
3LEXB 5I6KA 2O5YL 2Z4QA 4IMKC 5ID0A 1DBJH 2Q2LA 4Y5XA 1QR4A 1G9NL 3ME0B 4O00A 3ARRA 3ULVF 2WO4A 1MJUH 2IFGA 4XMKL 2CA4A 1R3IL 4PCYA 3BE1L 1EBAA 5L88H 4U1GB 2VDPH 1KSRA 1WDAA 3TH3L 1A7PL 1WV7T 2VT0A 2B3IA 4GPVA 2VTFA 4JRXD 5E03A 2UWEE 4MNGB 3AWFA 3TO4C 3K5RA 4CNIB 1MAML 1LHZA 3U30B 1YSOA 1WBXB 4S1RH 4YSOA 3WEOA 5CAYB 4TNFA 4Z0XB 2VDNL 1L9RA 1BEYL 3OJDA 5HJGA 4XO4A 2DJMA 1IFRA 2NY7L 1X3DA 3WFBH 2H1PL 2GEQA 3T0VA 2L7QA 5FV2A 2WQRA 3E3QC 2YIHA 5EU5B 4Z3EA 2PO6D 4N5UA 4MMXA 5EPMB 4HCIA 1XDTR 3FFOA 3N43F 4X8JA 2GQHA 3LN9A 1CDIA 3ARDD 3GZKA 4JDZB 1UGNA 3GPSA 4JKLA 1E4WH 4XPAH 4YZFE 4X2UA 1WPCA 2EDYA 4QMEA 1MJ8L 3QJTB 4F37K 4H1LH 3SDYH 3U36B 4J12A 2WP3O 2VNCA 2DI7A 3FTGB 5ESAA 4L3EA 1G0DA 2CBMA 4FG0A 1PRHA 4R0LC 4ZMVA 3MJ9H 4YT7L 3CH8A 2UY7A 5HY9B 3MRMB 2ZWSA 4IBSA 1EEUA 2ZE0A 5IB4A 2PO6C 2AK4B 1AZCA 1OCCB 1NOFA 2VN5A 3NFNA 4N0UE 4FFYA 4BUGA 2CLVB 4KY2A 5DQDL 2HFEB 1H5BB 4HJSA 2MOGA 5EO9A 1YY8B 4GQPH 1O5DL 1ET5A 4WHDA 1XT5A 1KLIL 4YC2C 3AY4C 5KSAD 3VGAB 1NBZB 1DE4A 3QZPA 5KVGL 1GW0A 4PS4L 1XD1A 1S7QA 3KS0J 2IGLA 1ANUA 5J9PB 3EJUA 1XF4B 2OMYB 5AZUA 1KXVA 4LMFA 1OGAA 1S3KL 1DVYA 4ZO9A 1Z9LA 4N2CA 4NQVA 1JSYA 3VCLA 3WIAA 5LBSL 2LV4A 4PJCF 4AGNA 4AUJA 1FFOA 1LO3L 4UQ2B 1CFQB 2G3NA 4P07A 3S5ZA 4YXHH 1YEEH 3CLFH 5MEOA 2B4CH 3K72A 3VFNB 5I0YA 3GMNB 1Z9NA 1A14L 1F8TH 5KSAC 1GS7A 3AM8C 1W8BL 1U4FA 5AAWA 4Y1AE 3UTZA 2EXTA 2IANE 3P9MA 5DI8A 2OYPA 4LCUB 1AJ7L 2FJFA 2J1YA 2B77A 4AK1A 2Z7WA 4B5ZA 1UM4L 5E70A 2ZX7A 3E38A 3V4PB 4PGCB 5L0QB 1MNUH 3ULVH 2Y7MA 3BPCB 2QV4A 1WIUA 2ZWYA 3L3GA 3CSYA 4UTBH 3U48A 3CBJB 5DWPA 4H7VA 2E4FA 3FCSA 4JFQB 1I1FB 2Z35A 2VABA 3W57A 1G1RA 1MCCA 1YMME 3MLRL 4KDTA 3GBEA 3PP3H 4V33A 5HHVH 1U9KA 5IFHH 5K9OB 2VLRD 4LIQE 3HO3A 4IBLT 3K9XA 1NQBA 2XTLA 5AW1B 4ANVA 4NWUL 1NUGA 2V7HA 4G6FB 5BMFL 2WKGA 2R69H 3CFBA 5DGRA 4JJ5B 2J94B 1NIEA 2EI8B 2ED8A 2A83A 5E8OA 4BE6A 4WU7B 5IBUG 5ISZB 4I13B 4Y16B 1LE5B 4Q9QL 2P7TB 3NH7H 2XC0L 5DCCA 2G2PA 1IEAB 4Z95H 4E9VA 4AYMC 4UU9B 3P0VL 4U6YB 3WXWL 3IU3B 3APFA 3DHJA 2DTMH 4FCHA 4EI5D 3ESVF 1MQKL 3WD5L 1QBAA 2V17L 1UA6H 3GXUB 2I9LB 2B1OA 4NYLA 1FFTB 5BO1L 4WW2B 3WHXA 2A6DB 4C8XA 3PWPD 4LPUA 1SY6A 1JXDA 1EDHA 3OB0K 1TEGA 2X28A 4N2DA 1OM3L 2GUOB 3UJIL 3ZHFA 3H55A 1OLZA 1PZ5A 1YYML 3HRPA 1EBVA 3FUEA 3VU2A 4G71B 4PH9A 3KPRB 4PREA 4XOCA 5AVYB 4U2YA 1UM6H 2ZKWA 5IVXF 1I1AA 3QUYB 4OIIH 4K23L 3GSNB 2FK9A 3FUIA 1PG7W 2EYTA 2IWGA 2WVVB 3QA3B 1SDDB 2CIKB 4ISIL 4AE0A 4RMUA 2GK2A 5E1GA 4BQ9A 1E5CA 4UM9A 5FUOL 3QIBA 2O5ZL 4PJGB 1YYLH 3RURA 4P8QA 3BSZH 1TJIL 43CAB 5E2WH 3RWDA 2VL5B 3FTYA 1NT0A 1NGXB 1JDDA 4YHNA 5I5IA 3GZPA 3N40P 1JGDB 1T83A 4OCRL 2FJGA 1T22B 3DHUA 1CDCA 2CHXA 4XAWH 1JS4A 2WCGA 5KTEH 4JDTL 1TQBB 2XNAB 3BQUA 3NDYE 5CU5A 2DKMA 4NGHL 2ZWNA 2UWPB 2WXFA 3AB0C 3CENL 3KQEL 5IQ7L 4XVJH 5E99H 5EULV 1BP3B 4LVOC 4Q0XL 4XNZB 5C09E 2J5LB 4AQ1C 3CFMA 5FAAA 1WHOA 4XGZA 5CWSB 3T08A 3OB8A 5AVSB 1S7RB 2X9YA 3WHE1 1R5WA 2P9RA 2DS4A 4LKXB 3UC0H 1W72B 3N42B 1I7TB 3LPGA 5EBWB 4OKDA 3KQBL 4XO8A 2X1QA 2A9MH 2H3NB 3SPCA 2DB8A 1Q0YH 1EMOA 1TVHA 2WQUA 3L95B 5F6HJ 5C0BD 2NCMA 3NSJA 4IKIA 2VDQH 4Q9BA 5DWUH 1KY7A 3EFFB 3F84A 4JFHD 4RGNE 5F7WC 1CD1B 3SOVA 4K3EL 4ODSH 1EO5A 3EYFA 4ERSH 5DUPL 3CAFA 4JFFA 1K2DA 2YC1A 1IFHL 4X80L 3SCMB 3VWKD 2AVGA 1A6ZA 2XJLA 3BT0A 3EUUA 3BD3A 4NUMA 2IXQB 3FUDA 4NCC2 1VERA 2VSDA 1S5IL 2P43B 3T4AC 2DV6A 2G00L 2ZX5A 3GXFA 5D7IB 3VXMB 3O9WA 7FABL 3QDJB 1X5GA 3LTGD 4BQ6A 2ZNXA 4B5EA 2C3XA 2PWFA 1J9QA 5SWZE 4Y5YA 3MUY1 5ENWB 2BQ6A 1X5HA 5D7LA 5DEGA 4PTUB 2E7HA 5I6LA 4RMTA 2XN9B 2ZWLT 4LEOB 4CVXA 4R4FL 5IVXA 2XVBA 3LXAA 2DJUA 5DJYA 3FRPB 3IBEA 1IGYB 3VWKC 1D9KB 1FYTA 2FBRA 2YRBA 4QTIH 3FSAA 1CFTA 4TLSA 4BSWA 3SDXF 1IC5H 5JO5A 3DOHA 2DQMA 3WOVA 4AG4H 4Z3JA 4YVNA 2YJLA 3UIZA 3CBKB 1I8KA 3K6SB 2YUZA 4TSCL 2A5UA 1KLGB 1HIML 2WXJA 4RWHA 4Y88A 3AREA 3PS6A 4X99B 5CMAA 1EA9C 5DT1H 5C71A 4LRIA 2A3TA 4TSBL 5JIKA 4G3YL 3OPUA 1J8RA 1UTDA 4KI5D 4NO5B 1NFUB 3F6IA 1HRFA 3DETD 4RGOL 4ES9A 4A04A 4LCCA 4GRWH 4NEHB 4M6OH 1S9YA 5FA4B 3HVDA 3UBXG 3SE6A 1ODUA 1RI8A 2PTVA 3OMNB 4JR9L 3V4VA 3V6OC 4OLXL 2ZG2A 1NBYB 4WV1C 5F7NC 2MCPL 4L48A 4ELDA 4Z9KB 3IN0A 1KFAL 4M48H 3MX0A 5EBMA 1BZ9B 1HL8A 1WCBB 35C8L 1GHFL 4KI5C 5D70H 3HS5A 4G8GA 4I3SL 1A7OL 3G08A 3M17B 2YSSB 1CEJA 1H6EA 5EC2A 2PR3B 2UY6A 4JZEL 3WO3B 4UZGA 2NUTB 1HHKA 4KXZI 43C9B 3QZWB 4NT6A 5F9JA 1CFSB 4HU2A 5I82A 1MI5D 5A1AA 1XGUA 5L2YL 1RZFH 1ZHKA 1KIPB 3NRFA 3UMNA 3K6OA 1IQWL 2Z3FA 3KVPA 4I18C 1P4BH 3K7UA 5MENB 3HC0B 1KIUA 2Q7NA 5FYJH 4R3SA 1ZDSA 3MLXH 4HWNA 3MCG1 4P2CG 1CYWA 1EEYA 5AYTA 5C0CD 4A7IA 1TZ8A 4BH8B 2NR6C 2CUAA 2WVUA 4NIYE 5IESL 5C9JA 2R2CA 1WP6A 3TBSA 4TVPH 3SGJC 3L4ZA 4FQQB 3BCFA 1MFEL 2G30A 2IQAA 4B6ZA 3WFEH 4HUMB 3ZTNH 4KNTA 2V2TA 2EIMB 2DLIA 2NNCA 4LPVA 4YDVB 1ZS8B 3WJLC 5F1IA 1L4IA 3SDXA 2EP6A 5C0RH 2HX7A 5GRXG 4WU5A 5KG9B 3C5ZA 3GHBH 1OCRB 1LGVA 2WIMA 2WLMA 1QEWB 2CPUA 2XWXA 4DK5A 5LNEA 4OLYH 1I8IB 1YEHH 3ZRFC 1FZJA 3A3YB 3FB5B 2B9BA 2EH8L 3DV4A 4E9TA 1B9ZA 4K2UL 3L7EB 2V5SA 4FYSA 3CU7A 1NMCC 2NY5H 1D5MA 2I85A 4ZX5A 3AVEA 4OVVA 3SZKC 1OAXL 5I5MA 1S9WA 4OGXL 2VR9A 3ZL4L 3VVVA 4O2CB 5F3FA 4X9YA 2BDNH 3AUWB 3JV6B 3ZE2E 3LQAC 3S9DB 2GBUA 2CKBB 3CS7L 5HYJD 5FXCH 4U6TA 4BUHA 4NRZB 3LNDA 5FCSH 4U6VH 4B9CA 3GSOB 1YEIH 4M8UA 4TOYL 2XBVL 3LQZB 3VFMB 2BWIA 5ALCH 4Y4FA 4K9EL 1J8KA 4K0OA 4C4KO 7PCYA 2P95L 1F3JA 2DH3A 2D0FA 3IGAB 3STLB 1BXUA 2EYRA 4EKJA 4LAJH 2WPHE 1KB3A 2WXPA 1UB5A 2YD4A 1PG7L 3ATDA 2M26A 1OPGH 3DIVA 3FO9A 5D1QB 5ICUA 1HKLL 3IAGC 4GUPB 3MRRB 4A7GA 5IIEA 4KTEL 1JGEA 5BVPH 2EE2A 4P2QA 4LDEB 5DHVH 5DLML 2OZNA 2APXA 1LK2B 3TPUA 5CZVH 3SDCB 2X9WA 4XN4A 5KVMC 3BUDA 1ZCRA 3KQDL 2EVIA 1I9EA 3W0WB 2BQWA 2VZUA 5ISZE 3LHPL 1VEMA 3T0ED 3GBML 1LO0H 1CL7L 2P80D 2DIAA 1KCBA 1HAEA 5TK2A 2V2XB 4JRFA 4LLMB 4TQHA 4B95C 2XTJB 4EPSA 5JUEH 1TYRA 3FPXA 4ZUWA 4ACPA 3HE7B 1XBDA 3DEMA 3L9YA 4B9JA 4NAMA 2VC2B 3VGBA 3L2NA 3Q01A 1OB1A 4NC2B 4DTGL 5IUCA 4ODVL 3UO1H 1KLUB 4HWZA 2AQQA 3HG4A 1FGNL 4WUUE 5JW5A 4PJXF 2DQFB 2Q8BH 5D8JL 3T0EC 1A4BA 5FKPB 1ZJAA 2IEPA 4N90D 5GJTL 5CJQH 4ZS6D 5GGQH 3DSNA 1BVOA 1E28B 1QQDA 3F6LA 1QATA 1HDMA 3HZ3A 5KUMA 5EF1A 5DJXB 3ARYA 1RURH 3DTDA 3QAQA 2X4OB 3LDBC 2VH0B 2KZ1B 3OGCB 4TUJA 4ZFZA 2OSXA 3AG3B 1PX8A 2NQ3A 1C16B 4GMTL 4BZ2L 5ICYB 4PJIB 4ABVA 1SVBA 1DQLH 4BKTC 4P2RD 3CXHK 1YN6A 1ZTXH 2AANA 3C5JB 4ZS6C 2Z0BA 2AJYL 4P3CH 5T5NF 1HAUA 2EIZB 3FFCE 1UWYA 3A4EA 4WTQA 1CO1A 1SF3A 3VG0H 4JG0L 2VJ0A 3T2NH 3VMNA 3X1BA 2AEQH 2HFFA 2Y7QA 3P54A 4HK0B 5TE7H 4JGJA 4DGIH 3HUJB 3VXTB 1CGSL 2IPUG 2F08A 4XP9H 1F58H 1GW6A 2DI9A 2PPEA 2Z8RA 1BPVA 1ACYL 1BYNA 3TA3C 4X4ME 2I5YL 2GG1A 4JY6B 3P3TA 4YO0B 1Q4GA 4YBLB 5E2UL 2GSIB 2H4EA 5DURD 5SWSE 1KBBA 2WOYA 4PJDF 2TSBA 3MDJA 2BMKB 3B2XA 3P5BL 3HB3B 4LEXL 3VM7A 5AKTA 3I3DA 2WQSA 3EH5B 4JQIH 1Q4NX 1FG2A 5CP7B 1UT2A 1TG8A 3KXFE 1KLFB 3WCYA 2FZ3B 4PSPA 3VFSA 4HPHA 2FO8A 3FQ1A 2UV3A 3B9EA 1VADB 3QPKA 4YSDA 3UROR 1G0XA 5EWIL 1RZJL 4OCXH 1Q9LA 2OXHB 3DDFA 3FQ2A 1BQ5A 1EJFA 1T5XA 3BVVA 4UQCA 2EDHA 5I9QC 1KJ3L 2B3RA 5IT2H 5AOJA 4MA8H 1KJVA 4OM1H 3PWUA 1QA9A 4P48A 5D1ZD 3HI1A 4N0YL 1F11A 3MUGB 1FZOA 3AWGA 1DQQA 3BIBX 1JWMB 4XP1H 1P4IL 1U58A 3MLZH 3JSSA 3WE6B 5D7IE 4CGUB 1DBBH 1OCZB 3QDJE 1SFHA 1HI6A 2YD0A 5FM5M 5I2IB 1G7QB 3EW3B 3CFEA 4X6DB 1CJYA 2ZAIA 3DV6B 4Y19D 3VJ6B 3V79C 2VDML 1QPPA 5I1LA 2ZPKH 4ZTPH 4HXBL 5IWLC 3K6IA 4YIQB 1QSFE 5E6ID 2AABL 2O61B 4YHIB 4HIXL 5D1ZC 4DK3A 3KGRA 4N2HA 4X6FA 2GTZB 4MAYA 1AY1L 2Q76B 3WTSA 2BSEA 4AYFB 3UYOD 1BVZA 5EZOL 1CF8H 4M7LH 4KX9A 5LWYL 2KLRA 4PHZA 3N55A 2DQTH 3D4CA 3R0MA 3VXOB 3WTTA 2BP0B 4MA3A 3P4OB 3PL6D 4NQXB 4M8QB 5E6IC 5FYKD 3N9GL 3AMKA 2X4SB 3K2MC 4CVUA 4DUVA 5HHXH 1XZ0A 5D5MA 1U8NA 3B1TA 3BT2H 4UILL 3FNKA 2CM5A 3OF6D 3R1GL 5I1CH 2B4CC 4GAYB 3MLPA 3S37H 1HILB 1NGZB 2XZZA 4F7TA 3H9SA 1A2YB 1ZV9A 3IS1X 1N2RB 2W8CA 2P42B 4JO2L 3LN4B 2QZ5A 3P11H 3LV3A 4JZJB 4U1SA 5FKAB 1RULL 4W6YB 1KPVA 2WZAA 4B7IA 4BFFA 4K94L 2R8SH 4HGMA 4ISHL 1RMFL 3PL6C 12E8H 1IT9L 1E3FA 1NPEB 3ZL2A 2CALA 1H15A 4P46D 1IGFH 1E5ZA 1AACA 3ARTA 3QJHA 1ZJBA 3ULUH 4EQ3A 1BX2A 3K46A 2P4AB 3FFDA 3Q48A 2QVIA 4GXVH 4XAKE 4GKSA 1INQA 1KCSH 4UF7C 2J6EL 1JPST 1UJ3C 4C56A 1DLHA 4HMEA 1I7UA 1TQUA 4IDJH 1YNKH 5BV7L 2NY1D 1B4JL 2H9GB 4KZ0A 1NAKL 2IG2L 3QEUA 4E9SA 1WBZB 4PGDB 4YMPA 1SRDA 1EO8L 4P46C 4E9RA 1JDAA 4AJYV 4PJ9A 4XNUH 4GW1B 5D2LF 3SE4A 5E6SB 2VYRE 2D7QA 2P5EA 5FYLL 4RSYA 3S35L 2ZOLB 3CFJB 1XXDC 1FFPA 4NC0B 3V5DB 4JGNA 3FCTB 3K2KA 3CMOH 1F4XL 1OKEA 4PRID 1U8JB 4W81A 1XH1A 4CUDA 1AO7B 4IHOB 2NY1C 5EUOB 2MJWA 2DPKA 2R2HA 3L5XH 4G80B 3NCMA 5FGBA 1K85A 2HJKB 2WNKA 2K4AA 4XBPB 4HJUA 1UXLA 4WSGA 1M42A 3KBPA 4RRZA 2QLVB 5AVQB 4F57L 4JZDL 1OQXA 4IS6A 5A2BA 2K0RA 2V7NB 4R9HA 5TE6L 1GOHA 2D4DA 1C5CL 2BZDA 3ZMNA 4BYHA 2R7EA 2K8QA 4DFIA 3D51A 4TXVB 3BWSA 1Z9MA 5CR1A 2JH2A 4WHTA 3RDTB 3X1EA 4Y2DD 5FR3A 4UQIM 2LOEA 1AIFA 3HJEA 2Q6WA 1PCXA 3BHBA 3O11A 4OIFA 1V3XB 3MNMA 2P44B 1B6DA 3EJRA 4O5LH 3UTPE 1XBRA 4KJYA 5FLVA 5GIRA 4BFNA 3SJVB 1QBLL 2WXMA 2XN0A 2GABA 3JV4B 5IQMA 2PKDA 2NZ1A 4NQSB 2CZNA 5GZOD 4Z77B 4L2LA 1J8HA 4Y2DC 3CQPA 1Z1WA 1OWWA 3HOGA 1MVUA 4YUEH 2Y2YA 1UUNA 4R26H 5IB5B 3T77A 1UASA 2LAAA 3I84A 3WMSA 4YGVA 4IOFD 5K1JA 3ZE1F 3B9VA 4TVUA 4Z7UB 5BS0B 1AGDB 3GKWL 1NFXB 4OFPA 5JORA 1Y7VA 4ILDA 4JHVA 1RUPL 2AV1A 3B9AA 4AM0B 3A6CL 4DK6A 3DO7B 1LWRA 4Z6AT 4BA8A 5GZOC 4UT6H 5DEFB 3VH8B 2UZIL 1OAQL 4P5RA 1PGEA 3QCTL 3A67L 5AW9B 2A73A 2MQ3A 2F58H 1TU2A 3FRUB 1RHFA 1PFOA 4IOFC 3CX5K 1EJOL 5KVDL 4JFTA 5C2BH 1YN7A 5E7FA 1NIDA 1OAZH 4XPHL 4A7VA 4HF5H 1NKGA 1U93A 3IJYA 5I6OA 3PQYA 1OCWH 3MUZ1 2AK4D 4JG1L 1EPIA 1G7PB 4NM8L 1XF3B 2XTJE 4EZMA 5F3HB 5HDLA 3U7WL 1AUTL 4N2KA 5C7ZA 5IMOA 3Q13A 4R5XA 4H26A 3O3BA 2P8MB 3GSUA 5F0PB 2IGTA 1AOHA 4LPWA 4XNMB 1QYGL 1RK1A 4G6KH 5I76A 3ULAB 1HREA 5F7AA 1CLYH 1Z66A 1FVEA 4JKWA 4K8RD 3S3BB 3O0RH 1N0XL 4ACTA 1QIUA 4AT6B 5GHWL 1SFDA 2DEXX 2HT4D 2YZ1A 1NEZG 3ILPB 4HKBA 4JAMA 4CN6A 1AE6H 1TDQA 3QCVL 4HUWB 5FM5O 3VGAC 5CJXC 2FHBA 1R1CA 3HR5A 4MJ5B 3QJSB 5JXAH 2LU7A 3QZBA 4ZMNA 1PQZA 3N3EA 2VM3A 4KZEH 2DW5A 4R7LA 3PYCA 2CO6A 4LEEA 4NOBA 1BJMA 2YSTA 2H0JA 1U2YA 4K8RC 1XSOA 1FRGH 3OKKA 4GUCA 4P2YA 2WPJE 2VISA 4TULH 5HJDA 2GTWB 1DVXA 1I1YA 2BZ6L 2EVFA 3RU8L 3M86A 4XVTL 2AMUA 2GJ6B 2J44A 3X1FA 1P5VB 1FZMB 4F58H 1BM7A 5DHDA 4NHUB 4PJAA 1UZ6E 2ILLA 4AJWA 5FYJD 4Y89A 3WFDH 3G5ZB 1VFBB 4U6XB 1V54B 2YAOA 2CXKA 5EZJB 4ZFGL 1A9EB 3LRSB 4QHLB 3UJTH 2FRGP 1B0GB 1N4XH 3GGWA 5L0QC 2MMXA 4JN1L 1A6TB 5ESVB 4WI0B 2DDQL 3SQOH 4Y16D 2X9ZA 4FXKB 4HC1L 1AQHA 1QNIA 3Q1EA 2H6PA 1LYQA 3D2TA 3OKDA 5AOIA 3MRKB 1CGVA 3OAYK 4NO3A 4P9MH 2DL2A 3UTSE 5HHQA 1M9WA 4JPWH 1I1RA 3QCUH 4FN0A 2K45A 3BGAA 2Z93B 5C08A 3ARXA 4HGWA 3ZLQC 5B3JF 5AD0B 1KJMB 4LASH 2DM3A 3BAKA 2KBGA 2ORBH 1YUHA 2CRMA 2ZP9A 1QFOA 3K81A 4HSCX 1RUML 5KJRH 3NRQA 3DX6A 3PNWB 4LCVA 1ACCA 4Y16C 4Y9EA 4KNQA 3RFZA 3DXAE 4OSUH 3EYSL 3ZDZB 1L7TH 3KPRD 3N1GC 4P4KC 3CZFA 1IE4A 2CMRL 1IM9A 3FAXA 5I18H 2X41A 3QUYD 4ELMF 4B9KC 5IQ9B 1P4LB 4WW2C 4X4XA 3RTQA 4UDTA 4EZLA 4KGLA 2I07A 2AV7A 4DT2A 3RUGB 1U8QA 2O1AA 4E2OA 3FQRB 2XPGA 1WZLA 1JZ5A 1ED3B 3RWGA 3C08H 3B6SB 3IXAA 4H0HB 4HLZH 3FT3B 3IDIA 4CUFA 2EINB 4U1MB 3UGEA 3I75A 1J7VR 2NY5C 3QJFA 3I2CL 3QUYC 2VXSH 3RP1A 2BJMH 4GKLA 1MCWM 1O6SA 3L17A 5CD3B 2D9QB 3MBWA 1YYCA 5LB1A 1ND0A 5E8PA 1K3IA 1QLRB 3IDGB 3E2HC 1HK6A 4NUGL 1MLBA 5IF0B 3RI5K 3N0PB 5DO2D 5DRZA 2OCJA 4AEIH 5T3XL 5INDA 5DZLA 1CLCA 4G5ZL 1SGKA 3GSQB 3GSWB 1QRNA 2FJHB 5DRWA 5FO8B 2QELA 3JYBA 4Y1SA 4N0RA 4BHUI 1TQBC 2VDRH 4PCKA 4YDKH 3VM5A 4OTXH 4JREB 2NLJA 3QS2A 3LKRA 1PPIA 4RX4D 4CILA 5D2NB 1BQHB 4XNZC 1VFOA 2J5LC 3MRQA 5DO2C 1B4LA 3MOQA 1EHLL 3QHZH 2G2RB 3SCMD 4X7CC 4BWTA 1R24B 5BRZE 2VB5A 5DQJB 4MASA 4ZT1A 3T09A 3X12A 4NQTA 2F54B 2F1BA 1NZIA 3FBKA 4G82A 4A1RA 2FE0A 5I15L 3LTVA 4GG6A 4J27A 3VXMD 4QRTB 5EOQL 2IOIA 1G7JB 2NY3C 4L1TA 4RIRB 4GNKB 1VACA 5IK3B 1SVZA 2WLLB 1FBIL 3GMOB 4CKVX 1CE1L 1DBML 1DN0B 3DGCR 4QLRA 3NBNA 4FZEL 3VQLA 1EXGA 2XN9D 3C60A 3CZNA 4Y4KB 1UKQA 2ICEB 4LLVA 3U1SH 3SCMC 3ASIA 3E0GA 2EYSB 4ELMA 3OZKA 1D9KD 3G3LA 1MIML 4FYQA 5GGRA 5HGHA 2JKSA 4UYQA 3RB5A 1E40A 4DGUA 4RRPM 4Q52A 4QAWA 2CGRL 4P9HH 1HHGA 3ES6B 5EUOE 3X3FL 1XGRA 5A43C 3GMPB 1XL6A 1CU4L 2ESVA 4OJEH 4RNRA 1H9DA 3QUMH 4WW1A 2VOTA 3W56A 1BYPA 4B50A 5D71L 3D3VD 4KJWD 1VJSA 3H4FA 3DSFL 3T04D 4LARL 4FQXB 1D9KC 5IREA 2IALA 1RFDH 5EIIA 1JN6B 5ETUB 3ARFB 3DOSB 5FO7A 1TJHH 4WI3A 4Z7WB 4GIOA 4Q9RH 1DYZA 1DJYA 3DWTA 4PJHF 2UXTA 3I9GH 3VWJA 1A21A 3D39B 3WO4B 4A7QA 1BFTA 5DUML 1BQLH 4S0TD 1FVDB 4KJWC 5DMKB 2IIJA 2VE6A 3DBSA 5HHOA 4A2LA 4JFUA 3SJVE 1QSED 2XWBA 2FAUA 3JVGC 5IHUH 4A39A 1IB5A 5ID0B 2J88H 1RZ7L 4M6NH 1T0MA 1USQA 3VRLF 1DL7H 3WMQA 4UT9L 4IIQA 3GUTA 1DANU 4MD5A 2GVYA 1VB9A 3MHZA 3RWHA 2Y7XB 1NFYB 1DSWA 4HJ0D 3SKMA 3ZTEA 4Z7UE 4QOKB 2BNUB 4DGWC 5BS0E 2CO7B 3TNMA 5MEND 3BOVA 5GGSB 5DHYB 3Q8FA 4KKCD 3DTXA 1NLDL 1NWPA 2B9AA 3OJDB 4L5FE 2ZWZA 5AZEL 3QO0A 4FOMA 3PFQA 4UT7L 2ZOTA 5F89A 3T3MB 3ZYGA 1G7LA 1ZK5A 3B5GA 4PLNC 3VGFA 1IZJA 5JBCE 4WFEE 3WNKA 4MMXB 4ATTA 4HJ0C 4U7KA 5E6ZA 1V8HA 3S6CA 4XMPH 1A3RL 3MOAH 3B5TA 4X8JB 3HMXH 4HCRL 2BNRA 4KTDL 1FP5A 1WGVA 4OZGA 4OV5A 5E2VL 3B2VH 2F5BH 1QFHA 3FUFA 4U3CA 2XQBH 4K5NA 3C87A 3PAYA 2KERA 4QKXB 4L3EB 2VDLL 3FRPG 3IU4H 4OIAA 5D7KE 2BNQE 2UY7B 5H2BA 2EILB 1M2VA 3GUFA 3PHQA 3PP4H 4ZMLA 5I1HH 4JO8A 5IB4B 5JW3L 5CN2A 3NFNB 2GJRA 5HDQL 3KPOB 2A74A 1HH9A 4ZFOL 3SYPA 1KB9K 1XGYL 2VVUL 4PV9A 5EO9B 3POYA 2OMBA 4U1LA 3WSQH 3H3PH 4O4YH 3N1PC 3ZUCA 2AHIA 2PHBB 2O6PA 3DX7A 1RJZA 1MFDL 2EO7A 5LGHL 5DD5H 2D3VA 4OQ1A 2IGFL 1S7QB 2E74C 3LXBA 3QWRD 3ZKND 4MJJA 4L8DA 1MPAL 1WWWX 2PPCA 2Z7YA 1OGAB 3TBVA 3VCLB 1U8CA 5CBEA 4JY5L 5I17A 1A1MB 3WIIH 1FFOB 3Q44A 4NN5B 1E4XH 1T04A 4QDGA 3DX8A 3MO1A 5SX4I 4W4OC 4XPFL 2MQ0A 4MJ6A 1IC4H 1T89C 1HT6A 1B88A 3K72B 4NO2A 1CN4A 3HG3A 2AJ3A 4ZUUB 3S4SB 3DYMA 1MY7A 3UTZB 3ZKNC 3QIUA 3MA7A 3P9MB 5DI8B 2D7TL 2FLBL 1IGML 1NFDF 1O7SA 5D1QD 5F96H 2FJFB 2YEQA 2H3XC 2NTSP 2GJ6E 2UWLB 3U7YH 1SLWA 1I31A 4XHJD 3QZWG 3O6KL 1XCXA 4Y9CA 3TF7C 4JDEA 3TBYB 3UACA 4JPVH 2HRHA 3L3GB 1M05A 3CSYB 1WHFA 1T0OA 3B2UD 3SDCD 3FCSB 1E6JL 1NJ9A 1OAUL 2QQNH 4AGMA 3A24A 2OMTA 3ULUC 1JP5A 2BP8B 2VABB 1BD2E 2JKIS 3W0WD 1PKQE 3MLYH 2VLJA 3BZDA 5FCUH 5H35A 4FTDA 1NBVH 1FAKT 2D8KA 3N43B 1I8MA 5D1QC 2V7HB 3OL2A 2XUWA 3D25A 4G43A 4Y2LA 3VRJA 4XHJC 2HVJB 1HL5A 1LQBC 2YGVA 3AS3A 4JQXC 1DQJA 3HE7D 1U8MA 3R0NA 5LNGA 2A83B 4WHYH 5E8OB 4MTMA 1YAZA 2K2SB 5IHHA 5CLTA 3W81A 1Y1UA 3ZJAA 4HPYL 4A2MA 4D9LL 5BRQA 1DANT 1OO2A 4G1EA 2VWEE 1JUFB 3B2UC 3SDCC 2YO3A 3FL7A 1HOCA 3QUZA 3BIKA 5DK3A 1DLFH 3IRZA 3QORB 4A6YL 3W5NA 4J3VA 3WHXB 4N1HB 4J3OH 4NYLB 2VKXA 5E5LA 2VLMD 3R7RA 1ZEAL 4Y1TA 3HE7C 3HAEH 4GO9A 4HW6A 2E7MA 2ROXA 3FKUS 3NIGF 2YAHA 4NWTL 2YD5A 2JELH 4GRMB 4KVNH 4LSQH 1PZ5B 2J8HA 3U4BH 1PLGL 4XE5B 3MCLH 1FFRA 4N0CC 3TWYA 3VD5A 3BAYA 4PREB 3G6AB 2N56A 4DWHA 1I1AB 3N04A 2IAAC 4PJCB 4NDMB 1G9NH 4DKDC 1MCOL 2DBJA 1HJBC 1H8NA 1QZNA 1SHSA 4G8FA 4M9PA 4XMKH 1R3IH 3BE1H 2CGYA 5KYXA 4FTVB 1A7PH 1BVNP 2B14A 7CGTA 4CMHB 2A4CA 3QIBB 1KJ2A 2NXZC 3VYOA 1LVEA 1G9HA 2NW3A 3RWDB 3MRDA 3SBWA 3T6WA 1E4HA 4XMTA 5LGKA 3T1WA 1LMKA 2NSMA 4NN6B 3LKOA 2VDNH 4XCYA 1BEYH 2OMUB 3SOQA 5FO2A 2FJGB 3B7YA 2CUMA 2NY7H 5A2LH 3EDKA 2HRLA 2W88A 3B3BA 2H1PH 3HB3D 3BQUB 5F7BA 4ZMZA 2BY2A 2HUEA 1JK8A 4J8RB 5KVFE 2WINA 3WS6A 4AIEA 3OHXA 3J7HA 3FT9A 1JXJA 4AQTA 3BO8B 3NYKA 1TZIA 4OY9A 4XGZB 1MJ8H 4HKJA 2H8PA 4AM0Q 3SDDB 1ZVHA 4A94C 4F2FA 3UDWA 1TJMA 2GC4C 2VLKA 2LGNA 3HB3C 3I9AA 1TVHB 1NCOA 4N2MA 5IOKA 5L2JB 4HS6A 4XN8A 1EFXD 5GGTA 3D2UB 3W1ZA 1QUPA 1U3NA 3IWUA 5EEYA 3EYFB 2B15A 2VSCA 4JFFB 4ZTOH 1K2DB 2YC1B 1Y6MR 3CDCA 1ECZA 3S98A 4Y7AB 1NAML 2XA3A 4HH9A 1K72A 1A6ZB 1T03H 5GS0L 1J8SA 3M7OA 1A47A 3QUHA 4QNPF 4PS4H 3O9WB 1D5IL 4NCDA 1S3KH 1GC1C 4PWGA 3LH8A 5JQ6L 2VXQL 1QOKA 5HHME 5D7LB 2Z34A 5D72L 3L9RA 5DEGB 2ZF8A 1LO3H 1AQKL 5EU3A 5IR1A 4NPYA 4CVXB 2YPLE 5IVXB 3CC5A 2COVD 2WPME 3VFPA 1TF4A 4FFYH 3X13A 4K7FA 2Q8AL 5I0XA 3ILDA 1A14H 1CFTB 2HH0H 3U1PA 1F7MA 1RUQL 2EUXA 5H4ZA 1LO4L 1AJ7H 2ED6A 3AREB 3ZHDA 4D0EA 5CMAB 1QBBA 4PJEE 1COBA 3ELAT 4MS6A 4KX7A 5DMGD 5DS8A 4NQDD 4BZYA 3WI9A 2X87A 3D39E 3CLWA 5EF3A 3C6EA 1MOEA 4OD3L 4FKEA 3CXHJ 4K3GA 1OP3K 5HYQA 4P2OA 3MLRH 3QNXA 4LCCB 3WKNA 1PZ3A 2OYUP 1S9YB 4S1SL 5AAMA 5KN5A 1YPZF 1UOKA 1VDGA 3V4VB 5TJWK 2JI2A 3II1A 1R5IA 5F7EL 5BMFH 4NWUH 1SMDA 2OK0L 3TBBA 1CXIA 2X89A 2CUHA 4B9GA 4AX3A 3NCYS 3G6DL 1FLRL 4OR1A 3LN5A 5DMGC 3WKYA 3ALPA 3MX0B 2YD7A 1OK0A 5TDNB 4F2MA 4Q9QH 4G8GB 3QC6X 2RAMA 4LSVL 2C7UA 1MCNA 3P0VH 4JZJC 4QOKE 5EC2B 2R2BA 4HS3A 3WXWH 1R17A 1HHKB 3H42L 5KAQG 2Z92A 1MQKH 3WD5H 4FEMA 5KSUA 4HULB 1ATBA 2K7QA 2V17H 3FT0A 2ZTBA 3HC3L 2F7IA 1XGUB 5BO1H 4BQBA 2ED9A 3ZXAC 2DOCA 2PP8A 3N8ZA 2WG3C 1KIUB 1BDYA 3IJSA 5CEZD 3EH4B 1ZK9A 3CHXA 1OM3H 5CLYA 3SPIA 2C3VA 4ODTL 3UJIH 4DAGL 1YYMH 2E9JA 2AQRA 4NP4L 1AO7D 1D2OA 3H7BA 3OAWA 4GW4B 5C9JB 4Q2ZB 3RGVA 3TBSB 5G2NA 4K23H 2X9XA 5F9OL 3UBHA 3VAEA 1I8LC 2E6JA 5BZWB 2V2TB 1DVZA 3HHMA 4NQQA 1O9VA 2V5YA 2VITA 1S4IA 5FUOH 2HAZA 2O5ZH 3C09B 4FFVD 3SDXB 1TJIH 4WU5B 3C5ZB 5I0VA 4XOAA 4J39A 3O6MH 3RDTD 1HHJA 2PWGA 2VDOB 4AQ8A 4KXDA 5F2FA 4X8XA 4RFNB 4GAFB 4WDIA 3AQDA 4MNHA 4OCRH 3RTLA 1EAIC 3QE5A 3ARDA 3DV4B 4WENB 3L3JA 4JDTH 5K93A 2F8XC 2BSCA 4NKMA 2IPTL 3NZUA 4LCIL 5HSFA 2OYEP 4NGHH 3H1ZA 3V52L 1URLA 3CGTA 4YK4B 5HJBA 5B4MD 2AAAA 4QT5A 1D5MB 5T1KD 3LPPA 5IQ7H 3CLEH 1FNEA 4FFVC 2LLNA 5IQNA 3O6LL 2I24N 4Q0XH 3AG1B 4FJ6A 1AC6A 1S9WB 3RDTC 1QLEL 5BUGA 2EDQA 4DW2H 4DUXA 2NOYA 3BXNB 1WWAX 1R46A 4OLVL 1KY6A 3EO0A 5EZIL 4PIRF 3Q3KB 2CRZA 4LVEA 5ADPL 5L9DH 3ULVE 1NC2B 4MJIA 1NMBL 1OGTA 1P7HL 4IRZL 1PY9A 4JE4B 2W2ME 1BA9A 3KH4A 5B4MC 2CJ3A 2HCZX 3PABB 5F0MB 1FGVH 5LAPA 1PW3A 4YWGH 5L7XL 3EDEA 3BPSE 1KYOJ 3RX9A 4Y4FB 1MW2A 5DUPH 2BHFA 1IFHH 1JNLL 2GHWB 4X80H 4ZQTA 4PP1D 3H56A 2EYRB 3M45A 2QFPA 3O2VH 1QPXA 1UB5B 2FX8L 3C2AL 1S5IH 2G0KA 3OV6A 4GKNA 3APCA 4JLRA 4MS8D 1JGEB 1IKNC 3VXQA 4E5XG 5E8EA 4WEBH 3ZYIB 4P2QB 4X5WA 2E7LA 1PFXL 2PW2A 2XIDA 4WCYH 3TPUB 3CUPA 2L7UA 1VGKA 2OXGA 3M6DA 2OV0A 2R0KL 1RK0B 1VPOL 4PP1C 5ES4B 1F97A 1PF3A 1GGBL 4ADJA 4LMQI 5GRWA 4FG2A 1GH7A 4Z7VF 2IDTA 2OL3A 5I71B 1BZEA 1BWMA 4BTIA 1AZVA 2OMZA 1CPUA 3COOA 3V0AC 1JZ4A 2UUDH 1F4HA 3QRBA 4MS8C 4WQOA 4TSCH 3DUSB 2VZTA 3GPEA 3HG1E 4N2LA 2JCCA 1HIMH 3MPCA 4LLYB 4DCQA 3VXSA 4G6JL 4HK3N 3C8KB 3VXRA 3SZ6A 2ED7A 4HWZB 3L5JA 2JI1A 1U91A 1CFMA 1IGCH 2ZXAA 3F6JA 4G3YH 5JW5B 4MXWL 2VZVA 4P9HC 4UMGA 4HWEL 4K73A 2QQQA 3OXSA 3B7SA 2EIEA 4RGOH 4OI8A 4WI4A 3K6DA 3DSNB 3FUMA 4JR9H 3RIFF 1QQDB 3ASNB 4OLXH 1HCZA 2AJSH 4KXCA 3FU7A 2BO0A 4OFIA 2QL1A 1V3JA 3RZWA 2MCPH 2RNLA 4PJ5E 1Q38A 4BWWA 2Q7YA 4D0CB 1KFAH 4EI5A 1PG7X 2OSLA 4TUJB 5EU6E 4ZFZB 1P7KA 5EEZA 3CD4A 1J05B 1GHFH 1AI1L 35C8H 4FTVE 5MHSE 2WOBA 4I3SH 1A7OH 1UD5A 1GIGH 1YN6B 5BW7A 3PWPA 5AVUB 5A6MA 3N8VA 2H0EA 1DP0A 4X6CA 4W9DC 5F7DA 3SE9L 4EBQL 1XO8A 4DPRA 4WGWB 2HT3D 1RFNB 2NNXA 3BPNB 4H8UA 2X4NA 1T7WA 3IFOA 2YBRB 2NCEA 3AU0A 4MHHI 5T3ZE 4F7CB 2GT9B 3VTAA 3DUHA 3O2DL 1IM3D 3VH8G 2MTPA 2UWOB 3LZNA 4EN3A 3SGDH 2M83A 1H3VA 1L0XA 5IESH 3O45A 5CSZA 1KDIA 3S36H 4NGAL 4AE1A 4XH2A 4YFEA 4Y6DB 3OPZH 1V1IA 2HT3C 1MFEH 2MEJB 1IGTA 2OCCB 2ZYRA 4NZUL 4O02L 3HTLX 5JOPD 3KM2A 3UBXA 2Y72A 3VFSB 1H8OA 1AHWA 2E86A 1FO0L 2V0AA 3I6LE 3IXTA 4CA4A 4FXKC 1J0IA 3BH8A 1AMYA 3CX5J 1T5XB 4MAZA 4G8IA 2WTRB 3MV8A 1I7ZA 1RLWA 5KANG 1YQVL 1KJVB 2XU9A 3EG9A 3PWUB 4QRBA 2JKNA 1QA9B 4JO4L 1EPHA 3HI1B 2ZONA 2EH8H 3NCJL 4OJFH 1FZOB 2PYEA 1DQQB 1B9KA 3H3KA 3KCPA 3RPBA 3QXTA 1JNNL 4K2UH 1U58B 2BSSA 4AYBA 4ODUA 4Y8AA 5CF3A 1TNNA 1ZD6A 2UX6A 1HI6B 4W6XB 2DQEL 1MLCA 1A5FH 4HUXA 2VJ3A 4FQPA 3CFEB 1HCFX 1OAXH 2QPFA 5HGDA 2W07B 4XNDA 4G83A 4QGYA 5I1LB 4OGXH 4AIXA 3EBAA 5LAXA 4P99A 5J5EA 3MKGA 1UFUA 5JBBE 2PW1A 1RPQA 3ZE0E 4PN6A 3PGCA 4X6FB 1MOXC 2WLZA 4CN4A 4MAYB 5C1MB 3WJJC 2PNDA 4N8UA 2E9WA 4KPHL 2Q86A 5E9DE 3IKCA 1UKSA 4EO5A 4ZMWA 4AQEB 1W15A 4NZTL 1SN5A 4TOYH 4GRWE 4BFBD 2NW2A 1H6UA 5AYUH 1PLCA 4LCWA 4K9EH 2EUZA 5IV2A 3M8OL 1KGIA 1ZLUK 1R5VA 2VVVL 1ADXA 1CXKA 4GI9A 5DA0B 1CTOA 1BZOA 2GI0A 3QMOA 1XZ0B 2RALA 2HX8A 1HKLH 3L9EA 3KYOA 2WLIA 1AZZC 1MCEA 4G8AC 2XC5L 4KTEH 4CAGA 1I9JH 1N64L 5T1LA 4F7TB 1S7TB 4ETQB 3EXLA 5L4IA 4P57A 4GB9A 5F1SA 5DLMH 1UATA 4OQTA 1MCIA 2I32A 2F53A 3LS4H 1IQEL 2K70A 3LV3B 3NOIA 4U1SB 4Z7NE 1KPVB 5ABDE 3GS7A 3ETBF 3TYGL 5KYYA 1GZPB 3BP6A 3LHPH 3GBMH 2C7FA 1H15B 2F54D 3D4GA 3QJHB 3SE3C 3PLYA 1CURA 5E8NA 3FU9A 1BX2B 5MI0B 3APDA 3FFDB 2BCKA 2JE8A 3DVGB 3MN8A 2APSA 5E8DL 4A2FA 5JPNC 3S2AA 1INQB 1UGKA 4DTGH 7PAZA 1VF5C 1JZ6A 4JREC 1C7TA 1VSCA 2PF6A 3NZHL 3ULSA 3V7AG 1P84K 5AG8A 5E5UB 5KJ7E 1DLHB 5D2NC 5AKRA 1GY1A 2XWZA 1UZ8A 2ICCA 1I7UB 3LRGA 1FGNH 4TVPE 3BKYL 4BFJA 2Y5QA 3UO8B 5D8JH 4JFED 4AJ0A 2CGZA 4O2FA 1OSPL 5GJTH 1MRFL 3TLRA 2UWEF 2WG4B 3KHQA 4PJ9B 1LK9A 4FFZA 4M8RA 4NAQA 8PAZA 2P5EB 1N7DA 4FEIA 2QZQA 4DQOL 3EYVA 1FNGA 4LDLB 4JPSA 4PWKA 4MD0A 4G9FE 2ZIDA 1JGLL 3QT2A 4FLSA 4L4TA 2OPCA 3X14B 4AY0A 1WLHA 3JXAA 3FH7A 3UYPB 1JIBA 1CICA 2ICEC 4NENA 2ZSWA 4JKNA 2R2HB 4QRRE 4BZ2H 1T1ZB 2W0PA 5BOJA 1NCUA 3Q9QA 1WTGT 3ARFD 2AJYH 4GSXA 5AOKA 4ESKA 2OTPA 3VQ2C 5IUSA 4UV4H 4YZFF 1I3VA 4IS6B 2W81C 5AKVA 4EDXA 4JG0H 3SYOA 3BD5A 3TK6B 3GKZA 4NM4L 4EKXA 4NNPL 1UZQA 4OW6A 4A2HA 5TQ0L 1CGSH 3R18A 2I69A 3KCWA 1F45A 1NCJA 1ACYH 4IOSD 1AIFB 2Y38A 3WTVA 2I5YH 1LPGA 1G7IA 2YWYA 5E2UH 2Q6WB 3O11B 3BHBB 3ARFC 1Z32X 1WHPA 3LZPA 4U4IA 5KSBE 3GMQB 1OGPA 4LEXH 3VGGA 4KJYB 3QRLA 3WO4C 4J7RA 4WFFD 4FL4B 3UTTE 2AXJA 1SYVB 2AK1L 3V95A 4PW4A 5IG7B 1JCVA 2DJ4A 1IX2A 3HBGA 4AZ8A 1J8HB 1E8XA 1MVUB 4FA8A 3V5KA 5EWIH 3H3BC 1RZJH 4YGVB 1YEJL 2QT6A 3ZDXE 4Y5XC 3WN5A 3W2DH 4F2EA 5C3TA 1KJ3H 4OH2A 5TF0A 2DIBA 3WDHA 1U2CA 2HG5B 3BAJA 2WO3B 3A4FA 3EZJB 3QJQB 4GMSL 4MXVE 4N0YH 4NAJA 2R29A 5JORB 2AV1B 3FC8A 5DEZA 2J2ZA 3QK0A 4PSRA 3O4OB 1P4IH 1B2YA 1M71B 2FSDA 3Q06A 2A73B 2UWEA 1WK0A 4CJ0A 4U1NA 1QFWL 5IGXL 2VDMH 2MWCA 4AEHL 3MNVA 4BA0A 3U4KA 5TQ2L 3LQAL 4L3ED 4HXBH 3EJQA 2CO2A 5B39A 3KYAA 4GJTB 5I24A 4JMXA 2AABH 4YHOL 4BINA 1U93B 4XMXA 3PQYB 4MMXC 1AY1H 3UZEC 1S5HA 1VIWA 3BWZA 1AMXA 1N18A 4D0BA 2R29L 1MFNA 5EZOH 3EO9L 4U0QB 1E2WA 5LWYH 1U30A 3BUPA 1I7RA 5IMOB 4H26B 3O3BB 2ZUYA 5DJZA 1TZGL 2EXSA 2IDSA 3MV9B 2EDFA 2CXGA 4UQBA 4HK3J 4JHWL 1RK1B 1E9QA 3ECQA 3O3DA 3KE0A 5I76B 5A16B 1OGAD 1JZEA 3R1GH 1BZ7B 3H0TA 1FVEB 4RBPH 5FW6A 2ERJB 1KCUL 5H37A 1ZTXE 4ZFQA 4ZMYA 2P8LA 4IK7A 4XP4L 4N0UA 1UWXK 3NJNA 1ZTMA 2KL7A 1UXSA 1UD4A 2NPLX 1FQ9C 3JWOL 3LJ3A 3QRGH 5IW6A 4HKBB 4JAMB 4IEFA 3IEAA 3BYTA 1RULH 3HBQA 4XX1G 1UT9A 2XZQL 4Z5RA 1OZUA 2BT8A 1JGIA 1RMFH 1IT9H 3HFMH 1PQZB 4KDWA 2BSFA 2BOKL 2JB6A 3TTYA 3MODL 2CO6B 4M5SA 1X9QA 1KXVC 1Y6KR 2YXFA 5DD0H 4FI6A 2DLGA 5JNYA 5A6IA 3OLIA 3SN6N 3LVTA 3U73A 2H32A 3L13A 4NN5C 5IB1A 3GCXE 2G0LA 1E4JA 3GDCA 2VISB 1KULA 1U8IB 1P5UB 1Z0MA 3AW5A 3OAYH 1I1YB 2JKRM 2BY1A 1GTFA 4YXLH 4HFUL 2FR4B 3Q2WA 3K8MA 5BV7H 3T65A 5ITFA 4OAWA 5AAWC 2IG2H 3ZY7A 3KHOA 3DARA 4PJAB 4IU2A 5E1IA 1EO8H 1MNNA 4Y1AA 4YHLL 2IANA 4KJPD 3MREB 4JL1A 5FYLH 2N0MA 2XG4A 3CFCL 2VN3A 3QHTC 1IQNL 3S35H 1NEPA 4NNXA 5F7YC 2IWFA 3GC3A 1F4XH 3U0PA 4G59C 2H6PB 3BI9X 4MSWA 2W2PE 1U3HB 3OKDB 4XBMA 1GCYA 1WAPA 2M8XA 4NO3B 4XPBL 4DEUA 5HHQB 1PZBA 1PSKL 1YUFA 2QFRA 1RZ8A 3P9WB 4KDTC 2JKLA 3KLAA 3ZUNC 1VRSA 4ZX3A 5C08B 2YPVL 2ICWA 4HGWB 4QYOA 1YMMA 1A66A 3DX9A 3MROA 4P59L 4F9PA 1NIAA 3P4MA 5FGCB 4XN7A 2NSXA 4DGVL 4KJPC 1YUHB 1IC7L 1FLTX 3QB7C 3CN0A 5CZKA 5TE6H 2W0LA 1C5CH 3DX6B 3AWEA 2G2NA 4PWHA 3P0GB 3KNBA 1MJUL 4AKPA 4F3FA 3SEPA 3V65B 3QXAA 2P5WB 1S3RA 4PJXE 3RFZB 3K6FA 2NTFA 2OJZL 3E6FA 3VUAA 4PVNA 3CZFB 4ZPVA 3TL5A 1IM9B 3DK2A 2YAQA 1I1AD 3O41A 3Q2VA 2BY0A 3BT1A 2FECI 5CN3A 1YEGL 1SLVA 5T5FA 2ARJB 2I07B 1ATDA 1QBLH 2AV7B 4EZKA 4CU8A 4UM9D 1O9ZA 3QIBD 3D1MC 3WFBL 2XPGB 1SJEA 3QFDA 1Q9WB 4RMVA 4LIQL 5DQ9A 3RWGB 5B38A 3UOAB 3DVNB 5IJKA 3IXAB 2AQPA 2X3CA 4QRQA 3CFKA 3IDIB 3O3EA 1F5WA 1OP5K 1LO5A 3GMMA 1LM8V 3I75B 1I1AC 3CHQA 3QJFB 3S4SG 1TIUA 1KXHA 1UZPA 1G4RA 1O6SB 2CR3A 2VUKA 1URKA 3BQUD 1DQDL 5F3BB 4HT1L 2DJSA 2DTSA 4CW1A 1RUPH 2WVTA 3AADB 4FQHB 1YEWA 1MLBB 3QIBC 4K15A 4ZUVA 3WS3A 2R15A 5GRYA 4A68A 1JV2A 5DYFA 2UZIH 5DRZB 1YZZA 3A67H 5INDB 3ULUE 4YAQA 1ZLWH 5IJBC 4NN6C 1J0KA 1T83C 1QRNB 4NI3A 4HBCL 5DRWB 4ZD3H 1BREA 1E2ZA 5KVDH 1RH8A 4PJDE 1BFOA 4MDRA 3BQUC 1A4KA 5CCJA 2JKTM 2GITA 3IRCA 4JG1H 2NLJB 3D2UD 4AL8C 3LKRB 4NM8H 5BOPA 3MRQB 1XL4A 4JFFD 2P24A 5F88B 2WWKT 3U7WH 2VWLL 2PLTA 5F0LB 5C09A 3MBEA 3EOTH 3X12B 1ETZA 1DQVA 2KYIA 1QW8A 3CQQA 1W0YT 2YARA 1E8WA 2R2EA 3CLFL 3O9WD 3CFQA 4R97B 1QYGH 2VQUA 2B4CL 3D18A 1VACB 4TSAH 4LHQB 2H9EC 4DOHE 5FM8A 4L3AA 4P3DB 5D7JA 2AEIT 5D7LD 4LU5L 4YN3A 1N0XH 5GHWH 4PGJA 4LLVB 3MRCB 1OZTG 3SD5A 4ELMB 4DPCX 1NFWB 1FYTD 5GGRB 5HGHB 4FQIL 3QCVH 5FYKL 4QHNB 3S7GA 4AYGA 2NDGA 1V10A 3QFJB 1L9PA 2XWJA 3O9WC 1HHGB 3ZTCC 4DZ8A 3EJZD 3ENEA 1XGRB 3GXPA 4N9GA 25C8L 3TURA 5MP6L 3KVDD 4Y5YC 2ESVB 4HIQA 3ARED 4XCNA 1BAGA 4UBDD 4G7YL 3CMGA 4WW1B 3FONB 1GSKA 4TQPA 5IFHL 3TBTB 4X83A 4CDHA 1J0YA 1SLXA 2P47B 2ZUXA 3BISA 3RU8H 4XVTH 2IALB 2VRQA 1R3KA 5EIIB 1DEEA 4ZX6A 2DQ6A 3ENSA 2OMXA 4GYBA 2X6VA 2WSPA 3D12B 2KLTA 1V5JA 2ZKXA 3EJZC 2ZXCA 4K9JA 4QRFA 3NJGA 3VWJB 1F18A 3AREC 4ZFGH 2HYMA 4UBDC 3GLAA 3VFRA 4KOCA 4LRIC 1NIFA 2DBLH 4X6BA 4UUJA 5J1TC 3PG2A 1T80A 4JN1H 3ZIMA 5HHOB 4HC1H 2J57A 2XWBB 3D0LA 4G8GD 4IBZA 3SGDI 2NZIA 2J1ZA 1H0DA 5EO0A 4YZWA 5C0EA 4LCCC 2VZOA 2WPKE 5F1NB 1A6WH 4ZYKA 2Z31C 3HE6A 4CSTA 3GZQA 1NEZA 4IIQB 4MD5B 5DK0A 3RWHB 4FQCL 5KBPA 2G3ZA 2A6JA 2UZYA 2N1TE 2V9RA 3FUNA 3SKMB 2JTYA 3VXUE 4I7ZC 1EAPA 1KBVA 4POUB 3TNMB 3ZE2F 3JV5A 1EH9A 1MWAL 1LMMA 3DTXB 4B3VA 4XWGL 1CLVA 3EYSH 3IETA 4QCIB 5FM4A 2CMRH 5F89B 1G7LB 4MNGA 4TUKL 5E2WL 4MRCA 5D2LE 1LE9A 1AVAA 2ETWA 3AT9A 1L3NA 4Z0XA 2BSBA 4GRLB 3PWNA 3CZEA 2ZUVA 3H2WA 4XC3L 5KTEL 4YOKA 3VE0B 1ZVYA 4RSVA 3C5ZD 5JHDE 4OCYL 3LSOA 2B08A 5FA3A 5EU5A 3CN2A 2EDEA 5E95B 2MCMA 3D06A 1J18A 3B34A 3KW7A 1JMXA 3IGKA 1M2VB 3EGXB 2XWDA 2BVOB 1I0UA 1KIRB 3U9UA 3VGHA 4K7PY 1HH9B 3MV9E 4LLQB 4FI7A 3U7UG 2RGSA 5LCVA 4JYVL 3U36A 4PV9B 1JL9A 2FLRL 5C6PB 1ZOXA 2BX5A 3N5AA 4NUGH 4U1LB 2A9ML 3C09C 5HY9A 3RNKA 4HYTB 3C5ZC 3ZQ9A 3DX7B 1RJZB 4PJHB 5T3XH 1RVFL 4G5ZH 1L6PA 1VLXA 1XH0A 3HNTL 2XC4L 1GGUA 1RL1A 2OS7A 2CR0A 4L8DB 1N1IA 2HKHL 4FCAA 5EA0L 3G6JE 3CK0L 3SSGA 4ABWA 1REIA 3TBVB 3JBG7 4EE2A 1U8CB 1DCLA 5I17B 4K9EC 2VAJA 4HQQL 1E42A 1Z9OA 1CGYA 1U3ZA 2FWOA 4UAHA 4YK4C 3KQCL 1TO5A 3MO1B 4RRPA 4XP6H 4MJ6B 5TD4A 3HS9A 4Y4FD 5ICXA 4NO2B 3MUUA 1EHLH 4COXA 1T2XA 1XF4A 2OMYA 3BW9A 4KKAD 4F1SA 1Z9SA 3ZE1E 1CL7I 3QIUB 3HO5A 3MA7B 5CP3A 1IIIA 2EDTA 2CDGB 4UQ2A 1MHPL 2OLDA 3G9AB 5EOQH 4RZCB 3WFZA 1BMGA 2WIIA 3GMNA 4P2QD 4KXAA 3ECBA 1FBIH 1IC5L 1CE1H 1M05B 1TENA 1KDJA 4KWUA 4FZEH 2IAMA 4Y4FC 2QKSA 2QTVA 1ZA3A 4MVBD 4AGPA 4KKAC 2VLJB 4GG8A 1MIMH 3QH0A 1SEBB 1I8MB 1ZV5A 2CGRH 4MLIA 3RVWD 3X3FH 1TQWA 3OTTA 1LEIA 1DQJB 4AV4A 4K8RL 1I1FA 2XV6B 1FIEA 3EGDB 2ODHA 1NPNA 5IVOA 3SDAA 1IAIL 5D71H 2BP5M 2ZXEB 3HI6H 5A2FA 5G4NA 4RETB 3S5YA 1GKEA 4MVBC 2K7PA 5I66A 1N7ML 1HOCB 3QUZB 2H0FA 3DSFH 3UAJC 5CJ5A 1IE5A 2PR4H 4LARH 1FE8L 3BIKB 5DJAA 2YD1A 4JJ5A 4M48L 1MW0A 2QGBA 2IMMA 5I71C 3ZRSA 4WU7A 5ISZA 2P5WE 3RVWC 3OKLB 4Z3FA 1H3TA 3BVXA 2VJ8A 5CSBA 5FGRA 3V4PL 4OGQC 1OB1C 5DUMH 2DQDL 5K1VA 2D31B 1HL4A 4OZFA 2GBTA 2R0WL 2CUIA 5LGJA 1IGXA 4JYUL 1XGQA 1OVZA 4HIJB 4DP4X 3IPBA 4WUUA 1HCGB 1KUMA 4XO5A 5B22A 2VXVL 1E5YA 1JI1A 1P4BL 1RZ7H 1ZHBA 5FYJL 4G8FB 4LGPB 4M93C 4KK6D 1CLZL 4UT9H 4Z7QF 5KYXB 1S7VA 5JVYA 1WFJA 1ITCA 5LXGH 1KJ2B 3KPRA 3REWB 5I74B 2NW3B 1KWKA 3QWQB 3Q1SL 5SX5H 1AZRA 2X0UA 2N01B 1NFDB 3B9DA 1KN2L 1AZBA 1NLDH 3LKOB 3ZTNL 4LPTA 1HJ7A 4XCYB 1SDDA 3VG9B 4I0PA 4QAMB 5AZEH 1PZDA 1QI4A 3FB7A 3FTSA 4KK6C 4UT7H 3VX1A 1MREL 2VL5A 5BJTA 4JO3L 4WFGD 3BPNC 3FFCA 3WNLA 5BNXD 2WINB 1OPOA 2AZAA 3OHXB 2DLHA 5L4JA 1A3RH 4HCRH 4YL9A 1D7BA 1TZIB 1T22A 1UT1A 5E2VH 4ECNA 4AYDC 1USZA 3PHAA 4HKJB 5E9NA 4FF9A 2H8PB 5D4HA 5E0FA 3S8FB 4A7SA 4MB3A 2F9BT 1ODAA 2VDLH 2VLKB 3I74A 4FLOA 2NY5L 4X4MA 3ZVVA 3B56A 3GSNL 3LRLA 1WFNA 5B3JE 1IQML 5SWSA 1E3ZA 2QPSA 1A7NL 1T2JA 4HS6B 5JW3H 2JNZA 3OWEA 3F00A 5HVWA 5HDQH 4ZH8B 3PAVA 1S7RA 1BF8A 3M1CA 4JB9H 4LMQE 1KB5B 4HFWB 1L7IL 3AACA 1IAOA 1J1PH 3B1UA 3QUKA 5I8OL 3KXFA 1EGFA 3LNIA 1YLBB 3ALWA 2Y0SA 4HH9B 3ZIYA 4U6VL 2GUYA 5GS2D 4DO4A 2WFTA 2CNYA 1MFDH 1MCFA 3EFFA 5LGHH 3BUYA 2IGFH 1MIEL 5DUJA 2XX0A 1KBGL 4PRNA 3L4XA 4CDGC 3U6RB 3LN1A 3R7QA 4MAYD 3UBFA 4JY5H 4CKQA 1F42A 3L9RB 3QFJE 2BSED 3EKCA 3H9YA 5EU3B 4UQEA 5HXMA 5IR1B 1I8AA 4X7FC 1BFVL 1JXKA 2G75A 3HS0B 1ES0B 3CC5B 3V9EA 3VFPB 1ULVA 5D7IA 3F5WA 5HDRA 1OP3H 3LXUX 3FS9A 3X13B 3QDJA 1IBDA 1NL0L 1W72L 4NQEB 5I1AA 2YMOA 3KGUA 1J0ZA 1A6AB 1OHZA 1N5AA 2MKLC 5CZVL 2PTTB 3VB9A 2XN9A 4X8GA 4TLTA 5I8KL 4MAYC 1QSFA 5HVGB 4HEMA 4OCSL 5DS8B 1OF0A 4GO6B 5K5YA 4L4VE 1LO0L 3H9SD 5ALBL 1NWOA 3EUDA 2XSKA 4TRPL 1A8ZA 5D9SB 3QAZB 3IGLA 1E6JH 2X0WA 1OAUH 1SHMA 4PBXA 5E1QA 5HYQB 4LSDA 2OYKA 5I1JL 3QNXB 1KLGA 5KN5B 3EJTA 1QR1A 1GJUA 3K71B 4HIIA 5FYLD 1V55B 1R5IB 4KV5F 4NFBA 4XB7A 4YFLF 2FNBA 2FLMA 2FJSA 3NJKA 4HBQA 4ZW6A 2WQVA 3LN5B 5C3LD 4OV6F 5BV7C 2GY7B 3BN9D 1G43A 5F8RC 4D9LH 3VD3A 4HPYH 5CJQL 4QJ4B 6COXA 2J6WA 1IVLA 2XRAL 3BPOB 4I9WE 5GZNA 2YXVA 3KBHE 1YO4A 1TETL 2C7UB 3FCBA 4HX1B 2XOTA 4ETYA 2C4FU 3TIEA 2PCYA 1RURL 2QADB 4ZXXL 2WLHA 4UDUA 4F8QA 3QYCA 3ISYA 2NY0B 1UFGA 2CRIA 4A6YH 4KQ0A 1WCBA 4PJ9D 2ZUQB 1KV3A 1DQLL 1ZEAH 4U1IA 4NBZB 5AB9A 2P5ED 3BN9C 5TF1L 3FB6B 5EFIA 2YSSA 4MDJB 3IJSB 1AC0A 2XXMB 2MNJB 4NWTH 3V2AR 4C4BA 2C3VB 4UB0L 5BRPA 2ZT9C 1WSST 3H7BB 1CFSA 2CJIB 4G7VH 3FQ4A 4FQLL 5AW5B 1LDPH 2RACA 3RGVB 3VD4A 4R96B 1E7UA 3ILQD 1EPFA 1U6AL 3ZQXA 4ONOA 3HC0A 3SW2A 3OX8B 4PJ9C 3ARQA 3SE4C 5CM1A 3GS0A 1P7QA 4XR8C 1B3JA 2VITB 1AGCA 2YGOA 3FH8A 2WCSA 1H3WM 1B0IA 1CZ8L 1IJQA 2EECA 2VDKB 4NJAL 2AF2A 2TRHA 1HHJB 2VR7A 3RWCB 3M07A 3UXFA 1CI5A 3MV01 5FGBC 4WDIB 4MNHB 3RL2A 3NQKA 3VXNA 4L2YA 1GVIA 3L3JB 2FD6A 3Q5OA 4ALAC 4NKMB 4JX0A 4PJHE 2XYBA 2OSWA 4OCXL 5JQHC 2WAHA 1YJDC 4QT5B 4JFYA 1QEWA 2R9HD 2R1YA 1KENL 1UHVA 2IFFL 1FNEB 1BM3H 3MRGB 4M7JL 4I88A 2G5BA 4OM1L 2QVKA 4ZO7A 4KNUA 4K5LA 3FB5A 4RGMB 1J8HD 1JD7A 5KSVB 1TCRB 4Y9FA 1HH6A 1FORL 3IE4A 4PLJD 3WKPA 4MJIB 4MA1B 5M7QA 3VRLE 2YHGA 1YNTF 3KJ6L 3LIZA 1OIOA 2R9HC 4LLUB 4FL4C 2ZP0T 4ZTPL 2JLPA 1KBWA 4LP4A 5J1AA 2WWOA 1DN2A 1LP9F 5BPPA 2HLFD 2CKBA 4CVZA 2ADXA 3U1QA 1T6VN 3V9FA 2C26A 2I60H 3P0YL 3QWOA 1L3YA 4PLJC 1OSEA 1BHGA 1DTUA 4GKNB 1RP8A 3NJXA 1D5IH 3VFMA 4M7LL 1EX0A 4TQ8A 3VXQB 1I53A 2IBZY 5CKNA 5E8EB 4X5WB 1PLBA 1VEPA 3PQYD 4POZD 4XO3A 5EDXA 1NGPL 2ADIA 2PW2B 2QHLA 5JQ6H 2VXQH 3O4OC 1LPKA 3ISRA 4AH2A 1P84J 1EVUA 3CUPB 3GHEH 1AQKH 2HLFC 3AT8A 3O2WL 2FGWL 4JQVA 4OF0A 4NKIH 5FOBA 3GQFA 3SOBB 5JW4M 2JIXA 1MRCL 1DUYA 2YRPA 4LNVA 4WFHD 2Q8AH 1BXAA 2X1XR 3LH9A 1OQOA 3S37L 2OL3B 1U33A 2WXHA 4PJBE 1URZA 2CKBL 2OMZB 2R56L 3DGDA 1RUQH 1LK2A 2C4FT 1F6AB 2WYHA 5IKTA 4C16A 2DWSA 1LO4H 4DCQB 2FZZL 1YY9D 2AMGA 2JCCB 3BAIA 4POZC 4MX7A 3F83A 3W0WA 1MG3C 1DVTA 3VXRB 12E8L 3HIZA 4N2OA 3BVUA 1IGFL 1RIVL 1ADQA 2DAVA 4HG4K 1WIPA 4OD3H 3BJLA 3OXSB 4OIBA 2WXQA 4X5XA 5IMLA 3W5MA 4S1SH 5DTFB 1TOXA 1MFMA 3FU7B 1WBYA 1YY9C 1YNKL 2OK0H 4OBSA 4UNTA 1QZ1A 1SQ2N 1R75A 2DQFA 1TTCA 2WWKO 3G6DH 3NGBB 1HEZA 2Q7YB 3GISX 5FKPA 5ANMB 4DEWA 5ILTH 1P7KB 4AIZA 3E80A 4QD2E 4LSVH 2AP2A 9PCYA 3ZQWA 5DJXA 1YNTA 3OSKA 1GS6X 4PYGA 4X6CB 1O7DC 4JFDE 3N8YA 5D1XB 3H42H 3HZMA 3R4DA 1NFDE 5CXPA 4GKZA 2X4OA 3LY6A 4X9FA 3IKKA 1IAKA 1S2EA 3ZO9A 2ADFL 4HV8A 1AS8A 3AU1B 4FQ1L 4YHZL 5BVJB 4Y7BB 2X4NB 2J25A 1C16A 4GAGL 2VC2L 2C1OA 2QEJA 3IFOB 3L5XL 4PJIA 1SBSL 5ICYA 3ROLB 1P6FA 2BLFA 4HUUA 5F72S 5DZ9A 1F2QA 2OYLA 3ZDYF 4EAEA 2EIZA 4DAGH 3OKYA 4EN3B 1CXHA 3GB7B 1J5HA 3TJPA 1FJ1B 3O45B 4NP4H 4WLCA 1M9SA 4GQ9L 2XZCL 1ORSA 3B43A 2DMGA 5C08D 2R51A 4XH2B 5KBLA 1IEBA 4B9IA 1XR8A 2Q7AA 1IGTB 5F9OH 5GGUA 2RFXA 1ACXA 2UYLA 3PDDA 2DQJL 4N3UA 5K9QG 5DRNB 1KTKE 3NTCL 4YO0A 3T2QA 2DQGL 3U0TA 3IXTB 5KVGE 2OM5A 3MLUH 2BMKA 3BH8B 1BBJA 2Y7LA 4YEEA 2IVFC 3SBQA 3MV8B 2AKRA 4H25A 5CP7A 1XIWA 3EG9B 3UTSA 1LEGA 1GYAA 1IM9D 1KLFA 1TQTA 1N6QH 1R9FA 2PYEB 4Y76B 2J72A 4Y9BA 5JIMA 1PX3A 2IPTH 3U9WA 3RTQD 4ANXA 5FPIA 2BSSB 2DMKA 2WLKA 2ZJSL 2YUVA 4J2XA 3V52H 4ODUB 1DBAL 2H26A 4V1DE 3NIGE 4DP2X 4HHGA 1TNMA 2VQTA 4GSUA 4HUXB 4XOBA 3O6LH 2WSDA 3SYAA 5HGDB 2BOLA 4B53A 3RFZC 1Z2KA 2GCYA 2XYCA 1DCEA 1JWMA 1QLEH 5LAXB 1HJCA 2A77L 1VZGA 3LS5L 4FRWA 4YJZL 5IOPB 3DXAA 4CJ1A 4OLVH 3KPPA 5EZIH 4WHCA 3PGCB 4JANA 5ADPH 1AR1B 1PLAA 1BAWA 4NQEE 1NMBH 4LQ1A 5TK4A 4FMFA 2AQ1A 4IRZH 3RTQC 5A40E 2Q86B 2ZXQA 5IJDC 3IKCB 1EV2E 4LL1A 3TFKD 4DN3H 4LORA 2X1OA 5EDSA 5L7XH 2H2PD 2NW2B 5L8KB 4CSPA 1PKOA 4LCWB 1N12A 4Z8FL 1DZ0A 4HF5L 4YHIA 3QG6B 4DKAA 1R5VB 3BAXA 4Q6IA 1ZMYA 2Q76A 3OKEB 3ZK0A 1JPFB 1QRND 4AYFA 2FX8H 4CC0A 4Z76B 4QF1A 5FFOA 4ZOBA 2PWEA 2WXKA 4UOW0 2WLIB 2EVGA 1GC1L 2Q1EA 4YSUA 1MH5A 4EUPA 4RUTA 2M2DA 5T1LB 4C4UA 4U31A 3TFKC 2NT0A 5JVZA 1FV1B 1AGBB 1M6OA 2H2PC 4HGKC 4P57B 4KNSA 1HS6A 2F53B 1JTTA 2VZ3A 1N3NA 4NQXA 2R0KH 1VPOH 4G6KL 2CPCA 1OE1A 1GGBH 5KYYB 1UACL 3INUL 1CLYL 3BP6B 3MFFB 2IH3A 3MV7E 3WNPA 1DVFA 2J95B 2OFQA 3O0RL 1OM9A 1VZIA 5E8NB 1N2RA 2BCKB 4GI8A 3O6FB 4HUCA 2WXOA 3NJVA 2WB7A 2O6EA 3MGTB 4PRPE 2ZQKA 2X4PB 3BZEB 3ULSB 4G6JH 5EV7A 2FH8A 4LRNL 1KMGA 5CISA 1UZ8B 4PRAA 3RIKA 4KZEL 3C60D 4Y7MA 1AQDA 5I6PA 4MXWH 4L0YA 1DHKA 4HWEH 4O2FB 1X5YA 3WKML 5JHLA 2AC0A 1GGIL 4B60A 4QNPE 1IMHC 5BRZA 1T4KA 4TULL 3SOBH 3DX2A 1MCRA 2RD0A 4BCYA 3BLKA 4X4YA 2W80C 4LF3A 3EYVB 1FNGB 1ZS2A 2ESVD 3V0FA 4BXSV 4MD0B 3HZKB 3OGOE 1BSIA 4GOSA 4L4TB 2FQDA 1OP4A 1SXZA 3VFOB 3C60C 4NENB 1CICB 3WFDL 1AI1H 4TUOB 3Q2LA 1HT5A 3VDBA 4M6ML 3CFWA 4M7ZB 4BZ1A 4HOXA 3UJTL 3CU1A 2Y06H 4HZAA 4EBQH 3SQOL 3ZHKA 4M1DL 5TFSH 5I5JA 5FWQA 4EDXB 1INEL 3VWJD 4BV1A 3KL6B 3V0WH 3KPMA 5EUOA 3OAZH 2EVJA 4G80A 1BIIA 5PCYA 1AOZA 2DLTA 3HZVA 1CIDA 1JNHA 5HHOD 3O2DH 4LASL 3L4YA 5F7LB 4OZIE 4HKZA 4YXKL 1PAMA 1U8PA 1EBPA 5IHZA 2ATPA 5DJ6A 1YPZE 3IJHA 3ARBA 3SKNA 2XWRA 3J2PA 2X4TA 3MRIA 1HXMB 3VWJC 1HQ4A 5HGAA 4WJG3 3VA2C 1MCPL 4NZUH 1SJHA 4WJKB 5CEZL 1O75A 3H53A 1V3MA 3OXRB 3DO4A 4A2GA 3TVMA 2VWMK 4AZ8B 4YDZA 1OF2A 3V5KB 4URKA 5I0DA 3PDOA 4FHKA 4OLWL 1X5FA 3P77A 3MRNB 3QVAA 1R47A 3SJVA 1PD6A 3QQ9D 2NY4D 1X6LA 4H8WC 1EK3A 4NQSA 3UBGA 4JO4H 1NKOA 4IIQC 5E7BA 1UWEL 3NCJH 4KI5F 4Z77A 3AS2A 3GSVA 4BKLB 2J2ZB 2FATL 3TH3T 2HMIC 1JNNH 4PJFF 5FV1L 4QHMA 2DF3A 2BNRD 1THCA 2W3IB 2AJZA 3KMDA 4GRLD 2DQEH 4Z7UA 2UWEB 5BS0A 1PY4A 3PAUA 4U1NB 3OMIB 3S34L 4ZMAT 5LG6A 4LK4A 1XAKA 2P1YA 4NG9L 1O6VA 3U6XA 3W3BA 3MNVB 4WI9A 2KQMA 3DO7A 3ETBJ 2NY4C 5B39B 2PETA 5CSGA 4DESA 4AI7A 5DEFA 2G4EA 2ZXWB 2FH6A 3MQEA 3CJJA 1FNHA 3SGEI 1MCLA 2XXGA 1EZLA 2FWUA 2D7NA 4KPHH 1S5HB 1SJXA 2EEFA 4K5OA 5T1MA 4D0BB 1J0JA 3VSUA 5CZRA 1I7RB 4IKJA 3CXDH 4YDKL 2BIOA 3M8OH 2EEDA 5DJZB 5D7HA 1RPUA 5IKVA 4QRPE 5J0BA 3LNEA 4ZK8A 4MJHA 3KLDA 1HKFA 2F8VA 3HRZA 5EIIG 3ATEA 1E9QB 3BSGA 3O3DB 3THML 4D9QE 1OEZW 1V27A 2BNQA 4E9XA 4M3JA 5ITBL 5JBAE 1ZPLA 2JF1A 5AUMA 4F7MA 2A74C 3H0TB 1JZHA 3KLQA 1CQKA 2P8PB 1N64H 1XSIA 3WTUA 2P8LB 4LDCA 1CBVH 4N0UB 5IFAL 5C07E 2MCAA 2L7EA 2G4GA 2KDYA 2P8MA 4J4PA 1O5DT 1N0LA 1HAWA 4IEFB 3CFNA 4HIHA 5HJ3A 5ANME 3TYGH 4Z5RB 4BGDA 3L4WA 3QIUD 1A3QA 5C0FA 1M7UA 5AZ2L 4JFVA 2WSKA 4E0RA 1G2MB 3LQMA 2KH2B 3Q9PA 3MJWA 3BUBA 5E8DH 2H32B 2CNZA 3G5XA 1N70A 4OJDH 4KRNA 5D1XE 4HUWA 1BQKA 3OKOA 3IJ9A 2IBBA 1UADC 3NZHH 3TFBA 2W0FA 4P9HL 1ZANH 3K8KA 3BKYH 1GGCL 4O2EB 3T65B 1Q1PA 4HWBA 5ITFB 4OAWB 2VLJD 5FWRA 1OSPH 2R23A 2WNXA 3QIUC 1MRFH 3P3YA 3C8HA 1KXQE 3QRFM 2LAGB 5E1HB 4GBXC 4Y1AB 1KEML 1KBPA 5F7UA 2F7OA 3T8XA 4L8CA 1Y6NR 3IDYC 2B0SH 3EJCA 3F7VA 2BFGA 2O5NA 2GJ6A 4DQOH 2JLLA 3LH2L 3ZHLA 1I3GL 1LK3L 1P5VA 1FZMA 2VO8A 1JGLH 4ZAEB 3N2JA 3U0PB 4G2AA 3V0GA 2ENJA 3NJMA 1HHIB 1MWOA 3IAPA 3TBWB 3TNNA 1OAJA 4GINA 4U6XA 5KWYC 3QUZD 1UD2A 2EEXA 3AJ7A 3SOTA 2W38A 5L2KE 1MRDL 2HZHA 4Z7VE 3QEGL 2WO2B 1BD2A 1YMMB 3CVHA 1IZKA 3DX9B 3MROB 1PKQA 4QHLA 3V8OA 1PAZA 4F24A 5AWNL 1F1GA 3P4MB 4XCCL 5ACMA 3MU3A 4WI6A 3DLQR 1RU9L 4WEMB 3MRKA 1M6UA 2VERA 1JVKA 2WYIA 4MD4A 3UTQA 1N8OE 4NM4H 4M6NL 4NNPH 3KNBB 5TQ0H 3PGFL 4TV3A 4F3FB 1EXUA 1KJMA 4M1GL 1FF5A 2NTFB 3QUZC 3A6BH 1BXXA 3E6FB 4LOFA 1QABA 3OLEA 4DN4L 4CGTA 2OR9L 4ZPVB 1FJSL 1F90L 2EC8A 3BX7C 4MJ4A 3O41B 4TQIA 4EIBA 5FLUA 1EWHA 2WNGA 4GSDL 3RYMA 1WS7A 3TJEL 3WN6A 5JOFB 3WY2A 4DGYL 1FF7A 1J9CL 2W9DL 3QR0A 1H6FA 3GXMA 1SJEB 2AK1H 3ZPDA 5DQ9B 5B38B 1TR7A 4BELD 3S97C 3CFKB 1CFVL 3NFPA 1B2WL 1A6UL 1LO5B 3T0WA 1YEJH 1CF1A 3BKML 2NNFA 1MQ6L 3RUGA 1FH5L 3B2VL 3FQRA 4O58L 1E7VA 5JR1H 4HJTA 4CC4A 5J11B 3ECVA 2DQUL 3GXNA 4QRSA 4XXWA 4XNQA 5ECJE 4ZUVB 5I74C 2KPNA 4OI9A 1JV2B 1NOLA 2H1LM 4YFLI 1F6LL 5FC9A 4NO0A 3H9HB 4WO0A 3SBWC 3VI4F 2Y5TB 5CD3A 4YAQB 5F7HA 1RUKL 1QFWH 2Y3NA 5IGXH 1I75A 4PJEF 4W70A 4AEHH 2VAAA 2QGDA 2H47C 1BFOB 3LQAH 2VLKD 4G42A 4JRWA 2RBLA 3KPSE 3ML9A 1A4KB 4RA0C 3T4YA 5IF0A 3DIFA 5E94A 4PG9B 2C3WA 2GITB 3L6FA 3T6XA 4DZBA 3WS6C 3LIUA 3OHXC 3GSWA 2FJHA 3HS6A 4HUKB 5FO8A 2P24B 2R29H 1SUHA 3EO9H 4PJ7E 5BZDA 3WUWA 5C8JA 4ZNEE 5C09B 3MBEB 3GI8H 1ETZB 3UDWC 1TZGH 4Y79B