2YGPA

Wif domain-egf-like domain 1 met77trp of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
174
Chain Sequence
TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRWPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords WNT INHIBITORY FACTOR 1
total genus 30
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygpA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygpA01
2VWLL 2P3UA 2G00L 3NJPC 1HAFA 5IKTA 2P26A 3KQDL 3LIWB 1CCFA 1G1RA 1HT8A 4CUEA 2BMGA 1FFMA 2F9BL 1DX5I 2KB9A 3N8VA 4ISIL 1ATDA 1HAEA 1COUA 2P95L 1EAIC 3LN0A 5FDQA 1O5DL 1CEJA 5F1AA 3HO4A 3H5CB 3F6UL 4RUTA 1NFYB 1Z6CA 5L2YL 2WPLE 3QCWA 2Y7ZB 4BXWA 4CUDA 2D1JB 1CQEA 2UWOB 3TBDA 1ATAA 4Y7AB 1XKBA 4FM5A 3U7UG 2AYLA 1N7DA 2ADXA 2J95B 2XC0L 4C16A 2P3FL 1IVOC 1EPHA 2W2QE 3ZYJB 5L30L 2VWOL 2Y38A 3MDLA 1KLJL 1X7AL 5CKNA 5COXA 2BOUA 1IQML 1PRHA 3V64C 4XL1A 2WPKE 3QMOA 2XBXL 1TPGA 2P93L 1JV2B 1NQLB 1WU1B 1NFUB 5CKMA 4X8SL 1JBUL 3HO3A 2VVVL 2J4IB 3OLTA 1WHFA 4Z0KB 3SOQA 1KLIL 1CX2A 1G1TA 1EPGA 3TK6B 2FD6A 3GCXE 2P3TA 1GK5A 1KIGL 3FBYA 2JKHL 3RR3A 1B9WA 3TK5B 2VH6B 4A7IA 5CKQA 1IQIL 1HRFA 2EI6B 2BQWA 1EPIA 3FFGL 1C5MF 4CUFA 1L5GB 2Y81B 1EZQB 3LN1A 1I0UA 2P16L 1IP0A 2FLBL 3KCGL 3M36L 3GISX 2XC5L 3TZIA 2W2PE 3Q3KB 1IQLL 4Y79B 4M10A 2K2TA 1NZIA 1XKAL 4ZH8B 3KK6A 1CCVA 2WG3C 4O02B 2PUQL 1P0SL 2D3JA 4Y7BB 2WPHE 1URKA 4YT7L 5JVYA 2Y80B 4Z0LA 1YO8A 2K2SB 3SW2A 3HS5A 3BT1A 4D90A 2VWMK 1Z6EL 2TGFA 4NGAL 5JB8E 2W86A 2WPJE 3KQCL 4ISHL 2BO2A 4Y76B 2RHPA 1UZQA 1FAXL 2WYJB 2YGPA 3BPSE 1Q4GA 2FZZL 3PGHA 1G2LB 1BF9A 4OTJA 1HT5A 3EGFA 1LPKA 1L3YA 3IITB 4CSYA 4RRZA 2BQ7A 4BDWA 2VJ3A 2P94L 1HJ7A 3KRKA 1JL9A 5JVZA 2UWLB 3Q7DA 2KL7A 4MMZB 3N8XA 3N8YB 1W7XL 4ZHAB 1PXXA 3FCSB 1ATBA 2BOXA 2W2OE 2YGQA 4JZDL 1V3XB 1EMOA 4JZFL 1KLOA 4ZAEB 3ZYGA 4BTUA 1UZPA 2YGOA 2J94B 1G1QA 1FAKL 3HS7A 1IJQA 1APOA 2WFTA 1APQA 1YUGA 3BT2A 3SOVA 2I9BA 1MQ5L 1U67A 4LORA 4NA9L 1XFEA 5JW1A 1ADXA 3ELAL 1WHEA 4X8VL 2EI7B 4BXSA 3V65B 1IGXA 2FLGA 2J38B 4RRXA 2BZ6L 4O1ZA 1FE2A 1F7EA 1IQJL 5IKVA 4ZXXL 1K36A 1DQBA 5I46L 1TOZA 2KV4A 1EPJA 3HPTA 3KQEL 2XC4L 4XLWA 1CVUA 4JZEL 2CJIB 4AQTA 2W26B 5CISA 1IOEL 5KIRA 1UZJA 2VVUL 5JBBE 3HO5A 2MHPA 1F0SB 3DEMA 4BTTA 1J9CL 2WPME 2XBWL 2BQ6A 3C9AC 3ASIA 4RRWA 5EGMB 3U73A 1MOXC 2GD4A 1M1XB 2VVCK 1A3PA 2I9AA 2WYGB 1HREA 5JBCE 1EQHA 1F7MA 1IQEL 3TGFA 1PFXL 2M74A 3LTGD 2YGNA 1DDXA 3LAQA 3KQBL 1NFXB 2RNLA 1AUTL 3CS7L 1SZBA 3CFWA 4BDXA 1IOXA 2DDUA 2Y5GL 1FF7A 2Y5HL 1P9JA 1RFNB 4X8UL 4NG9L 1ZAQA 4ZXYL 3N8YA 2W2ME 2P3FN 1F0RB 2PHBB 2W2NE 1IQGL 4X8TL 1LQDA 2B7DL 1UZKA 1LMJA 1OB1C 2EI8B 5JB9E 2OYEP 1NFWB 1YUFA 1DIYA 5F19A 2BOHA 2VH0B 1KSNB 3K9XA 3R05A 2P28B 1PTHA 3N8WB 1IQKL 1EBVA 2J34B 1HCGB 1NPEB 1IQNL 4YT6L 3HS6A 2Y7XB 1IGZA 4COXA 2J2UB 4MMYB 1MQ6L 3NTBA 4E1GA 2Y82B 4LMFA 3TH3L 4JYVL 2OYUP 1IQHL 6COXA 1QFKL 5JBAE 1G2MB 3LC3B 1N1IA 3GCWE 1IQFL 3M37L 1FJSL 4D0FA 1EQGA 1NT0A 2VWNL 3IJEB 4JYUL 1ATEA 2MGPA 4TGFA 5KN5C 2MGRA 3ENSA 3N8ZA 2FLRL 2UWPB 2W3IB 5IKQA 2PR3B 3CA7A 3CENL 3POYA 4RS0A 3QH0A 5L2ZL 3NT1A 1U8CB 5K0HB 4RRYA 3MQEA 2XBYL 3LC5B 2Y5FL 1W8BL 4M11A 2NPRA 4XBMA 4OTYA 4Y71B 2WG4B 2W3KB 3N8WA 2BOKL 2WPIE 1LPZA 3P5BL 4G1MB 3F1SB 3LTFB 1PGEA 4YZUB 1K37A 2WFXB 4BTIA 4D0EA 5E8DA 2RA0L 4Z6AL 1CVWL 1YGCL 4Y6DB 2XBVL 1DVAL 1XDTR 3OLUA 3NTGA 1EGFA 4PH9A 1EMNA 1LPGA 1HZ8A 1HX2A 3SOBB 1TLEA 2H9EL 3KL6B 1YUKB 3ZYIB 1FSBA 1G1SA 5IKRA 4MMXB 2Q1JB
chains in the Genus database with same CATH superfamily
3IMWA 3VXSB 2G00L 3NJPC 4WNSA 4N8CH 3TBSB 4AEFA 3MI6A 2QBWA 4GRMA 1M3JA 4WK0B 1QMUA 3BZDA 4N0UA 5DHYB 2R0LH 2OSYA 4UT6L 4ZOBA 1TVDA 1CI5A 1UA6L 2OX5B 4N22A 2K78A 4MB1A 1IAKB 3US9A 1K5NA 3KJ6H 1BQRA 3GRBA 4GRMB 5LVEA 4NZRH 2NY2B 4GP5B 1XZWA 2VQ1A 3RAJL 4KQ4L 3PWPD 1G0DA 1QHOA 3RPKA 2PYEB 4CW1A 4X5RA 1E43A 1MI5D 1QSFB 1NFYB 1TZHB 2G3NA 4OFDA 4L5FH 4YFLI 3B7TA 5F0PB 2R0WH 1Z1WA 2X89A 5JMOC 1NBCA 5IJDC 3KVPA 1L0XA 5F7UA 5I30L 1MWAA 3CN2A 1KBGL 1H6TA 1FYTD 3C8KA 3OG4B 3GHEL 3ORJA 5AYTA 4NFDA 3W39B 5IB2A 1A9BB 3UP6A 2XG4A 4XCFL 1R3HA 4G72B 3ROLB 1KWGA 4ZPVB 3JVFC 3ZT7A 3IAGC 2N7BA 3V9EA 5IJVA 4P23A 2BP3A 3N41B 1B9KA 1CN4A 3CZSA 3VB8A 5AVTB 3VQ2C 3LRMA 2B4CL 3AU1A 1G1KA 5F88A 3QI9C 4OZFH 3Q9PA 3LPGA 3MVSA 1B4JH 1X4YA 3HC4L 3I50L 4R2GC 3BZEB 4P48A 3OZLA 3WNPA 1PRHA 3VI4A 3R4RA 2W8CA 4WJKB 3S34H 4CSTA 1WGVA 3S96A 5JYLA 5DJ8A 2R8SH 1OAYL 1E6OH 1C7SA 5I1DB 5L2KA 2LVCA 3A4DA 4RGMB 1JBUL 4LCCB 1JNJA 2D73A 1WEJH 1A6UL 1SXAA 3OLTA 1X5XA 1VACA 3IFNH 1RAMA 4GEIA 5CLTA 1NFDA 4QUOA 3FBQA 1L0PA 3TK5B 1NC2A 2P24B 1GGCL 4LB8A 4I2XE 1HRFA 3HN5A 3V4VL 1ZVSB 3WD5L 1S7VB 1EHXA 2JKLA 2C9RA 4KY1H 1OP9A 4M1GH 4ODSL 1S3RA 5AYUL 3JTSA 1S7RA 1XH0A 4AG4H 2WKGA 1GJUA 2EYTA 1NCHA 2F18A 1KB5L 4ZMXA 3QCUH 1KY7A 1VGKA 2RGSA 4N8UA 4M5ZH 1QLEL 1I8AA 3SE9H 1ZHLB 2OTUA 2KPNA 1PIGA 1OL0A 2HUHA 1WZMA 1QOKA 4QMEA 1WG3A 2HT2C 3PWNB 4AH2B 1JV5B 1J8SA 2BHZA 2WLZA 3HS0B 1TZOA 1IQLL 1XZ0B 3HAEB 5ABAA 4OCRL 2FSEB 1RZ8B 1UWFA 2Y36H 2DV6A 1BZ7B 1SDDA 4S1RL 5DHYA 5IY5B 3V4UH 4BH7B 5JIMA 4I3GA 2PUQL 1B3IA 5M94B 1I1YA 2DL9A 3TN0C 2A9NH 4WO0A 3FDWA 2IH3B 2A9DA 2YBRA 5EV7A 4DGVL 4XVJL 3ATBA 1ZV5A 4I0PC 4POZC 4RRPG 5DDHA 5IEKB 1F42A 5C6TL 1MJJB 2WW8A 4MB4A 3H0TB 3LKSA 3VWJB 3CMGA 3JWDL 1MNNA 2BLFA 5DJ2B 1B4RA 3DK2A 2VDKB 4QOKB 3WS3B 5I1CH 1RHFA 4K2UL 1R5WB 2G0KA 2NXZD 1UYWL 3UAAA 1UM6L 2IANA 2NY0C 1NINA 5DMKB 5E70A 2DH2A 2Z7YA 3PAUA 4UIKL 1KY6A 5ALCL 3UG5A 1PY9A 1INDH 2BOCA 1QUNB 4JFTA 3BJLA 4Z0BL 3DI3B 1B0GA 4M6OL 3UC0L 1B90A 1E6JL 2AXJA 1DEDA 1WVZA 2AK4B 3OF6A 3PAZA 4P46D 4R3SB 1VPOL 2CPCA 4GUQA 1PW3A 4HUVA 3LIZL 3FUHA 4R4BA 3WLWD 3PGCB 2FWLB 4G7QB 1QBAA 4QRPA 4YSRA 4UV7L 3OBAA 3W56A 1BZQK 4S10A 4WFHE 5D1ZC 5KWYC 1QATA 2H9GA 1MG3C 2K3TA 4RA3A 5E8EA 3O6FC 3B5TA 3I6LE 4PS7A 1U93A 4KKQA 5C6PB 2DKSA 5HYIA 2BSRA 1AYOA 1F2QA 3S0PA 1UD6A 4U6HB 4LSVL 4NENA 4ZTOL 1S46A 3QRGH 4FP8L 2ZIDA 3TCLB 3VYNA 5KBNC 1NCUA 4PH8A 1KLOA 4UAHA 4NSKB 3BGAA 3ZYGA 3MN8A 4DEPB 1D5IH 3IJHA 3MREB 3KYOB 2C3WA 5MP6L 2NMSA 5FUCE 2IAMD 1CGWA 3NQKA 1LO4L 3GJEA 4LBEA 3UDWC 3V4VB 3QNZA 4FZ8L 1IM3D 1KGCD 3NFPB 5HTSA 1TQBC 3ZVVA 1KV7A 3ZDZF 1G1QA 3KEHA 2BSSA 4XN8A 1NMAL 5CCKL 1MFNA 1ETZA 3SE4C 4XN2A 1XD0A 3HR6A 2XV6B 5CILH 5FDYA 3HS7A 4CADA 4XO9A 5F7NC 1OD7A 2CA3A 3H42L 2MQGA 4NN7C 4ZZKA 4PJBA 4OJFL 1BAFL 1YUHA 1IFRA 3UAJD 2DQHH 1MCSA 4G9FB 2WZ6A 3RGVA 3M45A 4RA0C 4ZTPL 4JDTL 1CFVL 3OHXA 2NYYD 4H26A 4BYHA 4L1SA 3RNKB 4N2AA 4GLRI 2JJSA 1U36A 4G8GB 4RMUA 1D5ZB 3B9EA 3V6OE 2HKHH 5JNYA 1QVOA 2IANE 3ERXA 3CK0L 4Q9QL 1N3NA 2ESVB 1E4JA 1OSPL 1PKQB 4OFYA 4D7PA 2J38B 1CR9H 5DXWA 1RJZB 2XA8H 5C09A 5HDQL 4ODTH 4J3WA 1YY9D 43C9B 3LNHA 3MV9B 2XWTA 4P2RE 3I2CH 3ZL4H 2X89D 3AY2A 4LOFA 1OZUA 1UADC 2OMWB 1XSOA 1RLWA 4K23H 1AACA 3FOMB 1FDLL 1HN1A 2EIJB 3MJ9A 4OUUB 5JORA 1VA9A 3CLFL 4DP8X 1J05A 3O4LE 4XCEA 3U6RB 4NQVB 4FNUA 4LLMA 2AK1L 2B16A 5AW3B 5C09D 2OXGA 3G6DL 43C9A 5CFHA 1J1XH 5CGYC 2OR9L 3OC5A 4QOKE 4XPTH 4DP4X 2BNRD 3L9RB 2JJSC 5IFJA 4R4ND 3RVUC 4XCYA 5I5MA 2RB8A 2ZCHL 4LSRH 5CNHA 5EOTA 4IIQA 1HH6B 3OQ3B 3MV7D 3IXAA 3Q2VA 1NCGA 5T33L 1BBJA 5HHOA 4NX0A 1YDPA 4WY7H 2CLVB 3SKMA 4P3DA 4Q2ZB 2BNRA 3RZCB 2GJRA 3VAEA 2GD4A 3P9LA 5FK9A 3BH8B 1JZ8A 2EKSB 2EO1A 5DUPL 2AXGB 2NX5E 2FGZA 3TASA 1E42A 2YD8A 2V5MA 2I9AA 3QG6A 1M9SA 1EBPA 3VG9C 2PW1A 2LAAA 4XP1L 1IQEL 4MNQB 4JAMA 1AP2A 4XNXL 4GG6B 2WBJC 3VD0A 1AIZA 3ELQA 2XV0A 3EJYD 4RNRB 4Y5XB 5TE7L 3U6XS 4JGMA 4WDIB 3C9NA 4Y1SA 4D9LL 3OL2A 3FT3B 4V11A 4HX1A 3M1BA 3DSFH 1UFGA 5EUKA 1LE5A 4HCRH 1AXTH 2P5PA 1IOXA 3HMWL 3L2LA 1TVHB 4WTXA 4ZTOH 1BYNA 1NEZG 2FGWH 2Y3AA 1I7UB 2IDTA 1AR2A 2ZOOA 5EN2A 1MZYA 1ORSA 3WTSA 3CHSA 3VI4E 2F5AL 3DJTA 4X8UL 4HWBA 3GBDA 1EJ8A 3QULA 4O4YL 1ZAQA 4UV4L 1S5HB 4QAWA 3RJQB 1BMGA 4IU3A 5C7XH 1UZ8B 2AZAA 5D7LA 3QCTH 4YSSA 1QYGL 3BPLB 3NABH 4U3SA 2CDGA 5DJYA 1UD2A 3VXUD 2CLZA 3EYUL 3CHQA 3HG1D 4UINL 4JFFE 4YHLH 4FADA 2BOHA 1ED3A 2QMKA 1IBFA 3CPUA 4MNQA 3WKPA 2CIIB 3N8WB 3D8MA 2BWDA 2BSTB 5SWZE 1EBVA 4HHAB 1H3TA 2W60A 4LL4A 4WI3A 4F15B 2L7JA 1VRSA 1M2VB 3LXUX 3OPZL 3QIBA 2OTWA 2P7TA 4XE0A 1F3JB 1TFHA 4GP4B 2LU7A 4B5ZA 4N8VG 4PEEA 4ALAL 4ZS7H 3O6FB 1E3FA 2ZG3A 1BA9A 4X4ME 3M1OA 5I1CL 3K2MC 3MV9E 1T7VA 4MAZA 2DPKA 4U6VH 4YEFA 4XXCC 3KPMB 4KXZH 1JPTL 4OLZL 1R46A 2E9GA 3L3OA 1QSEA 4Z76B 4G83A 3HLAA 4OCNC 4IOIB 1N1IA 4A7QA 5BOJA 2NR6A 4ZS7L 1JHLH 5F93C 1IC0A 3QUMB 1I1FA 4RMBA 2PP8A 3FCUB 3BPOC 1NT0A 3B2XA 3S36L 3UBXB 5C07D 4L8DA 3CSYA 1WPCA 2W9EL 2O5XL 1J05B 4XCEB 3VRLF 4Z7VA 1NCCH 3NBNA 3MFFA 3RIAF 1DVUA 1PSKH 2OMTB 4LMQI 5FUZH 4PJ9A 5BOPA 4JRXD 3U4AA 1NCDL 4QKTA 3F7PC 5FYLL 1A0QL 4NN7B 4KZCA 5D96B 4XH2B 2R1YA 6FABL 4OCWH 4I5BB 5BOZG 4AEHH 2NSQA 4AOFA 4C4KO 2B1HH 1GC1L 3LNIA 3W0WB 1HKLL 1SNRA 4NO5B 2X28A 1SY6H 2JK5A 1YDPB 3SKMB 4KVCL 4TN9A 4C4KT 2NYZA 5D5MF 4QHMB 4PRDA 1LPZA 1I8LC 2R51A 3CCHA 1T6WA 3P0VL 3DGDA 5HDLA 5C0BD 3ZR5A 1I85A 4ES9A 1XCQA 2FGWL 4CVZB 4OZFA 4ONHA 3RYMA 1GL4B 5EZJB 1E7VA 3O3UN 4GAJL 5JW4M 1EGFA 2HVJA 1OOWA 1EBAA 2FZ3A 4IIZA 3K72B 4PS4H 1NSNL 3K8LA 3VRLE 1SHXA 1EMNA 1BBDH 3LZNA 3MGOA 5EFIA 1NFIA 3VFMB 5BUPA 1A6UH 1QWHA 4JG9A 1QIUA 2ZXWB 5DS8B 5AZUA 3KDMA 1P1ZA 1V7NL 4TULL 4CSSA 2CO4A 5FO7A 5DC2A 2YC1A 5F72S 4EI5B 5INDB 5IKRA 1E2VA 1VZIA 2XWDA 3OR7B 4LARH 5B39A 5K9JL 4KZDL 2BRRL 3VI3A 4X4XB 1N5AB 3FMGL 5FKPB 3K6DA 4XVOA 1KCLA 1RZGA 4C55A 1PEWA 4MDJB 3ECWA 4LU5H 3FJTA 1HSAA 4XT1C 1XEDA 3EGDB 4D94A 4RWHA 4ADJA 4MKMA 3TEUA 2F53A 3QJXA 4E41B 3D39A 1RUQH 2CM6A 2E47A 3D69B 2KB9A 3FO0H 2IALA 4AM0B 1CLVA 2VZ3A 3QAZC 3SKUD 4OCLC 5F7WC 1F4XL 1TZGH 4QRPB 3H7LA 3FUJA 2HRHA 3G6DH 1V55B 3TIEA 3WO3B 1FRGH 3LNFA 5E6IB 5IQ9A 4OIAA 5DMJB 5F1AA 1WC7A 3L3GA 3GQFA 1MKFA 4QY8B 1XAUA 4PBVC 4RUTA 4EEEA 5ESAA 1ZVHA 1B88A 2DQJL 3F6LA 4LOUC 1SXNA 1TIUA 1FFOA 4NRZB 3QXDA 2GJ6E 4A39A 3QIBC 2YWYA 3RVXC 3WMQA 1T1YB 5A2FA 1U58B 4KDVA 2EICA 3PJSB 5DUBA 2A1WH 3WKMH 3AB0B 4H88H 2PABA 4YH6A 1OXYA 4Q9BA 4Z7WA 1F5WA 3KLKA 5EO1B 3I6SA 4XBPB 4OTXH 4M48H 4FJ6A 1OAJA 5H4YA 5A2LH 2R0LL 3UTZB 4HIHB 1JWUB 1SVCP 3DUSA 1FAKT 5IVNA 3MDLA 2NLJB 3DURA 5IBLC 3KWVA 2R0ZH 1JIBA 2JKSA 2Y7SA 3X11B 1PX8A 2XZCH 3C5JA 3EBAA 1O7SA 1D7DA 3CFDA 5JHMA 3LPPA 2DEWX 4H0GA 2FJGB 1CS6A 1DQMH 2XZQH 3CZFB 4ILDA 2J20A 3E0GA 1DQQA 2EDXA 1SF5A 4IMKA 5DRXB 3WBDA 5BW7C 3CWGA 4HBQA 1UT9A 1PLAA 4R7VA 4XNMB 4GG6E 5CJ8A 3X12A 4GLRH 2YD7A 5GS0C 4APXB 3G08B 3J2PA 4PJ7B 2VC2L 1IBYA 2DLIA 2YXVA 4OAWA 2DQJH 1RURH 3SDXB 2QSCH 2YUVA 3FYEB 5I16B 3UTSB 3T2OA 2FEEI 4P59L 1E7UA 2DLEA 5DMIH 5L9DL 4KJPD 1CQKA 3MLVH 2NCEA 1LO3H 1M1SA 4F57H 4G6ML 2N56A 5EB9A 1I85C 3EDFA 4F1SA 2RALA 2Y81B 2HRPL 5I6OA 2OKMA 1MCWM 3QFDB 3GNML 1JI2A 1ZEAL 4MMXC 1VFBA 4LLYA 1FV1A 2IXQB 2EKJA 2J1YA 2NNCA 3IFOB 3ZOAA 3BEWB 4EDXA 5FO2A 1T0NB 3C09C 4X83A 5AKTA 5IMMB 4RX4A 4MBOA 3OX8A 3RP1A 1R5IB 3SPVB 1I8KB 1N19A 4AL8C 3N42B 1I7TA 4LK4A 5AW1B 4H2AA 4MZ3A 4YHKL 5DRZB 3SSGA 5C7XL 3S3SA 1CCVA 4XAWL 3FUFA 1PU0A 2EECA 5FGCB 3RNQA 3D0VB 1ZV9A 4MCYB 3TPUA 3MRPB 2EVJA 3H9SA 4MXVE 5JPMB 3ARSA 3NAAH 2XVGA 3RILA 3T0VA 2AS5M 2QADC 4YUEH 3NIGF 4ENEC 4KDWA 4JKKA 3S8GB 3PIQA 1ID5I 4WF7A 3E2HC 2Q3AA 2PNDA 3EFDL 5ES4B 3LEYH 2YPVA 3P2DA 1HOCB 3RJDA 1TO5A 5IJVB 5JB8E 1CZ8H 1OPGL 4AVHA 1MRCL 3MRKA 4P9HL 4XNQA 3VRJB 3IDNA 4XP1H 4KXAA 4MS6A 1G6RA 4Y76B 2OZ4H 1Z32X 2K4AA 4DEUA 5F2FA 2Y5EA 4EI0A 4QO1B 1DQTA 3UZEC 4DGIL 4JO5A 4JO1L 4ODWA 5IW1B 5CAYB 4AQAA 4J39A 1ACXA 3MHZA 3RJOA 1ASPA 5DUML 2GG1A 4Y4KD 1UENA 2QKIC 2XZAH 2R4SH 2NY1B 3OZKA 1FC1A 1PYWA 1UOLA 1UJ3A 5SX5H 2ZKHH 5D5MB 4Y19E 3EGFA 1T3FB 2QKSA 3QP3A 1Z7JA 5E2UH 5KJ7E 3A4EA 4RRZA 3RWDB 3W38A 1VGEH 1RUQL 2VB5A 4NQXB 1CLYH 3GDBA 4PGJA 1KN4H 2W95A 5C0GB 4HCFA 4ELME 1DBAL 4DKEL 2BSBA 3FU6A 4UM9D 2YR3A 1HE8A 2HRPH 1KCBA 2BNQE 5E4EB 5T33H 1YYLL 3W5MA 1J5HA 3EFOB 3ME0B 1PXXA 1XR8A 3FONB 4LZKA 4TRPH 1AZBA 3T2QA 2YGQA 1BAGA 4Y5XC 4QRTA 5E95B 3IETB 4LP8A 3CFDB 4KJQD 4DZBA 4IOSD 1EMOA 3CBKB 4QXWA 2G5UA 5GGRB 4ZMLA 2WBJB 3DHPA 4O2FB 3DKHA 1SEBB 3IKCB 3U9UA 3VFTA 3BH9B 3U9WA 3VGEA 4CC4A 1K8DB 2VXSL 2XJKA 3NZHH 1ZXKA 4KVNL 5ALBH 4KMTH 2E7CA 1HXMA 3DSNA 4AGQA 1MFVA 1HT6A 4NRYA 3K71B 4O51A 4ZYKA 4EZKA 3GMNA 3T6VA 2WANA 4P5KA 1GRWA 4ICWA 3ISWA 3OXRB 5EOQL 1E9OB 4GG8A 5AG8A 1APQA 4TUKL 3ZDZB 3K4ZA 4NKDA 3SBWA 3SOBH 3BT2A 1KELL 5KSBA 1VKXB 4KK6D 5CEZE 4AQ8A 4X8JB 4R84A 4AYSA 3WNLA 4HCRA 4N0CC 4E9VA 1Z66A 4NQUA 4APXA 1VDGA 3QDGA 4PJFB 5CN1A 2WXJA 1CDUA 4CU6A 3Q8CA 1ZWIA 1DJSA 2HA1A 1A7NH 2WM0A 2XRAL 4P06A 2VABA 4DN3H 2EI7B 4JY5H 4JFUA 3QZMA 4U1NA 1CLYL 3H2PA 3ABKB 4P5KB 3V65B 3M46A 1KGJA 3F7QA 5I17B 5LDUA 5HYSG 1IGXA 2QVKA 1NWPA 5C0FB 1QABA 3RWHB 1W72A 4Y2OA 1Z9NA 3LS5L 2VDOL 4WI9A 3NCBB 4PM1A 2VN4A 4ZMAT 3VQMA 4L29B 4PWEA 2IMMA 4I0PA 2X4SB 4WK4B 1MF2H 4B9YA 2HLFC 2HRGA 3NCMA 1G7PB 4GAGL 4GP8B 4M8VA 4NT6A 5TDNB 1VEMA 4R5VA 1D5IL 2YEVB 4OUOA 3CSTA 5TF1H 3A6CL 3THMH 4XLWA 5CWSA 4DWHA 2VDOB 2ZXAA 2EE2A 2X9WA 3FOLA 3RAJH 2WC7A 4ZUWA 2W9DL 5KYUB 4K7PY 4HS8L 5D70H 1MJ8L 5L4IA 4FFZL 5FM4A 2HX7A 3B1TA 3EH1A 5KBMA 3UCQA 1JDDA 2E7DA 3BWZA 1FF5A 3C5SA 5EO9B 4HGMA 2WOBA 2OMZA 1SJEA 1D7BA 5L88H 4A6YL 1XBDA 3EXLA 2CNZA 2IGLA 4R9HA 5DJXA 4NS0A 5HGHB 1KZYA 4WU7B 5AOJA 3P4OB 2XBWL 1H5BA 1XGZA 3W5NA 1C9SA 4Y2LA 3IS1X 5C3TA 2BP0B 4YXKL 2VLRB 3HE7D 1RZFL 4J6RH 4N86A 2FAUA 1P9MA 3ET9F 4W9CC 1GAFH 4F7PB 2M26A 5C0AE 2VXVH 1X6NA 2IWEA 2ZUYA 3LKPA 1DJHA 2E56A 3KPNA 2DB8A 5LN4A 1LEKB 3BVVA 3NJKA 4J8RB 3VXUB 1CXKA 1SJHA 5TE6H 3UABA 1RFDL 4K5PA 4PREB 4G82A 3KLHD 3HZVB 4BFIA 1D6VL 4ECNA 5KS9E 3CLFH 2EEXA 2F5AH 2TRYA 4Y8AA 5CM1A 1SY6A 1VLXA 4FQQB 4CBPA 3CZUB 4XODA 3MRHB 4Q8BA 5CJXC 1F4HA 1BAWA 2DZEA 1DQJA 3AXHA 1TZ8A 2Y5GL 1E40A 3OJVC 1JSYA 2DQDH 4U4IA 4MCZB 4YDIL 3MBED 1TJGL 1CD9B 2EXWD 4GQPH 4OB5L 4H0LC 5FECA 4G6AD 3KPRB 3FTYA 2PO6A 1OSPH 2WLYA 4OIFA 5HYJA 2H2SC 4EPSA 1S5IL 2EDYA 1LGVA 4KUCF 1D3CA 5JIKA 4FQIH 3K3QA 2BFVH 2ESVA 1KYDA 3BAYA 4M8QA 4RMQA 1A0QH 1W6WA 1BEYH 2ZT9C 3NSFA 4MDIA 2CKBL 1KNOB 1J9QA 1AO7D 1F0LA 1GGBH 4UBDC 2Z0BA 3FRUA 4X7TB 5DJAB 4GQQA 1OM9A 2G2NA 2DW5A 5KS9F 3HZ3A 2Y7XB 4LCWA 5F7DB 5F0JB 4KX9A 3VWKC 4Z9KB 1XV8A 2VRAA 3TH3L 4TVPD 1IAKA 3MJWA 3QWOA 1BIHA 2WWKT 3HKFA 1GGCH 2Y7LA 4PJXE 3ZZ1A 5EEYA 2E27H 4XCCL 3K6OA 2JKWA 5E8DH 2IBZY 4XOCA 3QDJE 2XQYG 4NP4L 1OP5K 1G1YA 3QIWC 3UCRA 5KBLA 4NNYB 2Z31A 4XGZB 5I2IA 4L8CB 3HG2A 5I6XB 5E0FA 5IESH 2GJZA 4A2MA 2D9QB 2GSGB 3FYIB 1OGPA 3ZYJA 4ELMF 1ZE3C 1LP9A 2DH3A 1JRHL 4D3CH 4Y2NA 1KJ3H 1BYOA 1E4XI 5KSUA 4X9IA 2QTVA 5DRNA 2W3IB 1HINH 5C08D 4UINH 1BVLB 1EANA 2PTTA 2ADFL 3CH1A 4ZZFA 4JRYD 2EXTA 1WQVT 2DM2A 1BFVL 4KGJA 4OCSL 1HXKA 1TENA 2MKLC 4OCYL 2E9BA 3VXME 1KACB 2C4FT 2IOIA 3MFGB 3MJ9L 4G7SB 3VWKA 1RMFH 1QNIA 1IFGA 1SF3A 1OE3A 3BUQA 1E28B 5TDOB 3TF7C 4QRUB 5DD3L 3MPCA 1FIGL 4H5SB 4R6UA 2BOKL 1OE2A 2N59A 3FUIA 3ARDA 4ZS6D 1A6WL 3F1SB 5F9JA 1AHWB 1RD6A 4AYMC 4HQQH 1NIFA 4ZNEE 4ZW8A 2UZYA 4JB9L 2IPTH 3QUXA 4I77L 5C07E 5I18H 3ABGA 2R2HA 3LSOB 5TTRA 2BMKA 3VXUE 1AQKL 4LHJB 5BRZD 3N44F 1DN2A 4ATWA 4FF9A 1O7DC 2FLMA 3MR9B 2V0AA 1ZLWK 1XCWA 1EDYA 4NLHA 1QPXA 1NC2D 2W88A 3AQZA 3BQUD 1SVBA 5CIPA 4XMTA 1YPZA 4OY9A 1XMWA 4F80A 5IQ7H 3AG2B 3ZYIB 1ROCA 3QUYA 3SE3A 3ULSA 4PRPA 1I7UA 4P3WA 1QI5A 4OGAD 3S3CB 3BEVA 3HNVL 3LS4H 3PGDA 4QNPF 4WFEE 2YPKB 3V6FA 1CL7I 4NZRL 3Q01A 1WBZB 3DGGA 1A2YA 5AB1A 1DDHB 3QWQB 4PJIB 5F3BB 2WLNA 4Z7VE 4QYOB 2BINA 1G1RA 1Y6KR 3G6AA 1HT8A 3SZKC 3UJJL 3ULVC 4AVKA 1IGCH 3ZE2B 3B2UC 5C9JB 2GKIA 4OUUA 2B1OA 4G9DA 2JNZA 2VSDA 3S5LG 2BVOB 4G7VH 2X4TB 1IBBA 1HI6A 3CQPA 4GKNA 4JM4L 1COUA 2A6DB 4RISL 1M56B 2CR6A 3FHQA 5AYUH 3I6KB 3KPRD 4YQXL 3NTCH 1I9JL 2RIKA 4ZFFA 5I1GH 4M7KH 2QR0A 2DYPA 2ZUQB 1OGAA 4KNQA 4RGMC 1WFMA 1PGRB 1PZ5A 5I1JH 1XWVA 3VFGL 5KYWB 4RFEA 5L2YL 1D5ZA 5D6DC 2AXFB 1KNOA 4Y88A 3T2LA 1IM9D 3DMMC 5C07A 1DJIA 4J3OD 4F7CB 1H6UA 4HWBL 4YQXH 5INCB 4J3OG 4KUCD 3DDGA 4JFZH 3HFML 4K3EL 1U2YA 2FBRA 3VFRB 2HKFH 4XVSL 3FXIC 5LCVL 4MD0A 4ZSOA 1U8NB 2F19L 4UB0L 4I5BA 4P05A 4IOSA 4Q6YA 4RMRA 5EWIH 1UGNA 3H55A 4FZEL 1EEUA 2CQVA 3P4MA 1EAQA 5FFOA 3AABA 3BP7A 3Q6GH 2Z7WA 4A63A 3QJFA 1A65A 1DQJB 3UJJH 3SKOB 4OU3A 1Z0MA 3QUZC 3S2AA 2FH6A 4XPHH 1ZHNB 2X42A 4PJAF 5BQ7A 1M7DB 4DK6A 1UM5H 3ARTA 4XI5C 3TPUB 2XG5A 3BXNA 3AACA 1ZKAA 1E4XL 3OLDA 3V0EA 1CFNA 3OKOA 4OLEA 1MHHB 2E8ZA 4KNSA 4UOW1 1CLZH 4AE0A 4OVUA 1B4TA 3OAYK 2LQRA 3JXAA 4K23L 2CR0A 2CRZA 4M5ZL 1QHQA 4JDVB 5JXEC 3BH4A 4KI5D 3ULUH 4WAFA 4I0PB 3GCXE 1T1WB 3DGCR 3SGDI 1MRDL 4JRYB 4L5FL 5J6SA 2I26N 1B6UA 2X3BA 2VH6B 1MY5A 3SQRA 4KDTA 1BFOA 4XPGH 5TQ0H 3AB0C 2KMWA 1GMIA 2NYKA 2LFGA 3F00A 5J6GB 2X70A 3QUXC 2DBLH 3REVB 2JTDA 4PYHA 1WFJA 5I0YA 5KEZA 3CVIH 2WLLB 3RWJA 4GMSH 1D5RA 1E8YA 3KDPB 5DVMA 4DERA 2Q9OA 3IMTA 2VQTA 5ITFB 1KTBA 4JFEA 1OAUH 2CHNA 1JMZA 3GSNA 3TA3A 3O6MH 3IWVA 1DBMH 3UYPB 1JFQH 2P4AB 3CBRA 1BD2E 3QEGL 3M8OL 3WJJA 2HPTA 2BY1A 4DTGL 4KK9C 4S0TD 3PXHA 5LGKA 2CR3A 3SO3B 3UEZA 3U0TB 3TZVB 3S8FB 4PY7A 4Y7BB 4JDZA 2WXNA 3IKCA 3U9UB 2YMXH 3VFTB 1RP9A 4I77H 4Z0LA 1BVZA 4OGAC 2YZ8A 4PGCA 5C08B 1W0VB 3GUTA 3Q13A 2YEZA 1I1AD 1U8MB 4D90A 2NY2C 3CBJB 1UVQB 3P4NA 4JFPA 4MQSB 4YAQB 5DYOB 5AD0A 4N90D 5IV2A 1CXFA 3IDMB 2Q10A 2I07B 2XN1A 1PDKB 2W86A 2B9BA 4PJ5D 3DX7B 1WBXA 3MQIA 2EDQA 3CQQA 2VN5A 5JA8B 5JO5A 4S0HA 3OXSB 2WBJD 4LLWB 1XF5A 3GSVB 5DMYA 3F6JA 4PCSA 4FYTA 2ADFH 2OJ1A 3TYGL 3TFBA 1ZV2A 1G94A 3T3PB 1BLNA 3TX4A 4ANVA 1KYOJ 4DH2A 2E9WA 4L4VE 3GMNB 1MFAH 4C4BA 1D5XA 1D9KA 1IBGL 3G6JA 5GSVA 1CD8A 3CX5J 3RDJA 1ZVSA 1E9QB 5ALCH 2BQ7A 1SYSA 4WHDA 3OQRA 4B9IA 2XIIA 4YDZA 3SYCA 3S6XA 2JCCE 3GBML 3KG5A 4RMVA 1FNGB 3OJDB 5JIDA 2PYED 5B8CC 3BDXA 3BP6A 2VXQA 4NAJA 2IQAA 1FVEB 5FECB 2HX8A 5BXFB 1ZD6A 3VD7A 1I9RL 4JZDL 5GGSA 1TXKA 1IILE 1MHHA 1WWBX 3PWNA 1JGUL 2DQIL 5E9DD 4H8VA 2WIIA 3WHE0 1ORQB 1GSMA 2OJZH 1PY0A 3SOTA 5DFVD 2KZBA 5IK3B 1QO3B 2YRPA 1PD1A 5BQ7B 3VFUA 1ONQB 1G9NH 3D52A 3PWJA 1RFDH 1EO7A 5IR1A 4HBCH 1I8MA 4QKXB 3VFWA 2R56L 1XXDC 5A3IC 2ADIB 1H6EA 1WZ1H 5HYFA 3AREB 1XIWA 4RX4D 5F3HA 1KCRL 3IMRA 5CHNB 3DX3A 4E9RA 3I84A 4S1DC 3FQUB 4KKBC 4KQ3H 2D3VA 1TR7A 4H0HB 3O3BA 4AYBA 2E7LC 1IGMH 2MPVA 3GI9H 4UTAL 1XFEA 1OGSA 3HZYA 4HK0B 4I85A 1NBVH 4UYPA 1IM9B 3KXFE 2Z31D 3KNBA 1J12A 1NKGA 5HGHA 1A14L 1CIDA 2DQFA 2G5BB 2CLRB 2J43A 4IBZA 2IFGA 4I18C 3JT2A 1IQJL 5I76A 4MDRA 3AZUA 1RIHH 2Y7QB 4ZUTB 1MI5A 2Z93B 3A47A 3AROA 2KV4A 2VDLB 3KPLB 3OJ2C 4JM2A 1LE9B 1YEIH 4PRBB 1UB6A 1OPOA 2ZSVA 2VCOA 2GJ6B 4ISVA 5CWSB 4OCXH 1L9TA 3HJEA 1IGTB 1MDTA 3KXFD 1H9VA 2VYRE 4PGCB 3ESUF 4WTZA 4ABVA 2BPBA 2ATKB 3HE6B 4XPAH 5JBBE 2WXOA 2BSCA 2N7SA 2A4ZA 3LN5B 3ZHFA 3O2VL 5A2JH 4MXWL 5D2NE 2TRHA 5D7HA 3VUAA 3ZRFC 1AO7B 4WW1A 4WO4D 4P9HC 2OFQA 4BTTA 1G5GA 5D72H 3ASNB 2WSPA 2Y6SC 3K91A 2Y06L 4FMVA 1JXGA 5I1LB 4ABQA 4PBWD 4DP1X 1CDCA 3MGTA 2Y69B 1B2WL 1VENA 5EGMB 3U73A 5DGQA 4R96B 4FNLH 1I8UA 2DI7A 3GS4A 3WNMA 1A3PA 1JZFA 1MCCA 2UX7A 3PE9A 3DX6A 3KXFA 1HHHA 5L2KD 3TEZA 4XN5A 2F9BT 5LBGA 1MUJA 4TLKA 5HHNA 2WZAA 2KQNA 1CXEA 4Z77B 1FFOB 4NRZA 3HC2A 2CJTA 1PFXL 1CC3A 2C7UB 4NN6B 5I9QB 5I1LA 4QWWD 2Q76B 3SDCD 1MQKL 1QRNA 3AMLA 3IJEA 3AM8C 4PPTA 1AHWC 2NX5A 3UERA 4EVNB 1JDCA 1T83A 2VJXA 4NN6C 5I9QC 3N91A 1J8HA 2RBLA 5CKGA 2GC7C 2BXZA 3CS7L 5E99H 2Z64C 3BD4A 2G60H 3RHWF 3FN0H 4LNRA 2NW3A 1S9WA 4FCHA 3OC8A 5IIEA 3NPSB 4L1HA 4NZFA 5DHVB 4M5YL 3MV8E 4M1GL 1BX2A 4KHTL 5B1BB 4PVBA 1RIVH 4W9JC 4O2FA 4M7LH 4BZYA 2AV7A 5B4MD 2FYYA 1V05A 3LZPA 1FF7A 3ZDXE 1XGQB 1RURL 3O41B 4JY5L 5LGJB 1HZHL 1NLDH 5E5MA 3CFBA 4Q6IA 2G4GA 5L8LB 1MJ7L 3MBXH 4U3HA 2Z65C 1K9TA 2I85A 5DEFA 5BO1L 1FVDB 1X7QA 4X0KA 2XTJC 1GOGA 3SBWC 4JREC 2OTUB 2XIBA 3OPUA 1T2QH 1JXDA 4EAEA 2Z92B 2JKTM 1AOHA 1I3RB 1LK3L 2CUHA 4W9FC 3T8XA 3RPIA 5FM8A 2EXSA 2E0PA 2V2TA 1PTHA 1I7RB 1S7RB 1ODUA 1A4JB 4QRPE 3ZE1B 4DK5A 4S1QL 3SDAC 4K5OA 1SXBA 3BE1L 1XEUA 3FQRB 4XNDA 4KVNH 4YT6L 4Z18A 3CLEL 3TNNB 1U91A 4L4VA 1T4KA 1V7NH 5FW8A 1BWWA 2AMUA 4Q89A 1I8IA 2Z8RA 1Q72L 3MRLA 2YPLD 1RHHB 1I1AA 1UWEL 5C0BA 4JN2A 1IQHL 3AC0A 3H6AA 3CVHA 2EEDA 8PAZA 4ODUB 2W81C 4O58L 4UQBA 4HEMA 3BLKA 2J73A 3DETD 4NZUL 5CD5D 3CZEA 2ALWA 2HH0L 3P9MA 4HS6B 1BW8A 3E2HB 3GKZA 4OF5A 4NOFA 3NCYP 4JKLA 3VDAA 2QQKL 4ABUA 3O81A 4X42A 3DBSA 1NGQL 3HS8A 2NQ3A 1H15A 2VWNL 1QKZH 3I75B 2CKBA 2IADA 5D2NC 4MCNA 3BN9C 4G1EA 3LPFA 4TGFA 2JVUA 3ENSA 3N8ZA 2FLRL 4IRJC 3CU1A 1VERA 5D2NB 1BF5A 3K1KC 4I89A 3O8XA 3D18B 3PL6C 1QKZL 1V3KA 2FNBA 4IGBB 3QH0A 3ZZQA 1BJ1J 3MA9H 5ICZA 3FTZA 1K72A 3JUZA 3MNWB 5K0HB 3HTLX 1P4LB 3N40F 4HWZA 1DDHA 3D9AL 5EZJA 5MI0B 5GIRB 5DI8B 5I1IL 4BFIB 1A25A 2BNQB 3CN1A 3V8CA 1U8MA 1XF3A 4JFPB 4JPQA 1GXEA 3M1CA 1VSCA 4YSOA 4TXVB 2KDYA 4RLDA 2DWXA 4KHXH 5A6IA 1RIVL 1Q72H 3AG1B 3FUEA 4DUVA 5F9WB 3WFHB 4M7ZC 3O9WB 4RDQG 25C8H 4BE6A 4JGJA 3WU1A 3NK4A 4PH9A 5F7YC 4BK5C 3ZMNA 3G08A 2R9HD 5JHLL 1QQDB 1QRNE 4KTYA 5I5IA 3AQXA 1TSHA 4HZLB 4I2XA 3WYRA 4U1IB 1QLRB 1H0DA 4P5TC 1L0YA 2I07A 4QHUA 1CFQB 2CKNA 2XZCL 2ZUWA 3CZFA 1UXMA 3D30A 3HN3A 1N64H 1MFMA 3RIAK 5HVHC 4L3EB 3KWXA 3WI9A 1FSKC 5E4AA 1A6TA 1F58H 5MEPB 3T9WA 3VFPA 5FPIA 3DVGA 4ZDHB 1UOKA 4JPSA 1B2WH 3QJVB 1MJ7H 1T1XB 4HH9A 1MH5B 5KSAC 2ZE0A 1YEDA 2QHRH 4JPWH 5DO2C 1L7IL 2CPUA 4GUPB 2I9LB 1T5XA 3N9GL 1QYGH 3GBMH 4WI8A 3QBTB 4AYFA 5CGTA 2VR5A 1C16B 1ZANH 4LOVA 1KJ2L 3GSWA 1LQBC 3KL3A 4M62H 3SY0A 5E00A 3UADA 4L48A 4J27A 1TU2B 4DESA 1O7VA 4WW2C 1TT6A 5FDQA 2VLMD 4PWIA 2MKWA 3O3AB 4ZDHA 2Q2EB 4S2SA 2XI9A 4XX1G 4YO0A 3H85A 1LEIA 4HUUB 4OLWH 5I2IB 3B9VA 3KPSB 4X6CA 2MPAH 2A2QT 4FFZA 5EU6E 3Q1SL 4X5PA 2JIXA 5E08L 5HJDA 4OFQA 1BYPA 5ETUA 1ECZA 1CFQA 4LOEA 3P3YA 4M8RA 3HMXL 2CGRH 2BOCB 2WO4A 1FRGL 4WLCA 5HJ3B 1YEEL 4KTEL 1R47A 4B9GA 4AV4A 3IDJB 2Z31C 1MW1A 5JHDB 1WGOA 3SKOA 3T4AA 5DO8A 3FUKA 3MODL 3EJYC 3QRGL 3DPBB 5C1MB 2P8LB 1F4AA 1SFHA 3CSGA 3MV7A 4B97A 1U8IB 3QPQC 3QFJD 4TV3A 5LAXB 2CUMA 3K6IA 1PG7W 3WFDH 2G3MA 1T20B 4UTAH 2APVA 1Z3GH 1NFAA 1MFDH 2BERA 3D4YA 3HBGA 4LIQH 2AABH 3GMMA 1GVIA 5GGUB 1JNLL 2EYSA 4X5WA 3RA7H 4GBXC 5B1JC 4XX5A 4XL1A 4XOEA 3MRCA 3JVGA 4APQD 5IB4B 4N26A 1NJ9B 2WIMA 4OI8A 3VD2A 1FNEB 1MCKA 4X8SL 3SDCA 2Z91A 1MOEA 1OGAD 2VDQL 1WHFA 4C58B 3SOQA 4N2DA 1CX2A 2W65A 4IDJH 4O4YH 4UV4H 5DTFB 4CKVX 3C5ZA 3AT0A 3TK6B 3IS0X 5AAMA 5ABZA 5I76B 3RR3A 4V1DA 5D4IA 1DP0A 3DYMA 4IGBD 1YNKH 3FZUD 4G9DB 1WHPA 4IJ3B 4JRXB 1PX3A 3MCKA 3LRHA 3GC3A 2BQWA 1NUNB 4F8NA 4FQCL 4NC1C 1DEEB 1DVSA 1E5BA 1SYVB 4M02A 3DX4A 3VWKD 1EZQB 3D25B 2WQSA 1NMCB 3QUYC 4NZ8A 2KHAA 2WGNB 4BK8A 3DOIA 4TVPE 4NO0B 4BH8B 1E8ZA 4H26B 1DVFA 1HKLH 2R1XA 4ETQA 1IC7L 3TPKA 2DTMH 4LPUA 4HAKA 1J5IA 3W0WA 5I28A 4Y2DD 4X6CE 2Y6TE 2Q6WA 1A3LH 3SDCC 4B3VA 3MNZB 3PYCA 1S7UA 4GKNB 3FU7A 4YGAB 1IZKA 4JDTH 1IGJB 4ZH8B 4RAUB 5FUOL 1ZVYA 3K2UH 1Z9OA 3M86A 3BQUA 4K5NA 5AAWA 5GS2H 2Y07H 4ZNCD 4B7IA 5E08H 3ARBC 2WPHE 4LRIA 1YMMD 4JZNB 2PPAA 2Q7YB 2X40A 2VITB 1RLBA 4W9HC 2YN3A 2DYRB 1AGDA 2C9PA 3DO4A 4OD3H 4AXWA 5KVGL 3ZT5A 1JHKL 2F19H 1OP3K 4E5XA 3NFSH 2AJUH 4Z77A 3U36A 1U2HA 2YLKA 3CIQA 4FAAB 2P5EB 3NPZB 4OQTH 5ACZA 3NZ8B 1JK9A 1FG9C 3CFBB 4S2SB 4YO0B 4LCIL 5KSAD 2VJ0A 4YHNB 4LSVH 4WWKA 3K8MA 3MLRH 5AW5B 3U25A 1AS7A 5E00B 2NY0B 5LBSA 1YAIA 2MCPH 4M7JL 2YGPA 2H26A 1YYMH 3BPSE 2NX5D 3QWRA 2D8KA 3GPEA 2VQUA 4UDTA 1USZA 4CW1B 4HKBA 1RQ5A 3BLPX 3X2QB 4RISH 1AOZA 2J4WL 4XC3L 2P42B 4JKNA 3ZDZE 3ZE0F 5HVHB 1LPKA 4NYLA 5HYJD 1ZHBA 3GMLB 1S7SA 5BS0D 3BVWA 2ED6A 5I73B 2NUTB 3LIZH 1VESA 1K5NB 4UNIA 4PD4J 4DVRH 1NL0L 4G6JL 4LIQL 1INQA 4NQSA 2EDMA 4NNPL 3N8YB 1LDSA 2YAPA 5KJ4A 2AGJH 3HAEH 2R69A 4OKDA 4B96A 4JE0A 2W2OE 3SDYH 5HYJE 1JPFB 5I1AA 3K71A 2QEJA 4MKTA 3LH2L 1U3HC 1OP4A 3DIFA 4N2GA 5AOZA 5TH2A 2G75A 3O3EB 5ADPL 5FB8B 3VX1A 2BH0A 3FT3A 1IEAB 1YEEH 4KTEH 4PTTB 3D0AA 4H8WC 2FB4H 2GITA 1FWXA 5ERWA 1VFAB 4FFTA 1IIIA 5F3FA 2YGOA 2EVFA 2JTYA 3V2AR 1G0YR 4LASH 2FJFA 2J94B 1JXJA 1KXTB 1WFTA 4NZDA 4R7NA 2X5PA 3HZYB 1HNYA 2XICA 3IJ7A 2HOXA 4ISVB 4D9RE 5B39G 1BFSA 3VA6A 3RI5K 1NC4A 1OEZW 2AK4E 2B3RA 1C12B 4GW1A 4ZW7A 3UYPA 1E30A 4GINA 2GIYA 4EDWH 3V6OA 1PL3A 3LEXB 4IS6A 2W38A 5FW6A 3SGJC 1A22B 4KO9A 2BT7A 2FRGP 2QZQA 2QGCA 2WXFA 1JWMA 3MCLL 4A66A 3C6SB 4YVNA 3BFQG 3O11B 2PN5A 3IE4A 2ZCHH 1FNLA 4IBLT 2AK4D 4M4RA 3VXRA 5FCUL 3VFVB 1FQ9C 5C0IA 1GY1A 4MLIA 3BSHA 2XQYA 1BZDA 2GSMB 1OP3H 1BVNP 2GI7A 4BUGA 1OTTC 1BF2A 3MYZA 3ZTEA 4JL2A 1T03L 1NTDA 2R15A 4BZ1H 1UH4A 2XNAA 4J3OF 5EOQH 4Y16C 3EYQC 2R23B 3K6SB 3APMA 2ROYA 3RL1B 2H7WA 1MCIA 5IJCC 1URLA 4XTRD 1QEWB 4AQTA 4ZMOA 2QTEA 3U36B 1JBJA 2TSAA 4HV8B 4WU5A 3H3BC 3AG3B 3I9GL 3X13B 2XG5B 1R24B 2E8YA 3VI4B 1P69B 2C9AA 1IUZA 2XFGB 4WWID 4X8GA 2OQJA 1CBJA 3GZKA 1NDGA 3DEMA 1XGTA 1C5DB 3UTSD 1E27B 4PJ7F 5GGSY 5IOPA 1IL1A 5BO1H 4DP6X 3C12A 1CTOA 2NCMA 4UB0H 1Q1PA 3GHBL 3QEHA 4F1ZA 5KSVA 5MHSD 5AWNH 4FQPA 3QAZB 2ICEB 3EDEA 1MFEL 5KTEH 1X5JA 2VT0A 1RUPL 3EHBB 4OZFB 4Z7NB 1GC1C 3QQ9C 4P2RB 4PRPE 1AIFA 2G60L 5C07B 3VTAA 4Y16A 4WWNA 2AXFA 4HIIB 1XR9A 4Z8FL 2M74A 2PCXA 1S3KH 2YKLH 3MUHL 2FT7A 4AC2A 2AQ3A 2CBQA 3ZQ9A 5IR1B 5JQHC 3PWJB 5D7EA 4YSEA 2HFGL 4YL9A 1CI3M 1RPQA 3I9PA 3ESOA 2B7DT 2X1QA 4QTIL 1T7XA 5I17A 3MLTB 4G8EA 3WMSA 3HG1A 3IVKA 3L9EA 5LXGL 2O93L 3TU6A 1AFVL 5MEOB 1P5UA 1XB8A 2Y5HL 1G5AA 1WH0A 3FB8B 4ZUWB 3RTQD 4FI6A 4YOKA 4ZFGH 1INQB 2DM3A 1ACCA 1UM4H 4JQIA 3Q8AA 3LN9A 4ZUVB 1G1OA 4G59C 2VDRB 3MLXL 1U8OB 3TXAA 4LSPL 4Q74A 2B2XL 4JLRA 1G9ML 4OQ1A 1ZGLB 5FM5O 1F0RB 1DQVA 2X3AA 1M7UA 3JV5A 4TL4A 4OGXH 1ITCA 3JBG7 4G43A 1T7ZA 5I66B 1KPUB 3QNXB 1RUAH 3PU7A 4YFDB 3T2NL 5AB2A 4NIYE 5HGAA 2F5BL 3ULUE 1N9PA 4MZIA 3S4SB 5GGTH 1FYTB 4YPGB 1WUNT 4U05A 3TBVA 2NTSP 1EUUA 3TVMA 2WZPD 2IAMC 4G6KH 1HIML 4BUHA 4JFDD 2RCSL 5F89A 2N7AA 3LH8A 4COXA 2C3VA 4UT6A 1ZLVH 5IM7B 3WDHA 2ADGA 4LQ1A 4K9EL 1XF5B 5C86A 2VN7A 1IGTA 3QUXD 2GI0A 4JG1H 4XP9L 5LQBL 3SYOA 4DGYH 5MENA 1U58A 3BO8B 5BRQA 1NPNA 2CIIA 2HTLD 3HNSL 1QFKL 4KK8C 2XY1A 1RZKC 3ZTDC 3HA0A 3V52H 4J3UA 1F8TL 4J3SA 3FN9A 5LQBH 4IBWA 1T6BX 3WIIL 3COOA 5I23A 4NHCL 2YSSB 3I9IA 1UWGH 4FFVD 3SGDH 4XVTH 5JXED 5GS0D 2OSWA 2ZCLL 2YAHA 4ZQKA 2IH1B 1WCQA 1AMYA 2DMGA 5TH2B 5KN5C 5FYKU 1FL3B 4R8WH 1SN5A 4AQAB 4ICXA 5F0LB 1CBVH 4KQ3L 1G7JA 3H9SE 4ZSOB 1OCWL 1N6QH 3FTUA 3W2DL 1T5XB 3ULAB 2CM5A 1GGUA 3FCGA 3HKZA 3KYAA 3ME0A 3UPAA 5JPNA 2R83A 3D1MC 4FFYL 2B39A 1J0ZA 4PJ5E 1AHKA 4TPRH 1Z5LA 4UOJA 1LNUA 3U1SH 4UCFA 1NAKH 4R2GB 4H1LH 5D4QA 2BVEA 1OY3B 2J44A 3IDYC 3QEHB 4GBXB 5AZEL 5GPRA 5C0GA 4MXQC 3S37L 1JN6A 1UH2A 3QJOA 1SQMA 4NYLB 5D2LA 4FNTA 1QFUL 5JMRA 1V7MH 1K37A 2WFXB 4ZAKA 4UTAA 3AS2A 3CFKB 1T0OA 4UU9A 5KANI 3F05A 1J8HD 3P4MB 4QY8A 3OKDA 2GCYB 2XBVL 2M83A 4YDMA 4M4PA 5BRPA 2A9NL 3P9LB 5SV3A 4OZ4B 2NY4B 2GPZA 3QFJB 4UQCA 3WHXB 1TLEA 2H9EL 2J1ZA 1YUKB 1SBSL 3DVNB 3FT0A 2FATL 3P40A 2QVMA 3PPEA 5KVDH 4N2CA 2R29L 3B9KD 2J21A 4X6BB 1DQKA 4O2CA 4YWGH 3CVHL 4MAYC 5GGUA 4B60A 4ZODA 1BD2B 4A68A 3FU5A 4YXKH 4Z7UE 4HA1A 3V10A 4G8FB 4MS8D 4P23C 4X99B 5FCUH 2V37A 2XWBA 1KB5A 4OIBA 1A4CA 3D0VA 4K3DH 3MNMA 3S5YA 2EH7L 5D7KD 4LRNL 3WIAA 4KJYB 4X5QA 5C3IA 2WN2A 3MLYL 3O2WH 5D1QC 2X09A 3WY3A 1CYWA 5EF0A 5DVNA 4JK0D 4OZIE 2F08A 2WJ7A 4ORGB 3OKMA 3VGFA 1ATDA 1HAEA 2IADB 4E9YA 5C0CD 1MVUA 4R0LB 1P0SE 1MJ8H 3QI9A 1D6VH 2R29A 3KH4A 3HE7B 1BVNT 3BIBX 4AKQA 2NOYA 1HWGB 4ZUSA 3OJMB 2OW7A 3F6UL 4ZX6A 4R7NB 3KPSA 3WN6A 2E46A 3P30L 4OZHA 4PJ7E 4R26L 5DEGB 1QTPA 3CHXA 3FQ4A 3L8QA 1E6OL 1JYWA 1P4IL 1OQXA 4ORZC 1G9NL 4E2OA 1CQEA 5FB8A 5F6HJ 2QR0B 4P2OD 3M8OH 1P5VA 2VO5A 4O58H 2YPLE 4IBYA 5FHAL 1J5OL 3VTTA 1MFDL 4FM5A 2OTWB 2P7TB 4QRRD 1BDYA 4QRSB 3V0AC 3FB6A 2XC0L 4C16A 2P3FL 5IROA 1FE8H 2GBTA 1EPHA 3QUXB 4FEIA 4ZG1A 3BMVA 4J4PC 4HC1A 2F1BA 4P5MB 3CLEH 1TJHL 2YXMA 4Z95L 2JCCB 1ETJA 3PABA 5FYKD 2CGYA 3RPBA 4N5UA 1VAHA 5FHAH 1J5OH 5EOCH 5CXPA 4M93C 4XMLL 3TBTA 5ADOH 5KVMC 1YQVL 4DGUA 1W72H 3QMOA 4EN3C 5CJ5A 2JSFA 2BZDA 1Y1DA 3H1ZA 4KH2A 3X14A 3ZJAA 2X2UA 3PGDB 5IREA 5ESAB 4HULB 1R0AL 3ARZA 5DJZB 3WXVL 2HFGH 5E5MB 5J9PB 4HLZG 1VCBC 1X5MA 2A6KA 2BVYA 2F7IA 4OLWL 4DZ8A 3N0PB 5T3XH 4PTUA 2DLFL 2EUWA 3GSOA 1IVLA 4WO4C 3IMUA 4PR5B 1QI3A 1Q9WB 4MJIB 5E9DA 1MWAH 1GH7A 5F7BA 3DROB 3BWAB 5DYFA 3QJHB 4GI6A 1RULL 2FIKA 1IEBB 2J8UB 4XP5H 1OT2A 1IQIL 4NDMB 3OLGA 2NNAA 1M7IA 1PG7L 3AQDA 3ES6B 1FFRA 1XQ4A 4JZJA 4Q9CA 2PO6C 5T3XE 4P8QA 3POCA 4XNYL 1PLGH 5AB9A 4MA7L 2C7UA 4LL1A 1R4XA 2HFTA 4U1HB 2HLFD 5CO1A 4KMLB 1ZWIB 2P16L 3AXLB 1UZ6E 4KROD 3KXFB 5HI4C 2VLJB 1D9KD 5DZPA 4KKLC 5GISH 2AEOA 3NJGA 4BD4A 1ZT7B 3MV8D 1VKXA 1OE1A 2F54D 4FMFA 5F7DA 5GSRA 5CR1A 1TDQA 5SWSD 2XV2A 1XKAL 2B0SH 3I9GH 2A83A 2EH8H 4K3EH 4EUPG 3EBHA 2IO5A 5DRNB 2UUDH 1A1NA 4A1RA 3GSUB 1XF2B 1MCQA 4CSZA 1DE4B 2UYLA 4XCYB 4M7JH 4MRCA 5HGDB 4ZMTA 1OT1A 2X3CA 3MRGB 1KPUA 1A1MB 1K3IA 4YT7L 2YBRB 4X6BA 4XE5B 5BZWA 3PL6D 1A6VH 3OKYA 3TEXA 3EOBA 5BS0E 1KXQE 2K2SB 2WBJA 3Q1EA 4HIPA 4P4RB 2EIZB 1UEYA 1AGFB 3ZKSD 5I8OH 4FXGC 1AKJB 4PB0H 2Z4TA 1RK1B 1ZIBA 2IPKB 3FFCA 2NTFA 5AVZB 4MA3A 2YC1B 2DTSA 4LLUA 2DQEH 4UM9A 2WXGA 4HZ1A 2EE3A 4DKEH 2BP8A 1LE9A 3DRTA 1U92A 3VXNA 4HJEA 4I13B 4L05A 2UY7A 3N44B 5FGRA 3MLTA 2A74C 4G8EB 4LKCA 2RHPA 1ET8A 1IGCL 2AJSL 2VRSA 2H0PA 2I60L 3KGUA 4H40A 1FAXL 2WYJB 1KB9K 3FO2A 4MNQD 4PWHA 3W2DH 2VZ1A 3QRLA 4TTDC 4Z3IA 4H13C 15C8H 3G5YB 2AKRB 3ZSTA 1RUKH 1TZGL 3H3PH 1EXGA 1BF9A 3RVTC 3ZRSA 3Q0HA 3ECQA 5IB4A 1SJMA 3GZPA 2ZSWA 3MRRA 3SDDC 4LQFH 1E2ZA 3MLSL 3V6FB 3U9PH 2I7SA 1NGZB 3IJYA 4XP4L 1CGVA 3RGVB 2O4EA 3DJRA 2HMIC 4HFUH 3FQUA 1Z3GL 1FCCA 1HHJB 2RFXB 5F71A 5J1SC 4QXVA 1WWAX 4G6MH 1NANI 2IFFL 5CIPB 5DZLA 3O8XB 4UNUA 4NCC1 1GHFL 2B4CC 3FF7A 1HL5A 5GRJH 5A43C 5J57B 2W5PA 3ILPB 4LFHG 5JDSB 4XB7A 5J56B 3TWYA 2YSSA 3ARFC 4L4VD 4MNHB 4XXCA 1FHNA 2CKBB 5GS2D 4AIXA 4E9SA 3MREA 4YLBA 3IAQA 4U1LB 1R24A 4XC1H 2VLRD 4FABL 3TT3H 4P5RA 2CGRL 3EJZC 1F6AA 4FQXB 1KIPA 4H5SA 3JYCA 3FQ1A 1QFWH 2CDGB 3ARDC 5DJYB 5E2VH 2VAJA 3F7YB 2XWXA 4CKQA 2RR3A 2TAAA 2DIEA 1C12A 3ZTNL 1FGVL 3QDJA 4JR9L 5E9DB 3OAWA 1PMYA 1G7LB 4G9FA 3SPHA 1T0PB 5CD5C 3GSOB 3BWUC 3CVIL 4LCCC 3D85D 2NDGA 4WUUB 5E24E 2BP0A 3L4CA 1MY7A 2VLJE 4L18A 2IAAC 2WY3B 2VR6A 4FJZA 3VB9A 1D5XB 5GSVB 2VERN 3NCJL 1N68A 1OSYA 1YEKH 3HG5A 4WW1B 5ISZB 4WFGD 1U8QB 1G4RA 3P77A 1LTXA 3T8XB 5B1AB 4ONFL 2KQMA 4I4WB 4PJ8D 1XGRA 4L3EA 1M05A 4NQQA 1F7EA 1AQDA 3S37X 4YHIA 3VW3H 3FTGA 1MREH 4OJFH 5D7SL 1P7HL 2HN7A 5JXAH 1IT9H 2EQDA 3FONA 4KROB 3L1OH 1OLZA 3K4AA 2BDNL 4P46A 4PWFA 3KVDD 5D7JA 1EFXB 4U1IA 3BKYL 1QTYT 5AL0A 3OXRA 1DLFH 1HOEA 2WLMA 3N6YA 4NCDA 3ZZLA 2A9BA 5HDRA 2O6EA 3VXMA 4Z3FA 3RRQA 5JXAL 5FM5M 3TBSA 1JTPA 2XXCB 1IAIL 5E6SB 1M6OA 3AITA 5BV7L 4GRWF 1JF1A 1V54B 4HKBB 5GQBA 5A6MA 2FEDC 1KB9J 2IPTL 1GHFH 1BZEA 2BOBB 4ZW5A 2ZWNA 4HUWB 2DTML 1ES0A 3Q43A 3QNXA 4C4UA 3U7YL 2WPME 3N9GH 1ZLVK 2AK4A 2YUXA 4RSVA 1TQBB 1UH3A 4RRWA 1RJYA 1OT4A 3ULUC 3M17A 4PWJA 3FMGH 4HJSA 4XZUB 2YZ1A 1WTLA 4D9RD 3MYJA 4OCXL 1A64A 4Y4FB 3V5DA 1HQ4B 2B20A 4KXBA 4HEPG 1BBJB 5HHOB 4OVVA 1NFKA 2J6WA 2OMBA 1DVYA 3EDDA 5JOFB 5DGRA 2WK2A 4G5AA 1N8OE 1PFCA 3WE1A 2BIHA 4MJ5A 1NFXB 5J6HB 1RZQA 2XU9A 1C1EL 1OAXH 3CXDH 3SGEI 3N0AA 1GIGH 5E7BA 4D0DA 4KKAC 3KYNB 5IROD 2DRUA 2B15A 2HT4D 3ETBF 2LABA 2WHVA 4JANA 4QAMB 5GS1C 3VSTA 3GIZL 2O6FA 4J12A 2F53D 2G4EA 4JFEE 2Z0UA 4Z7QB 4EE2A 4PJGB 3OX8B 2IG2L 1NMBH 2CWRA 2ZUTA 3RI5F 2E27L 1I1AB 1NCWL 1XR8B 4UDUA 5BV7C 4KVCH 2OL3H 2G9KA 3N40P 2ORBL 2JFCA 2VITA 3B3BA 2OI9C 4HPOH 5DZOA 1A1OB 3T0DA 4FLOA 1LMJA 3FULA 4TLUA 1DUYB 3HS9A 4HGWA 4PI0A 1TTUA 1MFBH 4FQJH 2XDHA 5F88B 1U4FA 1G9EA 1LL1A 4KRMB 2F61A 4IKLA 4IGBC 3HB3B 3RURA 5CLWA 3EJZD 1J8RA 2HJLB 1IGZA 1Z5LB 3ASWA 1N8ZA 3PHQB 4W6YB 3WN5B 3SPIA 3GGWA 1RPUA 1FO0H 4FHBD 1HSBA 3RKDC 3QUZD 1WA1X 3G9VA 5DK3A 1KB5H 5BQDA 4KKRA 4N0FB 4NB7A 3QDGE 3LNGA 1I8LA 4G42A 2YEZB 1B0WA 4QRRA 1F56A 3CCHB 3VXSD 3X11A 4LSUL 1YN6B 4LCWD 1RMFL 4MHHI 3JTTB 3BVXA 3ZU8A 2Z8SA 5IIEB 1FJSL 4L2LA 4DGWC 4MZ2A 4D0FA 1LP9F 3OPZH 1QO3A 2VDKH 3IJEB 1QRNB 4FQLL 4BKLA 3J7HA 4NSKA 1AXSB 2X4QA 3CC1A 4ONOA 1JJUA 3BE1H 3ULVF 3KGRA 4PW4A 4PJEB 3NRQA 5F7EH 3O9WD 3SE8L 3WIHL 4QPEA 3ZMRA 4G8IB 1JP5A 1OAYH 1MIMH 5TDPB 5DURB 4HPHA 2PO6D 3VD3A 4UQ2A 1JPST 2Z4QB 4FHJA 4XCNA 1F18A 2MCG1 5I1HH 3QO0A 3QDAA 2NY5L 5AW4B 1YY8A 3QDME 1EDQA 3EGXA 1KJVB 4XC1L 1IX2A 1QBMH 1EXHA 4MA8L 3TO4C 3U1QA 4NQCD 4G1MB 3A23A 3ZDYB 3LTFB 1EEYA 2O1AA 4Y4HC 2ZWSA 4Z6AL 1XGUB 3L54A 1LP9E 3NJHA 3VXOB 2JJLA 3AXIA 2JE8A 3NQIA 1KENH 3NTGA 3SY0B 5IQ7L 5AYQA 1T21A 4MX7A 1I7ZB 4PN6A 4KAQL 5CJBA 3TBWA 3T4AB 1IBZA 3J8F7 2YAQA 3MLZH 1I75A 3NPSC 4M6NL 3DX9A 4Q4EA 4QT5A 2R2EA 3B2VL 3HC0A 5I75C 4KI1A 4DK3A 4M03A 3RY6A 2APXA 4OFPA 4Y4FD 2AF2A 5J3HD 2RQ8A 1K3ZA 3STZA 2VSCA 4GY4A 2FO4B 4L9LC 5T3ZL 3S5ZA 1QR1A 2BFVL 5DUPH 3EYOB 5CMAA 1N5AA 1ZTXE 1J0KA 1JE6A 2WLLA 1HAFA 5IFHL 4CL7A 3WTTA 4F20A 1HL8A 2CLRA 3CFJA 1BQLH 1JS4A 1CCFA 3IPFA 3KDMB 3TZVA 3U0TA 3HPJB 1FFMA 3CH1B 5FHBH 5FGSA 1LWRA 5AFAA 4G43B 4ZD3H 5MEQB 1I9EA 4K8RC 5EU7E 3STLA 1MDAA 1H3GA 4QRFA 4ISIL 1G6RB 1YNKL 5DJ0A 1G7LA 3D50A 5BCAA 5IGXH 3DSFL 3MZGB 1NOLA 2GUYA 1OVZA 1YEDB 2WAQA 3BX7C 3QQNA 4H4NA 3RWCB 1CD0A 1B3JA 3WDIA 4KKZA 3QYCA 1ACZA 4JDVA 4XPAL 1WT5C 2J12B 4WHYH 4BSWB 3EYFB 4Y5XA 3O2DL 1EH9A 3H5CB 1EEQA 4CN4A 2P5WA 1LO5A 2ICWI 2EILB 5ELIA 5F8RC 3KJ4C 4KNUA 5AB0A 4MRBA 1YMHA 4LXFA 3CJJA 2UZXB 1P4LA 3CQFA 4JQVA 4IKIA 3MJ6A 4CUDA 3CHRA 1UJ3C 3DC0A 2VXSH 3NZHL 1XKBA 3VGBA 4XVUC 5LNDA 3TIEB 5T1DL 4KC3B 2XWJB 5HYSA 3TEWA 1AG6A 3HPLA 4BQ6A 3S36X 3TF4A 1QBLL 1BZ9B 1N10A 1P6WA 4GIOA 4P23B 5C9JA 1V3MA 1DCLA 1ETA1 4Z7VB 5D6CB 4A6YH 1AKPA 3ECBA 1C5BL 4JANB 3VI4F 4IU2A 1KFAL 1DFBL 1NDMA 3FCTB 3P3RA 4GMTL 4D7BA 2V33A 3JUYA 2AXHA 5CJXA 5AZ2H 1LO3L 3H42H 5JW5A 1ZGLP 2P93L 1EX0A 3ARGB 1WU1B 4BFFA 2DIBA 1PZ5B 3WUWA 3O8XC 4JN2B 4XN4A 1L7TL 4FQIL 4UQAA 5IVXB 3ZHLA 4JFYA 4JRXA 4F58L 3ULUF 1Y7VA 4OZ4A 4DOHE 3TA3D 2YD4A 4JQXA 1IT9L 4BEIA 3AS1A 3B2PA 4MVBC 3BPNB 2I5YH 5MHSE 2ZF9A 1KEMH 1MLBA 2R7EA 2XKUA 5EZOL 3WN5C 5E03A 3RDTC 1JWSB 1XO8A 2BP8B 3VSVA 1PDKA 3G6JF 5EZIH 2X4UB 1WISA 3V4PH 3QUMA 1DQQB 1YY9C 2LT9A 1XX9C 1NCOA 2DEXX 5GGVY 1C5MF 2QJDA 4TSAH 4CUFA 2Z92A 4FL4B 2BVPB 3QIWB 5B7FA 2V2XB 5I74B 1SEQH 5ERWB 3WGVB 1AQHA 2WUCH 2ZKWA 3RGVD 1JF1B 5CSGA 3M36L 1EAPA 4Y5YB 1CDJA 1R3KB 3DIFB 2E75C 5CD3A 1TETL 1Z6JT 3MX0B 4OGYH 3QYNA 1U8IA 2DWYA 3DHJA 1XH3A 2IDUA 4L2YA 4N25A 3NJIA 5KW9L 1MRFL 4HUXB 4JZJC 3S35L 4KMTL 1P0SL 5I73C 2D3JA 1OF2B 4WDIA 2DS4A 3LSOA 3NEXA 4TUOB 3GMQB 5ADOL 5JVYA 1G7MA 1HVXA 2VDPL 3A24A 3ABZA 4GG6A 3QXVA 4IYKA 2X70B 2CK2A 3PAVA 1Z6EL 1DANT 5KBPA 1W0YT 5IJBC 4X9BA 1F4YL 2GY5A 2A0LD 3DXAE 2DWEA 4JFXB 3BVTA 3QEUA 1G0XA 1K4CA 4U31A 1HHIB 4F8QA 3GBNL 5F89B 3C60D 4H20L 4KJWC 4Y5YA 4A7GA 3HVDA 3ZYZA 4GKZA 3VD4A 3C09B 1ZPUA 4HMCA 3KM1A 3LKQB 2OTPA 4FOMA 4TNVF 3S4SA 2YAFA 5IFHH 1NWOA 4BFKA 5L6YL 5IROC 3WEAA 4Z7AA 1JRHH 3Q5OA 1USQA 3NMEA 1U8LB 2YD3A 2GQHA 4AQ8C 5L0QB 4WI6A 2ZX8A 2UZIH 3DTXB 4ENZA 1MRCH 5DLLA 3VI3B 3Q7DA 5EUOE 1W15A 3B9KC 4LEXH 3GHBH 2XTJB 4MBRA 1W7XL 2D4DA 5A16A 3OWEA 5B21A 3FCSB 2VZSA 2OJZL 3NDYE 5IBUG 1KLFB 2O5ZH 4Q7DA 1JZEA 1WIPA 3V4PL 4NRXA 3AFLA 3PL6A 2YPVH 2WXPA 2G0LA 4ZOAA 4ZO9A 4ZAEB 1KN2L 2YAOA 1DSFH 3B7SA 3O9WA 1TVHA 3IU3B 1NC4D 3V0VB 4HXBH 5D7KE 4ERSL 3RHWK 1DQIA 4GRLA 3L95A 4HPYL 4JJ5B 1VEPA 1I1YB 3ULUL 1TJXA 1Z9SA 4ZMZA 5K59E 2R2CA 1GC1H 4EF3A 1TMQA 4AI7A 4QRTB 1FAKL 3T1WA 5JW3H 1URIA 2OLDA 5IHUL 1S9VB 1XH2A 1FFNB 4HU8A 4PRHA 1ZSHA 3WN5A 3MRMA 1FH5L 3GRGA 3QSKB 5K5YA 3CDGA 4PJBB 2AJXH 1MVUB 5L6YH 2DY2A 3GJFK 4R8WL 2F58H 4P4KD 1U67A 1F13A 4PY8J 5C2BL 1GZPA 3M7FB 3PF2A 4QR7A 5JIQA 1S9YB 1A7QH 5GJSL 1XHHA 2DQCH 4CC1A 5JZ7C 3LKNB 2JXMA 1QX1A 3FTXA 4TYUA 4AL8H 1FH5H 1E90A 2L7QA 3RIFK 1X6LA 2BJML 4DKFL 3QHFH 1CU4L 3V5KB 2KH2B 3TONA 2NXYD 3V4VH 2YMTA 4RRXA 3GRWH 3VNYA 1ORQA 1XL4A 4N2FA 4O2CB 3O9WC 4DCQB 4R7DA 3RWGB 4MNQE 1UOWA 4ZPTA 2UYLB 2MTPA 5IBTL 5EIIA 1QSEB 2BRRH 3T3MB 4Z76A 3DVNA 3HG1E 4ALAH 2PXYB 3ZX1A 1LEKA 2VXUL 3RGVC 1Y1UA 2VZOA 3V0WH 4NN5C 1MSPA 1J5CA 3VFNA 5J1TC 3MRLB 5JORB 4G80A 3RFZB 1EVUA 5JIPA 5SWQA 2WQ8A 3MV11 5SWSA 5JIHA 2AQPA 5E94A 1XL6A 3S98A 5J6HA 4IRZL 2OPCA 4HT1H 4GQRA 4JM2D 3CUPB 3QEGH 4IJTA 3V6ZA 1ZLSH 4WV1B 3H9SB 2WBXA 4FI7A 5BRZA 3ZKXC 1IE5A 2XQBL 4X5LA 5E1AB 1KGXA 3QQXA 3T0ED 3GXDA 1BQSA 4H25B 2YARA 3UOAB 3ASIA 5DS1A 3LV3B 3OG6B 4F7MA 3QEQD 2ZP9A 5EMYA 1KXQA 3C8DA 5K9QG 4Q58C 3QJHA 5PCYA 2BHFA 2VE6A 2O5YL 1SBBA 5FW7A 1PNDA 5EZIL 5T3ZH 3GFUA 1ITBB 3QORC 2WLJA 1EQHA 1BJ8A 3OV6A 4ZXBB 4KROC 5E8OA 3W9EB 1JZ7A 5C08A 3UYOD 3RVWC 3WIIH 1KEML 1W8EA 3WFZA 4H8WH 5I1KL 5LG6A 4X6DE 1U33A 3HCVB 3PS6A 4X4ZA 3B4NA 5F70A 1ZSDB 1MW3A 3V4PB 4XNBA 4AW4A 1ZJBA 2ATKA 3HE6A 1GGIL 5JW4N 1TTFA 2BCMA 5CN2A 2FEEL 4OSUL 3KH3A 1P84K 4Z3JA 1U8OA 1XCTB 5EU5A 3OXSA 5F1KC 5KYXB 2KPWA 5F96L 1CU4H 4BFEA 1PEZA 4M1DH 2DDUA 2C8NA 4LVNC 2A5UA 5CN3A 4OFVA 4PJEA 1HIMH 3EHBD 1JPTH 2VLME 3BN3B 5MENB 4KBPA 4ZOCA 5FOBB 2J3SA 3O4OC 3QCVL 3QDGD 5ENWA 1ZPLA 3FTGB 3ZTCC 1JPGA 5LJYH 4MSWB 1VGKB 3ZE0E 1S7SB 3BC9A 1KIRA 3CDCA 4FXKB 2WUBL 4NQDD 8CGTA 4YVUA 4D0BB 1GYCA 3A67H 1V3JA 3NJXA 4MVBD 4ZMQA 1JWUA 4ADGA 3SYQA 2P28B 3OB0K 1I4FB 1UURA 4LSPH 3NZSA 4IBQA 1IQKL 1T22A 35C8H 3EJCA 2H5UA 4PJ8A 5GJTH 3L4ZA 1F86A 4FA7B 4WW2A 1QI4A 1MG2C 4RFNC 2Y5QA 1JOIA 1O0VA 4NWUL 4FA6A 1MQ6L 3MLRL 5CHNA 3QI9D 5DRWA 4K3HA 2CBPA 2QVIA 4XNUH 3ARXA 5CSZA 4A7UA 3V6BR 4L8BA 2AITA 3GZOA 4WWKC 1QD0A 2A1WL 5EZOH 1L3WA 3MROA 1FG2B 1YSOA 4U6YB 1SN0A 3SQBA 3WS3A 1X44A 2XWBB 3HIZA 2BVUA 4A38A 1WIUA 3AWFA 3HAEG 4KDTC 4OD3L 1EAOA 4OF8A 2WYTA 1L7TH 3D85A 5DDHB 5A1AA 3VJ6B 3NEEA 3QJFB 4WQOA 4A55A 1CE6A 1Z9PA 5SWSB 1HX0A 2UUDK 3P3TA 4F37K 1ADQH 1CD1A 3U0WL 4CMMB 5K69A 1OB1B 2OA9A 4PJ8C 2MGRA 3PWVA 1BZ8A 1FGVH 4BH7A 3ATAA 5T1KB 2ICWB 1I3GL 4I0PD 4POZD 3D2UD 2X4OB 1NCCL 3POYA 2Y5TA 3BD5A 2UVEA 2OM5A 3LCYA 4P49A 1LWJA 2BNUA 3C8KB 3ZE1E 3T0WA 1NCIA 3ARGC 3VJ6A 2WXLA 5F3HB 1YEGH 2WQAA 3TH4T 1JZ2A 2A6JB 5A40E 3ULVE 2J71A 4JJHA 1WZAA 2JF1A 3QCVH 4D0CA 1HHKA 1NCWH 1Q1JH 1NIDA 3Q44A 1R3IL 5IUSA 4BTIA 4F8OA 1VZHA 1NGPH 2P5WB 3FFOA 5I0WA 3G9AB 1S7WB 3BP4A 1YGCL 1H3UA 4OAWB 1RZJH 3JYBA 1WFUA 2BIIA 4NZJA 5I6LA 2AGJL 5DTFA 1HXYA 4AE1A 3U83A 2HVJB 2Q8AH 1T2JA 6CGTA 4LPXA 1OM3H 4XMVA 3ZZSA 2IVFC 3DUUB 4LP5A 3FF8A 3MJ9H 4LHQB 3O3DB 2V9RA 2YA0A 5IB2B 5JQ6L 4IMLB 3DRQB 3BWUF 3DV4B 3ATDA 4XMKH 3RFZC 2ROXA 3AT9A 5JHDE 3RVVD 2BP5M 5C0BE 3NRPA 3IFOA 2FWUA 3JWNG 1K4DB 3NABL 3UO1L 4HYTB 5IP4A 4M61B 3ROOA 2G75B 4QRBA 1J8HB 5ACLA 4WUUE 1HZLA 3KQDL 4ODXB 2NXZC 2OJEA 2MWCA 1JZIA 2XA8L 4L1DA 1UACL 3W0WE 5AKRA 1GW0A 3MDJA 2QGBA 4H8PA 3O11A 1P1VA 4EDWL 1Q9LA 5GSRB 1DX5I 1ETB1 2R69H 4BDVA 4LLWA 1R5VB 3CC5B 5LGYA 4DQAA 4PP1D 1IFHL 5BZZA 1FAIL 5HYEA 2HUEA 4L3CA 2CIKA 3JWDH 1T1YA 3PV6B 3HFFA 4XBGA 2EDLA 4X7EC 4B6ZA 3BEWA 4WW2B 5IB1A 1RUMH 2YOCA 1D6EB 3IEAA 1Y07A 2UXGA 2VW6A 1JYVA 3C5JB 2YWZA 2WPLE 1LO2H 4P2QB 1MCJA 2JB5L 3E8UH 4MJIE 4L4TA 2YAMA 1G6RL 2YQBA 4W9KC 4PJBF 2QPEB 3FK3A 4PG2A 3DURB 3KZ8A 2VZUA 3DUSB 1ZIAA 3PV6A 4XBGB 3H7BA 3IRZA 3L13A 3UZVA 5CEXB 3BQVA 4B9CA 2AYLA 1MHCA 4Q4IA 1M2VA 4MXVF 1S9KC 2ZXEB 4KHXL 1NKRA 2OX5A 3A5VA 2KL6A 3HW7A 2H1LM 5AZ2L 4PJAB 3ZYJB 5E2JA 1G7HA 1G4MA 2H1PL 1XH1A 1QLFB 5D2LF 1G9MC 5COXA 1FORL 1UD3A 1VCAA 4XPTL 5DF0A 4NNYA 1ZHNA 4F7KA 2YRBA 2VZTA 1Z0NA 2WMPA 3GMLA 1OD9A 2CRIA 4UT7L 1AH1A 2PYFB 3SOBL 1JV2B 3QB7C 4L8SA 4P5MA 1JZ6A 2ZOUA 5HI3D 4ZMNA 2ZCKL 3NA4A 4EIUA 1M71A 3SE6A 4Y16B 5E7FA 1M4KA 2DJ4A 2F8VA 3JV4B 1FPTH 2OMVA 4NQTA 1EPGA 2VDMH 1N67A 3ZL4L 3E1F1 4BHUI 4EZJA 2E6PA 1RZJC 2ICEA 2CALA 4MMYA 2P5EE 4C54A 3H4HA 3D69A 2MOGA 5FO9B 2BWIA 3D39B 1FN4A 2FL5B 1RZJL 1UYWH 5E4IA 5IW3A 1BG9A 1GOHA 4FTVD 1AXTL 4OZHB 3OKKA 4K94C 5D7LE 1GCFA 1WP6A 4JX0A 3MRQA 1IKFL 4BINA 2BNQA 4JAMB 4PJXF 2GEQA 2AABL 2J2ZA 4AQ1A 3F2LA 1F3DJ 4Z78A 1TEGA 4G11A 1A4BA 5TE7H 5DD5H 2Y1VA 3N85H 1BSIA 4NUJA 1IZJA 1WC7B 3CUPA 3L3GB 4AMKH 1F4WH 2Q87A 3OAYH 4JQXC 1WK0A 3VYOA 1FFPA 4U7MA 1F45A 1UC6A 4J2QA 2K3HA 3UJTH 3T3PE 4Y19A 2VLKA 3RFZA 3MBWB 1DJZA 2IDCA 3ZIMA 4JM2C 5AUMB 4PJCB 5DUMH 1G87A 4FZ8H 1G1CA 5BVJA 2HT4C 3SDDB 3CMOH 3B9DA 1HNGA 1HYRC 2G9HA 5I15H 4X0NA 1QZNA 3WFEL 2ZXBA 4EXKA 2BOLA 1HWHB 2YPKA 4HS6A 4FQ1H 1HYSC 1BVKB 1KGWA 1QLEH 1A9EB 4HC1L 1CF1A 4JEGB 3U30C 3GSUA 1XF2A 1EO5A 2XX1A 4FKKA 5FA3A 5JPMA 2PF6A 3WEMA 5LUMA 1DVXA 2TGFA 2XTJD 1GMEA 3PWLB 3FCSA 3FSWA 7PCYA 3FOMA 3PQYA 2JKJA 3FQWB 1NL0H 3A6BL 2FX8L 3EH4B 3IJ8A 1JAEA 1E3XA 3EO0A 4P3CH 4W9GC 3QIBB 1VIWA 2GCYA 2YQ3A 4RRPA 4C56B 1JERA 2BO2A 4LVOB 1WA2X 4KMQA 4FS0A 3BPNC 3CFEA 1AS8A 1COBA 1NC4B 3BIKB 4WEBL 4YBLB 4LEOA 3GSNH 2J4WH 4MA3B 3N3EA 5IMKA 2N3JA 4N8CL 4UIMA 2V17L 4M43H 4X6CB 5E1IA 3W9DA 2ITCA 2AMGA 2GAZA 3ES6A 3A67L 3GHPA 4XXDB 3EADA 1TJIL 2ADJB 2DQMA 1T2QL 3EIFA 3LKPB 1HJ7A 5EN3A 4WWKD 2R39A 5F7EL 5JVZA 2HTLC 3BEVB 4KK8D 4U6XA 1HH9A 2QT6A 3MKGA 4Q6IB 1WAPA 4MMZB 4PJ6A 1HILA 5F21B 4DNLA 4O02A 3RVXD 2WXMA 2BFGA 4Y5YC 3D09A 5ENWB 3B2DC 3T65A 4U1KA 2BZ7A 3L4UA 4TSAL 3DPBA 3S88L 1BX2B