2YGPA

Wif domain-egf-like domain 1 met77trp of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
174
Chain Sequence
TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRWPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords WNT INHIBITORY FACTOR 1
total genus 30
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygpA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygpA01
4JZDL 3C9AC 1EMNA 2G00L 1UZKA 1COUA 1DIYA 2D1JB 4RRZA 1EZQB 3CFWA 1UZJA 1NPEB 4A7IA 1SZBA 1APOA 2WPIE 2I9AA 4BDWA 5IKQA 1G2MB 1K37A 1OB1C 1G1TA 3CA7A 1I0UA 3OLUA 2VVVL 3QMOA 1CCFA 3PGHA 4E1GA 1YO8A 3KL6B 2J2UB 2RA0L 3NTBA 4OTJA 1U8CB 2B7DL 3TK5B 1NFYB 1EQGA 1PGEA 3K9XA 4ZXXL 1IGXA 3P5BL 1J9CL 2EI8B 1NQLB 5L2YL 4ISHL 1IJQA 1IQLL 5CKMA 3KQBL 3V64C 3ASIA 4MMYB 2F9BL 2P26A 2W3IB 1WU1B 1NZIA 2H9EL 4M11A 5COXA 2BZ6L 1IQML 2D3JA 2VH6B 3FFGL 1IQJL 1L5GB 1EPIA 1WHEA 2VWOL 1APQA 1KSNB 2RNLA 4NG9L 3NT1A 5L2ZL 1ADXA 1IVOC 2CJIB 2W2QE 4RRWA 1U67A 1F7MA 4BTTA 2WG4B 1B9WA 4BTIA 4CSYA 5JB8E 5CISA 1XKBA 2ADXA 1DVAL 3NJPC 3KQDL 5KIRA 4Y6DB 2Y7XB 1TOZA 6COXA 3KQCL 2EI7B 2Y5HL 5F19A 1LPKA 1G2LB 2W26B 4XBMA 2W2PE 2Y7ZB 3NTGA 4BDXA 3Q7DA 3KRKA 5JBBE 2MGPA 4PH9A 2Y81B 2XC0L 1TLEA 3IITB 1IGZA 3N8YB 2P93L 2WPHE 1CVWL 3ENSA 1FAKL 3N8ZA 1HRFA 4Y79B 1YUFA 1NFXB 4O1ZA 2FZZL 3LTFB 4COXA 1G1SA 2VVUL 3HO3A 2P3FL 1YUKB 1LMJA 3GCWE 5L30L 1F0RB 1CCVA 4C16A 1G1QA 1ATBA 5JBCE 3FBYA 1MOXC 5E8DA 2WYJB 2W2NE 3HO5A 2VJ3A 4LMFA 1BF9A 3EGFA 2J94B 4G1MB 4LORA 2UWPB 1KLJL 2W2OE 5JW1A 4FM5A 3N8VA 1XFEA 2UWOB 4XLWA 4JZFL 4Y7AB 4JYUL 3QCWA 3SOBB 1XDTR 2VH0B 2NPRA 3ZYGA 2PUQL 1FJSL 2VWMK 3HS6A 1DX5I 2Y82B 1JV2B 3GCXE 2JKHL 2YGOA 3LIWB 1NT0A 1L3YA 4Z0LA 1W8BL 3U73A 1IQEL 1YGCL 2XBVL 1N7DA 2YGQA 2I9BA 4MMZB 2P3UA 2PHBB 3BT1A 3BT2A 1JBUL 2BQ7A 1RFNB 2VVCK 1GK5A 2Y80B 2EI6B 2RHPA 1XKAL 2P3FN 1IQKL 2DDUA 3TK6B 3TH3L 1HZ8A 2WG3C 2BO2A 3OLTA 2WPKE 2FLGA 5KN5C 4XL1A 1Z6EL 4D90A 1NFWB 2XBXL 5JB9E 3SW2A 3GISX 4X8UL 1KIGL 3IJEB 3MQEA 1IQIL 2WFTA 1M1XB 4RRXA 4BXSA 2MHPA 1FSBA 1PTHA 3V65B 4RRYA 1IOXA 3QH0A 2BOHA 2PR3B 4MMXB 1EPHA 3MDLA 5JBAE 2KB9A 2UWLB 3LN1A 1KLIL 1F0SB 3Q3KB 1IQNL 2W86A 2WPJE 4M10A 5F1AA 4AQTA 1EGFA 2YGPA 4D0FA 1P0SL 1QFKL 2BQ6A 3BPSE 4NGAL 5EGMB 1PXXA 1F7EA 2J95B 4X8VL 1LPGA 4JZEL 2WYGB 4X8SL 1HREA 1HAFA 3DEMA 1CVUA 4TGFA 1O5DL 4RS0A 1FAXL 3HS5A 4ZHAB 4RUTA 2BMGA 1Q4GA 2OYUP 2WPME 1A3PA 2FLBL 1ATAA 4BTUA 1Z6CA 3CS7L 1CQEA 2VWNL 1UZPA 2Y5FL 1HT8A 1DQBA 3KK6A 1AUTL 3LC5B 1HT5A 1C5MF 4Z6AL 5CKQA 3HO4A 4Z0KB 1K36A 4Y76B 2P3TA 1UZQA 2VWLL 2Y5GL 4YT6L 2BOKL 3N8WA 1JL9A 3M37L 2P95L 1IQHL 2AYLA 4OTYA 3HPTA 3KCGL 1CX2A 1URKA 1X7AL 3F1SB 1KLOA 3POYA 1W7XL 3ZYIB 2FD6A 2J38B 3N8WB 1NFUB 1N1IA 3ZYJB 3H5CB 4NA9L 1YUGA 4BXWA 3CENL 1MQ5L 2KV4A 2GD4A 1ZAQA 1IQGL 4CUDA 3LTGD 4ZAEB 1PRHA 2P16L 2BOXA 3LAQA 5K0HB 1LQDA 1CEJA 3FCSB 3SOQA 5CKNA 1HCGB 4Y7BB 1EPJA 2K2TA 2J34B 1IQFL 5IKVA 1IOEL 2W2ME 3LN0A 1WHFA 4ZH8B 2Q1JB 4O02B 5I46L 5IKTA 2YGNA 1LPZA 3M36L 1PFXL 1FF7A 2FLRL 2WPLE 1IP0A 1ATEA 2XBYL 1P9JA 2KL7A 2XC5L 1HX2A 1V3XB 1G1RA 1TPGA 3U7UG 3ELAL 1EPGA 3TZIA 2BOUA 3R05A 1EBVA 2BQWA 3HS7A 3TGFA 1HJ7A 3TBDA 4CUEA 1EAIC 3LC3B 3N8YA 2OYEP 4Y71B 2M74A 1FFMA 2MGRA 4ZXYL 1MQ6L 2XC4L 3SOVA 3N8XA 3KQEL 2K2SB 5JVYA 1EMOA 1FE2A 4CUFA 2WFXB 2Y38A 5JVZA 2TGFA 2P28B 1EQHA 2XBWL 3F6UL 4YZUB 4JYVL 4X8TL 5IKRA 4ISIL 3RR3A 2W3KB 2J4IB 5FDQA 1DDXA 1ATDA 2P94L 4YT7L 4D0EA 1HAEA
chains in the Genus database with same CATH superfamily
2KDGA 4KKRA 4ZS7H 1DO5A 3N3EA 3QBTB 4PB9H 2DI9A 2GSGA 4NJAH 4DP9X 2DI7A 4IIQB 2P43B 1JZ4A 1HSAB 1D5MB 4M6MH 5I24A 1S7UB 3C8KB 4ZMNA 5IIEA 2QKIC 2QSVA 2WGNB 4BDWA 3UTPE 4EOWH 5EC2A 1JUFA 4E41D 1SXAA 1HWWA 1HHGA 3LMJL 3C75A 4OZ4A 4V33A 3B2DC 1UZ6F 2X9YA 4XMVA 2VO8A 1K37A 1NFDA 1X4XA 1FVDA 4X2UA 3CA7A 4DFHA 1JZ7A 3S6XA 2A6JB 3IKCA 3HHMA 4PJ9A 3OJDA 4JFHD 4AEIL 5KSAC 2V6HA 3PYCA 3WFEH 1H5BA 2J1KA 4QLRA 4RQQB 4HS3B 5C86A 5G2NA 3U9UB 1KTBA 1A47A 5JPNB 3LXUX 1GIGH 2CRMA 3MA7A 4DAGH 1QX1A 3HC3H 2R0ZL 2YBGA 5KBMA 2A9DA 2YIHA 1JNHA 2ZUQB 2F9BT 4IOSA 3DUUA 1M2VB 1QFWH 1XCTB 4WGVB 4TQIA 3EUDA 4YSQA 5CZRA 3TT3L 4QHNB 5LVEA 1KT2A 5CIPB 1JZ2A 3KQBL 2OYLA 3V64C 2VXUH 1HCVA 5AAMA 1JGLH 3O6ML 4WY7L 4MXQD 3HS0C 3LZQA 3CFNA 2EO9A 2APXA 2IQ9H 4L37A 4P5TD 2NCMA 3FQ4A 2E9WA 3FO9B 4G80B 4YHYC 4YHNB 5CCGE 3GBNL 2ZG2A 3MLXH 4LOFA 4UOJA 5EU5A 3D39E 2BZ6L 1MH5B 1WRFA 4N0CC 5DFVD 1EMTL 2Q7YB 3SGKC 1T03H 5GISL 1IQJL 1A2YB 3L3GA 4LLDB 2XWJB 2K78A 1HZLA 1BJ1H 1N2RB 2YXFA 4X6FB 1NDTA 3MV7A 2AXGA 3QUYA 5BW7A 2CJTA 2H6PB 3T0WA 1LO4H 4IDJL 1MHCB 2YAFA 4MXVE 5DT1L 5IBUG 2QGCA 3O9WD 4RRWA 3IGLA 4CC0A 2NR6C 2CO6B 5F1KC 4YGVB 5AENA 1X5MA 5JB8E 1SYSA 3NIFF 1CCZA 5C0IA 2YPKB 1HINH 3CWGA 3KPNA 5FUOH 3WMSA 2R0ZH 4NKIL 5C7XH 1WLHA 1KFGA 4NAMA 3S36X 4WJG3 4I87A 3BUTA 3CFTA 1XXDC 4OGXH 1SDDA 5F19A 4Y4FC 5F2FA 2BSCA 3IJ7A 3RY6A 4O2CB 2LTQB 2PPDA 4Z76B 3CQPA 3QJZA 5DS2A 3MRPB 2OMUA 3MSPA 3FT2B 1IMHC 1IC7L 2X6BA 3SE6A 3DBSA 4UQBA 4L37B 3IXTA 3L54A 4F7CA 2YFNA 4B0MB 3PGCA 3SKMB 5JIQA 3I6GA 1ZPUA 2Z92B 4B27A 3LHPH 3IITB 2NNXA 1QWNA 3BAEH 3AMLA 1D9KD 1I3VA 3MREA 4DGWC 3RUGB 4X99B 2XWTA 3AQDA 1QNZH 1BAFL 1QHPA 1L7IH 4OFKA 4O58H 1LP9A 3BQUD 1E43A 5ISZA 5I6LA 1YYML 4OCWL 1JPSL 2X1XR 3A0OA 4R2GD 3T09A 1JGLL 3NRFA 4P2OC 3OHMB 3QWQB 4ZUVB 3MOBH 3QUMB 4LASL 5DA0B 1FNEB 2JCCF 3H3PL 3OQ3B 1YUKB 3F7RA 5D7IB 5J1TC 1CFSB 2O5XH 2WKOF 1SZNA 1YNTA 2A74C 3U2JA 5FR3A 4FFZA 3WFZA 1PZBA 3IJ9A 3TEYA 2H3XC 3RBSA 4K5LA 3MRJB 4X9YA 3TNNA 3W2DH 1KDIA 1XSKA 1Z7JA 4RFOL 3HI6H 3VFPA 3ESNA 4L3EB 2IH3A 3HO5A 4XCFL 1UYWL 3WUWG 4ABUA 4U1HA 4U1SA 2GSIA 1IE4A 3UJTH 1TYRA 2AITA 4G1MB 1Q9WB 1IGIL 3QDJD 4XRCB 3GF8A 2EXYD 5CJXC 5FYKH 2DQGL 3QNFA 3VWKB 1QLRB 1XFPA 4N24A 1WISA 3NG5A 2E6PA 2GSIB 1CD0A 3AXLB 3ARDD 4FXTA 3K4DA 1AGDA 2NTFA 2HB0A 2IVFC 4PRAB 2DD8L 4OI8A 4J2XA 1P7KA 5JOPD 2AV1A 2VSMB 3H85A 2Q7YA 3O11A 5FFLA 4H25B 1XHHA 4URKA 3BH4A 1J0JA 1T1XB 3L3OA 5IP4A 1O6SA 4WDIA 1OSEA 4EBQH 2AJVH 1D7DA 5EUOB 3WDJA 2A4CA 3GCXE 2VUOA 5HI5D 3SDYH 1FJ1B 4LSSH 1T80A 3IRPX 2LVEA 3CXHJ 4X0NA 3T6QC 1KBGH 1U8HA 4RX4D 3V79C 3BP5A 4TNWK 2FIRT 4L18A 1UKTA 1UD5A 1N7DA 5JMOC 5CBAA 5LG6A 4MMYA 2GK0B 3PHSA 2EVHA 2ZYRA 1IE5A 4WJKB 4F91B 2AHIA 4N8VB 3OV6A 1QFOA 1NCIA 2DI8A 2VN7A 3O2VH 4LLYA 3WI9A 4HGMA 4LU5H 3SIKA 4L8DA 2K4WA 2WD0A 3ULUC 3TIDB 4P5MA 2RHPA 5IB1A 1KWKA 3FTXA 2WQUA 3TEUA 3DDFA 3V7AE 3X1GA 1FZJB 4EIUA 5AKSA 4DZBB 2A1WL 1BYPA 3BWSA 5KN5C 3WNPA 1NC4D 2J2ZA 2H2PC 4ZMYA 1QRNB 3FB6A 3FFCE 2XBXL 3QYCA 2ZOUA 5E0FA 5FYJU 4C55A 4BUQA 2UZYB 3V4VL 3BZEA 4G7VH 4FQXA 2GY7B 1ESOA 4HU8A 3EJQA 1S78D 4K7PH 2IAMD 3RDJA 4H20L 4TVPD 4IIZA 5EZIL 2VIRA 4IMKC 5DO2D 3ZO0A 1OTTC 2GVYA 3AB0C 4IRSC 3HPJB 3QE5A 1L9QA 2Q3XA 1FL6A 2J55A 5EO9A 1SBSL 4J8RB 2EXSA 1IOXA 5JDSA 1CB4A 1F8TL 2PR3B 4MMXB 2G9HA 1OT1A 3FTSA 3QUMH 2PKDA 2EVGA 2ZXAA 5D6DC 1J05B 3QWOA 4M5ZH 3VI3F 4DGUA 1WUZA 4PGJA 5I6XB 4XVJH 1KIRA 4JQXA 2IV8A 4H20H 3BN3B 3Q9QA 2FEDC 4WI5A 3SDYL 2YGPA 5FF6A 2W59A 5J06A 5EU3A 3FPXA 1NMBL 1BECA 2R0KH 4OCMC 2XCMC 4FCHA 5EGMB 2EE3A 4BZ1A 2ROYA 5K93A 4EIBA 3OAZK 3NJMA 1M7DA 3K0WA 3U1SL 2WYGB 1X6LA 5F7YC 1NUNB 5DC2A 3V0FA 2ZSVB 1GA2A 3L4ZA 3IDXH 1AACA 2I60L 2YO3A 3OXSA 1PU0A 5IVXE 1GZPB 1ZWIB 3H9YA 3M8OL 4M8QB 2NNRA 2K8QA 3Q8FA 2H45A 4F15B 2EEFA 2VMCA 3T04D 4WI4A 5C0AD 3MOAL 4P9MH 5T1LB 1KENL 2NY4B 1HDMA 4RGMB 1JMXA 3VYPA 4JFFD 2D7PA 5CNHA 4J39A 4JBSA 1ONQB 4IGBA 4OM1L 2J8OA 1TKWB 4HQQH 2QQNH 3DHPA 4CDGC 2P24B 4XZ4A 5C08B 5LNEA 5JR1H 2F8IA 2B59A 5H2BA 4GO9A 1T20A 4QNPE 3FHAA 1R75A 4FI6A 4QHKI 4PWJA 3KK6A 3MVSA 2X44D 3NGBC 5DJ2B 3ALPA 4HWZB 4WSKA 4Y5VB 5FO7B 1ZANL 4FTVE 4HJUA 2FL5A 4UINH 5TF0A 4UAOC 3ZQ9A 4ZBJA 4AEHL 4E9VA 3EADA 4GRMB 3WGUB 3M46A 3NJVA 1QQDA 2BDNH 2QPSA 5DLML 1WHOA 2OTUB 5EBGA 3PIQB 3FKUS 4G8IB 3PWJB 1I3UA 5ESVB 3C60D 3HPTA 1BYNA 3PP3K 1M53A 4NQVA 3VQ2C 4A63A 1KLOA 3ZR6A 2OTUA 2HLAA 1AO7D 2ZUXA 1P7QB 3NCYS 3ZYIB 4N0YH 5DLLA 2CLRA 1U8QA 1F8TH 2RHEA 5AZ2H 1BMZA 1DSYA 3TO4B 4FQ1L 4DO6A 4POUB 2H26A 2NY6D 1JXJA 1BD2E 3B9AA 4HJ0D 2IANA 5KVGL 2ITDB 4OBSA 3BH9A 3CNKA 2E75C 2MHAB 1H9VA 4RZKA 1C7TA 2H26B 3U6RB 4GSXA 4PCYA 4PEEA 2GITB 2I7SA 1FSKC 3MDJA 3O45B 5I1IL 2CGZA 4WHDA 2E7MA 2FGWL 1DQJA 4PG2A 1K6QL 1ZVNA 2MNWA 3JWNG 3RFRA 1TEYA 3OMIB 3MJ9L 4U1MB 3PPEA 4JJHA 5E23A 4PVBA 1JWMA 1S3KL 4PWKA 2OP4H 1IEBB 3QRGL 3BVWA 1Y6NR 3O3AB 3GNMH 4IEFB 4O02B 2G0KA 3EGSB 5DHMC 1U8OB 5IMKA 1A3RL 1A7QL 4FA8A 4M9PA 4PW4A 5ADPL 3G7TA 4G7RB 2DY2A 3FQRA 4AQOA 5I74C 2NQCA 2A6JA 4CVWA 1G7LA 1SYVB 1S78C 3EXJA 5DR5H 2WPLE 5E8PA 1GZQB 1RUQL 3EGDA 2IDCA 4UOQA 4KXBA 5CR1A 2CDFB 2R0WH 2WINA 4PI0A 1AFVH 5C08E 4KQ0A 1FO0L 4JFDD 4DUWA 2MCPH 1ZVSA 1YNTF 1GGYA 3FQNB 3FS9A 2B0SH 5I1DA 3B6SB 3VXPB 3R4RA 2Z35B 3D4YA 1I8MB 3MJWA 4UTCA 4NO5A 5HYIA 4N26A 2VXSL 1RU9L 2EVFA 1I3RB 1QFUH 3A67L 2Y7NA 5D1ZA 2X53A 3WJLA 5H4ZA 1ECZA 4HPYL 2YAMA 4BSWB 1F6FB 3EIFA 1OL0A 5B1CA 2WBJD 4XMLH 1OCWH 5GJTL 1OAZL 2ZAGA 1K6QH 3V5DA 3RX5A 1U58A 4PYGA 1N64H 4U6VL 3RUGF 3WNIA 3FOLA 3PWUA 2XBWL 1IGTB 3ROLB 1C1EH 5EF2A 4ISIL 5FPIA 2VLJD 1RJCA 1IGJA 3QYNA 1Z5YD 4IDJH 4WWKD 1I82A 2PO6C 1JNJA 4H88H 4PY8I 3SE3A 5E5UB 4URTB 4RGOL 3OQRA 4LVHB 2XY1A 1ROCA 2QZ5A 1IKFL 4WTZG 3HN3A 5KBDA 4U1GC 1COUA 4M7JL 3SN6N 4QGYA 3ZSTA 5IUCA 4ALAC 3GSVA 5A2LH 5JYMA 2IADB 4GQPH 5IJVA 1YYCA 3V10A 1SZBA 2GJ6E 3MLXL 5AVUB 2APVA 3V0IA 2I9AA 2CHNA 4Z7WA 4NHCH 3SDAA 2XTSA 3QIUD 2VXVL 4OZGB 4AZ8A 3IFNL 3VXRB 3D6GA 3A3YB 1XEDA 3DX4A 3PNWB 1SXBA 5JZ7D 1I0UA 5BS0D 5C3IA 1I3RA 4H8WC 2NY0D 3OKMA 2H9EC 3UJJL 3PGHA 3FQUB 3FUIA 1CYWA 1A6TA 1EO8H 3D2UD 1UG9A 4AEHH 1U8CB 1MF2L 3VXNA 5T1KB 1DQQA 3UCRA 3HE6D 1G1OA 4Q9QH 1KXTB 1R5VA 1EEYA 2ZCHL 3MJ7A 5AOKA 3GLZA 43C9B 1JF5A 3GTNA 3L3OC 1ZHBA 4TNWF 5IHZB 2WTRA 3MV9B 4MTMA 4NQCE 5T5NG 4I5BA 3SGDH 4EUPB 3RZCD 5JIPA 3H9ZA 1TKWA 2OKMA 5DD5L 5EOQH 2A73B 2ZOTA 5CN3A 4BK5A 1QIUA 1CGUA 4QHPA 4YX2L 1CTMA 1DBBL 3DSFH 3EGSA 5HHMD 1NZIA 1BZEA 4JVUA 3I6SA 5KSAA 4AEFA 2PCYA 4JNXA 2CAKA 3D0LA 1WD8A 3ZW3A 2BX5A 2DH2A 2VH6B 3D48R 2VDRH 4BHUA 2FLBT 4PFEA 3BUBA 4BZ1H 2CR3A 4RFNB 3QZMA 4Z3TA 2XWXA 2H2SC 3H9SB 4GW1A 1Z5HA 4L4TE 4JR9H 5J4MA 4CSYA 4Q4EA 3L95A 1VF5C 3HBGA 3MYJA 4FG0A 4P46A 4ZFGH 1U95B 4AT6B 1C9SA 3AM8C 4JDEA 2LAGB 2HH0H 1KEGH 4IKIA 5CP7A 3VFWB 1QFHA 5ITFA 4TQ8A 3UJIH 1Z9NA 4ZDHA 1LO2L 5I0WA 1SQMA 4C59B 3PLYA 4PLJC 4PJ6A 2XQBL 3QHZL 3ATBA 3BAXA 1CGSH 4MB3A 1GZHA 3AREA 3DGGB 3RVTC 4NQCB 1FLTX 1KJMB 3BCDA 5D4QA 3GBML 2V3DA 1L6PA 3FONB 5T33L 2NW2B 2N7BA 4B96A 2R1WA 3FQ1A 3X3FL 1A6VH 1R5WB 2VC2B 1E8ZA 2J56A 5INCA 1A6AA 3CLWA 3W11C 1P1ZB 4NQQA 5JUEL 5HDBE 3JWNC 4OD2A 1FF5A 2O72A 5F1NA 4X7EC 3N8YB 1UURA 1YMMD 5DJDB 5EIIG 4F2ME 3AT9A 3WTWA 2Z1PA 5J57B 3U9PH 3O8XC 5G5DB 1UOWA 4GINA 2MFNA 5D6CB 4O4YL 1A6UH 1SJXA 4HC1A 4PJBB 5TK2A 1VACB 1RVFL 5BVPL 2NTSP 1KIUA 3DHUA 2IBGA 4R4NC 4OAWA 4U1GB 1F4YH 1A4KB 2DWTA 1BWMA 3S3JA 3DO3A 4IU2B 5TQ0H 2Q86B 4L8BA 2ZX5A 4NQUA 2AJXH 3R4DA 3HIZA 3L5XH 4CMMA 3G5ZB 2RCSL 4KROB 4LL4A 4NLAA 2OJEB 4ZO9A 2WAHA 3NIDF 1OP5H 4Z7UE 4N2OA 4P04A 5C8JA 2ZXGA 3MA7B 2XTJD 1P4BH 3TH4T 4PJXF 5CCKL 4OY9A 4OLYH 2AQNA 2VZSA 1T21B 3ARTA 3NPSC 4NJAL 5HYEA 1AGEA 5E5LA 1AQDB 3V52L 1KCKA 4FTVD 3HPLA 3O6FD 1CVRA 5JW1A 3FQTA 4RFOH 1CDCA 4FQPA 1KCUL 1C5BL 4I9WD 4MQSB 2BIIA 4QXGH 3OSKA 3K6NA 3QIWB 2BIMA 5IMMB 4QRSB 4JYUL 3ALWA 3US9A 3VFGH 3ZL4L 2ENPA 4XOCA 3SOBB 2O5ZH 4MDIA 3Q3GA 4HD5A 1VB9A 4R0LB 4LZKA 3MUY1 1FNEA 1X9QA 4KITB 5B39B 2PPAA 5EOCH 4BELD 4Y9EA 1J0HA 3LEXB 1JGEB 4R4FH 2Z3FA 5ACZA 4M6NL 4OZFG 5D1XC 3WXWH 2JKHL 2YGOA 3D39A 4XMWA 2F8OA 2WUBH 5T3ZD 2DQFA 5I0YA 3BWUC 1JPTH 4FP8L 4I0PA 2E6JA 3FAXA 3HN5A 4GKNA 1P7BA 3UG5A 1HHIB 4PJGE 1ETZB 2XBVL 2G30A 2VSCA 2WLYA 3LNHA 4KJYB 3CMOH 3I74A 2VRSA 4F33B 2I60H 4RBPK 4AYDC 4K3JH 5CP7B 2KZWA 3DO4A 4ENED 4O2CA 1YEEH 5I8OH 3FW6A 4FQQB 5AOLA 4DOHB 1FO0B 5TDOB 3SKNB 4ETYA 3MBWB 3KNBA 3HPLB 1E5BA 3PQYD 4HKZA 5D5MB 1AG6A 3AZUA 5I1GL 2L0DA 1CLCA 2OJZH 1HZ8A 1SJEB 4JO1H 1QSVA 1KB9J 2C1OA 5B3JF 3SBPA 2AJ3A 2HJKA 2WPKE 3DX8B 2CCLA 3CZKA 3ARZA 3LDBB 5KBPA 4XN8A 2ZCLL 3U79A 1EH9A 4FF9A 5CUSL 5GGUB 1JPEA 2W9DL 1UJ3B 3B2XA 5IJKC 3U36B 1CBVL 4JREC 3DX8A 1M1XB 4GRWE 3GXDA 4NUJA 4KKQA 4XWGH 4KQ3L 5E6SB 5EZLA 4GG6E 4Y2OA 1F00I 5J0BA 1NKRA 2GYSA 3QO1A 1GSKA 1A9BA 1FAIH 3CFBB 4NNYB 1F58L 4Y2LA 3POHA 2YPVA 1HEZB 1O5PA 4G8GD 1DVFD 1WYJA 1DBMH 1E6OL 4KQ4H 2ZIDA 1F6AA 1UWFA 2NY2D 4NT6A 2QSQA 4JPVL 3KPMB 3VH8B 1AKJB 2EDBA 3WHXB 3ZYJA 5JXEA 3CFBA 1A25A 1M3JA 2JKTM 3KH3A 2AEQH 3MRCA 4DW2H 3QO0A 3JV5A 3BD3A 5D1QD 4L8DB 3VRLE 2VXUL 5EBMB 5GHWH 1F0LA 4S11A 1USZA 4KZEH 5K33A 5C07A 2WPJE 2VLKA 4H1LB 4Y1SA 1EGFA 4AQTA 2X2JA 4JRXD 4Y9FA 3UMTA 4W4OC 4TQHA 1NM9A 3V7MA 3BPSE 1LK2B 1ES0B 3HG1B 4TKWA 1U3HB 1QRNE 3PGFL 5B7EA 3T3PB 4OZHE 2IGTA 4I88A 3TA4D 2WWMC 2Q8AL 3CZLA 3MR9A 4EJ1C 1S7WB 4XP5L 4Z3GA 4N3UA 4RS0A 3CDGB 4KI5F 1RZIB 4UF7C 2CHWA 1KLGB 2ZP9A 2VABB 3OZ9L 3QDGB 4XWGL 1Q4GA 1T5XA 3QAQA 4C56E 1KCWA 2ESVE 1Q1JL 1P1ZA 3IMSA 3UADA 5KSUB 1BJ1J 3SDXB 1HCYA 1ATAA 3BAKA 3SDCC 2BSSB 1MPAH 1YDPA 4M6OL 1JGEA 1SMOA 3MYZA 3G5XA 3VXOB 2J6EL 1E5AA 4PJ8B 1Y0LB 4QO1A 3SO5A 3ES6B 4W9GC 5FKPB 1G7QB 4OR1A 4AIZA 3QO0B 4M93B 4ADJA 2XSKA 4OTXL 1SJHB 2BDNL 5FO2A 2IDFA 4IMLA 4OIIH 4R7VA 2ZOWA 4A7GA 3SYAA 4JE0A 1PEWA 2P3TA 3ZKND 3WNOA 4F7CB 3Q8AA 2MH4A 1XF2A 1UCBL 2ZAHA 4IRSB 2ZYIA 2GTZA 5JW5A 4Y4KB 2EACA 3VX1A 3ZXAC 5DUJA 4OCYH 1HU8A 4ZUUB 4UUJA 3UYRH 1XR8B 1VEMA 3QQ4B 2WHVA 3IETB 2WTRB 3MV9A 1S9VA 1MN4A 2UZXB 4G80A 4UT6L 3TESA 1Z9SA 4A94C 3LZPA 3T3PF 5CZVH 1KZYA 2E8ZA 2KPWA 4KO9A 3RVWC 1L3WA 4BH8A 5ECJE 4CGTA 1NFUB 4WI2A 4P8QA 3D2TA 3TFKD 4BXWA 5DSCA 4PB9L 1OK0A 3KMDA 2QR0B 2BSSA 4J3UA 1XCQB 4AGNA 4LASH 4PRNA 4BGDA 5CM1A 2ARJQ 4F8QA 5DD0L 1X3DA 4I77L 1JMZA 4YS4A 3IDIB 5I15L 2J34B 1INEH 2B3IA 1K9TA 2A6KB 4WNQA 4CSZA 2CO7B 4DEPC 4XBEH 4U1IB 1V1HA 1GHFH 3BKJL 3CJJA 2AXJA 3LN0A 2SODB 2MKWA 1D5RA 4Y19B 3V5HB 4FA6A 1SVCP 4LHUA 4PCKA 3C9NB 4DN4L 4YMPA 2Q1JB 1L0XA 5D7JA 3OZ9H 4L0ZA 1KC5L 1I1AA 3VNZA 3NRQA 4P06A 2Z7YA 5T3XE 5AVTB 2AJYL 1UXLA 3OKMB 4HGWA 1P4IL 4ONOA 2NXYD 3WJMB 3WY4A 2X4SA 3QUXA 2DIJA 5HI4D 1ETJA 3KYOA 4I13B 2R29L 4LBAA 5T1KA 3CHPA 4YSDA 1INQB 2GT9B 2VQ4A 3N43B 5HY9A 1QEWA 4JG5A 3DSNA 3TO2B 1UT1A 2XC8A 1DN2A 1M4KA 4ONGH 3CU1A 1FL3B 4RSYA 5GJTH 1MY5A 4AV5A 3R05A 1CICB 1GYCA 3VD0A 4XO3A 3TGFA 3PWLA 5D2NA 3GJFK 1XZ0A 4R97B 1R47A 4HOZA 4XPAL 3TO2A 5C9KA 1V3KA 4GP4B 4Y1AB 3TWYA 2HKFH 5GS2H 3I75A 4OLZL 3GGWA 3MGTB 2PYEA 1FYTD 3JWNE 3CZSA 4GRMA 4BK5C 4AQ8A 2EJ1A 3IFPB 3QDJE 3SKUD 2WYHA 4HHAA 4HXAL 3SDDD 3T5WA 3QIUB 4KI5C 1TVDA 4N2HA 5JPMC 3SGJC 1FZMB 3ZL1A 5B38G 1S8DB 3QJQB 4ANWA 1JNNL 3CVHL 5EH1A 1AQ8A 2EYTB 2V2XB 2Z0UA 4DH2A 3Q1EA 4NHUB 1Y7VA 5CCHE 1T89C 3FO0H 5CSZA 1H3VA 3RR3A 3ZQWA 2J4IB 2DV6A 5J12C 2YAOA 2CA4A 4N2BA 5ETUA 1CXLA 3LIZL 3IU3B 3S3PA 4ONHB 1JF6A 1NLDL 2O4EA 4NNPH 3CVBA 1U8JA 3TT3H 3HNTH 4HIHA 4CUCA 2NMSA 2VLJB 5LHDA 2Y5TA 1E28B 3P0YH 5I1CH 1UZJA 1CG9A 1U93A 5GQBA 3SE9H 4QAMB 4AC2A 4U33A 2C9VA 1CFQA 1X5HA 4FQXB 3OMAB 2EIZA 5I8KL 4XOAA 3NJLA 1QSEE 4S0HA 4K3JL 4OCXL 4MQ7A 4FJYA 3E1F1 5DQDH 4KDWA 5FYLE 1B3JA 2ZWKA 3RU8L 4KQ3H 3BH8A 3LPWA 2KC0A 3F85A 4KY1L 4NQED 5DCCA 4ZUTA 2ORBH 4NQEB 4R7DB 3O6LL 3AWFA 3OAZH 4M5SA 2JQZA 1IGXA 1GRWA 1TSRA 4NPJA 3QWOB 3PJLA 2EDQA 3MROA 4YBQC 2P80D 5ICYB 2ARJB 2IPKA 4WUUA 2VDNL 3RVWD 5F0MB 4Q0XH 4KBPA 4R7DA 1VCAA 3HUJA 5BJTA 4RIRB 2FTAA 2VC2H 4HC1H 3K4AA 3L4YA 2X5PA 1NIEA 5IWLA 3MROB 4G7SB 4YDLB 1D6VL 1G7QA 1QZNA 3DYPA 4QRTB 1NANI 2W65B 3EJRA 5F21B 3POCA 2CK0L 2D3JA 3EBIA 4GPVA 3UAJC 1LO5A 1NOAA 2IDQA 2RJMA 1VZHA 4N2KA 4PMFA 5CJQH 2VR7A 4BH7A 4FG2A 3ZOAA 4FYQA 4MA1C 2IWKA 3PWUB 3MCG1 5E1QA 5ENWA 4AOFA 4TOYH 1CXHA 3IM1A 1BIIB 4HJGA 2VDLH 3SCMD 3ZO9A 2ADXA 3T65B 4A6YL 4K94C 2IGFL 4L1HA 4BSWA 2FZ3A 4BDVA 4YPJA 5L4FA 3QNZB 4IRZL 1KIQB 3TO4D 1VCBC 3PXLA 1FL5A 2CM6A 3L4CA 1OAUH 4WO4C 1LYQA 2CZNA 4F58H 1LJMA 2E7LA 4Q2ZB 4X9IA 3VFGL 5I0VA 1ED3B 4HPOL 3CIAA 3L4XA 1LPKA 2C9UA 3HZYA 2BY2A 2LLLA 3EYVA 3ZRSA 1YN6A 4IK7A 1J8HA 3QK0A 5F0LB 5F3HB 2MRYA 5DJAB 5A6MA 4DZ8B 1NEPA 1ZJAA 5FC9A 4UDTB 2Q2LA 4YHOL 2Z8VC 4HETA 3WHXA 3KRKA 4L29B 1GYAA 5BRZE 4ONGL 5C0CE 2E5EA 1ROWA 1ADWA 4L4VD 5DTFB 1JF1B 1WGVA 2EE2A 3CFUA 5E5MB 2BS9A 3V7AG 1FFOA 1NZRA 3NGBB 2R56L 2RR3A 2QQLH 1X44A 2PCXA 2AJXL 4COXA 1G1SA 2VVUL 3MZTA 2P3FL 4M1DH 4IIQC 3TYGH 4KPHH 4M7LH 2CKBH 1OE1A 2GKIA 3F12B 3KGSA 3TM6A 3WXVH 1V7NL 3VXSA 1KYOJ 2GITA 1XH3B 3N04A 4B5EA 4JKPL 1GW0A 1ATBA 2VABA 5B8CB 1HTYA 1XBDA 2YXVA 3CFQA 3K46A 2ZJSH 3DROB 3O4OB 5KOMC 3N2JA 4LNVA 3DVNA 5AW9B 1T20B 2DRUA 2PF6A 1UVQA 3IDNA 5AW1B 1BQHA 3EGFA 2ZWYA 4N1CA 3WY3A 1MCWW 2ADJA 4FOMA 4F7MA 4NC0B 4Z7VF 2QPUA 5D2LF 3AAZB 5GXBB 1V7MH 1WDAA 2ZX8A 2EAEA 4PJHE 1KG0A 4WU7A 5FKPA 3TLRA 1XZWA 2ZPKH 5HGBB 4JPVH 3OGCB 4MAYD 2F7IA 3U4BH 2YPKA 3WCYA 3X17A 3JV0A 2RQ8A 5E2TL 1B90A 1HCZA 4XCEA 3BQUC 4Y4KD 5KJ4A 3D39B 3QCWA 1ZVSB 4MD0A 1EGJA 3CFJA 4HZLB 2UZIH 4OZHF 3ZLQC 5LQBL 5T1JA 1IFRA 5HYFA 3ZYGA 2WLLB 3EOAA 5FCUH 3EFOB 2VLRD 4NZFA 3GKWL 3T71A 5T1DL 4MNQD 2P5PA 1MFCL 3AQXA 2OCJA 3U2IA 3HS6A 3RGHA 1F4XH 3WV0A 3IXTB 1U9KA 1BFOB 2CJUL 1KJ2L 1NT0A 1XSIA 4IHOB 1OPOA 3UP6A 1JWUB 3ZE1B 4M6ML 3H7BA 4Z0LA 2X89D 4ZZKA 4L3EE 1NBQA 2OQJA 3AGWA 1J8KA 4FE9A 3MKKA 5HDBB 4MJ2A 5CZKA 3KPPA 1AGEB 3IU4L 1YN7A 3BPNC 4N85A 4U05A 5EPMA 2EDEA 5B1AB 3ULSA 3AC0A 4UQ2A 3ARFB 4UTBL 4YE4H 4XMZA 3LKSB 3GBLA 5D55A 4N8VG 4ZUTB 1EAQA 3JV6B 3X11B 2XWCA 1UJ3A 2YS4A 2DWSA 1Q1JH 3TCTA 2X10A 1XKAL 1BSIA 2DYPD 4O02H 5EIQA 5EORH 2D0FA 4LEBA 1OM9A 4D3CH 1B0GA 5JYLA 5JPNA 2J44A 1WQVT 1FZKB 1X4ZA 3WY2A 1T2JA 3N9GL 1TDQA 1VKXA 3OLTA 5E5RB 3EYFB 4U6XA 4F8TA 2YEZA 2PABA 1HN1A 3BMWA 3U2SA 4HCIA 4DQAA 4L3EA 5CEZE 2Q8AH 4NN7B 3RGVD 3SZKC 2X4RA 5LGYA 3NEEA 3LN9A 5ISZD 2D0HA 3C6SB 5IFJA 3PGDA 3H9SE 4PRIE 1EO8L 1WG3A 2DQFB 2FX9L 2Q2EB 2XACC 3EJTA 2OYKA 1RZFH 5FKAA 3CN2A 3WNLA 4YEEA 1JOIA 5GSRA 3VXUA 4TYUA 2XZCH 1HT6A 2JB6A 3AABA 3PJNA 4LEXL 1JXGA 3ZKSD 1IUZA 3RDTD 1MFAH 5IVXF 4UNIA 4X8XA 5AUMA 1TQSA 3EJZD 3P2TA 5B3JE 1ES0A 3AS2A 3HG1A 3LSOA 2FWOB 1QHQA 3H55A 1J88A 3GMMB 3TOPA 4BH8B 4U6YB 2ZKHL 1YUHA 3SKNA 4O5LL 1FORH 5HD8C 4LMQE 2B59B 4IOFC 3MREB 1CC3A 1ZT7A 3QEQB 5KANG 4FCAA 3CN0A 3ZDYB 4J3TA 1O9WA 2GJPA 4KKLD 1SPDA 2KKQA 5IMOA 2ETWA 3D3VE 5CCKH 4KV5F 4LXFA 2BQ6A 1G7LB 4DVBA 2TAAA 2QADB 2Z91A 1LPGA 3GRBA 4UB0L 4BQ8A 4F1SA 3VG9B 3K5RA 1RHHB 3W82A 4NQTA 3OBAA 5EDSA 2DLIA 2BO0A 5D5ME 3PAUA 5A16B 3ZZLA 1V5JA 3L5WB 1BYOA 1GJUA 5EG6C 3MXWL 4QO1B 1A1OA 3RA7H 5BXFA 3HG2A 4MSWB 1UH4A 2F53E 4ONFL 3V0VA 5DJ0A 5GGSY 2YGVA 2F74B 1KCBA 3HC0B 2ZCZA 1KELL 2K6ZA 4BCZA 1YEEL 3GZQA 4JMNA 3P2BA 4J3WA 3ZGHA 5C8JB 3F6IA 1AKJA 3FN3A 3MBWA 1IQWL 4GRLA 4YJZL 2W1NA 4MA7L 5A2AA 5MHSE 1B6UA 1ICTA 4R2GB 3CCHA 4BXVA 4H2AA 4JG1H 2VDKB 1OGAD 3ABMB 4HW6A 3DPBA 4MLIA 4KX9A 4OGZA 3GBMH 1E4WH 4GQ9L 5D72H 3GHBH 2DKSA 3FB7B 1CICA 3NJIA 3HO4A 3AY2A 1N7ML 1CLZL 4PTTA 4APXA 4QI3A 1BOYA 1CBVH 1P7KB 1IAKB 5B1KA 1UATA 4JO8A 2ITEA 3U1PA 2VIRB 4NP4L 5IEHB 4O9HH 3FOMA 1AS8A 4PJ8A 1FIEA 1E4KA 3HN8A 4PTTB 3JTTA 2C1OB 3BGFB 1G9MH 2LT9A 2DQMA 3NJXA 5IEHA 3C6LA 1UWXK 2WXJA 4G3YL 2DYRB 3N8WB 4RDQG 3ZUNC 3ZYJB 4FYRA 1EXUA 1A7PH 2WQAA 4DZBA 4PRPE 3U9UA 4AH2A 4BQCA 1TPXB 2GD4A 4G6ML 1KKEA 5IOPB 1ZHKA 5GRWA 2YD8A 2KS0A 2XIBA 3OAYH 1KGJA 2BY3A 1E7VA 1DUZB 1W9XA 5J6GA 1HYRC 1QBLH 4HWEL 3SO3B 4Y7BB 3E2HC 4NOBA 5AZ2L 1EEQA 2XTJC 2YSSB 4NZTH 1LK9A 1W15A 3MLVL 4PBDA 1A4JB 5AVWB 5J13C 5KN5A 1Q9LA 4PJ7B 4RFNC 5AZEL 4X42A 1WHFA 1Z9MA 4MMZC 1TQVA 5DHVH 1HXYB 4NQDB 1TXKA 1NL0L 3T9WA 3BN9D 4X7DC 2X12A 2C9RA 1T83A 2J5LB 1RHFA 1RZJL 3FB5B 3T65A 3EYSH 1FJ1A 4B9ZA 3K2UH 3WEOA 1DVXA 1G9MC 4K9JA 4YDNA 4H8UA 5DRWA 3ZL4H 3P3SA 4EI5C 2D7TH 3ZDZF 2CK0H 4ZAKD 4PJEA 4F7KA 4F9LC 4B9YA 1OF0A 3MJ8B 3SQRA 2N1TE 3OHXA 3SY0B 1HX2A 5MEQB 3QO1B 2QLYA 2WWMD 5DFWH 3V0DA 4Z77A 5IW1A 4Q9RL 3I6KA 5LNDA 5BZDA 3TZIA 4NQCD 1RZJH 3H54A 3LZNA 2VRAA 4FTDA 1LXMA 1E9PB 2GG1A 2AK1L 4PJIF 3NCMA 1NOFA 2EDTA 3AMKA 5GRJL 5C70A 5IESL 3GHPA 2RTTA 1EAIC 3J2PA 4QOKD 1HX0A 2BPBA 5E6IB 2BP0B 3MUUA 2VL5B 4UM9B 1NBVL 1ET5A 4HDIA 4X7TA 3WAJA 1CDYA 5JW3L 2N0MA 3MUGA 3NCJL 5CSBA 5KVGE 4I3GA 2RALA 2Q86A 2HVBA 1RI8A 4NP9A 3FQUA 3WUWB 1XBRA 1CXEA 1NCNA 1L6XA 4LSVL 1LEIA 4WJ5B 3H9SD 5C09B 3GI8H 2R8SH 4PD4J 4JYVL 4X8TL 4OZIF 3P9WB 3ARVA 4IHBA 4QD2E 4BH7B 1ZGLP 1SFDA 4KFZC 4LLWA 2VN5A 4KXZH 3DPBB 1ATDA 2EZ0C 2WXNA 2UVEA 2Y7OA 4K3EH 3GLEA 2B9BA 3O3DA 3KLLA 1AP2A 3E6FA 4H26B 2DMKA 1OVZA 2LFEA 3JUZA 5GRXG 1EMNA 1LQSR 1UZKA 1N5YL 1WAPA 3LPFA 3VGFA 4LSVH 3PWNA 1HHGB 4OZ4B 3ROLA 1W0VB 4JHAH 4RMTA 4GUOA 2ORBL 3BT2L 3RGVB 4YDIL 4K94L 4ZSOA 3IJ8A 4XCCL 2DWXA 2G60L 3LIZH 3VXMD 1IGFL 2B4CH 4GUPA 1QD0A 2EDMA 4GQZA 1AO7E 1J10A 4HS3A 1MUJA 3H53A 1OB1C 3O2DA 5HHOD 3AY4C 2OZ4H 3WS3A 4LFHD 1ZAGA 1A4KA 1T89A 2WXOA 1TITA 2WZPA 4ENEC 2FCBA 2VQUA 2XDHA 3ZTNL 4XGZB 1XR9A 3RUGE 5MP6H 4EN3D 4W6YB 4L1BA 5E99L 5F9JA 3ARFD 3B9KB 3DIFB 4UYQA 2F7QA 5FLVA 2NY1C 4BUGA 1EFXA 4HMCA 4QRPE 3ARYA 1MF2H 4NIYE 3QEGL 4YSCA 4O9HL 1V3MA 3UJJH 3D87B 2UXFA 3PXJA 3L6FA 2PXYD 3UAFA 1UM6H 5EIVA 4FGMA 3ASIA 1A0QL 1MCSA 4NJ9L 6FABH 3HI5L 4J3OG 5KVDL 1IBZA 1KLFA 4N5ED 4Z7WF 1FE8L 4NO3B 4TSBL 3O2VL 3S36L 1W0WA 4JPWL 4NX0A 1MCWM 2DM2A 1OB0A 5HDOA 2MPVA 2WVTA 4MA1B 4TUJB 2FHBA 3FFGL 5CHNA 5AVVB 1D5IH 2EUXA 3K6OA 1GYUA 4XI5C 3MA9L 3VFMA 3KPSD 1QSZA 1I1FB 2NSQA 5AB2A 1I4FA 5B38A 2PTVA 1FHGA 3F65A 1XX9C 4MAYB 4NHUA 3ZDXE 3H3KA 5LBSA 3QQ3A 4XMPH 2XVLA 3DXAE 3F84A 1UQSA 4XBEL 5F7HA 1AZNA 3BZ4B 1OW0C 4I0PB 4I3RH 4WV1A 1HE8A 2PR4H 2Q0ZX 5BV7H 2WSPA 4J1UB 3E8VA 1N0XL 2WGXA 5DJZB 4CRPA 1U8QB 4XO4A 3WIIL 3WEXA 2JWYA 2BVOA 1IGCH 1TOZA 4YDJB 2XA8L 4KK8D 3GMLB 2D0GA 3HA0A 4F3FB 2W26B 2A99A 1NBYA 1TVBB 1F4XL 5DD6B 1REIA 3HS0A 3GDBA 4TNVF 2X41A 5E5MA 4DKFH 2OMYB 3LQMA 2I69A 3Q7DA 4D0CA 1U58B 4OD1H 5LJYH 4EZJA 3ZKXB 5C0RH 1SRDA 2X2YA 4LVOB 1PAZA 3SQBA 1OP3K 1BBDL 2I07A 4KZ0A 3MCLH 1AGBA 2AAAA 3W9EB 1DVFC 2HAZA 3BH8B 4M7JH 1RUMH 5GRYA 2EKSA 3W3BA 3FQTB 1KTDB 4RVBA 1AHMA 2XWRA 4AQZA 1XF4B 1TNMA 4LSPH 1LE5B 4MA7H 3GS7A 4ODBD 1JD7A 4JKMA 3S8FB 3SDAD 2RA1A 3ZZ1A 3QHFH 4L4VB 1A4CA 1RZFL 4Y5VA 1F56A 4KNSA 4J3SA 4PJ9C 5E2VL 2H0JA 4KMTH 3M8OH 2BCMA 2ICWJ 2WXGA 3ILPB 3VWJA 3J27A 5LWYH 4WEUD 3SY0A 5KVFL 4FJ6A 3VGBA 2CDFA 2GTQA 4LSRH 1BVKB 2PW2B 5CJBA 4ZOEA 5FUOL 4MJIE 4JAMB 4JZJB 5FECA 4E9TA 3FRPG 2EILB 3HFML 1QPXA 4XGZA 3QJTB 1KG0B 1G6RB 3BDBA 4KVCH 4OLVH 3ZX1A 4UT7L 5GGQH 2HG5A 4R26L 2IADA 1RZKL 1TVBA 4LARH 4OD1L 3QNYB 4DKFL 3VQ1C 3P4MB 1S7VB 1CFMA 4AMWA 1EEYB 2Y5EA 2QJDA 3MJ7B 2CLVA 1NFIB 4C4KO 4XP5H 3N8VA 3VDAA 4PRHD 1ZA6A 4MA8L 5FGCB 1B2WL 4H13C 1MXDA 1YYLL 4XTRC 3WIIH 4QRPA 2BZDA 4QEGA 4YN3A 3Q43A 1NFIA 1RZIA 1H3GA 3RWIB 2VMFA 2IDUA 1FL5B 1EZUA 2CJUH 4G6FB 5ALBH 4U1NB 4FFZL 1R34A 4NUQA 1DVSA 2PUQL 1JVOA 1N19A 5J6SA 1OALA 2Q6WA 3UTSB 4LF3A 1VGKA 4PCSA 3FT4B 1UA7A 3UC0L 4B3EA 4AGLA 1QR1A 3QXAB 1XMEB 3NBNA 4OLXL 3PFUA 4YDKL 2CCVA 3I50H 4XP4H 3O2DL 4I1RA 1NGYA 1YAIA 2VITA 1WO2A 2GIMA 3ZTDC 1ZT4A 1I8KB 4NZJA 5HHVL 2JJTA 4YLBA 5GS2D 2TSAA 4HUKB 4UTAL 2AV7B 4JDVA 3EYQD 1V05A 1E9OA 5CGBA 3T4YB 5F8RC 3M17A 5HHOE 5DHDA 2V17L 2P5WD 1W6LA 2H5UA 2HVJB 4NO0D 2Q8BL 2G4GA 2BP5M 1T66D 2HJLA 3APNA 1MREH 3TH3L 4ZTEA 1YEDB 2Y5TB 3GSUB 2WG3C 2BO2A 2H8PB 2GHWB 1AG0A 3BDYL 5A2BA 4OIFA 1U2HA 2BCKB 3HC3L 4L3CB 1U3HA 3WKQA 3HHSB 3RWFA 1NFWB 4JKPH 3Q6GH 1E6OH 2BIQA 2XU9A 2YAPA 4KQ4L 3SBWC 3TEWA 1JWSB 1ML0A 2KLRA 3D85D 1F58H 1A5FL 1HHKA 1MFBH 5D1ZI 4BYHA 5DSCB 1KJ2H 1BZ7B 4OLEA 3PQYE 4H40A 2F0CA 4XNYL 3U6RA 1SJEA 1U6AL 3V6OA 4IOIB 3V6ZA 3FO2B 4KJWD 4EEEA 1L9SA 3QUZC 2R56H 2FEDD 2FYYA 5IJCC 4NZDA 4U1LB 1PTHA 3QDHA 1F3JB 1OAKL 3TA3C 3V65B 1UH2A 5C0GA 3ULVE 3DKHA 4UANA 1KGIA 4X5QA 1QO3B 1L0PA 3OMNB 4XN4A 1ZLEA 5HJBA 4A2HA 2YEVB 2Y3AA 4HJEA 1WV7T 1RCYA 4DPCX 4IDLA 5B3SB 1T22B 3MCKB 3MO1A 1KLIL 4JRYA 3GZOA 1VA9A 2R2CA 4Z18A 2HFFA 3PWPA 3UBXA 3SKJH 1MDAA 1EJ6A 3FCGA 4M9OA 1MRFH 3KXFE 4OJAA 3N40F 2JFCA 1W8NA 1T04A 4NDMA 3AITA 2R0LH 5FB8A 2V7HA 4PJCA 4WGKA 5CWSB 1RUKH 2P45B 5HJGA 1KCUH 1AD9B 3VWKA 1KXVA 1C8QA 4PJ5B 3DX9B 4J7RA 3QDMB 3CBKB 3TL5A 1GVIA 2EUVA 4K55A 3ARXA 1HI6B 5HHOB 4TUKL 1S9VB 2UZXA 3DXAA 4RUTA 3WXVL 3HC2A 5DZVA 3X3FH 2WZ5A 3PFQA 5HGHA 2H32B 4OLUL 3BVTA 2AV1B 2NNAA 4QJ4B 1IC4L 2GEQA 3BVDB 3VRJA 1BDYA 3CDFA 1N7MH 4KH9A 1AQMA 1PLBA 4J5VA 3CFCH 4WFFE 4D0DA 3BRFA 3S35H 1DE4B 3F8UB 1JZ8A 5LGJA 4N3TA 4UZGA 3VSTA 5FAAA 1J0YA 4QJ3B 2WB7A 1RPUA 2NDFA 4N1HB 1B0GB 1NBCA 1OW0A 1N18A 1T1YA 2BNRA 2BHZA 4IRJB 4CN1A 1PZ2A 3QJXA 1EAOA 1QQDB 3Q6FA 5HTSA 3G5YB 4NAQA 3WS3B 2B5IC 5I6XC 4KOCA 3DRQB 3QUZD 1DQDH 1YEHL 5GS3A 1N6VA 3LRLA 1ZT1B 4QJ5B 1UZQA 2VWLL 1AXSB 3HG4A 3NABH 1IGMH 4ERSH 3RY6C 4GNKB 2BFVH 1WTLA 3VFPB 3BIAX 2JI3A 2R4SH 3ATDA 3AU0A 1M6UA 1WBXB 4WHTB 1A3LL 2G75B 4C4UA 4OTYA 1OD9A 5JW4M 1ZGLA 1SNRA 4CJ1A 1QA9A 3OG4B 3QFDB 5AWNL 1J8SA 3QDJB 4LLVA 1RMFH 1UD8A 1LEIB 3G6JF 3LB6D 4PHZA 1I7TA 2QVKA 3H5CB 2CSPA 4A7QA 1GSMA 4CBPA 2C26A 1E5CA 1RULL 2LR4A 2BJMH 4UIMB 3TVMA 2KV4A 3AG4B 1ZAQA 4M1GH 2XPGB 3FOMB 2E86A 1UM5H 3U0PB 3IJSB 1GZHC 3R7QA 4Q14A 1QLFA 4A68A 5BW7C 1AGDB 1FN4B 2V37A 4PRAA 4YO0A 4G8GA 3UTOA 3FB5A 3TVMB 1VADA 2GHZA 1JTPA 3VUAA 3G6AB 1OARH 4TL5A 3NDYE 5IKCB 1AZZC 2BRRH 2GIXA 5IKVA 5D5MA 4IJTA 4CW1A 5LXGL 3CDGA 3JBG7 2BHFA 4ES8A 4EI6A 1FQ9C 4CMHB 1R5IB 1WHPA 3FU7B 3N5AA 2WM0A 2YRPA 2ADJB 2Q5BA 5CU5A 4F7MB 4Q6KA 5CP3A 1NCJA 2VLKD 1B4TA 3VYNA 2CDGA 2IQAB 2XWBA 4HSCX 3TBWA 4AQ8C 1T1ZA 1Y6KR 1X7QB 2XQBH 2X0WA 2EIKB 3ECUA 1D9KB 1EZLA 5CZXC 1OWWA 1V3LA 3WO4C 1VFOA 4X98A 3LXBA 1XF1A 3LIUA 1EXUB 3EOTL 3NIFE 4WW2B 3CZGA 4HCRL 1V3XB 3QZPA 5ILTL 3BPOB 3KWUA 5EOQL 1MNNA 1XGRA 3B37A 4NI6A 25C8L 2EADA 2VJ0A 2ZUVA 1HJ7A 3NTCL 3GYRA 3DWTA 1DQDL 1YEHH 1QRNA 3FB6B 1RK1B 1DQML 1IAKA 2NNAB 2HYMA 3IDYC 4EDXB 3IF1B 2OQJB 1FFMA 2VW7A 3S98A 3VRIA 3BAYA 1OT4A 5IQ9B 5D7IF 1E40A 3QEQA 3ETBJ 2Y7MA 3IJEA 4PJEE 3VFSA 3GSNB 3KXFA 4G9DB 1CFSA 1P2CB 4JLRA 5ES4B 4WFED 2BSED 1MIEL 1XGZA 2R69H 5DF0A 4XZUB 5EZLB 3VGGA 5DZLA 4WW1B 4NNPL 2AJYH 2J1YA 4NKDB 5IV2B 2GC7C 4MB5A 4NM4L 2J43A 2WOBA 1FFRA 4DF9A 1WFOA 2VL5A 2X88A 1M71B 5F72S 5KUMA 5ACZB 4EO5A 3BVXA 4BWUA 2PYFB 1QP1A 3BAEL 4P9HH 1FC1A 5BXFB 1WUNT 1PPIA 4TULL 4JRYB 2AERT 1AFVL 4WFHE 2VWEE 3VM5A 2ZD0A 2B77A 3IYLW 3BSZL 1OZUA 4FQCL 5IKQA 1ETZA 3UERA 2NY6C 4YZFE 1IC7H 1AS6A 2W95A 4M7KL 2HKFL 4G1EA 3GUTA 3QW9A 1SEBB 2FSDA 3S5YA 1R3LA 1T1WB 3F7YB 2FK9A 1I7TB 1FBIL 1HXMA 4PAZA 3JVFC 4NWTH 2Y36H 3LPPA 2XI9A 3TWCL 3PQYB 1KXTA 1SVZA 4BFNA 5J11C 3NTBA 1C12A 2GAZB 3VFVB 2V3FA 1OCWL 4K3GA 4AMKH 3JTBA 2OSYA 1U42A 3WFCL 4ZTOH 4RZCB 1I9IH 3TONA 1IVTA 1UA6L 1USQA 1YUHB 1DLHB 2J8UA 4Z3IA 3L3IA 1NGPL 2LGNA 2ITFA 3CAFA 4ISHL 2ICEC 4DFIA 1E2VA 2A38A 4N9GB 4Y16A 4NKDA 5IV2A 3UTSE 4KPHL 2LW3A 3FSOA 4UTAA 1XB6A 4JDTL 3W0WA 5HPMB 1HNYA 3HG3A 4Q58C 3ECWA 2RACA 4KKBC 4N2EA 2J7LA 1T1YB 2BNRB 3V4PL 1JYVA 1T03L 4JFZH 4KK9D 3QJUB 3QUXD 3JYCA 4GY4A 4HEMA 1MJ7L 1XO8A 3BJLA 4WWOA 5CILL 4DGIH 3PY9A 2F54E 4RWHA 5LGKA 1CK0H 1U8IA 3FT0A 7FABL 3GO1H 3ARDC 4HZLA 1T4WA 4I3RL 4LEEA 4XPFH 4OZFH 4AUUA 2EVIA 4JO1L 2Q3ZA 5FX3A 2WINB 3NA4A 1MCHA 3NACH 4CMHC 4PP1D 5I16A 3WELA 3GFUA 4LSTH 3MFFB 2Y36L 3GJFA 3LKQA 2ROXA 1LMKA 3BYTA 4XXWA 1U67A 4FC3E 4K3HA 4PJ7F 4U6TA 2WG4B 5H4YA 3MUJA 5C9JA 1PSKL 4NBZB 1XKBA 1QW9A 4C4BA 3DOSB 3T08A 2CKBB 4XBPB 1FV1A 4XP4L 3D7PA 3TJEL 4G5ZH 4N2FA 4UMSA 1NGPH 4Y6DB 5C71A 4M8RA 1F86A 5DMKA 2CM5A 5FYJH 2FATH 4PV1C 2JTYA 3NCXA 1L3NA 2OMBA 3VACA 3GSNA 4AKOA 4D7PA 5AAWA 5BVJA 5I5IA 2PCFA 1BOGB 5E2UL 5I0DA 3O8XA 2Y69B 4GXVH 1F3JA 5JIHA 3DVNB 3B9KC 2RIKA 5EA0H 3JQOB 4P2OD 2FH8A 4LHJB 5LXVA 4M02A 4A7GF 4Z7QF 3EJJX 5TK4A 2FBJL 3EDJA 2W38A 4F2MB 2ZF9A 3EBHA 3BKCH 1PL3A 3BP7B 1IGZA 1KN4L 2JXMA 2PCPB 3HAEH 4KRPC 4FQHA 3BWUF 3H8NA 1D5ZA 3OPZH 1B2WH 2IMMA 2ZKMX 1PLCA 2YOAA 2BY0A 1JHTB 1NH6A 1DANU 2CKBL 3MLRH 1DQMH 3B8SA 1K5WA 1RJYB 3DX0A 4P57A 4X98B 3MRLB 4KTGA 1Q0XL 4KFMA 3GCWE 2QTVA 2X4NA 4BA8A 2OW7A 4GAFB 3HE7B 3EHBC 5FCSH 3D07A 1INQA 4UT7H 2VXQH 1XH0A 2VDLB 4R5TA 1MAMH 1FCCA 2DJ4A 2KDYA 1OANA 4TRPH 1P84K 4NYLA 4LDCA 2E0PA 4XPHH 3ZYZA 4U6YA 1EV2E 2FO1A 2W2NE 2X40A 2VJ3A 4JZNB 3GSOB 3N6YA 2OSWA 3C8HA 5LWYL 1I9JL 3VW3H 4L8SA 4PB0H 2ZOLA 3FN9A 1XH3A 3KYKH 4XBGA 3SE8H 1PZ3A 3VO0A 1N8ZB 1TO4A 3IEAA 2ZXWB 1S9WA 3MMEA 3VFNA 5I8OL 3THML 3BO8B 4HJGB 3JWNH 4AYGA 5FYKU 3V5DB 2F1AA 3FC8A 4NIKB 4Z6AT 3QXDA 4FM5A 1NGQH 5MEND 4XN5A 3BSZH 4ZXBB 5TDNA 3DPDA 3B3IA 4J6IA 3T0EA 2AEQL 4R97C 1JZHA 3D69A 5JIMA 3GB7A 3FT4A 3T6ZA 1AIZA 4HALA 4ZMAT 3KPRB 3E1ZA 5B7MA 3WU1A 1BXUA 3EJZC 5IY5B 5FWQA 5IVNA 1VACA 2JQMA 4OGAC 1EANA 3EYVB 3F6JA 5CU9A 3ET9F 1KPUA 2EO7A 3EJPA 3RAJH 1ZT4B 3BN9C 3SCMB 3NCCB 2EIDA 2H3NA 3O81A 2APSA 1Z3GL 1ZLSH 1X7SA 5DEFA 2YN5A 1JZGA 1GGIH 4QRPB 2F61A 4OM0H 3EH5B 5F9OL 2XIIA 3GD1C 4BWWA 1XGQA 1XCTA 3MX0B 3Q8BA 1MWAH 1MHEB 2VDMH 2EH8L 4L5FL 2NY2C 4N8CH 2W0LA 2XV3A 2P3UA 4NZRH 3P3UA 3HE6B 1FG2B 4S1RH 3N0AA 3WNKA 1IJ9A 4HXBL 3BZFA 3HMXA 2VVCK 1RZQA 1IU1A 4P2QD 3SB3A 1A3QA 1DQJB 4OZGE 3CBJB 2ZKXA 3QORC 3IDUA 4DPBX 2ED6A 2K8MA 3WEBA 1TYEB 1VDGA 4ZUWB 4XNUH 1WFTA 3AWEA 4PV9B 4BZ2H 2VDRB 3NJJA 3T2PA 2NZIA 3NSCA 2AXHA 4P2AA 2HT3C 5EU4A 2CHXA 2NOYA 2VISB 1LE5A 3SW2A 1KIGL 1KIQA 2HKAA 2V5SA 5I71C 1TMCB 5SV4A 1P4IH 1B4RA 1W0YT 1YY8B 5CMAB 1N4XL 1OSYA 5BVPH 1JN6A 4B9FA 1HOEA 4IBZA 3PAZA 1IC5L 3PV6B 5EO1A 2NCEA 1KBKA 5EUOE 1CLOL 2AGJH 2QFRA 3EH4B 5KOVC 4WFGE 1CFTA 4Q7DA 5DS1A 1YY8A 3B6SA 5D1XB 4AXWA 1ZDSA 1RD6A 2O5ZL 4JFEA 1IBBA 4O2FB 3O41B 3D18A 3PV6A 4YK4B 4P4KD 4QXGL 4R90H 4N0RA 3MDLA 1FPTH 2KB9A 4JS7A 3S35X 3OF6D 5C3TA 2UWLB 3FCTA 3LV3B 2VMJA 3L6FB 1TZHB 2BMKB 2J4WL 5D1XD 4ZW8A 3V0AC 2NUPB 1JPGB 4UU9B 4RMSA 4OB5H 2ZUTA 4LL1A 5ABAA 4NGAL 2V5TA 2XV0A 1F7EA 3BWAA 4OLUH 1DLFL 1JNNH 2YD1A 3BP4A 3QRFM 1MFDL 2Y1AA 3QFGA 3UTTA 1ZRUA 1S9YA 2BVPB 4HFUH 4S1SH 5ALCL 4UT6H 3RWEB 4GUCA 2IO5A 4Y1AA 5L2KA 1IAOB 3CC5A 3O3AA 4XCYB 5KUKA 1CBJA 1M1XA 2XZAH 4CJ0A 2W5PA 5DD3H 4JAMA 4I4WB 4JZJA 2NZ9D 5EBWB 1YHPA 1KCVL 2Y1VA 3L7EB 3CSYB 1H6TA 1MCIA 4PJAB 1B6DA 2BP0A 1S8DA 2C1PA 4PS4L 1AI1H 3F6LA 4JZJC 4KK5D 4XPTH 5KG9A 2OL3L 1KTCA 5I5JA 5D1ZD 2XYBA 4H1LG 2YC1A 1TQCB 3L45A 4HSAC 4YH6A 1T0PB 2K6YA 4U1JA 3H42H 1HINL 2Q3AA 2VITB 5EN3A 1R3JA 1HXMB 2V8LA 4AE1A 1Q72L 4NB7A 4PW9A 4TTGA 4Z6AL 2WXMA 2VLJA 2MQ0A 3CLFH 4QWWC 4NM8L 2Y7QB 4H0LC 4OGAD 2D9QB 5ID0A 2XQYK 1ZS8A 2NXYB 3QXWA 1NQBA 5KYWB 2BC4B 5D72L 3RFZA 4JFOB 2QLVB 3PP4L 3ZDWA 3SDDB 4XNQA 1A7PL 5IB4B 1X7AL 2G3NA 3BIKA 1PKQE 4HUCA 4WV1C 4I77H 3KPRD 3TBSB 2MQGA 2VGLM 1KEGL 3CFDB 1A7OH 3LAFA 5KTEH 4XXDA 1N67A 5I6MA 5INDA 4EXKA 2E56A 3T2NL 5GGRB 3TJPA 3VJ6B 4GFTB 2R2BA 43CAA 4CNIB 3VFUA 3BP6A 4ZXBD 2PUQT 3E0GA 3I6KB 1KJ3H 4XT1C 5D7SL 5BS0A 1KXHA 5KG9B 3RVTD 5E7FA 5IQ7H 2OP4L 4QXUH 5KYYA 1KY6A 3HCVA 3QORB 1HYSD 5CKNA 4JG0L 1HCGB 2FECL 1E4WL 4GQ9H 5AW5B 1XTLA 2P8MB 4HF5H 5E6ID 1SJHA 3CK0L 3EF4A 1OAKH 5E8EB 3REVA 4HD9A 2VR5A 4CVXB 3GK8L 3OJMB 3CVHA 1VPOH 5AB9A 3IRCA 4AEIH 1T21A 4XNUL 2HKHH 5C09A 2COQA 1LP9B 1PY4A 3C5JB 4ZFZB 4C56D 1QEWB 5BQDA 3RHWF 4F7PB 4G43B 4XXCA 1XR8A 1DBAH 1RUAH 5GS0H 1AQKH 3FHEA 2WUCH 3DC0A 3MBED 5DVPA 5C0CB 2J6WA 4FFTA 1YCSA 2D7QA 3PGCB 2CHDA 4X6FA 1B9ZA 4MZIA 2A6IA 3K2MC 3P0VL 1G1RA 3U7UG 3KGUA 3EO9L 1KTDA 4RAUA 5D7SH 1MI5E 2VDOB 3KJ6H 3L3OB 3HR5B 4HAFA 1I4FB 2YUZA 4L4TD 4NQDD 1EBVA 5T3XL 2BQWA 1JL8A 3KD4A 1OOWA 4LCCC 3FJTA 2VM3A 4U3SB 2DMGA 2G9HB 2IGLA 5GRVL 3N06B 3WHE1 5IROC 2DMHA 3FTYA 4KXDA 1G1CA 3IDIA 2CR6A 2XKSA 3P3RA 3SHSA 3SOVA 4W9CC 3QDGD 4G8IA 2EE6A 5DVLA 3K72B 4P9HC 1AD0B 3KPOA 3N41B 2OCCB 2WO2B 4MJID 3QCUL 1MY7A 4X5WA 2LFGA 4KUZH 3WENA 2AQQA 4TSCH 5D7KE 1MI5A 1RZKC 2WYIA 5HHPB 4ODVL 1WSST 4V2CB 1I7UB 3FTUA 4RGOH 1R3KA 2IFFL 5FV1L 4O02L 2UX6A 1H6UA 2WMPA 4FNRA 4MRBA 2COVD 4ELMA 4AYFB 2D73A 4HX1A 2GCYB 2RQEA 1HAEA 1I3GH 3U6XS 4JZDL 1KJ3L 4NYLB 4B9GA 2E4TA 1DSFH 2G00L 1BFTA 4PJ8D 1R3LB 3F7YA 1O6SB 1OAJA 2O6EA 4X5PA 3MRRB 4FAAB 5B1JA 2XXCB 2MNUA 1DTUA 3RNKA 5EBLB 7PAZA 1UD3A 1KOAA 3QXTA 1NC4B 3IDJB 3BXNB 4XMKH 4QTFA 5E2WL 1QFUL 1NPJA 5FOBB 3I6LD 5I5MA 1RIVL 2PO6D 1NCAL 4GS7C 1ZA3B 3JYBA 4U0RC 1OPGH 1YEJL 4WI6A 4ZO8A 1DVFB 3TBCA 1YMHA 3T0AA 3OLUA 3U0WH 4Q52A 2GY5A 4FQ1H 3IJSA 1TJHL 4Y2DD 3TK5B 4OJCA 2GJ6D 4NKMB 4NERA 4FKKA 4A04A 3MV9E 2CBPA 4Q4IA 3IWUA 4AJWA 1JZFA 2ATKA 4F7EA 2BZ7A 2UX7A 2B8OT 4YIQB 4CC4A 1X5GA 3VMNA 4JKWA 1SEBA 4NWUL 1VJSA 4F9PC 1QVOB 1RUPL 4X6CF 1PKQA 4ANVA 5FUZL 4YE0A 4XOBA 2E27L 5I1HH 3O6FA 2P26A 1RFDH 4YHPA 4BSJA 2JTDA 2GUYA 5DDHB 4NAJA 4BQ9A 4EZMA 4CU6A 2QGDA 2YPVH 4XMUA 1UC6A 2DQCL 1FNGA 2LVCA 4K7PX 1NMCB 3VDBA 3GRWH 4J3OH 1MCBA 1E4JA 3U0PA 3ULVD 4JL2A 3QZOA 3PDOA 5A3IC 1KSNB 1TENA 1WC7A 3ARDB 2CIKA 3EJYC 3NT1A 3II3A 1E30A 3IJYA 3L08A 4Y8AA 1ID5I 2WQ8A 2X2UA 3GTTA 2FX8L 5IQLA 5MEQA 5F7MC 3O3DB 1C16B 1U2CA 4UQ9A 3QIWA 2ADFH 4GBXC 3O4LA 1NWPA 3P69A 4FQIL 5LN8A 1Z6JT 4ORZC 3KQDL 1KPRA 2Z91B 2JJWA 3WTUA 4KKNA 3KCPB 2SEBA 2D9CA 5CGYD 1E4KC 4Y5YB 2K6WA 3ASNB 4AJVA 4JGNA 1G0XA 4OUUA 1I31A 1QKZL 1SLUA 4CA4A 2EEBA 4K7PL 1QTSA 2D03H 5FOJA 3VX0A 3ULUF 3W5MA 1SMAA 4XBMA 4TUUA 1MI5B 1S5IL 3UACA 3V6OE 4HUVB 1M42A 3O6FB 4WWID 1SUJA 2FNBA 4M5TA 4HWBH 2B14A 4K4KA 4BFOA 4UTBA 3KLAA 2H8PA 2OMUB 3MRMB 3UEQA 1OAUL 3BWZA 5JHDD 4K2UL 3VD9A 5E8OB 3CTTA 5EO0A 1QTPA 5GSRB 3ZKQD 1WICA 2ZOOA 2X09A 1RZ8B 3WFCH 1MG2C 4O1ZA 2H32H 1HZHL 2Y7SA 4LKXA 4H25A 3ZE0E 2H41A 5I6OA 1BZQK 1FRGH 5HHOA 3A6CL 3OJ2C 2JKNA 5DRWB 3L7FB 5K9OB 2VB5A 2E9JA 3S88H 2WZPD 1G0YR 5D1QE 4HEME 4LVHC 2NW3B 4NO2A 1CZ8H 3JXAA 1DVFA 3V5KB 4A7UA 3FK3A 5LXGH 3NQIA 1HHHB 1TZGH 4KKBD 4ODUB 4OT1L 3BUPA 4UZSA 1MOXC 3FCBA 5SWSB 4JDZA 2OK0L 1BHGA 1T7VA 3WIAA 5D1QA 3CSYA 1XIWC 3GPEA 4I2XA 4KH2A 4ABWA 1NDGB 1YPZE 4HP5A 5EU6E 3W9DA 4K73A 3ARGC 1CXKA 4X6DB 1RHHA 4V2BA 1UFGA 1JGDA 2IH3B 2A6DA 3FFDB 5T1MB 5TH2A 3TFBA 3IN2A 1L7IL 2AJUH 2WLLA 1WBXA 4K0OA 2N7SA 3BH9B 1NFKA 2VLRE 1KBGL 3D25B 4G71B 5LAXA 2CK2A 4GAJH 1SJVA 2QPDB 2VZVA 3RURA 3SJVD 3WJJA 4ZMPA 2JCWA 1HK6A 5E24E 1FCGA 4OV5B 4K3EL 4L4TB 5ACMA 3UBFA 4DTGH 32C2B 1QLEL 2RBLA 4R7LA 5I18L 3ULVF 4PGZA 5F96H 3WSQL 1AI1L 1DX5I 3PP3H 3MAWA 2OLDA 2J25A 4NRYA 4XPTL 1MZYA 4PJBE 2YD6A 4APQA 2DICA 4EI5B 2K3TA 1WK0A 1L3YA 3ULUH 3D69B 2G2RA 1A02N 1ZHLB 4G3YH 1RZ7H 4EUPA 3QUZB 2EIJB 2EDDA 2J8UF 1J87A 5LBSH 3P4OA 1CUOA 2K70A 3QJVB 4PJHF 3UTPD 1WVZA 3QWRA 4TV3A 5KAQG 1I8LC 2A0LD 2Y07L 1VKXB 3FU7A 5DVKA 5IB5A 5EV7A 1GK5A 2DQJL 1UZ6E 1PCXA 2O5YL 2P3FN 2APTA 3AUWB 3KLDA 3D09A 4JM2F 3ZSSA 1O7DE 1U6AH 1FNHA 4FXKA 5D8JL 4GSRA 4YHLH 2BT7A 3G6DL 4P3CL 5HYSA 1F18A 1A5FH 1MFBL 4AW4A 4K5OA 3CVHB 3MV9D 4HEPG 1HILA 5E8PB 3L9YA 4PWFA 5EEXA 4A2MA 5D7HA 4OJYA 3IXAA 3KBFA 5JO5B 5EOTA 2FQGA 4UQ3B 4K9EC 1OQOA 3OLDA 3PL6D 3GISX 3UAJA 4OFVA 4LPWA 3KYAA 5I1EH 1WJ3A 2C4FT 2F2HA 3NFPA 2QSTA 5CD5C 4WY7H 1CU4H 5ERWB 1NIFA 5AFAA 3CVIH 3Q5YA 5LLIC 5HHXL 1KNOB 1XF3A 1TTUA 4ZDHB 2NY0B 1KTJA 1VAHA 3TC9A 4FN0A 3V9CA 1A9EB 3O45A 4OQTH 3BZ5A 1I9RH 4JHZA 2YQ3A 4LCYA 1BVNT 2XA3A 4TM9A 2VDOL 2BVTA 4UU9A 3WTVA 3LS4H 5F1IA 4W4NA 4WVRA 1GC1H 1WC7B 2NT1A 3CDZA 4NBXB 3VXSB 3SQOH 1N12A 2I5YL 3CUPA 2P1YA 1OT2A 3ARGD 1U8PA 3OR6A 1KN2L 1QG3A 1J8HB 1SDYA 2FJSA 5D93C 3SJVE 3T8XA 3WLBB 2DKMA 1F0SB 2HKHL 1H3WM 1IQNL 1TSHA 1XGPA 3QNXA 3RZCB 1UZ8A 2AANA 5D7JD 5IJBC 4KX7A 1Z2KA 4GU4A 5FFOA 1DCLA 3MPCA 3BUQA 3RIFF 3DO7B 3W38A 4LF3B 5FA3B 2VLME 4YGAB 4MNGE 2OSLB 1G6RH 2JKSA 1BGXH 2YXMA 4PRIB 1EMTH 5CLTA 3WY1A 1YMME 4JFEB 1PD0A 1UXSB 3Q6GL 5T1KD 4OZFA 4E42B 4E9RA 2GUOA 3HZMB 4TNFA 4U7SA 2DF3A 3FQNA 1CVUA 1M56B 3ZE1F 4YEFA 1H6FA 1IEAB 3NIDE 5JA8B 4JRWA 4ELMB 3CG8A 3DX7B 5H35B 1HHIA 1U8NA 5DRZB 1MWAB 1U8LA 4J2QA 1AE6H 4RMVA 1ORSA 2AV7A 4ZS7L 2ZF8A 2FX7L 4DESA 3TJHC 5J9PB 1KF9B 4HK0A 5CR8A 3LJ3A 2VR6A 3C5JA 3NK3A 3FAWA 4ZFZA 1WZMA 4BTUA 3ILQC 5J6HA 2DKUA 1F42A 1LM8V 1HL8A 1OCRB 2AP2A 2FB4H 2OTWB 3HAEB 3SPVB 5C1MB 4RMQA 2CCWA 1A6TB 4TUKH 2Y5FL 5GGVY 5D70H 1FL3A 4OLXH 1JXDA 3BPLB 4YSUA 3QFJD 3F7KA 3ZKMC 5HSFA 2WNXA 1MCPH 4M62L 3DK2A 1TLMA 15C8L 4HQQL 5L4JA 1INEL 3H4FA 1BEYL 2E3VA 3MLWL 1ZK5A 4AMKL 1XGPB 1WCBA 5IZ7A 1YA5A 4XPAH 3MUZ1 3CXFA 1L9MA 2R0LL 2WAQA 2V2WB 1CQYA 2V5YA 2YKLL 3R8BB 2OPCA 4AL8H 4NO0A 1S3KH 2MMXA 4DZ8A 1DEDA 2BINA 1TUPA 3LHAA 4YXKL 3BP6B 1CD1A 1CX2A 1URKA 1MFNA 2B3RA 3VCLA 2OTPA 3BZ4A 4QKTA 2NX5E 2FBRA 5ESQB 5LDUA 1BW8A 4AYBA 4AYSA 2O1AA 1F90L 1TQUA 1W7XL 2W9EL 4WCYH 3D85A 1TQWA 3BUIA 1MPAL 4M6OH 5B7FA 4OKVB 2FVNA 3ULVC 4HG4K 4Q8BA 4OCSL 3VA2C 4DGYH 2F5BL 3JWDH 4FXLA 3ZE2E 4JFDB 3L3HB 2AQPA 5F70A 5E51A 3VD4A 2W92A 2R4RL 1IT9H 5DO8A 4A39A 2FE0A 2FQFA 4OTXH 3NEOA 4JZNA 2FIKB 4X7CC 3X13A 1RL1A 1P7QD 2EXWD 3ZRFC 3VI3B 1YJDH 2GJZB 4OUOA 1J18A 4JANB 1MKFA 2DIAA 4U6HB 1THAA 5BS0E 4KVNL 4PV9A 3PWPD 4JM4L 1PYWB 3PHOA 2IH9A 3CU7A 3IPFA 4MNQE 3U7WL 1GOHA 2W88A 5DD1H 2IDSA 3QC5X 4NQDE 4NRXB 2AJZB 3I3EA 4J23A 5EU4B 4GMTL 2P42B 4XP6L 2CO4A 4GOSA 3TBTB 3SPHA 1ADQA 3QI9D 1I1CA 2XBYL 3OXRB 5FDYA 5DC9B 5HD8D 1ANUA 1UGKA 1BBDH 1SLVA 5D70L 5I26A 4B41A 1G6RA 3DXAD 2DQEL 4M3JA 3RE0A 2XPYA 4X5LA 5DRXA 3WTXA 5I19H 1JHTA 3HCVB 3QORA 3L95B 3B43A 1EAPB 3SPJA 3AG3B 4HIEA 3EGXB 3QEQE 2BVOB 5JHLA 4DCQB 1KWGA 3PCYA 3UG3A 2M74A 2UXGA 3ARBC 4LP4A 4MCNA 1TZIB 3Q44A 3TN0B 2BMKA 3IE9A 2DQDL 1ZA6B 3N8XA 3RVUC 2WN2A 1PZDA 3KQEL 3GWJA 2FD6L 4RWYL 1JWSA 5D1ZC 2WLHA 3IMBA 1KGUA 2Y38A 3FULA 5JVZA 4UCFA 2F15A 4RISH 4TS6A 1AHWA 2EKJA 4N6RA 3VG0H 2GBUA 4ZX3A 1SOQA 5F7LB 3T1FB 4GT7A 3X1BA 2P94L 1G43A 5FCUL 4YT7L 5A7BA 3RWEA 2V33A 2P5ED 5DEGA 5TPWL 1UD2A 5JDSB 5C08D 3IMTA 1TF4A 4N2MA 4L4VA 1ZD6A 3MNZA 5L7XH 2K3HA 2RH0A 4UQAA 1OV8A 3VGAC 4A7IA 8FABB 3IMVA 4Y5YA 2WKGA 3WIFA 3CFMA 1SOXA 1F4YL 1UWEH 1NTDA 5LNGA 5EZIH 3VMPA 4MA3B 4LHUB 1KEMH 5CJXA 3UX9B 4YHOH 1M57B 1XF5A 3L9RA 3D4GA 1QWUA 1D5XB 2XY2A 3CBRA 2G3MA 2JLLA 3CCHB 3W56A 1UWGH 3MLZH 4DQOH 5E4EB 3RWJA 4CKQA 3MRMA 3RL1B 4PJIE 1KIPA 1E0OB 3FFCB 1VIWA 4KMQA 2R8SL 3QB7C 5EF1A 2JK5B 1XF2B 2WP3T 1WIUA 2IG2H 3IBEA 3PF2A 1WIPA 4UQEA 2D31A 4FNLH 2VDKH 4KXAA 4Y5YC 1RK7A 3T0VA 2CGYA 3D30A 2OTWA 1HNFA 1IBGH 4Y4FD 3H9HA 1NUGA 4DUVA 2JB5L 2WQSA 4DP2X 1AZUA 1INDH 2EDLA 1C5CL 4HIXH 3MNWB 4FULA 2A0LC 4H8VA 4RZCA 5I6NA 4MGXA 4TRPL 1QEXA 4POZD 1I7ZA 4YFLF 5HJDA 1T1XA 1UB5A 2X3AA 1J5CA 4JFSA 3DX6B 1JZIA 3OAWA 1ZTXE 1T1ZB 1T6VN 1TO5A 1WZ1L 4M43L 3S2AA 3BYYA 1FVDB 5FW6A 2VO5A 3FZUC 3RWGA 5BJTB 3GRWA 4JB9H 3C5ZD 1LO3L 3P3TA 5DLMH 1GPOL 3RWDB 3DVGB 3RVVC 2OL3H 4JQVA 4X4KA 1YAZA 3GMOA 5AW2B 2FUTA 4G1MA 1QRND 4BZ1L 4O4YH 3F7LA 1HHJB 1KCVH 1B4LA 1FNGB 3NJPC 5I23A 3NIGE 3PABA 1DN0B 2VDNH 4JRLA 4RNRB 1DSFL 4Z3EA 1BFVH 1TPXC 3CMGA 5DUPH 1AC0A 5CFHA 1PKQB 1FO0A 5TDOA 3EYOB 1KEML 3RL2B 2GK2A 4MCYA 2HMIC 4R6UA 3LRSB 1AZRA 5EOCJ 2N01B 2I07B 4IQHA 5J6GB 1CFQB 4LCYB 1PF3A 3ABZA 4F24A 5HJ3A 1QSED 3MLWH 2FATL 4GRWF 2VH5H 2OL3B 4F92B 2GCYA 1JK9B 1CGSL 1GS8A 3B7RL 3H6JA 4ZUVA 1UB5B 4KK5C 4KJQC 1LO2H 3GBEA 3BRGC 1TLEA 2X7LA 1DZBA 4EQ2A 3BEWB 3P02A 4TVPH 3MRQA 4U1MA 4LP8A 3NFSL 4L3ED 4PGDA 4PRDB 2QBWA 4PHXA 5I1JL 3C6LB 2VQTA 5IBLC 4Z7OB 1YUFA 3CFEB 5I17B 3I2CL 4WSGA 5K9JL 4BSVB 1Y0LA 2R0KL 4A37A 3K2UL 4S0TD 4F2MA 1MREL 4HDIB 3B1UA 4G6AD 1T3FB 4PRDA 1TQCC 4PJ8C 5SX4I 2D3LA 3RLSA 4S0SD 4OF3A 3U9WA 3KPMA 4JY6B 1P4BL 1A6WH 2W0FA 3KYNA 3PU7A 1MNUL 3KVPA 4YFLI 4G1EB 4RQQA 1NCCH 4DERA 3GUTB 2D7NA 3FBYA 3OKDB 3LQAH 2EIEA 5IB2A 4PJ7E 4IRSA 5G4OA 2ZWZA 4HWEH 4HX1B 3CD4A 2AEWA 1OSPL 2WJ7A 3G9AB 3VD1A 2VXTH 4Y16D 3ZDZE 2WXKA 4ELMF 4OSUH 2H4EA 5F93C 2MCMA 4X7TB 4LAQH 5BOPA 4Y4HA 5KYUB 3DX9A 2JKXA 3BLBA 3D0VA 3KVQA 2W2OE 3RUGA 1A21A 2UWOB 4HXBH 2RFXB 1IC1A 5D2LA 3ETSA 4KRPD 1CWVA 4PJGF 2QADC 5EMYA 1KMGA 5FOBA 3UIYA 3M1BB 3GI8L 4FD0A 5CP3H 3REWB 4CU7A 3L16A 1P9MA 1A2YA 3L3GB 4LCVA 2R2EB 1XDTR 4LLDA 3VTTA 4K8RD 2SEBB 5E2VH 3L1EA 3CSTA 4S1DD 5E9NA 1YEKH 2O5XL 2DBJA 2NUTA 4JZOB 2D4DA 2O61A 2APWA 2YD0A 1KACB 1OTTD 4LPTA 4R0LA 1A7OL 5KTEL 3WGVB 3WO4B 2FJGB 1KV7A 4UILL 5DJAA 3UPCA 3WUZA 1WBYB 2XQYG 1EHNA 3FBKA 1D3CA 5I74B 1W8BL 2NUTB 4FXGC 4JHVA 4AH2B 1DCEA 4TVPE 5C0IB 1HSBA 1QNZL 4R5XA 4PRNB 5SWZB 3HZ3A 3GLAA 4XPBL 4Z1PA 2HH0L 1KTRL 5HGAA 2AI0H 1DYZA 4AK2A 2P8LA 4JREB 1TTBA 4NSKA 2TRHA 2D2CC 1HSBB 1VRSA 1A1MA 1BQLL 1KELH 4H5SA 4H2CA 1PNCA 1NGQL 4H8QA 4CVXA 4XVTL 3HAEG 4Y19E 5KN5B 3D0VB 2PTUA 3UH8A 2AAVA 2WCSA 4PJXE 3I9AA 5FKAB 2FLRT 2IC2A 4HUXB 1LQBC 3RI5F 7PCYA 2FQDA 3CZNA 5HJ3B 1IKNC 3QHTC 1B4JL 1UHVA 4HIIB 3VYOA 5AB0A 2Z92A 1U8KB 4U0QB 2BXZA 2GI0A 2HTKD 4XL1A 1IAIL 1QYGH 3C6LD 4M3HA 2FHFA 5KVEH 2W60A 2RGSA 1K4DA 4MHHG 1YO4A 2X4OB 4KI5D 4LPYA 3V4UL 1DJXA 2W0KA 4MKMA 4PGEA 1NDGA 4LAJH 1J8HE 4P5KA 4PN6A 2AMGA 5GGUA 2PW1B 1UENA 2ENSA 4XAWL 2B0SL 1YEJH 1KBPA 4NLHA 4AW7A 2ZKHH 4MBOA 4WO4D 2H9GA 2WLIB 4QOKE 5F6HI 5TQ2H 3QH0A 4ZS6C 5IOKA 5AL0A 5C0JA 1W8EA 4E41B 3IDGB 4PJBF 5E8EA 4HIPA 5JBAE 3GMOB 3P30H 3DJ9A 2APBA 5IJVB 1U91B