2YGPA

Wif domain-egf-like domain 1 met77trp of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
174
Chain Sequence
TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRWPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WNT INHIBITORY FACTOR 1
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 30
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygpA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygpA01
1YGCL 3V65B 1WHFA 1NPEB 2VVCK 5EGMB 4RRWA 4Z6AL 4ZAEB 4NA9L 4YT6L 3NT1A 2BZ6L 3OLUA 4E1GA 2BQ7A 1Z6CA 1IQEL 4RRYA 3NTBA 5L2YL 1CVUA 4ZXXL 4NG9L 3HS7A 4JZFL 3GISX 3N8WA 5IKRA 2W2ME 2W2QE 2H9EL 4X8VL 2P94L 3TGFA 1V3XB 4ZXYL 2TGFA 2WPHE 2KV4A 5CISA 4PH9A 1G1SA 5KN5C 2Y5HL 5JBCE 2Y80B 1IGXA 1PRHA 3HS6A 2YGOA 4Z0KB 1ATBA 1LMJA 3TZIA 5IKVA 1UZQA 1UZJA 1L3YA 3C9AC 3LN0A 3KCGL 2WFTA 1IQJL 4BXSA 2MGRA 4CUFA 1TPGA 1XFEA 2VH0B 1AUTL 1FJSL 2XBXL 3KRKA 3N8YA 1FF7A 5CKMA 3SOQA 2Y81B 2PR3B 1IP0A 2J95B 5IKQA 1HJ7A 1W7XL 3CS7L 4CUEA 1MOXC 3N8XA 2Q1JB 1CCVA 2XC4L 3IITB 4RRXA 3BT1A 3QMOA 4BXWA 1HT5A 2Y7XB 1DX5I 1XKAL 2J38B 2WG4B 2WPLE 2W86A 4BTTA 3SOBB 1YUGA 1APQA 1WHEA 5JBAE 2BOHA 2WPKE 2WG3C 2BQWA 2EI7B 5F1AA 2KL7A 5IKTA 2XBYL 1ATDA 1HX2A 1LPKA 3F1SB 1MQ6L 2OYUP 1YUKB 4JZDL 1FAKL 1KSNB 3CFWA 2OYEP 2WYJB 1W8BL 1HT8A 4OTYA 2XC5L 1ATAA 2Y7ZB 2XBWL 3MQEA 3LTGD 5L30L 1F0SB 1YUFA 3ASIA 2GD4A 2BOXA 1FSBA 2AYLA 3TK6B 2FLRL 2WPME 3DEMA 3R05A 1OB1C 1TLEA 2MHPA 4Y7AB 2W26B 1NFXB 4LORA 4Y6DB 3OLTA 1MQ5L 3FCSB 2WYGB 4YT7L 1DVAL 1CVWL 1F7MA 5CKNA 1G2LB 2K2TA 1IQML 2CJIB 1CQEA 1N1IA 1NFUB 5I46L 3KK6A 5L2ZL 1URKA 1TOZA 2P3FL 4CSYA 3TH3L 1IQNL 2DDUA 4NGAL 2BO2A 2FD6A 3ENSA 3H5CB 1EPGA 1M1XB 2JKHL 2VJ3A 3SOVA 4Z0LA 1ZAQA 4AQTA 1IQIL 4CUDA 2ADXA 5JVYA 2RA0L 2VVVL 2UWLB 1ADXA 1HAFA 1NZIA 2YGNA 1C5MF 4M10A 2W2PE 4RUTA 2VWNL 3F6UL 2P3FN 2Y5GL 1KIGL 3KQDL 1EPJA 1EPIA 3QCWA 4XL1A 4Y79B 3GCWE 2F9BL 1K37A 2K2SB 3RR3A 1K36A 1EMNA 3M37L 1PTHA 3LTFB 4XBMA 1PFXL 1UZPA 2P3TA 2P28B 4BTIA 3U73A 1IQKL 1A3PA 3LC3B 1HAEA 4Y7BB 5JB8E 1KLIL 1G1RA 5FDQA 1EQGA 2VWOL 4D0EA 1NT0A 1P0SL 1NQLB 3KQCL 5E8DA 1CEJA 2RNLA 2FZZL 2I9BA 3QH0A 1LPGA 3POYA 3U7UG 3KQBL 5CKQA 4ZHAB 4TGFA 1O5DL 3EGFA 2WFXB 1IVOC 1BF9A 2NPRA 2WPJE 3NJPC 2VH6B 3IJEB 2I9AA 1G2MB 3HPTA 1IOEL 1EQHA 4RRZA 2VWLL 3GCXE 4X8TL 3CA7A 1FAXL 4MMZB 2B7DL 1F0RB 1ATEA 4YZUB 4MMYB 1HCGB 5K0HB 6COXA 1FE2A 1NFWB 1FFMA 4FM5A 3HO4A 2PUQL 1COUA 4XLWA 4JYVL 1UZKA 1HREA 1N7DA 2J94B 1G1QA 5F19A 3PGHA 2J34B 3FBYA 3MDLA 2W3IB 4JZEL 3TBDA 1PGEA 1IQFL 4BDXA 1U8CB 1IGZA 1Q4GA 2J2UB 3NTGA 4JYUL 3BT2A 5JBBE 4X8SL 4O1ZA 4BTUA 2BOKL 1CX2A 3LAQA 1LPZA 2VWMK 1L5GB 1KLJL 5COXA 1XKBA 4ZH8B 5JB9E 1F7EA 1JV2B 1WU1B 3CENL 1IQLL 3LIWB 4D90A 2WPIE 3ELAL 4Y76B 2Y5FL 2RHPA 1XDTR 4X8UL 5KIRA 2UWPB 4ISIL 1J9CL 4D0FA 3P5BL 4G1MB 4M11A 3N8WB 4BDWA 1IOXA 1NFYB 1U67A 1DQBA 2MGPA 2P26A 3HO3A 1EBVA 4ISHL 2Y82B 1GK5A 1EGFA 1IQGL 4OTJA 1DDXA 2XC0L 2G00L 1JBUL 3LN1A 2EI6B 2Y38A 3N8ZA 5JW1A 1DIYA 3FFGL 1RFNB 1Z6EL 4RS0A 3Q7DA 2BQ6A 1CCFA 1APOA 2D3JA 2M74A 2W2OE 3Q3KB 3KL6B 4COXA 3V64C 1HZ8A 1G1TA 3TK5B 2P95L 3N8YB 1IJQA 2YGQA 5JVZA 2P16L 3M36L 2YGPA 1QFKL 3ZYIB 3HS5A 1I0UA 2W2NE 3KQEL 1PXXA 2XBVL 4Y71B 1X7AL 2BMGA 2PHBB 3K9XA 4A7IA 2J4IB 2FLGA 2FLBL 2VVUL 2P3UA 1EPHA 3ZYJB 2W3KB 1EAIC 2KB9A 1EZQB 1P9JA 2BOUA 4LMFA 3SW2A 1IQHL 2EI8B 3N8VA 1JL9A 2D1JB 1HRFA 1YO8A 1KLOA 4MMXB 1B9WA 1EMOA 1LQDA 3HO5A 4O02B 3BPSE 2UWOB 3ZYGA 2P93L 4C16A 3LC5B 1SZBA
chains in the Genus database with same CATH superfamily
1SYVA 4Y4HC 2B5IB 3SKUD 2VLLA 3U7WH 4X8GA 3A6CH 1ACYH 2UXTA 4LLUA 5EGMB 2WBKA 4QHKJ 2ENSA 1K6QL 4MGXA 4XHJC 4D3CL 2PXYB 1AZVA 2BC4B 3VWJB 3F12B 4BUHA 3CDGB 5SWZD 4OJEH 1B0WA 2W59A 3MUY1 1P7BA 5J0BA 1JF1A 1MWAA 1SDYA 4PJDF 1HXKA 4I48A 4EIGB 2H32B 3APMA 4BWUA 1TZHB 3QUXA 1I1AB 1CLCA 3V5HA 4Z9KB 2X44D 2ZG1A 5I6XC 2XZAH 4M9OA 1X5AA 3UTSE 2K6ZA 4R26H 1MFAL 4JCLA 1NEPA 2MH4A 4H8WH 2P8PA 3RWEB 1JXJA 3FTUA 3QG7H 4JY4B 1KJ2H 1JP5A 3S5YA 3GTNA 4HCRL 1AHWB 2XG5B 1X4YA 4IIZA 1N5YH 2GCYA 3U30B 4UIMA 4ZXBB 3T0EA 1G1SA 1Z3RA 4WY7L 1Q94B 5KN5C 1MEXL 4KI5C 4YSPA 3GMMB 5CGMA 5SWSB 2QKIC 1R3KA 2NY4D 3GLDA 2PP8A 5T5FA 4HV8B 1CLOH 4BINA 1R3LA 4DKEH 3KLDA 4KFZC 3L48A 2VDLL 4Z7IA 2ZX5A 3G6DL 1DQMH 1KCRH 3QFDB 1AGFB 3F84A 1TYRA 5EMYA 4F5CE 4MWFB 3OKDB 3H9SD 4H0LC 4B0MM 2NX5E 5B8CA 5PCYA 5CCKL 2X4NB 1LVEA 4L8BB 5AKVA 3TNMA 1F56A 1IQJL 4TLTA 1XGPB 5C08D 3ZTJH 2IPUK 2CKBA 2G60H 1N6QH 4UOZA 1MCJA 2RCSH 3SOQA 3CPLB 4WHCA 1NBZA 4NERA 4LLAA 3CFEA 4CVUA 3IMTA 5HVGB 5IFAH 1X5XA 4FXGC 3M1CA 5FXCH 5D7JA 3I84A 2IFFH 3BP6A 2X0WA 4UOW0 1QP1A 2K45A 4OR1A 1KXTA 2WWMD 2XZQL 3BJ91 1IVLA 2AJZB 5CXPA 1QLEH 3DUHA 4JM0A 2Y7NA 5EU6A 5F44A 2AABL 1G9HA 1IGML 3RUGF 3LZNA 3MUJA 1LE5A 1A4CA 3F85A 3GSVB 3T6XA 2J6EA 2WG4B 1ILUA 2WPLE 1NDGA 2YMTA 4URTB 1CFVH 4K5MA 3H55A 4FABH 1S9WA 5HTSA 5A6LA 2W91A 3SGEH 5GPRA 1WHEA 5FYLD 1MHEA 2E9BA 2FHFA 2ICEC 3ZL1A 3BVVA 5I16A 2JNZA 1AD9A 1RK0B 2AITA 4X5QA 4DAGH 4DOHE 4MD4B 3UEZA 4G9FB 1IGJB 1W72A 2NR6A 1J87A 1CFSB 3FH5A 3QISA 2CH8A 5DFWH 5D9SA 4K5PA 3T8VA 5ITFA 4LHUA 4XZUA 3RLSA 5GGRY 1A2YA 4F9PA 5EIIG 3H0TA 4TSBH 3QHTC 4JM4H 3MZTA 1O6SA 1TQVA 2JQZA 3TA3D 4G42B 3MOBH 4KXCA 3BIAX 4WFGD 2VABA 3ASWA 3QDMA 2V9TA 3VXNB 3TX4A 1JK8B 1I8IB 3C5SB 1PZBA 4HWBA 1Q9OB 1LO0H 1XSKA 3W1ZA 4NWUL 1TJIL 2AJXH 5LNGA 4G9DA 2VZOA 1G5GA 4Z7VF 2HWZH 1QSFD 2I5YH 2JWYA 4PRIA 5AZ2L 1YUHA 5JHLA 3N0PB 1QSED 4PV8B 3MRLB 4OJFL 1I7UA 1V3MA 1PLAA 4U2ZA 1JZHA 5ANMA 4FFZA 1ZEAH 1WIOA 4JM2F 4JFOA 1PZCA 4DCQA 3LQAC 3G6JA 1WISA 4LRNH 3DBXB 5I8EA 5C2BH 1VFUA 4NKIL 1R3HB 1WFIA 2XUWA 2YC1B 5I1AB 1J1OL 1F18A 5A2KH 5D5ME 2CNYA 3VTAA 4HOMA 5GS1B 1IBFA 3T6VA 1ZCRA 3H6JA 1DUYA 1DQJA 1OTUC 1WWWX 4NBZB 4I88A 2X4SA 3V4PB 2H3NA 1WC7B 2X6VA 3P4NA 3LCYA 4FQ2H 2OQJA 3RWCB 3ARBC 1QSZA 4ZUWA 5JHDA 2BS8A 4XCNB 5EO1B 2BT7A 1Y1DA 4NNXB 3O6LL 5GS3A 1QD0A 4JDTL 4LL9A 2B9AA 3LDBB 3ATAA 1TENA 2X2HA 4AM0B 5IR1B 2ADXA 2XCMC 5JVYA 3IDGA 2VMDA 4HHAB 3T2NH 4Z7OE 2IWGA 2JJTC 2FR4B 2VDMH 1BZEA 2X9ZA 2CHZA 4UZSA 2W60A 4EJ1C 3BVXA 4MNHA 4GBXC 3T6QC 3GLZA 3VXUE 2HSIA 2VWNL 2F5AH 1QPPA 3LNHA 5GJSH 3QG6A 2JELH 3BXNA 4QNPF 1FFPA 2H0PA 5F93C 1Q4NX 3BSZL 3D9AL 4U6YA 1A5FL 2WLHA 1R0AL 4IBWA 4P46D 3BKJH 4PUBL 3QDGA 1RIVH 3MRHB 4K3JH 3QYNA 2DYPB 3ZKXC 1I3RA 3LH2H 5C0GB 4MA7L 1Q9KA 4POZC 2GI7A 4E9TA 1OCWL 2V17L 3AY4A 1ACXA 2H3KA 4HXBL 2CNZA 3VI4B 4NIYE 1MFDH 5A1AA 3FFDA 4NXSA 2BSSB 4POUB 2N7SA 2CKBH 1UZPA 4BUGA 5E2WL 3PGDB 1XD1A 3FQRA 4BTIA 4YAQA 3UBHA 1MAMH 3NIGB 1KC5H 3JTSB 3N1PC 1UXSA 3LC3B 1MCRA 3VM5A 1E5AA 5JB8E 3FN0H 1ITCA 4LNRB 5IJVB 4OJCA 2VWOL 4WWKC 3BLPX 3ZMRA 1FNEA 1HH9A 3KYMA 1DBML 1F42A 1S7UA 2RNLA 5M94B 5I9QC 5BRZB 3QJOA 2IH3B 2YMXH 2VXUL 3KQBL 1XZ0B 1D5IH 3BE1L 3SHSA 4WHTB 4BCXA 3WY4A 5F3BA 2NY7H 1XCXA 4FFYA 1BFVH 5DVMA 4GS7B 1HNGA 3AREB 5HHME 5TDNA 3COOA 4AKQA 5I0VA 1UT2A 4QY8A 5I19H 5HHXH 1TG8A 1XSOA 4K23L 3V5KB 5A2IH 2DQEH 5LXGH 3MVSA 2RGSA 5BZXA 1Z66A 1S5HB 3DX6A 1NCWH 1P7QD 1HIMH 1WICA 1NMBH 1RUPH 3KR3L 8PAZA 1KXQE 3U9UB 1ND0A 3ZKND 1KPUA 4X8TL 2WK2A 3TN0C 2IQAB 4L4TB 3LZQA 1BEXA 4PREA 3HRPA 2MNUA 4F57H 5EF0A 4NAJA 2B7DL 4M7LH 5T1MB 4OUUA 2VXVL 2APVA 4HWBH 2ZNXA 4ZFFB 1HCGB 2JCCB 3QA3A 4V2BA 4OCYL 3S3PA 3KW8A 5BVPL 3HN8A 2AJ3A 4R4FH 1QA9A 2CDEB 3MACL 3MGAA 3QEQD 2XSKA 3CIAA 4ODXB 5FDWB 4HX1A 3JYBA 3VA6A 1UZKA 1GYWA 1OAKL 3HI1A 4GSDL 4KXBA 1VGKB 4NNPL 1N7DA 2BIIA 4J27A 3FBYA 2I24N 4PIRF 1R3JB 3MSPA 3W11D 1E43A 1SLVA 2CCVA 4NHUB 1AXTH 5D7IE 3D0AA 5GISL 1DJSA 1G1KA 2AJSH 2ID5A 3LNDA 1F4XL 5GHWL 3RY5A 4MMZC 1OALA 3IFPB 1TPXC 1YNLL 4ELDA 3QJRB 5E1GA 5DF0A 3CXDL 5CJOH 5D7LD 5KZCB 4JYUL 2O6DA 4HIJB 2WQ8A 1NKOA 4YFEA 3PPSA 5IB2B 4YHKL 1IEAB 3ZUNC 5BMFL 2VRAA 1C9SA 2EYTB 4G7VL 4PY8I 2IH1B 5ETUB 2GJ6A 1XO8A 4NJAH 4LVHC 5LXGL 2DN7A 4LLWA 2B3IA 4NAMA 4A68A 3RWJA 1WU1B 1QHOA 3SSGA 3Q06A 2OAAA 2X3BA 1IQLL 1A6AA 2ILLA 4D90A 4OV5B 1OK8A 2ENQA 3CUPB 5EZOL 2ZT9C 2K6WA 3GM0A 4CADB 3V9EA 2Y23A 1B3IA 2A9AA 2FRGP 3ETBJ 4PRHA 3HPLA 5CBEA 5KVEH 2CO7B 5TH2A 4A39A 4O2FB 1J18A 3KPSD 4KKBC 2ZOLB 3MUGB 4EEEA 2XTJE 4LEXH 1EHXA 2NQCA 4L48A 1MNUH 5TQ0L 4NRZB 3TYGH 1FO0H 3OGCB 3ULVF 3HNVL 3O3BB 3REVA 1DBAH 1A1MA 1CDUA 4DO5A 2HKHL 2NZ9D 2EI6B 4NZTL 1DIYA 3TEUA 2FEEL 1GS7A 2XXGA 3QUXC 5JNYB 2XTSA 1BPVA 4XOAA 3HZMB 4AC2A 4FCAA 3IJYB 3UJIH 2F58H 3G7TA 1QBLL 5FUOL 3QXDB 2F1BA 1RZJH 1V27A 3KM1A 2BQ6A 2HXAA 1T4KA 3A6BL 1MFCL 4CVXB 3ESVF 4XAWL 5K9KB 1BVKB 5INCB 4OGYH 4QRRE 3DYPA 4MAUL 3B2UC 4TTGA 3MV11 1G1TA 1P5UA 1L9PA 4LZKA 4UDTA 2Z91A 3T0EC 1RURL 4KRPD 3LZPA 5BQDA 3N8YB 1IJQA 1PS3A 4PMFA 4M00A 4WKZA 1X7QA 4N0YH 3DKHA 2WXPA 1S3KL 5EDSA 5JW4M 4QRSA 1LEGA 4KJPC 3TFKC 2Q8AH 3HR5A 4IK7A 5GSRB 3IGLA 1SGKA 1TLMA 4G8GD 5CO1A 5E5RB 3VGGA 1KGCE 1CVSC 2PHBB 4ZX4A 2DBLL 1WZ1H 2H6OA 5B8CC 4HCRA 3QDJD 4JRLA 1HSBA 3CFKB 1BIIB 3RIAK 3HNTH 1G9NL 4WNQA 4Y1AE 5FO8A 1JGEA 3RBSA 3K3QA 2BWIA 3UAAA 2BVQA 3VFRA 4KHTL 4FQIH 2ODIA 2SEBA 3L9RB 2PR9A 2HRLA 4X6DA 4WJ5B 4PLKD 1UOLA 1OM9A 4PVLA 1MLCA 4N2NA 2W95A 3GHPA 4LMFA 4X6CF 5D7JC 4CILA 4L3EA 2IALB 3ILPB 5HDWA 2CJSA 1AANA 2C5DC 4PW4A 2QPEB 1TITA 5DHYA 4ZT1A 4P5KA 3HAEG 1ULVA 1EO8H 1OARH 2VKXA 3Q6GH 5EDXA 5IEKA 3PV7A 5FW6A 3BRGC 4HUWB 2WQSA 4XRCA 1QWHA 3VD9A 3CVHL 5DJXB 1Z1WA 3SDAC 2P5EA 1FVCB 1T2XA 3HJ0A 3QNZA 2FO4B 2UWOB 2QFRA 4PJ7B 3ZR5A 4ORZC 3LPWA 4U4BA 5DZJA 4H1LH 2D31B 3WJMB 4ZMPA 1LDSA 2HX7A 4PJDA 2VO8A 5MEOB 4KKRA 3S37L 2VZ1A 2DQJH 5GGUB 5LWYL 5KS9F 4NKOB 1KGJA 5F9DC 4AOFA 5JIMA 1WFOA 1PD0A 4NRYA 2VVCK 5CUSL 4IBZA 1Z2KA 5J1TC 3E9UA 3LJ3A 2F8OA 1OCCB 3SDCA 2NR6C 4TQEL 3JT0A 3UP1A 4W1TA 3BZ4B 2EDBA 3NIDB 2VERN 4PYHA 4DKFH 4ZTPL 1C8PA 4EOWH 3DC0A 3F8UB 1JTPA 5FGCE 1WE5A 3RJQB 4F9PC 4D9LH 1LO4L 4P23D 1BVOA 4HIQA 4P2CG 4UOJA 1CVUA 3CCHA 2N01B 3OKLB 2TSAA 3DXAE 4NLHA 2VLRD 2AJVH 3NYKA 4U2YA 4CAGA 3DVGA 3PJLA 4DQOL 4DSYA 2H0FA 3ZT5A 2Q20A 4B9GA 2COQA 4AVKA 5JOEA 3UDWA 2XN9A 2H9EL 2H7WA 1XGZA 1IAKB 3MRBA 4ENEC 1UD4A 1NOFA 3ZDYE 4PJ8D 5F9WB 1S7QB 4YK4B 1A6UH 4QXTB 2WO2B 1HHHA 1HU8A 2V7NB 3ZIMA 1A3LL 2H8PA 4TNEA 2G2RA 5DD6B 3B3BA 4N6RA 4D0DB 3L5XH 4KZCA 2DLTA 3ETSA 5H4YA 3VGDA 2DWDA 2YAOA 4GJTB 1KJ3L 1DCLA 1FVEB 2Z31D 3F6LA 1PY9A 2NTFB 4DKDC 1KCBA 2VRKA 4HC1L 4GQ9H 5GS2D 3C9AC 1LE9B 2NY0C 5GS2H 5DSCA 5I15H 5LGJA 5BV7B 3KE0A 4C58B 3E2HB 4BXSA 1CFNA 2V3FA 4L8SA 3R1GH 1QI3A 2ZAHA 1FE8L 3MXVH 5IHUH 5I73B 3HNSL 4XCYB 1UUNA 5GS0C 1GJIA 1E2ZA 3RUGA 1XFEA 5AUMA 1C5BH 1AUTL 2OZ4H 3LPFA 1H3UA 4JDVA 3BISA 1RIUH 4Q7DA 3KCWA 2ENPA 4OQTA 3KWVA 5KJ4A 1HAUA 5C0CE 1NCIA 4WVRA 5CSZA 1QLRB 4Y4FA 2QVMA 4N0UA 4GAGH 3EO0A 5IQ7H 5FA4A 2ZXCA 3C6LB 3FUJA 4JFPB 1U8KA 1TQUA 1B4JH 4I3SH 5JIHA 1MOXC 3N8XA 1OP3K 3SYAA 3QNFA 5DC4B 1JZGA 2XC4L 3QC5X 4OCRL 1Q1JL 3T09A 1OAQH 3ZUCA 5KJRH 3QEHA 5IMMA 3X12B 4FLOA 1HT5A 2ZOKB 3F62A 3MLRL 5F7DA 4XPAL 2HB0A 1DX5I 1XKAL 5LBSL 3MLPA 4F37F 2A7BA 1KT2B 2VDPH 4U1KA 3UZQB 3ZMEA 2BOBA 5EUKB 3JV0A 3O3AB 4ZMOA 1D5BA 3BVTA 3I9PA 1JTTA 4NKMB 1D7DA 2WPKE 2C1OB 5ID0A 3FU6A 1CL7H 2IPTH 3DJSA 1MRCH 2PR4H 5BS0E 1LMIA 4MKMA 3LEYH 2FAUA 4JY5L 2R2CA 4AV4A 3AY4C 4TNWK 3ISYA 4IU2B 4W6YB 4BQBA 5IESH 1J9TA 4TSAH 2OYEP 3CFWA 3L95B 2BPBA 4YHNA 2EDOA 4Z7VA 5IMLA 1FQ9C 5FYKU 1Q38A 3HVDA 4XB3A 4P0DA 1BEYH 3VWKB 1EFXB 4D9RE 1ATAA 5I18L 1PD6A 1U8IB 3MV8A 2NY1C 1OQOA 1F0SB 4HD9A 1CDBA 4JM2A 1I1RA 3QXVA 1ZLWK 1RKRA 5DC2A 3UTSB 2Y7QA 1FZMB 3OAUL 4UYPA 3L4CA 3VFSB 2VTFA 4NN5C 5EOCJ 1XSIA 2AGJH 3HA0A 1HHKB 5FK9A 3R05A 2D7MA 2GUYA 2MHPA 4MAYD 1NGYB 1UCBL 2A9NH 4J4PD 2DKMA 2OMTA 4BA8A 2XDHA 3TCXA 4Y6DB 4GT0A 2G3NA 3G5YA 3ZL4H 2WZPD 4X80H 2CRZA 1L7IL 5L7XL 4OZFA 3RZCA 5EV7A 1RP8A 5ILTL 1N6UA 4KX7A 2CJIB 2OR9H 1NFUB 5FGSA 5HD8D 1H8NA 3K74B 4WK0B 3PPEA 3CDYA 1BQ5A 3TF7C 3HBZA 2VDRB 2WXOA 3O45A 3U1SH 4Z77A 2BK8A 2F68X 3NJIA 1HQRA 2EDEA 3D50A 5D4JA 4PGBB 4RGOL 3OPZL 2H45A 43CAA 4AIZA 4AVJA 1T6VN 5FM5M 4TXVB 4XN5A 1ZAQA 3MJ7B 1ZVNA 1KY7A 2F61A 1I9JL 1EDYA 2ZKHL 5F1OB 3RWFA 3VYPA 1ROWA 5KYXA 1WBZB 4AMKL 5B3JF 4HH8A 2HPOA 3VRJB 1AQDB 5JDSA 4PJ5D 1PZUB 2GTZA 3OJ2C 3EJUA 4JRYE 3VH8G 5KWYC 2OXHB 4MA3B 3DX8B 4NJ9H 4JFZH 4PG9B 2P3FN 3KPQA 3V8CA 2HCZX 4Y2LA 1GCYA 4AZ8A 3KXFD 2CDGB 4F37K 5E2JA 2A6KA 1WDAA 3B9VA 4AUYA 3UC0H 3ZZQA 1NBYA 3EYVA 3VFUA 3FS9A 4JLRA 1C5DA 3SYCA 4DOHB 2F9BL 1D2PA 1GPOH 1WAAF 3A6CL 1AGCA 3DSNA 4RBPK 4DJMA 1LXMA 2XLLA 3GXUB 1IC7H 4N1CA 2BLFA 1CDCA 1RZ8B 1AAJA 1GGCH 4XXDB 4YDIL 4JFUA 4F7EB 1Z9MA 2BVTA 3N55A 1BQSA 3FFCE 4OQTH 1KXHA 3K2KA 2NUPA 3U73A 5E2VL 5JPMB 3N40F 4PJFA 5EN2A 4Y7BB 1KEMH 3ELAT 4QHNA 4YZWA 3PWUB 5FDQA 4GW5A 1KEGL 2KT6A 1PPIA 2AQNA 2XZAL 1FZKB 2E3VA 4HJIA 4LMQI 2NQDA 3GRWH 5D7KD 4AE0A 1RLWA 4R26L 1XCQA 4P06A 2UV3A 1OT2A 3DDGA 2YMOA 1PZ2A 4H8WL 1CI5A 1KBGH 2KZ1B 1ZT7A 3H3PH 5DMIH 1SEBB 3RTLA 1FV1B 3PDOA 3MLTB 3WUWB 1NCCL 4N5ED 2AZAA 1LK2B 1MJUH 3EYQD 1G7LA 3KLAA 4GAAA 3U36B 2W07A 1X5IA 4HJ0C 1WD9A 1RK1A 2HJKB 2WFXB 1ZHLB 2X6AA 1SNRA 3RVUC 3WN6A 5D5MB 3KS0J 1F11B 3QDHA 4HEMA 4JZJA 3CHOA 4DKEL 1H6EA 4EDXA 2VDKH 1DQML 2YD8A 4XO4A 3EG9B 1CXHA 2DH3A 1QQDB 4GKSA 2H2PC 2VWLL 4PQXA 3A6OA 3GCXE 1LHZA 4HMDA 4ZMZA 1M6UA 4JFEE 3D69A 4WUKH 5AW2B 3TNNA 4PGDA 4KZ0A 4ISVB 1ORQB 4HSCX 3M7FB 1P5UC 1NICA 5JMOC 4L9LA 3G5XA 4H2CA 1U0QA 3PWNB 4EVNB 4Z7OB 1I1CA 2AQ2A 2RCSL 4WHYG 2E7LA 1E27A 1MCLA 1TQBB 3MO1A 6COXA 4XBPA 2WYZA 5IFAL 1HYSD 3N50A 4HG4K 4C4KO 4LKCB 3LRLA 3VXUB 1LO2H 5ICXA 3X11B 3CC1A 4I7ZC 4UTBH 2F1EA 3S3DB 3VO0A 3BHBA 2MHAB 3NFSH 5D96C 3D0VB 3O8XD 3CZLA 3MBXH 1NFIB 2DRUA 4ETQA 1E90A 2W3IB 4OZGA 2C3WA 2HZHA 3EKCA 4G6KH 3X17A 4G43A 4NQUA 3WAKA 1YY9D 2QMJA 4BFFA 4OCSL 4ELMF 3W5NA 1CFVL 2A9DA 3DRTA 1JWUA 2KLTA 1ZS2A 1U8QB 2YEZA 3CN0A 3CN4A 4MZIA 1FJ1B 2VLMD 4FMKA 2EVHA 2YXWA 4ZUTB 1GW6A 5DZAA 5F6IB 5FYLL 4O1ZA 5EEYA 3UIZA 3ARZA 2OTPA 2MPAH 4QHKI 3ARPA 3AWEA 3BT2H 4Y2OA 1OP9A 4GXUN 4NRXB 1G7QB 3MRGB 4BZ1H 5IB3B 1F7EA 1FP5A 1EAPB 2B59B 3JV4A 1X44A 2EDMA 4UV7H 1J12A 3CVIH 5IBLD 3X1FA 5CEXB 4K5LA 2MMXA 3FNKA 3EO9L 4R90H 1J10A 4TSBL 2WPIE 4NQCA 4P2RD 1FNSH 3FQNB 2IGLA 4PS8A 4YIQB 5T1LA 3T5WA 3OG6B 4EI6B 3ZVVA 4DPBX 2AXGA 3KPRD 2OSXA 3BESR 3V5DA 2VC2L 1LO0L 5C8JA 4G59C 3SDYL 1JZ4A 1U8JA 2HWZL 4ZQKA 5T1DH 3P3SA 4PP2B 2WQVA 1RHHA 4HQQL 3SDCC 3GLEA 4TTDC 5DRWB 4ATWA 1PX3A 2QLYA 3L5WA 4I5BA 4WCYH 5CWSA 5LAPA 4DGUA 3V2AR 2YRBA 2ERJB 3U6RA 1T22B 3MOAH 4IK6A 4KI5E 5HHMB 3ARDB 3X1EA 3ECBA 4LRNL 5T5NG 1RUQL 4U6XB 4AEIH 4A55A 3IMUA 4D9QD 5F7FA 3DOIA 4APXA 3FAXA 4RS0A 1N64L 3CJJA 1CYXA 2VM3A 1KULA 4X4XA 3DYMA 3FHQA 5E51A 5H94A 1WH0A 1TZGH 2G0LA 5A6MA 5IKCA 3CHRA 4RZCB 1HZ8A 5I1CL 5J11B 1EK3A 2XQBL 4O51B 4MNGA 5A16B 4A7GF 1CD9B 3ESMA 1BFTA 4JRFA 2KH2B 1EX0A 2ZXAA 3TO2A 1H6FA 3PL6A 4X7TB 4XODA 1MH5B 1XAKA 1J0JA 1ZHBA 3VU2A 2I07B 4PJBE 5FC9A 1F86A 3VX0A 4ODVH 4H40A 2PW2B 1E6JL 2BMGA 1ZOXA 4X6CA 1BF8A 5D7IB 2YEVB 5KSBB 3P54A 3UPAA 1D6VH 2F5AL 4GG6A 1QRNE 3HIZA 5AVUB 4KGLA 4ZK8A 2D3LA 5FM8A 5IHLB 4L8SC 1INDH 1YNKL 1KIRB 1UH2A 3V6BR 3X2QB 3ARGB 4MCMA 3FQTA 2HAZA 1EAIC 1I7TA 1LNUA 4XVUD 1RIVL 4K3JL 3S2CA 3P0YH 4LCCB 3HCVB 3X1BA 4QRUA 3EH1A 1IZJA 2J73A 2ZIDA 4Y4FC 1BAFL 5KS9A 4JKLA 3FU5A 4HC1A 4Y0GA 5F96L 4OZHE 1HRFA 4JFQA 4XCEA 4FG4A 2R51A 1H3TA 4FQHA 5MENE 1LQDA 2X6BA 3EHBB 4MJHA 3ZYGA 1F6AB 1RPQA 2QVFB 2Z7YA 3BMWA 5CZKA 2WOYA 2V2WB 4XC1H 1MPAL 1SZBA 3FN0L 3U46A 3LRGA 3T0BA 2XKSA 4UM8B 1M2VA 4H8VA 4IS6A 3O9WB 2AJYH 4G7RB 2XTJB 1J0YA 4EN2A 4X99B 2WYTA 3NT1A 2WBJD 2Y2WA 1FRGL 5HYJA 3FRPB 5DI8A 4BH7B 2BQ7A 2DIEA 2OSLA 3NG5A 4JHZA 5IZ7A 4N25A 4GQRA 3CFIC 3QJHB 3MRFA 3OM3B 3PNRB 1HHJB 5DHXB 4RRYA 5LBSA 3MNZB 3ZR6A 1VFBB 3P4OA 4NFBA 3B7TA 4UQCA 3VGHA 2ED7A 1IBGL 2NY7L 4HCGA 1UD8A 2L4OA 1BFVL 5C0NC 4G7YL 5IVNA 5EOTA 1G6RB 3MR9B 4JM2C 3SQBB 3CVCA 3OC5A 5HHXL 4PH8A 1QUNB 3O41A 1BREA 2AC0A 3QO1A 2W2QE 1FFTB 1MW0A 4ANXA 1HIML 4HZLA 3GEWB 5EZPA 3RFZB 1ACCA 1PDKB 2VW4A 3VFGH 4QRRB 3A4DA 1HHGA 2OMWA 2K6YA 4PH9A 3MRRA 5IF0B 5SWQA 4F57L 2J5WA 3MV9D 4JY6B 4M7LL 1XV8A 5AVXB 3S36L 4GW4B 4A2EA 1J8HA 1E9OB 4OD3L 5JIQA 5B1KA 4UNVA 4O9HH 3NK4A 3ZSTA 4TPRL 2BSEA 3SDXF 3BX7C 4RGNC 4AV0A 2YD1A 3RTQA 1UZQA 3KG5A 3QQ4A 2ZP9A 3J2PA 3QXAB 1WWCA 1MFMA 3HMXA 4U6HB 4NIKB 3E0GA 1AP2A 1EA9C 2R23A 4E9XA 4MJ2A 5TGBA 5LGYA 3EOTL 1MQKH 2DMGA 1AXTL 2DM3A 3NQIA 1F2XK 4Y1AB 2PCYA 2AJSL 4ZX3A 4CN6A 5GGVY 1GGIH 3HKFA 5D6DA 4IU3A 5FGBA 5TF0A 1QFOA 1OTSC 3TP4A 3MNDA 4PLJC 4G11A 3UAJC 3KYOA 4UBDC 5ACMA 4GPVA 3K0YA 5EZJB 1U8MA 1Z32X 1GOGA 2L7JA 3MRPB 4GAJH 4KZEL 4CUEA 3STZB 1EAQA 1HEZA 3EH3B 4P2OD 2Z92A 4RRPA 2X2JA 3RJDA 4F3FA 3QUYD 3V0IA 2UZPA 3K71A 3C5XA 1XF4A 3W82A 3RHWF 3IVKB 1REIA 3KVPA 1MI5A 2WD0A 3SJVA 2BQWA 4OCNC 3NCJH 2EC9U 1OP3H 3T8XA 5E03A 5KVEL 2GK2A 2HT2D 1YEFL 3C9NA 4MJ6B 4MXQC 3VMNA 4F2FA 1YMMD 3O3DB 2WVVB 4YPGA 4LEXL 3ILQC 1MNUL 2QPUA 1A4JA 4MMXA 4EUPA 5FGCB 2X1XR 7FABH 2YSSA 3KPNB 1FO0L 2NSQA 1EEYB 3IFLL 3AAZB 4DTGH 3DXAB 2CUIA 4NUGH 3Q9QA 3V7AE 2XTLA 4E41B 4N3TA 4IKNA 4ZUSB 4UV4H 1BXXA 2VKWA 3MRDB 1P69B 2AYLA 3B9DA 4YHIA 3LMJH 2XJKA 5EWIL 3FMGH 2WPME 1EJOL 2WUBL 4PJCE 4QJ3B 4AEHH 5BOZG 5I8OH 2A6DA 4XPGL 3ZDYB 1R5IA 2NXYC 3CQPA 5FM4A 5ALBH 1OGAA 1Y18B 2J2ZB 4XPBL 3ROOA 4J6RH 2BIOA 4LOUD 4D0CB 1H15A 3AU0A 1OVZA 3RDTB 1AKJD 1BQHB 1TDQA 2QSCL 5SWZA 1EZLA 1DVFB 3OKMB 4YBHA 2H9GA 4HKZB 1SXBA 1CXKA 2WYGB 4YT7L 2Y6SD 3AQZA 3T4YA 1HQ4B 3AG3B 4N0YL 4RLDA 3X13A 4NDMA 3RVVD 3R06B 2F7OA 3V4VB 4JZJC 4F9LA 4M1CD 5JR1L 3TBVB 1A9BA 1DJWA 5FYJH 3D4GA 4CSYA 3QORB 2WN2A 4MJJA 1U3HC 3CFMA 2F5BL 3NSCA 2NY6C 1M7DB 1OK0A 2KKQA 2OZNA 4DH2A 2DDQL 2FWSA 5C70A 4TF4A 5JUEL 2QVIA 1FLRL 3GS0A 3L4WA 4HJGB 4OFYD 4KQ4H 4BA0A 4AXWB 4R3SA 4MJIE 1ZHKB 3AT9A 2Y5TA 1IV8A 4QIRA 2EDTA 4L9LC 5DXWA 4FEIA 5C0CB 2RA0L 1VCBC 3ZXAC 2E7LC 1IC5H 5DD3L 1A9EB 3V6FA 4PG2A 4YSSA 1VERA 3MQIA 1HOEA 3JWOL 4JRXE 3T8MA 3O6FB 4AIXA 1UHVA 2YXFA 3LRSB 1WAAA 1VADB 4YDZA 3H9SA 3RL2B 4U31A 1RI8A 2N1KA 3TT1H 4HK0A 1ZDSA 4OLZH 3U0TA 1K3IA 4AK1A 3TIEA 2HUEA 5ES4B 1NGWB 3OHXB 1HXYA 2CCLA 3BEVA 3MJ6A 4XOBA 1F6FB 3FRUB 5BS0B 1IM3A 2WZ5A 4IBSA 1LP9F 1G7PB 2X70A 5ICYB 1PTHA 3QZWB 5JW5A 3FUEA 3CFBA 2EYRB 2ZUVA 2I32A 4CNIA 4ADJA 4NQSA 4XBMA 2EJ1A 4KO6A 3KJ6H 3QW9A 1EHNA 2VJ0A 43C9A 1XT5A 1IAII 4JFFD 4R7DA 5DFVC 3GIZL 5LQBL 4EOWL 1QFHA 3HE6A 3RX7A 5CN1A 3RWGB 4YHYB 2A3TA 3ZE2F 4D9LL 4MLIA 3PREA 3EOBB 3GSWA 3Q48A 5DJ2A 1VCAA 1ORSB 2IAND 3ULVC 1NDMA 2AJVL 4U05A 4RBPH 4AGMA 4X9IA 1Z9PA 3LY6A 4FF9A 3BQUD 3FT1A 1OB1A 3P0GB 3CBJB 2OCCB 2VSCA 4P4KB 4YXLH 5J3HC 3OV6A 25C8L 1X9LA 2CO6A 1ESOA 4F15B 1RZFH 5DMYA 2F1AA 1DQIA 3CPUA 3BGMA 1GS6X 2MPVA 1IAIH 3T0EE 2E86A 3PWPD 1OP4A 3L7EB 4NI6A 4X8JA 2G5RA 4ZX5A 2JI2A 2IAAC 1ES0A 4U6VH 3L3DA 3TA3A 3UTPD 2Y3AA 2XA8L 2O26U 3I6GB 4EUPH 4FQ1L 4M5TA 1CICB 4GQ9L 5DVOA 1ID5I 3JWDL 3WNOA 3WTYA 4HIXL 2IDTA 1A3RL 1L7TL 2R69H 3QNYA 4R4BA 1BVNP 2EIKB 3MXVL 3TU6A 1UT9A 5HGDA 1AOZA 2EE3A 4U1MB 3TFBA 2I9LB 2WO3B 1ZDQA 3O4OB 4CSZA 3WEBA 5C07A 1DSYA 1RIUL 2DQDH 3PL6C 1SFHA 2BCKB 2QPSA 4ELMA 4F8PA 5CP7B 3WE6A 1FFMA 1KBPA 4XN2A 4DNLA 5IQ7L 3KLHC 2ATKA 1KCVL 4UT7L 4Y7OC 1QBMH 2NXZC 3FT4B 1T20A 4L1HA 1GGYA 2J34B 1H19A 2XWTB 3UBXB 1SXNA 4N2LA 2HN7B 2H9EC 2EVFA 2Z35B 4JQXC 4LPXA 5HYSB 5EU6E 5GRJL 1EAOA 4IGBD 4GW1A 4YR6A 2AW2A 4QYOB 4ZMQA 4IBTA 4CSTA 4P2AA 2OMUA 3SOBL 2QADB 2QSTA 1IM9A 2XETA 2R1WA 4KO7A 3T2OA 4PEEA 4CMMB 2CRIA 2X3AA 3W37A 2D4DA 1PG7X 5B38A 4DZ8B 3K0WA 1MHCA 2FIKA 2K78A 2R2BB 2IPTL 2VITB 1MRCL 3GXDA 3QJFA 1P7KA 1BD2D 2HJFA 4XVSH 4Y9FA 1UTDA 3LEYL 3TIDA 4EBQL 1U8LB 3ZBMA 2R29L 4XT1C 5JB9E 5FLVA 3AXIA 3BZFA 4FXKB 3VXOA 3FFCB 2PO6A 4TSAL 4AH2A 3OSVA 3BN9C 4P07A 5IMKB 1BEYL 5C0AA 2XV6B 2VXQH 3DJTA 2Z8WC 2Z0UA 4FFWD 4FYRA 3RA7H 4MXVF 1XDTR 5C7ZA 5MEQB 3AXLA 3JTTB 2AV1A 4P46A 1Z0NA 4Y7MA 1XH0A 3W0WE 2FVNA 3QDME 1TQCC 3IU3B 3OB0H 2WTOA 2XU9A 4X7SL 4GAYA 3EDEA 3L3JB 2FX8H 1FZOB 5ABAA 4LAJH 4NFCA 3QUMB 5DS8A 4PRIE 2A9NL 4CN4A 4OTJA 3N9GH 5ANME 1M71A 3VD3A 2D7TH 1YECH 3VTMA 3JZYA 2GK0B 4I9XA 4UDUA 1FN4A 1TU2A 3MBWB 4A7GA 4N2MA 3VQ1C 5HY9B 1EPFA 2XWEA 3FYEB 1RFNB 5F71A 5AZEH 3AM8C 3QULB 4F8TA 1JYNA 3RNKB 1AR1C 3UG5A 5CS7A 2A4EA 5ESAB 4IEFA 1V7ML 2ZAGA 3NSFA 3NN8A 2O6FA 3Q7DA 3U1SL 1P1VA 3GZPA 4RFOH 1V05A 2CWRA 4JFEB 4LF3B 5HYQA 1TOXA 2XZCH 3BKYH 4OZ4A 4RWHA 1IFGA 2WLIB 1A7QL 3EGSB 2R56L 2A77L 3GHEL 3OKNA 2QBWA 3KBPA 4QOKD 5BO1H 2YGQA 1B2WL 3HHSA 4LBAA 1MRFL 1VGEL 2C9PA 3JWNC 2EDQA 3GSNH 4YSDA 3GYRA 4LIQE 3CSYA 3AACA 3ASNB 3ULSA 4WSJA 3ZHFA 3RTQC 4J8RA 1X7AL 2H26B 2Z1KA 5AOIA 4TULL 1P7QA 4YE4H 5IVZA 1DTUA 4F33B 3NZSA 4XVJH 4DW2L 4C83A 2MCPH 2JK5A 2WPGA 1CTNA 5DR5H 4HWUA 1ML0A 4WTZA 1XCTB 4NO2A 3PV6A 3KHQA 5D6DC 3FO2A 1B0RB 1EZUA 5FGBC 4Y4HB 5F88A 1A64A 3QDGE 1QIUA 1CF1A 1GPOL 2FBJL 4KROD 4UM9A 2IAMA 2NUTB 4RQQB 5C0FB 4D8PA 1D5ZB 1Z5YD 1B3JA 1IGIH 3B7YA 1S8DA 4KHXH 4N0FA 4K55A 3BGFC 4XTRD 3DROB 4S11A 2BOLA 2Y36L 4U1IB 1GGCL 4L5FH 1J5HA 4RMUA 1KJMA 3BIKA 2P5WD 3HPJB 1YYCA 4K7FA 3BZ5A 1CVRA 5D1XD 2V9QA 1CMOA 5IEHB 4UILH 5I6XB 1V10A 1MZZA 2GITA 3CZFB 4QRQB 4OLYH 2BHFA 4W9LC 3AMLA 1NGPH 1KJVA 3ZT7A 4KK8C 3SO5A 1KGUA 1O9ZA 4Y5YA 4Z6AL 2V2XB 5D1ZI 5BUGA 1L5GA 3LPPA 2W1NA 1PVHA 4KPHH 3H3PL 5DMIL 5GZOD 6FABH 3IGFA 4OKVB 2ZXBA 3O2VH 5KN5B 5T3ZL 3I02B 3NJFA 5AALA 4JG0H 4IMLA 1JMZA 1WCBA 2QKIB 4KK6D 1AFVH 3VB8A 4P59H 2AEPH 2XWJB 3DO4A 1PLCA 5FV1L 1AE6H 1C8QA 4GINA 4BDVA 3L3IA 1E2VA 2WTRA 4NG9L 4BFEA 4HU8A 1SHWA 5JZ7D 2RAMA 5F3HB 3SDXA 2G75B 4JN1H 2DEYX 2AEQH 5D1ZD 3WMQA 4DP0X 1BQLH 3K6OA 5E94A 1T5WB 5FS5A 3NPZB 1SHSA 2J1YA 2DMKA 2KV4A 1ASQA 2ODHA 3QVAA 4DIXA 1T1WA 4LKXA 3ZKSD 4O2CA 3OMAB 3POHA 1J1PH 2Z7ZA 1N0XH 5IREA 1ZHNA 3UERA 3HS6A 4KTEH 4UNIA 4FXGB 1KZYA 4PJBB 4ACTA 5GZNA 3OWEA 1CZ8H 1L9NA 1YEWA 2CHNA 2W0PA 5HHVH 1UZJA 4QF1B 4S0HA 2EUXA 1PCSA 4F9LC 1G7HB 1D5MB 1LO2L 4AKPA 4UTBL 1P9MA 4PJEF 1FC1A 1RJYA 3LN0A 3SBWA 3NFSL 1HWGB 3E6HA 3KNBB 1QRNB 3GSQA 2EACA 1FAIL 1UB6B 2LGNA 4ODSH 4Z3FA 5DJCB 3IDNA 3SCMC 1WS8A 5E9DD 4PRPD 1PEZA 1ZGLP 2OMZB 4N2KA 4MNQA 1AACA 1B9ZA 2FO8A 2ICEB 1K5NB 4JPIB 2LQRA 1BMZA 4DUXA 3GSRB 4M61A 4PG2C 3MFFB 4OZHB 1H8OA 4M7ZC 2HG5B 3BT2L 2GJ6E 1NIFA 4G8GA 5GRVK 2BWQA 3S5LA 4MQ7A 5MENB 5IM7A 4FG2A 1IBYA 3NQKA 1IBBA 5K1NA 4LEBA 2OXGB 4S1RH 4R90L 3UXFA 3MV7D 3QPXH 1DO6A 4BTTA 2AEIT 3QR0A 2OTUB 2OSWA 3QJZA 2PW1B 1YY8A 3TCLB 1APQA 4Y4KA 2Q5BA 2OV0A 2EI7B 2MWCA 1ZANH 4LSVH 2XBYL 5F1NB 4YSAA 1LPKA 4PRHE 3DJ9A 3MDJA 1VHPA 1H9VA 5BXFA 3A4FA 5T1DL 3ESOA 3TXAA 1OD9A 1YEEH 3KLKA 1LQSR 3SPJA 4G42A 2Y5EA 3NJMA 1TVHB 3AS1A 4OTYA 3MRKA 4MDJB 3P9WB 3LPOA 4N26A 3PLYA 2Y7ZB 3HE6C 1QO3B 3MOAL 2I7SA 2ZKXA 3A67H 3LXBA 3RL1B 2GT9A 4P9ML 3DPDA 5EBLB 4AEIL 1NGZA 1DQQB 4UU9B 4ZSOA 4BQCA 5T3XD 3C12A 3TF4A 2FBRA 5BZDB 2FLRL 2CIIA 4BK4A 2ZSVB 5DEFA 4HUVB 2E74C 1OB1C 3ARBB 4KJQD 4JO1H 4HIIB 3GBNH 1RU9H 2PN5A 5BPPA 3II1A 4XO3A 1R3HA 5ANHA 3KPMA 1HZHH 2PXYD 5K9OA 3I3DA 5IW3A 5FA3B 3VWJD 1PLGL 3U4KA 1DE4B 2ZCHL 2FJHB 1BBJA 3ESPA 4H44C 1K2DB 4X5WB 1ZLSL 1ODAA 2XG4A 1CQEA 1SN0A 1O7VA 4RISL 2H32H 2VLRA 4GBXB 5HYIA 1I1AD 5AOLA 3WTSA 3DUUA 1IIKA 1CTMA 3SKOB 2XVLA 4JPKL 2D7NA 4NGAL 1II4E 2MQCA 3VYNA 1D6VL 2B4CC 4AM0A 2DLEA 2EVJA 4PS3A 1WWAX 1KYFA 5AD0A 1F90H 1U8PA 3DNKA 2XZZA 1INDL 4MASA 1PZ5B 3T3MF 2DTSA 5KBKA 3QCTH 1DLHA 3L3OA 1NC2B 2Y0SA 4PJ6A 3ZKXB 5EN3A 4PFEA 2ARJB 3EYUH 4X6DE 4UQ3B 1AY1L 5SWSD 3S88H 5ECJE 5CEYA 3WY3A 4PTTA 4PBVC 1SVCP 4FFTA 1LP9A 1G9MH 5I1IL 3OJDB 1KY6A 1ZK5A 4L3EE 5GRUH 2ZF8A 3OKKA 3QQ9C 4RUTA 2XKNB 4UQ9A 1YMHA 3AQDA 1XEDA 3LS5H 3DTXA 4BCZA 1H9DA 2J5LB 4I2XA 3L3GB 1Q8MA 3KQDL 1AS8A 5DA4A 3GO1H 2P5EE 1FFOA 4XL1A 2EDFA 4ZPVB 8FABA 5IG7B 4WWKB 1LTXA 3BZEA 3TWCH 4V33A 4EKJA 2Y5QA 4PJDE 3INOA 3B2PA 5E5MB 1T7ZA 3MBEA 1NLBH 4TVSa 2BP8A 1KBVA 2O4EA 3O4LD 1JPFB 5I9QB 1FVDA 1I1FB 3OXRA 2A73A 3JXAA 4IRJA 4YXHL 3U1PA 1LWJA 1N6VA 4ERSL 1E5UI 4ICXA 2WUCL 4PRNB 1DP0A 2PO6C 1HOCA 4RIRA 4TQPA 1NM9A 1MCEA 4OT1H 2VL5B 4HJSA 1QFPA 3V0JA 2PNDA 3NIFF 1RSYA 3LEVL 4K3HA 4D0EA 1DBBL 3T0XA 4P46C 1KB5A 4PJCB 2CO4A 3BQVA 4DVBB 2AVFA 4WW2B 4X9FA 4K07A 3WXWH 2KDGA 1FHNA 2ICWA 1NAKH 1S7RB 4M6OH 4YMPA 5BOPA 3F2LA 2XN9E 2WV3A 3TN0B 4DK6A 3VFGL 4PCTA 4HUCA 4O4YL 4XO8A 3S3BB 4L37A 4LQFH 4KUZL 3ILEA 2KS0A 2H1LM 5BCAA 1QLEB 1XDTT 2XI9A 2AEWA 1MKFA 1S5HA 2H0EA 2JKNA 5ADPL 4V1DA 1IVOC 2EC8A 2KQMA 1AS7A 5AFAA 2PYED 4NBXB 5I8KL 2ZX9A 1N70A 4ZS7L 5GGTL 4WK2B 4JFXA 1DVXA 3UZEA 3Q5OA 4B5ZA 5I0DA 4F2EA 2BY2A 1HAWA 5CM1A 1TJGL 3NABL 4UQEA 5A6IA 3IXTA 4K9EC 1MQKL 3S35H 5D2LF 4HD5A 1KELH 4MMZB 5KAQF 4J4PA 4MJIB 5DS2A 3ZOAA 1KTDA 1GGIL 1JN6A 3U4BL 1VACB 3F05A 3TCTA 3RUGE 2DMHA 1P4IH 1CU4H 4DWHA 3G6AA 5AQ0A 5E08L 4U0RC 4JRXB 1MIEL 3DV4A 4L18A 5DJDB 4LVHB 4GAJL 4N0UE 4RWYH 2PPDA 5DO2C 5AYUL 1T7XA 2Q7YA 3PHQB 2CRYA 4Z76B 4G3YH 3CHSA 1YPZF 3PWJA 4FKHA 1JXFA 4KNUA 5TE7H 3MXWH 3T0AA 1M6OB 3V4PH 2NLJA 4H4NA 5EU4A 5CHNB 3ZKNC 2UUDK 2EYSB 3FSWA 4XMKH 1SYVB 3Q0HA 1JHKH 2VLLB 2X6MA 5I1EH 3FCBA 4L29A 5AOZA 4DGIH 3V9CA 4LLUB 4TLUA 3L81A 2IAMC 5DLMH 1LPZA 2H4EA 3IRZA 4S1DC 4DPCX 5E1AA 3P3UA 1ZTXL 2Y1AA 4Z3TA 1EMTL 2XPZA 4UTCA 4YSCA 3CENL 1RUAH 4Z7VE 3SPCA 2NYYD 4KU1A 7FABL 1JF1B 1MWAB 3KW7A 1J9SA 3GQFA 3KXFA 2BP0A 3BOVA 5FO9A 3OZ9H 4KJWD 2GFBA 4DEPC 5EIIA 1T5KA 3QUXB 4PB0H 2YD7A 3MV8E 3V5HB 4UV4L 3DHUA 4O2EA 3GXIA 4XN8A 1E8XA 4D0FA 1CDJA 4HPOL 4TNVK 5F0JB 5IB1A 4DFIA 2P8PB 1IOXA 2DYPD 3FMGL 1NFYB 5I8OL 4RX4D 4Y5YC 4B96A 5KSAA 5ALBL 1IBHA 4ELME 4J6RL 1PD1A 4AIOA 5JPNB 2GCYB 1G7IA 4UIMB 3T0EB 4JUSA 5EZLA 3BSGA 2NNRA 4LBEA 4ZMAT 1UYWL 1NLDL 4UTAH 1T04A 4ABQA 5B4MC 1L9OA 1R3KB 1UACH 1AZRA 1IEHA 1OEZW 1R3LB 3TBYA 4RGNE 5H37A 2XN2A 1AHWC 2HMID 1K3ZA 3S37X 2JKJA 2O5YL 1IQDA 3L17A 4M3HA 5B8CB 1DL7H 5KVDL 5T33H 5E4AA 4HH9A 1GTNA 2MKWA 3BLBA 4QAMB 1JIBA 5GRYA 3AMKA 4MB5A 5BRZD 2CKBB 2DLGA 4W9ZA 2AJUH 4ZUUA 4JVPA 3O3UN 4E9LA 2JKLA 4QNPE 2HRHA 1I7RA 3CFEB 1NINA 1J9RA 1MCOH 3CN1A 2AHIA 3N40P 1OW0A 2CM5A 3FUIA 2MFNA 2NZ9C 3N2JA 5D7JB 1TSHA 3ARED 3ETBF 4XN7A 3BP6B 5GZNC 2Q7NA 1R34A 4FNSA 4WFHD 1X5JA 4XWOD 3WKML 5I28A 1FGNH 1KXTB 1P9MC 1YAIA 5EU6B 5TDOA 1NFKA 3SBWC 2J4IB 4ORGA 2FLBL 2H1XA 4X7FC 1LE5B 2WCGA 4CDGC 1K72A 4OLZL 3NCYP 4EDWH 5CBAA 3EF7A 4KV5F 1IO4C 2ZX6A 1KWKA 1NDGB 1JGUL 1AQKL 2FATL 4P5SA 1S9WB 3SQOH 2NTSP 4I4WA 1KFAH 1MHEB 3BO8B 4E68A 5F1IA 5I16B 1AD9B 2BOUA 2DQTH 5DWUL 3C8DA 2CIKA 2VMEA 1FVCA 1W72B 4JANA 1JL9A 4Z0BH 1UM5H 5D9SB 2D31A 5E4IA 3ULUD 5ITFB 1EXGA 4LHUB 3SE4A 4XZUB 3ULUH 2HLAA 1TZIA 1A2YB 5EC2A 5DWPA 5EO9A 5EUOF 3AZUA 4Y2NA 4JGUA 2JCWA 3K6DA 3H0TB 5DRNA 1MREL 1ONQA 2JKSA 1O6SB 3K81A 1R46A 1LMKA 4E36A 2VABB 3QDMB 2APXA 5DRXB 4Y4KC 5TPWH 3UYOD 3LIZH 4G9DB 4NZUL 1XTMA 2DEWX 1BLIA 3MJ9H 4GUCA 4PRIB 1YUHB 5E2TH 1F0LA 1U93A 2WC7A 1O5DT 2ZD0A 1FAKT 1I7UB 3W57A 4LSSH 5ANMB 2ZWLT 5C0JA 4XB7A 5DT1H 4JFOB 1IAIL 4OJYA 2CGRH 4RDBA 4DCQB 3G6JB 2ADYA 4XNXH 4UIKH 5FYKH 5I8EB 2GYSA 5DDHA 4E9QA 4TLSA 1J5OL 5AW1B 4N1EA 3FH8A 2WKGA 2UZYA 2APTA 2WXGA 4HEME 4HA1A 4M4RA 4NUPA 2NZ1A 1DUYB 3GISX 1DQJB 1ZSHA 1TYEB 4OGZA 1JNLH 2FHCA 1EVTC 2VDNL 2P94L 2X4SB 2H3NB 4X50A 3P4NB 1TCMA 2KLRA 2OQJB 1MW1A 3M6DA 1LO3L 4PJEA 4ZUWB 2R69L 5DZLA 1CK0H 4P9HL 4K3EH 4BSWA 3ET9F 1KIQA 5JBCE 3U25A 1PIFA 2DZEA 5DVKA 2WZ0A 1IGXA 2QQNH 1PRHA 4YDLB 4OJAA 3IDGB 3RKDD 4FQPA 4LLDA 4NO5A 4XNYL 1WTLA 4IJ3C 4WO0A 2BSCA 4FQXA 5HGHA 5LN4A 2W60B 4PGCA 4MNHB 4NO0A 1QBML 4OM1L 2C4XA 3H42H 5DQDH 1A6WH 2D7QA 3A24A 2WFTA 2E9JA 6CGTA 1S4IA 3OG4B 2YQ3A 3QG6B 2WVTA 3FRPG 3GBMH 3BXNB 1FFPB 5HHNB 2ZX7A 1RPKA 2E4TA 5T3XE 4YFLI 7CGTA 3GGWA 3QDGB 2Y81B 1NL0H 1QEWA 2VW7A 3L3OC 2NY2C 2KDYA 1I3RB 4NQDA 1JD9A 4LSRL 5CZRA 4X4YA 1Q9KB 5KSVA 1SYSB 1RCYA 4KJYB 3VGFA 3DI3B 3KYNA 4DVRH 4XVSL 3FFDB 5E99H 4DGVH 1BX2A 4E9VA 5EUKA 2X4UA 2ZUUA 3HI5H 1AZCA 3CFTA 3FQRB 4FTVA 4PR5A 4YAQB 1A22B 3FO1A 4U1JA 5EA0L 4HK3N 1UXSB 3QDAA 4OIIL 1SBSH 4ZTEA 3RA7L 4YSRA 3GMLA 2P45B 2FE0A 4NQCE 1XZWA 3ULVE 4NN5B 1ATDA 1FNEB 3QPQD 3GSXA 1HX2A 5L88H 3KYMB 1G1YA 5MERA 4HFUH 3MBEC 4MQSB 3RB7A 1KCUH 5I82A 3VWKA 4WU7A 5B7MA 4KK9C 4OLXH 4IRSA 4GXUM 2Q8BH 4IRJC 1SMAA 1W8BL 1HT8A 3IT8D 3N9GL 1TTBA 4O02A 3ARUA 3H53A 4YHPA 3GK8H 1N3NA 2D7TL 3FHEA 5F3BB 1MAKA 4S1SL 5KVFE 2WY3B 3H2QA 4KVNH 4PHZA 1EDQA 1RULH 4JNXA 4QY8B 5HHOE 4PW9A 3K6IA 1FSBA 1IGFH 5IGXH 3TK6B 4GUQA 4PCYA 3B6SA 4TUUA 4RETB 3DX6B 3SQRA 2LTQC 3DEMA 2UX6A 1TLEA 3VTTA 3MLXH 1CXFA 3W3BA 1ND0B 4RFOL 2WBJA 5IJCC 3V0AC 1KPUB 4Q8BA 1JPTL 4PREB 1ETA1 5CJBA 5C6TL 2UVEA 3G5VA 3D12B 4KUCF 2AQTA 4MNGE 4OUUB 2KHAA 4KKCC 4JFSA 5AOMA 2NX5A 5F9JB 2NYKA 3QA3B 1JVKA 2AJ3B 5D4QA 1QA9B 2R1XA 2A0LD 3VAEA 4HX1B 3GSUA 5F7LB 4JFYA 2XQYG 5IB4B 4OM0L 2CK2A 3HI1B 3TO4A 4HS8L 5AOKA 3UZEC 4P5TD 1OGPA 5AVSB 2RALA 4LGPB 4GO6B 4PU2A 4E9YA 1BIHA 4XVJL 4X6CE 3SYOA 1MCNA 4TS6A 1R19A 3EJSA 5KYWA 4NHCL 1W6LA 4R0LB 1HILA 1OSPL 1VLXA 2CLRA 4J4PC 4UT6A 5F7UA 5CMAA 2CR0A 4M8RA 1EEZA 4EPSA 4FXTA 4RMWA 2B8OT 1I3GH 3RX5A 2G2PA 4NM8H 4JHVA 1KTBA 5JOPD 2H47C 5GGTA 4W9JC 1HNFA 3F7KA 4NQXA 2AK4D 2GJ6B 2IGFL 4LLWB 5KS9E 2EKJA 6PCYA 4TLKA 4C4KT 3TT3L 4KRLB 3RWJB 3D3VD 2YAMA 3M1OA 2PPCA 1SN5A 1UCTA 3ORJA 1A6AB 3BWZA 3V6OA 4IDLA 4IRZA 3NGBB 5BV7H 1BQHG 2DQ6A 2ITFA 3LKRA 4G5ZL 4Y79B 1CDHA 3U4EA 4L1TA 3VW3L 3CU7A 3THMH 2VN3A 3PUUA 4FRWA 4FD0A 2MOVA 1W91A 2A6JA 2APWA 4OLYL 4XWGH 4PRHB 3HPLB 5CBEB 4M5ZH 4WEEA 2HLEB 5TH2B 3ES6A 4OCWH 1BXAA 3EBAA 3P0VH 5D7SL 2V5YA 2HH0H 3QJQB 3C6LD 3NP4A 5JXAH 2YD4A 2A5UA 4I85A 5G5DA 5HYJE 4QRPD 2X28A 4LHJB 3KYAA 2EABA 1JYVA 1KTLA 4WGVB 5B1CA 5DZPA 3O2DH 5CJ8A 3REVB 1AFVL 2OW6A 1A1MB 2AEPL 1G1RA 1AE6L 1JD7A 2QGDA 3L9EA 4RGMC 1ID2A 5AAPA 1F58H 3OZLA 5A2LH 1X4XA 4AGNA 3C8KA 1UQSA 1Y6NR 3HZ3A 3OQRA 4OF5A 2E8YA 2DIBA 1CEJA 5E8DA 1HI6A 4QXUH 1GA2A 1OAYH 4L9DA 4ZODA 5EIVA 3Q8CA 4G82A 1XGQA 2AAVA 3LD8C 2AEQL 2BNUA 4Z7WF 1BQLL 5EOCL 3T1FA 3Q05A 1T4KB 5KSAC 2VRQA 5IROD 3CBRA 1EEUA 1I7ZA 3DRQA 4QAWA 1P5UB 1TNMA 3AABA 4XP9H 1M9SA 2Z91B 4UDTB 4JHWH 5D2LA 4IOFC 1AI1H 3CZGA 3IEAA 3HLAA 4MXWH 4WKZB 1W0VA 1N0XL 2E0PA 5CEZE 1X7QB 1J8HE 1HE8A 2YUVA 3GNML 2FZ3A 5I17A 1A47A 1CFMA 3JWNE 4PJ9A 5K9JH 4QRSB 1LEGB 4P2YA 4Q6YA 5EEWA 3HPTA 1FL3A 3IE9A 2ZCLH 3HR5B 4OGQC 2BH0A 4PM1A 3CHQA 2DQCL 5D96B 1DQTA 3QZWG 5FW8A 2A99A 4O02H 4MA1C 1AD0A 2L7UA 3PWNA 4EVNA 2ZWYA 3SB3A 4XI5D 1HSBB 1NSNL 1YPZA 2F0CA 4WNQB 4NYLA 5FO8B 4HAFA 1JGEB 1AKJA 1JPGA 2VISA 1E3XA 1GHFH 2BVQB 3VFRB 1KIPA 2VR7A 4WEBH 2X1QA 5AVYB 1MCFA 1FNFA 1R4XA 3ABLB 2SEBB 3HB3D 1G43A 2DWTA 4M6NL 4X6DB 3RZWA 3BVDB 4JJ5A 5DD1H 3UBFA 2EIMB 2BSBA 2CBPA 1MLCB 3QIBA 4XBGA 3EFFB 4FE9A 5FHBL 4JE0A 1OW0C 4L3EB 5FO7A 5A2CA 5DHYB 4Q9RH 4X9HA 4JO3H 4IYKA 2YQBA 4P5KB 2JKWA 1QKZH 1HJBC 2D73A 2EEFA 5IEKB 4XRCB 4J3TA 2B14A 5BO0D 1CIDA 2P5EB 1FNGA 3QNZB 2G3XA 2R9HC 3BSHA 1I31A 4PJDB 1YDPA 4GNKB 2X4OA 5IHZB 1MI5E 3Q1EA 4YSEA 4KZDL 3MRJB 4XNDA 1MF2H 1JCKA 4NRYB 4OIBA 1KFGA 2J4WH 4ZH8B 4B50A 2F74A 2ZYRA 4PTUB 4U7KA 4TN9A 1KUMA 1WEJH 3TJPA 3LNEA 5CR8A 4F8LA 2DYSB 4WWNA 3A67L 3CCHB 5F0MB 2R8SL 4ZQTA 2WQWA 3VXRD 3DVGB 1AZBA 1SY6A 2XV3A 4N9OB 2QQLL 2NZIA 5L9DH 1EWHA 5T3XL 4AL8H 1G4MA 1U91A 2N56A 1DANT 2XN9B 2HFGL 1MLBA 4HVBA 3MRBB 5CJXA 2MGPA 3GBNL 3UBXG 1CLYH 1OGAE 3IAPA 4UB0H 1HHHB 1GK5A 4WO4A 4AVHA 3KBFA 4Z3IA 1IQGL 3H7BA 4P57B 3VXPA 5HYSG 2H8PB 2G2RB 2G00L 3FQ1A 4KVPA 3TH2T 4TNGA 1ZTMA 5IBLC 5SWZE 4N6RB 3ZQ9A 5MHSD 4WI6A 3HC3L 2GTQA 2HG0A 4N90E 3EBIA 1GL4B 3S3CB 2DWDB 2YD5A 4ZX6A 1GAFH 4LCWA 5F9WC 4M03A 1EVUA 6PAZA 5J6HA 4JDEA 5B3JE 1CCFA 5DSCB 5LGJB 2C9SA 4LSDA 1S5IH 3WBDA 1XGRA 1UD2A 1IL1A 1CFNB 2J44A 3A3YB 4L8SB 4TQHA 4YDMA 2G4GA 1MSPA 2IBGA 4NB7A 3RUGB 5AUMB 5HXMA 1PSKH 3ZKMC 2K8MA 4JDVB 5E8DH 2QPDB 4LDEB 3RGVA 2YAEA 4FHKA 3ZIYA 2UY6A 5CSZB 3RVXC 3DETD 4Y4FB 4N0UB 2JQAA 3EO0B 1R1CA 2A4CA 5FA4B 1JG9A 4UWQB 3T6ZA 3S88L 1U8KB 3ZDXF 3LNIA 4FQXC 4Y71B 5SX4I 3NAAH 1G9ML 3EH2A 4FFVD 4OFKA 3U7YH 3DIVA 1XF5A 1WAAE 3MNVA 3QEHB 5IMMB 1KWGA 5E0QA 3LB6D 3H9SE 4N28A 4OTXL 1RZ7L 4XNMA 5F7DB 3MRQA 1XF2A 4YL4A 5ENWA 3GO1L 4U1KB 2GKIA 5EUOA 5C08E 3ZHDA 4YE0A 3GTVA 3QZMA 3PXJA 1D5BB 3UO8B 1YN7A 1E4JA 3S36X 5ID0B 1F6LL 2LU5A 3ARVA 1RXLA 3C5JA 4GU3A 4UT9A 4XMTA 3EZ8A 1JHTA 4EI5D 2LV4A 3P11H 4UCFA 5HYFA 4YHNB 4Z7VB 5IMLB 4JO4H 3IPBA 2Z93A 2J6WA 1CD1A 2NY3D 5FDYA 4IGBA 4OT1L 1DZBA 3O0RH 4C16A 1IU1A 3O9WA 3MV8B 2F19H 2HKAA 3MC0A 3S7GA 4FLSA 4PB9H 4JM2B 5GGQH 4AQ1A 3MRIA 3GDCA 4YHOH 2Y7QB 4TRPH 3SPHA 5DFAA 2WXHA 3M45A 1CWVA 5FYLE 1QUPA 2ADIA 5FK9B 1B0GA 5TQ2H 1D5RA 3H8NA 3UAEA 3VWKC 4E1GA 4IRSC 2OMTB 3VD5A 4KTDH 1G6RA 3LXAA 4LQFL 3G5YB 2BHYA 1GZPA 3HG1A 1S7VA 3NTBA 1WFJA 3RZCB 4OZFB 3BGAA 1UGKA 3PY9A 4PAZA 1N2RA 4JO8A 1JBJA 3AY2A 3SPGA 4RGNB 3HC0A 3UJJH 3SKNA 5HVWA 4HULB 2CGYA 3OD3A 5DMGC 1CT8A 3UYPA 4WFGE 4PV9A 4CU8A 3UTQA 3O45B 3N06B 4WI4A 4Z77B 4QI3A 5C71A 1HQRB 3L8QA 4M62H 4ZXYL 3G3LA 4PV1C 2CHXA 2CUAA 4AIZB 43CAB 4A2LA 4N0CC 1DEEA 3EYSH 1Z7JA 4S1QH 5BW7A 1XR8A 4Z78B 1Q0XH 5KVMC 3RWFB 1P4IL 2IVFC 3D6GA 5KYXB 1CU4L 4KK5D 1F4WL 3GRBA 5C07E 1W0YT 4YDKH 3ZYOA 4GU4A 1PBYA 1XF1A 3DHJA 4Y1AA 3D09A 5DJZB 4JO2L 1TJMA 2GTZB 2W0KA 2WWKO 5JDSB 4F7TA 3TO4C 4B3EA 3VI4F 3DX3A 1QYGL 4LE8A 4YWGL 1CDGA 1OAZH 3KPQB 1BVNT 2NNCA 4AZ8B 5D7HA 1CF8L 2I25N 2XBXL 3RFRA 2A6KB 3KRKA 5B39G 3STZA 3D06A 1NBYB 3EYVB 3VFUB 4JLRB 5JIDA 1C5DB 4XMKL 1RZKL 3PP4L 2EXWD 3DTUB 1SOSA 1DJZA 1JHKL 2R4RL 4YXKL 4ZD3L 2WIIA 1W7XL 4CDHA 1AGCB 1BM3H 1QPXA 3AQXA 3DSNB 4N68A 4KQ0A 3AUWB 1V1HA 1XIWA 4G6MH 3SOTA 4I3RH 3BT1A 1XXDC 3QMOA 4BXWA 4W9EC 3GI9H 1PL3A 4JFDA 1MVFA 1SOXA 3AJ7A 3CSBA 2F53D 3I9AA 4BK8A 1RUAL 3ZYJA 2NUPB 1JUFA 1ZWIA 2J38B 3LV3A 3V6OC 3A5VA 4K8RC 3ZX1A 2EXSA 2IPKA 1WBYB 4PJFB 5EN2B 3CGTA 4JB9H 1X7TA 5C0AE 3BDYL 4QHNB 4HPYL 2EDNA 2GJRA 2JV6A 4S2SA 2GG1A 4GW5B 5GGSA 5TE6L 2BOHA 2B0SL 2Z7WA 4B9CA 5F1AA 5J13C 1XCQB 2W0LA 3MLYH 2NXYB 3MJ8B 5EU7C 4Z7NF 3KPLA 2JTYA 4J2QA 1RIHH 1CR9H 1J0HA 2V2TA 3PDOB 4NGHH 3AITA 3U79A 3WIIH 1G7LB 3KLAB 2W07B 4GI9A 2DWSA 2DICA 2YA1A 3MQEA 1CDIA 4UTAL 1RK1B 2J1ZA 1A0QL 3GDBA 4F91B 4GKOA 4JZJB 3AW5A 5FV2A 3V0DA 2WO4A 4D0CA 1OE3A 3EAKA 4IHOA 4EDXB 2F2HA 1BJ1H 1VPOL 1DVFA 2NY6B 3B5GA 5KVGL 3BAKA 1A8JH 4GKSB 4Y7AB 2IBZX 3KYKL 2XTJD 3QI9A 3WFZA 1F8TH 3D33A 4AQOA 3D69B 1A14L 4KQ3L 4LOFA 2KZWA 3TNNB 4PGDB 1OE1A 3V4VA 1UKSA 5K1VA 2YAHA 3TBVA 5BUPA 4L9LB 2FL5A 3G5XB 2K2TA 3U9PH 3B9KA 4RCAA 2D3VA 3BPOB 1E27B 4ZO6A 1P4BL 3MO1B 4AT6A 4BD4A 4XBPB 1U2CA 3OWRA 1TETL 3DK2A 4PJ9C 4AJ0A 2IC2A 1L0XA 1U3ZA 5ICXB 4KMTL 4HJGA 3WHXA 1T7WA 1G6RH 1I8AA 3EFOA 3BHBB 4B3VA 1KGWA 4AQEA 3LEXB 4OZGB 3VSUA 5CILL 2JKHL 4G43B 1TQBC 4F58H 1NCDL 1MUJA 4QRRD 4EDWL 2MNWA 2F6AA 1IQIL 3PAVA 5LGHH 4ZFOL 1UZGA 3DRTB 5DURD 1JWUB 2YEZB 4EO5A 2P48B 4CJ1A 2Y6SC 3MLUH 2VO5A 1RMFH 3AS3A 3QFGA 3WFDH 4EAEA 1V3LA 2LFGA 3HG2A 4JX0A 1M3JA 5ISZA 1VEOA 2DQTL 1CI3M 1DJIA 4U4IA 3QIBC 1JWMA 2W2PE 1VSCA 4KXZH 4Q2ZA 3QEQE 2LU3A 4RAUA 4Y2OB 5LCVH 1K8DB 4Z0BL 1UM5L 1JGDB 1KGCD 5CGTA 3UGUA 3QP3A 3ULUL 4EIBA 2ALAA 3FRUA 1EPJA 1FI8C 2HJLA 2VUYA 4Y89A 4TKWA 5I1HH 1KCWA 3HI6L 4FL4C 5KG9A 5ICYA 5E8OA 3OL2A 1HWWA 4NQCB 1NIEA 2EYRA 3ILDA 3GCWE 1WT5A 1K85A 2N7BA 3Q2CA 1K37A 2AXGB 1GC1H 2EE9A 5GSVA 3PIQA 3RR3A 2R27A 3M37L 2XC8A 4JO5A 3V5DB 5C8JB 2XWXA 4MD0A 1GGTA 4QR7A 3P40A 3M1BA 1WWBX 1IKFL 1XH2A 4R5TA 3MJ9L 4FG0A 1RHHB 2BW5A 4AQZA 2DBJA 5FPIA 3CVBA 1A1NA 1NBQA 1ORSA 1OF2A 3L5WB 4I5BB 4NI3A 4XNUH 4Z7WA 4LSSL 5CLXA 4U1GC 1P84K 3TBBA 3U6RB 5FKPA 3ECBB 4XNXL 5F70A 5IVXF 2QQKL 3UX9B 2K9FB 3VFOA 3HC4H 2X1OA 4MA8H 5F8QC 2HFTA 1P0SL 4IOSD 1WG3A 3KLSA 2KZBA 1T03H 4APXB 1TJHH 3I6KA 1QVOA 1MCHA 3UIYA 1JNLL 4FADA 2A1WL 2J55A 2EEBA 3CDCA 3SDXE 1ZVHA 2ERJC 1CFTA 1XBDA 3O3EA 4X4XB 5CJXC 3TZVD 4HUNB 5H94B 2BXZA 2ALWA 1LPGA 3KPSE 5IKCB 1EQWA 2TSBA 5TDPA 4WO4C 5HVHC 4MNGB 1C08A 3U0PA 2M8XA 4HIHA 4YFLF 1X5HA 4GSXA 3SDDA 3WKPA 1E2WA 3H9YA 3EGFA 3TO2B 3PL6B 3MYZA 2QDVA 4NPYA 1CICA 2QQNL 4PGJA 4Y2DA 4YO0A 1ZHBB 4AZUA 1MCPH 1UM6H 2X4TA 3OJVC 5K39A 1NKGA 2NXZB 1T2QL 4E41D 4DN4H 1QFUH 1BJ8A 2V5TA 1IOEL 3E80A 3FULA 3TASA 3TEWA 4X6CB 4H26A 1UGNA 4AV5A 4XPHH 2VNCA 4PBDA 5AKTA 1U21A 3FL7A 4ZS6C 3GBML 4XMPH 5CP7A 2RHEA 4JRYA 3FCSA 4LCIL 3RDTD 4AMXA 1SJXA 3FQTB 4PJ7F 2X2UA 1YA5A 3CN2A 4U3XA 1LNUB 4EZJA 4NWTH 3RGVC 1WP6A 3Q6FB 4QRUB 4ODBD 3ZTJG 3HO4A 1B9KA 2PUQL 1COUA 2VAJA 1ZE3H 5KS9B 1QATA 5DHEA 1OCOB 5D6CA 4CRPA 1N10A 3V4VH 2FEDC 1Z9OA 3HW7A 4JFQB 4XCEB 4V11A 3IB4A 4G8GE 3AFLA 1BOGA 1BGXH 1E9QB 4TOYL 2LW3A 1E4XI 3S96A 3GF8A 4FQHB 3NFPA 2FT7A 1OWWA 4N22A 3WFHA 2EZ0D 3VFVA 4QXVA 4P9HC 4PY8J 1RZGA 3TH4T 1BFSA 3PDGA 1UD6A 1ZV2A 1SBSL 4B9IA 1E4KA 2Q2LA 4Z23A 5JHMA 1MCKA 4JPSA 3U46B 1UWEH 1TQCB 1CGSH 2XBDA 1M2VB 3LKPA 5L2KD 4IS6B 4YDVA 5GQBA 4WFED 2CM6A 5J4MA 4HT1H 4MS8C 3MUZ1 1KLJL 5COXA 1XKBA 2AXWA 1MVUA 3LKNA 2DW5A 3O6FD 4F7PA 5HYJB 5DI8B 3B2DC 4N6QA 3BWUC 5DVNA 3ZE0F 2OSLB 2RFXA 1MCCA 5FHAL 3MREB 1RERA 3E6FA 4TYUA 3P4OB 1VFAA 3H4HA 2Y5FL 2RHPA 1SJHA 3KAAA 4QXGL 2J72A 4IGBC 4YZFF 3O9WC 1RULL 5EOTB 3WFEH 4AQ1C 1AZNA 1AR1B 1J9CL 2AERT 3I75A 4KXDA 5IGXL 1IGFL 3O41B 4BDWA 4ZSOE 2JB5H 2Q1EA 4HU2A 5BS0D 1AQ8A 3QO1B 1M05A 4KDVA 1GIGL 1NCGA 4HZLB 4LL4A 5E1QA 1TFPA 3B5HA 1H0DA 2JH2A 3O4LA 3HO3A 1HHGB 2OMWB 5FOBB 2HT4D 3MRRB 1DDXA 3VXMA 5SWQB 3IGKA 4XNQA 4FNLH 4Z3GA 2VXSL 1EEQA 1J8HB 4N2DA 4YGVB 4D9RD 1FORH 3D5OF 2Y38A 3QEUA 4LLVA 3BH8A 4XMWA 1GTFA 1YAZA 4MDIA 3B2VH 3FF8A 4FFWC 3SGJA 3RFZC 4LHQB 3RTQB 3QQ4B 5F1SA 2HX9A 2VLRE 3F00A 2R0WL 5BUAA 3Q44A 1DDHA 1AP2B 2R23B 1UC6A 5TGBB 4MAZA 3RIFF 4M7JH 2UYLA 4P4KD 4M6MH 1CQYA 3PP3K 5E6ID 5F1KC 4WRLA 2BZDA 4Z7UF 1QNZL 2XT1B 4IU3B 1V7NH 3EGDA 1NBCA 5BW7C 3Q9PA 3OXSA 3IF1A 1V55B 5JVZA 2J8OA 3AADB 4Y16A 5MP6H 3KYOB 4X7EC 5HJGA 1Q72H 2IGTA 3VRLF 4ZAKD 2KPWA 1U8MB 4KOBA 2D3NA 1ZLVK 3EDFA 2BS71 4QKTA 1HEZB 3BGFB 4HJJH 35C8H 4F93B 1YSOA 4ZO9A 4Q6IA 1W15A 1LP9E 4FNQA 3I2CH 5LB1A 1IE5A 2GJJA 2YD6A 3ZKQD 2Z92B 3IAGC 2FLGA 1AO7D 3UBXI 2DQUH 4IHBA 4A6YL 5HI3D 5DS1A 4F3FB 2P3UA 3K71B 5BV7L 3FYIB 2F8VA 1SDAB 2BVYA 4NN6C 1XF4B 3ECWA 5CINL 5C0FA 5E6RB 5K1JA 1XWVA 1A02N 1MI5B 1O9WA 3GWJA 4A2GA 1E42A 3IKCA 3Q2WA 1KBKA 3SJVB 2CUHA 1PKQA 3ZE2E 2FX9L 4X8XA 4I1PA 3SPVA 4APQD 3C9NB 4A7VA 2OL3A 1VFMA 2HH0L 4ONFH 2FIRT 4YPGB 3H7LA 5JXAL 1XIWC 2GEEA 4KKLC 2R7EA 2X05A 4MMXB 1A4JB 4GIOA 1QPKA 4QRQA 4EUPB 4LEOB 4GUOA 2YSSB 3B7SA 2J88H 4JFHE 4AYID 4RVBA 4W6WB 5DD5H 1UWYA 3OKEA 2NNXA 1T6BX 4HJEA 1G94A 2MEJB 2QADD 3CLEH 2E76C 4YHIB 1MELA 5EEVA 5ADOL 3MA9H 4QTIH 4JGNA 4ZAEB 1OAYL 3B8YA 4NA9L 2A6DB 3OPUA 3WJLA 1R5IB 4GY4A 3ISRA 1VEMA 1N68A 1OGAB 4HLZH 1SUHA 1KCSH 4I89A 3ROOB 2I26N 4JCMA 1SVZA 3GJFK 4XPTL 3L4VA 3CMOH 4LAQL 1H15B 3C87A 4W9DC 4GQZA 5SWZB 1FG2A 1ZLDA 4JKKA 3DOSA 4XP9L 3MCG1 4JHWL 3T4YB 4EF3A 2BHZA 4ODTH 4NZRH 3NH7H 1JZJA 2C9UA 3QWRD 1OPOA 2WXKA 4NDMB 4V1DE 3X13B 1YYMH 4AM0Q 3AS0A 3WLWD 1KB3A 1A9BB 2ZCLL 1NCNA 1JMXA 2W9LA 1YEJH 5C7XH 3PFQA 4FDWA 4X8VL 3TGFA 3QJUB 1DVFC 2P80D 2OJEA 4RX4A 3RIFK 1IT9H 3RVTD 1KGYE 3QI9C 4FNUA 4LHUG 5HHPA 2DQHH 4R3SB 3QUMH 1GHFL 1U6AH 1R5VA 2MOQA 4M1GL 4WEBL 2Y5TB 4KTGA 3QC6X 4OSUL 4LU5H 3B9KC 2IXQA 1LMJA 1IUZA 3ETTA 5IKVA 3NTCL 4GMSH 3V6FB 1PTZA 3FF7A 1J1XH 1IB5A 3CN3A 3TJEL 4BXVA 4OLEA 2F54A 2YAPA 3IAQA 4Q9RL 4JO3L 4QO1A 2GHZA 5JW4Q 3H9SB 1QKZL 4ZFZA 4FQLL 3KGRA 3QBTB 2WAHA 4I0PA 5D8JH 2VDRL 2Y69B 3U0TB 4JFED 2NSMA 4HF5H 3I74A 5C08B 4BE6A 4BKSC 4JN2A 4LQ1A 1AJ7L 2R83A 4TUOB 4XP1L 3TIEB 1LYQA 2WLKA 2JIXA 1YC7A 1HXYB 3BEVB 3FSVA 1F4YH 1MJJA 1IM3B 4BZ2A 2NT1A 5AG9A 2VSMB 4JKWA 4LDCA 4MXVE 2C3GA 3CFBB 1RZQA 5HDLA 4CNIB 1PMYA 2J4WL 4NQSB 2EIJB 4N2GA 4PVNA 1MJ8H 1MN4A 43C9B 3VFTA 4R7DB 4NQVA 2GI0A 4J3UA 2CR6A 3HE6B 4YHZH 2LE9A 3HOGA 2DQGH 3VDCA 4ZFOA 5I5RA 3FQ4A 4PWIA 5FCSH 3GSWB 3KXFE 5JORA 3NA4A 1YJDH 5DJ2B 1WT5C 3BW9A 1NDMB 3GSOA 3B37A 2F9BT 5B1JA 2KL7A 4Y4HD 4AMWA 2HFEA 2VQ1A 4BRVA 3CFJA 1JZ7A 4RMQA 3FFOA 4NM4H 1AYRA 2NPLX 4AL8L 1MY7A 1SF3A 5JDJA 3QCUL 4J39A 2CO6B 2Y06H 1DUZA 1SN2A 3CVDA 3QO0A 1CLYL 3DWTA 4B9JA 1MFVA 4K4KA 4CVZA 4EN3D 1NANI 3BGMB 5D7EA 2UZIL 3UTTD 2XC5L 1UXWA 5DK2A 4XCCH 3QIWA 3NMEA 5DRZA 1ES0B 3ASIA 3L3DB 3TA3B 3T0VA 1TT6A 4G1EA 3VQMA 4RRPM 4F15C 1ZK9A 3BWSA 1S5IL 4HXAH 2KI6A 3MLZL 2PWEA 4JHBA 3ZJAA 1MFBL 3D39A 3QNYB 4LORA 2FQGA 4FMFA 2VCOA 2MTAA 4QRAA 4R4BB 5ESQA 2YPVL 2DM2A 5HGDB 4XCFH 3ZZ1A 1JZ3A 4YVNA 5EEUA 1BQRA 2YD2A 3GMRA 4JZNA 1FZJA 1F7MA 3E8UL 5T3ZE 4HKBA 1NANH 3SDDC 3KVQA 3EOAB 4KI5D 4WW1A 4FQCH 1HINL 1D2OA 5C07B 1USZA 2MCG1 1RQ5A 4ELMB 1CICC 1UOWA 1DQDH 1MJ7H 1UH3A 3D4CA 4Y2DC 2R4SL 2WANA 5DUPH 3WE6B 4EZMA 1BPLB 3TEYA 2ENJA 2ATKB 2A9MH 1O5PA 2Y07L 3I9GH 3O6KH 3K4AA 2O5ZL 1T20B 5AL0A 5C3TA 3V10A 1A6ZA 2H6UA 3U7YL 5C09D 2BO2A 4P3CL 4WV1A 1YYLH 4LEEA 3WKQA 2OMXA 3BD4A 2ARJA 4GW1B 4YR6B 2CK0L 2XXMB 4N9GA 2OMUB 1TR7A 1IM9B 3FKUS 2R1WB 5AWNH 2DL2A 5B38B 3D85A 4G8AC 1MHCB 1HL4A 2FIKB 2CD0A 3QJFB 1MVYA 1P7KB 2HJFB 4EQ3A 4DERA 4LSPL 2ZAIA 3MLWL 3TIDB 1OB0A 2YFOA 2FYYA 4RAVA 2BIPA 3BZFB 3VXOB 1CIUA 3CZUB 2PO6B 4AH2B 3BMVA 1SUJA 2HT3D 1KV7A 1QRND 1KNOA 5C0AB 3QCWA 4OAWA 3O0RL 4ADGA 4NUQA 3AXLB 4OD2A 2AV1B 4PB9L 2XNAA