2YGPA

Wif domain-egf-like domain 1 met77trp of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
174
Chain Sequence
TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRWPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WNT INHIBITORY FACTOR 1
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 30
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygpA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygpA01
2I9BA 4YZUB 1NT0A 3SOVA 4FM5A 1K37A 2FLBL 5CKNA 3RR3A 1EAIC 2ADXA 2P94L 4RS0A 3SOQA 2VWOL 2WG4B 4M10A 5CKQA 4Y7BB 3TZIA 3QH0A 2Y7XB 3HS7A 3HS6A 1MQ6L 2KB9A 1HCGB 1ADXA 4X8SL 1AUTL 3LIWB 1M1XB 5EGMB 4ZHAB 3FCSB 3GCXE 2Y82B 1FJSL 3N8WA 1HZ8A 2BOUA 1Z6EL 2Y5HL 3TK6B 4BDXA 2P93L 3ASIA 3ENSA 3H5CB 1P0SL 3BT2A 4Z6AL 1F7EA 2K2SB 1CEJA 2Y5GL 1OB1C 1QFKL 3KQDL 2WYGB 2P3FL 2J38B 1DIYA 2W2QE 1EPHA 3NT1A 3GISX 1PGEA 1LPZA 3SW2A 4O02B 2P28B 4Z0LA 5K0HB 1LQDA 3BT1A 3HS5A 2W3KB 2XBXL 1JL9A 2FLRL 2P3TA 3N8XA 2WPJE 4AQTA 1KLOA 3QMOA 5IKQA 1EPGA 3LN1A 2GD4A 1HAFA 2YGQA 2BQ7A 3FFGL 1ATEA 3CFWA 2FLGA 3TGFA 3U7UG 1IGXA 1UZPA 4NA9L 2BZ6L 2B7DL 1KLJL 1G1SA 2XBWL 1P9JA 1C5MF 2P16L 2BMGA 1IOXA 2J4IB 1LPGA 2WPLE 4MMYB 1HJ7A 1XDTR 2Q1JB 1HX2A 2KL7A 1XKBA 2PHBB 4CUDA 2EI8B 1LMJA 1RFNB 2EI6B 3LC3B 2UWPB 4TGFA 2VVUL 1FSBA 3CENL 2G00L 5IKTA 1YO8A 2W2OE 3LC5B 4JZFL 2VVVL 3N8WB 3LN0A 4RRXA 3LAQA 2OYEP 2J34B 4OTJA 2XC5L 1FE2A 3M37L 4CUFA 3HPTA 2BQWA 5L2YL 1LPKA 1IP0A 4M11A 2BOKL 1NFXB 1HT8A 1L5GB 2D3JA 2DDUA 3Q3KB 1UZQA 4LORA 6COXA 2VJ3A 1TOZA 4O1ZA 4ZAEB 3M36L 5JB8E 2P3FN 3ZYIB 4D0EA 2FD6A 3QCWA 4JYUL 2WFXB 1TPGA 3IITB 1FFMA 2EI7B 2Y80B 1JBUL 1U8CB 1DQBA 3HO5A 3FBYA 4X8UL 2VWNL 3KL6B 1Z6CA 1Q4GA 5COXA 5I46L 2RA0L 3KCGL 2P3UA 3BPSE 1WU1B 4BTIA 1PFXL 5KN5C 2PUQL 1IQHL 4G1MB 3KQEL 4BDWA 1EPIA 1NFYB 4Y6DB 2XBYL 3ZYGA 3N8YB 1PTHA 1F0RB 1JV2B 2TGFA 1GK5A 2BO2A 1KSNB 2FZZL 1YUKB 1YUGA 3ZYJB 1HRFA 4XLWA 2OYUP 4ISHL 3K9XA 1IOEL 2D1JB 2YGOA 2WYJB 1XFEA 4E1GA 2BOHA 5JVYA 5CISA 1DDXA 1L3YA 2WFTA 4YT6L 5JVZA 4BXWA 1NZIA 5IKVA 1N1IA 2I9AA 2M74A 2VVCK 2J95B 2VH0B 2Y7ZB 4A7IA 2W2PE 1G2LB 4X8VL 1G1TA 4MMZB 3V64C 2H9EL 5F19A 1G1RA 4D0FA 1ATAA 2MHPA 4C16A 2JKHL 1IQNL 2W2ME 1WHEA 1K36A 1XKAL 3R05A 2RNLA 2RHPA 4X8TL 2P26A 2XC0L 1V3XB 1APOA 3KRKA 5L30L 2UWLB 1IQJL 5JB9E 3SOBB 5JBBE 1YUFA 1TLEA 2YGPA 1F0SB 3POYA 3LTGD 1IQML 1ZAQA 4RRYA 5JW1A 2BOXA 3OLUA 4BXSA 4CSYA 1PRHA 2UWOB 3N8ZA 2Y38A 1MQ5L 4Y71B 4Y79B 4OTYA 1CVUA 3HO3A 4BTUA 3LTFB 5KIRA 2PR3B 4COXA 1N7DA 3F1SB 1PXXA 4RUTA 3NTBA 1IJQA 1W7XL 2XBVL 1DVAL 2MGPA 2W26B 1O5DL 1NFWB 2Y5FL 3Q7DA 3MQEA 1X7AL 2MGRA 3MDLA 1G2MB 5IKRA 1IQIL 1CCFA 1A3PA 2VWLL 1APQA 1ATDA 1FAKL 2WPME 1EGFA 4ZXXL 2AYLA 4RRZA 1IVOC 1DX5I 1WHFA 4Z0KB 1HAEA 1HREA 1U67A 1IQLL 2J94B 1KLIL 2K2TA 1MOXC 4MMXB 1J9CL 1IQKL 2KV4A 1NFUB 2W3IB 1BF9A 2CJIB 1SZBA 4LMFA 3P5BL 1EMNA 4YT7L 1NQLB 1CVWL 2YGNA 1F7MA 4XBMA 3U73A 3IJEB 5CKMA 1URKA 1CQEA 4D90A 1YGCL 2WPKE 2F9BL 4CUEA 4NGAL 2NPRA 2WPHE 2Y81B 2WG3C 3ELAL 3TH3L 1ATBA 2VH6B 2WPIE 1FAXL 2BQ6A 1EPJA 1IGZA 4NG9L 1EMOA 1CCVA 3GCWE 3F6UL 1B9WA 3DEMA 3KQCL 1G1QA 2J2UB 1I0UA 2XC4L 3KK6A 3NJPC 1EZQB 1W8BL 1KIGL 1IQFL 3C9AC 4JYVL 4JZEL 4PH9A 1UZKA 1COUA 3N8YA 5E8DA 4Y76B 2W86A 3CA7A 1IQGL 2VWMK 4ZXYL 1CX2A 1FF7A 1NPEB 5L2ZL 1UZJA 4XL1A 5F1AA 4BTTA 3CS7L 3HO4A 4ISIL 1EQHA 4ZH8B 4JZDL 4RRWA 1EBVA 3NTGA 3PGHA 2P95L 3TBDA 3TK5B 5JBAE 5JBCE 3KQBL 5FDQA 3OLTA 4Y7AB 3V65B 1HT5A 1IQEL 1EQGA 2W2NE 3N8VA 3EGFA
chains in the Genus database with same CATH superfamily
1MFMA 4EZMA 2FJFB 2GC4C 4OGYH 3SPCA 2ICCA 2OMWB 4JKNA 1RULH 1D5BA 3EFDL 3CFCH 3QO0B 5D1XA 1CT8A 4QRTB 3QZNA 2NNXA 4XAWH 1WBZB 2J12B 3NRFA 3NJNA 2ZXGA 4MQ7B 3PWPA 1A6WL 1O6VA 4ADIA 3QUMH 5KSUA 4LSSL 2WLIA 5DHVB 3IJ9A 1FNHA 2VZOA 5HHOB 2Z8VC 3M88A 1HHGA 1ZHNB 5ICXB 5GGQH 1RP8A 1PX3A 1EJ8A 3INOA 2JH2A 5JIDA 3SE8H 2O4EA 3HVNA 4UIKL 3O4LA 3M17B 1RL1A 1FL6A 1W72B 4J3TA 2P5EE 1M1XB 3FB6A 4QYOA 5AZ2L 3KLLA 4BSVA 2G2RA 3LV3A 1AC0A 4TLUA 1BZ8A 3B9KB 5KUMA 1B2WL 2E7MA 4RX4A 3U4BH 1MKFA 3EG9A 3RUGA 4NO0B 3TK6B 1JXKA 1NJ9A 2A9DA 4NO3B 1ID5I 1N7MH 3L3IA 3BT2A 4A37A 2G60H 3H85A 3GC3A 5CILL 1X7TA 2V2TA 5HI4D 2IPUK 1CXKA 4BK8A 5HHNA 1RERA 2H26B 4WUKH 5TDNA 1KC5H 1AXTH 4DTGL 4YZFE 3ML8A 4LGPB 3KM1A 2IGTA 4P23D 3IMSA 1UCTA 3TPKA 4AJ0A 5GSVA 3FCTA 2ENYA 2VAAB 1W8OA 5EB9A 1XGZA 5KVFE 3GSNA 1I85A 3TBSA 3OQRA 4JFPB 4YZWA 2WINB 2I24N 5C0AE 4CN1A 5FCUL 2P24B 3RILA 2BT8A 1SN2A 4DP0X 3WO3B 1UZGA 3I2CL 4MA7L 5E8EA 3UTZB 3L9EA 2EH7L 1IC1A 3GK8L 4DP9X 3HUJF 2RIKA 2DQCH 2JE8A 2CCVA 3ABGA 2BSSB 5ISZB 3CHPA 4GKZB 1KULA 2MCG1 4IK7A 5HHMB 5BVPL 2YGQA 4S2SA 4PBDA 1P7KB 1VFBB 4P5TD 3PNRB 4A04A 2P8MA 5KJ4A 1DN0A 2DQHH 5AVXB 2KS0A 2F7OA 4X4YB 4OF5A 2B7DL 3L3JB 4NM4L 2IJ0C 3LRMA 1T2QH 2QSQA 3M46A 3Q6FB 3RL1A 4AXWB 1OCRB 1RZJL 4IMLB 3WFHB 1DEEA 4UTBL 4CKVX 4P3DB 4ZUWA 1T7WA 1UFGA 2J4IB 1BQHA 2VISA 1T21A 2ZSWB 4N25A 5EU4A 4AH2B 1XB3A 4DVRH 4ZUUB 4D9QD 2QHRL 4DP6X 4Y4HB 4GQPH 3UYRL 1FRGH 3ULVH 3MUGB 4XOEA 1IKFH 4GT7A 3LKQB 2OMXB 3QZBA 5IEKB 1RJZA 3IJ8A 1IGFL 3QORA 5LNEA 1OARL 3MRPB 4GI9A 5HI5C 2Q5BA 1XF3B 2B9AA 3NRQA 3KYMB 4ODHL 3MLVH 2Z7YA 5CN3A 2VW7A 5D2LE 5IROA 1L9RA 1D5MA 2YOAA 3DOSA 4K5LA 3LN0A 1TCMA 2CO7A 1MWOA 2WZPP 3DWTA 5FM8A 4NC1E 2Y1ZA 3HMWH 5JW4R 5LN8A 4CVZB 5BUGA 2J4WH 3FQXB 2ORBL 3NIDB 2CKBL 1FE2A 1R5WA 1JZHA 1WLHA 3QHZL 1PLBA 2G3XA 3QJQB 2XX0A 5E23A 1U8KB 5L2KA 3BLPX 3KH4A 2XU9A 3L9YA 3D25B 3MYJB 3KBFA 4MXQC 4TUKH 3RDJA 3VGAC 4DCQA 2P80A 3ZHKA 5LNGA 1K3ZA 3OQ3B 4XMPL 5K9QI 3H7BB 2BHFA 3NJMA 5IWLC 4EDWH 1PNDA 1NLBL 1ETZB 1NGYB 3QEQA 4GW4A 3MLRH 4YHKH 1GRWA 4D0EA 2HKHH 3BZDA 4HJGA 1TZAA 3BPNB 1YY8B 1DJYA 1YVLA 2AJZB 4FYTA 2NX5D 4KK8C 5K59F 4FQLH 4X7CC 4Y4FD 2YRBA 4JKPL 4XC1L 4XZ4A 1AAJA 3DARA 4U7KA 1UQSB 4WEBH 4PR5B 1XGRA 2R1XA 3CZFB 4JPWH 5ILTL 3KL6B 1OHQA 2BVOB 4ZS6D 2N1TE 2XNAB 3GXFA 4FLOA 4L4VD 3NEEA 2QEJA 2YD3A 3H4HA 4XXCC 1ZXQA 4Z0XB 2LVCA 1PY0A 1S7QB 2WMPA 3ARRA 4HUNB 5C09D 3BPLC 1A65A 5IHUL 4UQCA 5F21B 2DIAA 2IF7A 4YJZL 3AU0A 4PJBB 1CDCA 4DAGL 4XODA 3GYRA 2BP5M 1DUZB 1CLZH 2OULB 3IDYC 3FB5A 2ED7A 3DIFA 1BCIA 1BVLA 4JCLA 4JK0D 1PTHA 2YQ2A 4X9FA 4BEIA 2DRUA 4XPAH 3FPYA 3WNPA 1EANA 2BO2A 3Q2LA 4RISH 3UIYA 1E6OH 2OXGA 3MOBL 4LL1A 1NOAA 1OPGL 1A4KB 3T5WA 4NQDD 2A9NL 2IPKB 4CVXA 1UASA 1I7ZA 1CK0H 2KLRA 2WXKA 2BP0A 4NKDB 3VRIB 6PCYA 3K74B 1D9KD 2W0FA 5DT1H 2FR4B 2BXZA 1KTRL 2J5LB 4P46A 5E2WH 3NCWA 4HZAA 2I69A 1WBXB 2AXWA 3T2PA 3NCCB 4Y5VA 1OLZA 1LP9B 3BP4B 1K2DA 3PGFL 1QTYT 4ODUA 1OANA 5B38G 5FYKE 1X7QB 3HC2A 2YQBA 5TTRA 1CFVH 5ESVB 5C7XH 1IC4L 5KVFH 2JNZA 3K8KA 3PP4H 4LBEA 3RVTC 5DCCA 4Q2ZB 3WE6A 4GP8B 4C83A 1CG9A 2KKQA 3CHRA 2ATPA 3WOVA 2KZWA 4FZ8H 4DZBA 1TTAA 5BQ7B 1L3NA 5I1AA 5K1NA 2A0LD 3EO1A 2NY2D 3MMEB 43C9B 2ZJSL 3QDJA 1OCWH 4LBAA 4N20A 5IVZA 4PG9A 4AQ8C 3ZDZF 4Y5XB 5IBLC 3MQIA 1NDGA 3D3VD 5BVJB 3DLQR 3TYGL 2C26A 4FCAA 4PTUB 1TQTA 3NFNB 4MMXA 4ANXA 1PZ5A 1AI1L 3AW5A 2LQRA 3QEUB 4HX1A 3LDBC 3MJ6A 1V3XB 1OE3A 2UWLB 1N5YH 1JK9A 1BGXL 4WVRA 5D7KD 3T0EE 2V5RA 2VC2B 1WV7T 2QSTA 2A6DB 5CZKA 5E1QA 2MKLC 4KC3B 2WBKA 4U2YA 2VDQB 1TLEA 2XV3A 3JUYA 1ZPLA 1X4XA 4MZ2A 3NEXA 5DWPA 1WCBB 2C5DC 5LGHH 4TSAL 2F8OA 3OKKA 3MV7A 3P77A 3BSGA 4I9WD 4WO4A 4KK5D 3CNKA 5B7FA 1P7QD 2W59A 1ADWA 3FMGL 2EE2A 3MRJB 4FNPA 4PJ7A 3OF6A 3WEMA 4G8EA 4ZRGA 1I4FB 4UDTA 3MAWA 4FQJH 5ADOL 3JWDL 3MOAH 5DJYB 3C5ZD 2CKNA 5F1OB 4IBLT 4E41A 2JB6B 4I3RL 4S10A 3IDJA 5B7EA 2G9HA 1H3WM 3BRDA 3TCXA 4ZXBB 2RBLA 2YAQA 4H20L 1W72L 5FECB 4KX7A 2KQNA 5HYFA 2WCPA 4AT6A 4A7TA 4LKXB 3WEBA 1UKSA 1PKQA 3RTQC 4V1DB 3RY4A 4IMKC 4XNQA 4YHML 3OHXA 2V9UA 4M4RB 2XZCL 2JB5H 5MEQA 3QO1B 5I75B 1GJIA 3O8XB 2EE3A 3EDDA 3HS0A 3PLYA 2EXYD 5G5DA 4XVUD 2XN1A 3UBXG 5I6KA 1HZHL 1ZXKA 5DVPA 4HBQA 1X3DA 1JERA 2WW8A 3OJ2C 1YCSA 3D1MC 3QUZC 5IHLB 4IRZA 3VGGA 5JPNA 1KT2A 4X0NA 3BSHA 4JAMA 3UTSD 4DW2H 1XCTA 1ATDA 2WQRA 2WPME 3DUUA 2NSQA 5HGDB 2ZG2A 4FXGA 3ZTDC 4Z8FL 1E27B 3QNYB 2KQMA 1SXZA 1HAEA 4Z3TA 2EABA 4JFZH 4PRHB 2Y06L 4YGAB 5D1QE 4IIQC 5DLML 3ESMA 4XMWA 4ELMA 5IB5A 3Q9PA 2J94B 2BERA 1J8HE 4QCIB 2NRDA 1N0LA 4N6RB 1IQWL 1KJ3H 1I31A 2WNGA 4LCWA 3KGSA 2OI9C 4LSTL 2GFBB 4F2ME 2B59A 2AK1L 1J9CT 2E59A 2R0KL 4L3EE 1EUTA 3LN4A 2NTFA 3UCRA 3NZHL 2CJIB 1SUJA 1UM6L 4F9PC 4HUXA 4K8RH 1KXVC 1GR7A 4KZEL 3CFIC 3MFFB 1JG9A 2VL4A 4JY6B 3GMQB 1TQCC 3GPSA 1MFBL 1REIA 3R8BB 3S37L 1UACH 3PHOB 3MO1A 3SYOA 4MCYB 5FHBH 1U8HA 1S5IL 4D7PA 5CGYC 5FB8B 4NQED 3AADB 2WG3C 2RTTA 3HCVB 4PG2C 4M6OL 4WWKC 4N0CC 4ZOBA 5F0MB 2HX9A 4YHPB 3BSZL 1M71A 1EEYB 3CN4A 5INCB 2CR3A 1KPVB 5I18H 3PQYE 3D0VB 15C8L 4F58L 4LOVA 2WWKT 1EMOA 2D8KA 2PYFB 4JREC 5IKCA 3ETTA 4CJ1A 1E8YA 1A7QL 1M42A 1MQKL 2ZUQB 3CE1A 3QHFL 2YUZA 4TOYH 5B4MC 3DUSA 5EEYA 3SQOH 4KROB 4WNQA 3NJPC 5C70A 1WYJA 4BKLA 4Z3FA 3O2DH 4NIYE 4P8QA 4UI2A 3ZE2F 3ARFD 5HHQA 3N44B 4ZUVA 5F9OH 3X1BA 5IHBA 1TLMA 2ZUXA 3BDYH 1ZA6B 3HZVB 4H40A 4MLIA 4ISVA 4LHQB 5FX3A 1RAMA 1N18A 4AYBA 3BUDA 3B56A 5JXED 3NJJA 1K8IB 3FO1B 3U36A 4X6DA 4W9HC 3E6HA 1JNLH 1P7BA 1FGNL 3NACH 4AYDC 4Q6YA 3KW8A 5ICYA 1U91A 2BIOA 3EBGA 3QG7H 1S3KL 4J12A 5E6ID 1QRKA 2X6UA 4NZFA 5B39B 3AUVA 3SY6A 5EEVA 1KGYE 3BUQA 3MPCA 4WUUD 1NGPH 5FLUA 3FQYA 1MREL 4NBXB 3SKOB 1EQHA 4WI2A 1JHKH 2YMXL 3LJ3A 1I9JH 3QPQD 1DFBH 1LO2L 5T3XH 4AW4A 3GI8H 1NQBA 4Q9RL 1IEHA 3TNMA 4XP6H 4FP8L 5JBAE 1J87A 4K3JL 4AK1A 3Q48A 1X5IA 3QIWC 4GRLC 5LBVA 4KJQD 4PYGA 2ZOTA 4YDJB 2XDHA 1PG7L 2H8PB 1BEYH 1TETL 3ZHNA 2ZKHH 2BOBA 5A6IA 3JTSB 3T4AA 1BM3H 3D9AH 4XO8A 1A02N 3NA9L 4BCZA 1T2JA 5EBLB 2XTJB 4N4YB 4NUMA 5IQMA 2WUBH 4YZUB 2ERJC 3DGGA 2WXMA 1Z5LA 3OKNB 1UTDA 4YHIB 1XF5B 2WXPA 2LT9A 4P3WA 1P2CB 4KVNL 3H54A 1E90A 1G7PB 1R3KB 1OQXA 2VM9A 1KN2H 3D07A 4D0DB 3IB4A 3OXSA 3WJMA 2A77H 3V6OA 3LKNA 5CKQA 3GKWH 4R2GC 2W0KA 4EI6B 1FBIH 4ZQTA 2Q2EB 4UQ9A 1EFXD 4DKTA 5F70A 4KJPC 4IU3B 3ARBB 4LARL 4MAYA 2R1WB 3EOTL 1NGZA 2Y5TA 3HE6C 2BCKA 1AUTL 3SBRA 4FI6A 4LQFL 3FCSB 4QHKJ 1QAWA 1XIWA 1AZUA 3QGVA 1FJSL 1MG3C 1ZPUA 2FO4B 2RCSL 4QKTA 2YFNA 5CN2A 5F8QC 4PTTA 5HDBE 4IU2A 1RZKC 3NBNA 1S9WB 1T5KA 5DUPH 3MBWA 1RZ8A 1F3JB 3S48A 1SYVA 4AGMA 3T3PB 4HKZA 2C7UA 2VXVH 2ZT9C 1HQ4A 2EC9U 4HKXB 1SDDA 2X1OA 5AVUB 4Y16B 1QFKL 3PV7A 5IBTL 5TQ2L 1H3GA 2NX5A 4HA1A 4M5YH 4NSKA 5GJTL 5C3LD 4Y4FA 2O6EA 4Q4EA 1S6NA 1U30A 3WJJC 4C4KO 3MCG1 4OCSH 1BZ9A 4JR9H 5HYSA 4AEFA 4AM0B 4JFXA 4YR6A 3MCYA 1LQDA 2AEPL 3W9EB 4HIXL 4PV9B 4ZMQA 4UWQB 3I9GL 1DQJB 2XN9B 1HOEA 1PU0A 1PDKB 3WTVA 2FX9L 5C09A 4ODSH 3LQMA 3QMOA 5GRUH 4ZUSA 2VDQL 5HHVL 2O5ZL 3ARUA 3D4GA 4FNQA 1FN4A 3EO9L 1HAFA 2JJWA 3P4MA 4B0MM 4BIKA 2N0KA 1BYPA 3CFWA 1Z9NA 3FRPA 4X6FB 1ROWA 3GMPA 4X8JB 4F2EA 1NIBA 4I13B 1OGAE 3S3DB 1IAIL 1NBVL 1CE1H 1N6VA 3G5VA 5GGTH 4EI0A 3NJXA 1JPSL 3QUMB 1KLFB 1M9SA 1S7UB 4NQDA 4PJGB 1BD2D 4YDZA 4ELMF 3FCGA 4E9YA 3G6AA 2BH0A 3EADA 1NWPA 2VUOA 3BN9D 1A7PL 4NWUL 3K46A 3SY0A 3ZMEA 3UPRA 2Q86B 1LDPL 2WPLE 1D7DA 1U58B 4M7ZB 4PWJA 4GAFB 3M7OA 1UENA 1MCFA 3MCLH 4GS7B 1KTBA 4AZ8A 1LMJA 4PJXA 3PXHA 1Z3GL 4KTGA 1R24A 1MFCL 1FIGH 4RIRA 3QWQB 4GSRA 5E99L 1GH7A 3QA3A 4P2CG 4X2UA 2BCMA 3ZRFC 3GHBH 3WLBB 1NFIB 3C6EA 2WB7A 3GS4A 2G00L 3SIKA 3VDCA 5HDOA 32C2B 5TFSL 5JHLA 3GMRA 4WV1B 1NH6A 2HPTA 3GFUA 4KHXL 3CSYA 3N8WB 1A6VH 5KYXB 4JZJA 4MAUH 4K9JA 3UP1A 3Q5TA 2J7LA 2WXFA 4G6FB 1HYSD 4UIMB 1JGLH 1LD9A 3DO3A 1MUJA 1NFKA 2CG9X 4FQQA 3W5MA 5I6LA 3O0LA 4JO3L 5HVWA 3RWCA 3BP6A 1ZLVK 3T6ZA 4KMTL 4XNXH 3QR2A 4CW1B 3A4DA 3D3VA 1RFDH 2BNQE 2VXTL 4JPKH 1KJ2A 2Y7NA 4P49A 6COXA 2YKKA 4CMHB 1ZGLB 1OZUA 1WT5A 1MHPH 3H9SB 3F7PC 3VXOB 3X3GL 4L48A 5I26A 1EEQA 4A39A 4EIUA 1MCLA 2WFXB 4UB0L 5L4MA 1BWWA 4MJ6A 2BVQB 4LOUD 4OJYA 2YPKA 4FFWC 2JVUA 5HYJE 3EF4A 1WRFA 3B5GA 4FQXB 1RZKH 5DQ9A 2EAEA 2H6PB 2Y7SA 2IEPA 5CEYB 3E6FB 1P7QA 1YJDL 3A5VA 5DRNB 3REVB 4ILDA 2NY4D 1IGTB 2RA0L 1EO8L 3KCGL 3RZCB 4Z7QB 1WHPA 3QIUB 1AQDA 5KN5C 1BXVA 2XY2A 4OZHB 3VXNA 1E4KC 4OZGB 1IQHL 3VDBA 5F1IA 3CQFA 4DP7X 1NFYB 1J0YA 3BW9B 4MJID 1WFMA 2EUVA 4YFEA 2CO6A 1AHKA 4Y6DB 3IWUA 5FO9A 4BXSV 1T89C 4X99B 1SUHA 1AZZC 3M6DA 4JFQB 2BOCA 1OY3B 1MZYA 3HE7D 5E6YA 3RVUC 3QRLA 4FL4C 5DFVD 3S36L 3KPPB 5JPMB 3MRBB 1LE5B 2EDDA 3W2DH 3CUPB 3DDGA 4I0PB 2YGOA 3WY1A 5I8CB 1PZCA 5C07D 3EXJA 1NGQL 3U6XA 4UILH 1ZVSB 4PRIE 4ZNCD 3P73A 1DVYA 3DK0A 1CF8L 2DZEA 4FABL 4RMVA 2B1AH 4EZJA 5EC2B 2K8MA 1P6FA 3FYIB 4QXTA 2QMJA 2WFTA 4GIOA 4QF1A 5HHPA 5J1TC 4OD1H 2IV8A 4UV4L 4NO0D 4Z7WA 3RJDA 4OT1H 4ZFZA 5FCSH 3PV6A 4UOZA 3W9DA 1NZIA 3QVAA 4POZD 4ZYKA 4MNHB 4DN3H 5IJDC 1N1IA 1MVFA 2F5BH 1NUGA 5HI3C 1X5JA 4KK6D 4PGEB 4OVVA 1IC7L 1RP9A 3SPVA 3JWNG 1NINA 1IBDA 3RFZC 2AMUA 4PP1D 3V7AG 4NNPL 3VXSE 3QNZB 5C3TA 5EU6A 3ZIMA 5C08E 3L3GA 4M1CC 2OXHB 4ALAL 4Y4KC 3JWNE 1OAKL 4BFJA 5GGUB 5LQBH 3V7AE 4YBQD 2ZICA 2VDOB 4W9LC 3IBEA 4KAQL 3VFNA 1Q9LB 3PWLB 4DGYL 1RJLB 1XO8A 1JHLH 4X8TL 2OCJA 4AL8C 5ISZD 5BRZD 1B0GA 3DOIA 3JV5A 2JCWA 1CTMA 2XKUA 4NQEA 3FO2B 1VESA 5IM7B 3AAZA 2AK4D 1Z66A 4PGCB 1PG7W 3P02A 3VI4B 5I1CH 1TSRA 2D4DA 4AYFB 3L17A 3E9TA 4UMSA 3WNMA 2ZG1A 4OLYH 1G43A 3MRKA 3OJDA 5TPWH 3N5AA 2VLLB 4UM9B 2ENSA 5JW1A 3D4ZA 3BP5A 3LOWA 2CRIA 1KY6A 4HXBH 4LCVA 3IFLL 4KX8A 1MI5E 1YEFH 4Y4HD 1QP1A 4N2AA 4UMGA 3R18A 4Q0XL 3SDXF 3ARFA 3OGCB 5C0BB 4YAQA 1YC8A 4KNQA 1OTTD 2P44B 1CFNA 1N7DA 5DRWA 4PJ8C 2OMTA 3UJJH 3VXTA 2YXMA 1DVAL 3ZO9A 2YPVH 2EILB 3K4DA 1S8DA 1O5DL 1I9IL 5I76A 4HISA 3V5HB 1AYOA 4K94H 2AZAA 5DD6A 4R0LC 2J6EH 3L4UA 4IJ3C 2R2HA 1PFCA 5DO2C 4AGNA 3FTGB 5HJBA 4NZUH 3ULUE 1G94A 4F7CA 4OJFL 1MFDH 4RZCB 3H4FA 3V9FA 1T7VA 2D0HA 3ZZSA 3FU6A 5CJXA 2IALB 4AEEA 4PJXF 4OH2A 4KHTL 1U41A 1A3RH 3QDMB 3QFDA 3CXDL 3P3SA 3T8XB 1JTPA 2CDEA 4AQAB 2E4FA 2JJTC 4FI8A 3O3BB 5CP3H 3TBTA 3VRLF 4RMBA 1FHGA 2HJLB 2WLNA 1R1CA 4HYTB 4PGDA 3DVGB 3UIZA 5L8JB 4OKVB 1MJ8H 4JRFA 2HX8A 3MRLA 3AWEA 3L5WA 4JFDA 4M4PA 3ZE1E 3AXIA 2J57A 1T04A 2W91A 4OGYL 5GGSA 5MEND 1MF2H 3W39B 2XYCA 1PZSA 5D1ZC 3T0AA 3WN6A 7PAZA 3KCPA 1P4UA 4HUMB 4XAWL 3UOAB 1QR1B 1QPKA 4JVWA 5F89B 2DEWX 1EJFA 1FDLH 4NJ9L 5DYOA 4DKFL 1M2VA 4G3YH 5FA3B 3DURA 5HSFA 1O7SA 2AXGB 3LZOA 2ICWJ 4XBMA 1RUQL 4JRYB 2J73A 3QNXB 2NLJA 3V0WH 2R56L 4KO5A 4JFYA 3ZT7A 5J1AB 4GAGH 3MRHA 4NGAL 4LPWA 4X98A 1NCAL 1N59B 4WI5A 3PREA 1BVKA 2NY5H 3A6CL 4HV8A 4L29B 4TS6A 2AGJH 4U1IB 3CV5A 1YEDA 1WGOA 2ITCB 1M1SA 1BLNA 3CIQA 3LQZB 1YEIL 5F7AA 1FE8H 5HY9A 4WJ5B 1EXGA 2YSTA 1AFVH 4LSRH 4NP4H 5ITFB 1FAIH 1IGZA 3EGSA 1T6VN 5DK2A 3G08B 4EOWL 1LNUB 3S35H 4O51A 4GKNB 4PCKA 5I23A 4X80H 1G1QA 1QBAA 5DK0B 5EUOB 1B4TA 2WYTA 5C86A 2F19H 1CQYA 3HZKB 3Q3GA 4AL8H 4AXWA 3FOMB 1V10A 3VQLA 4BELD 5FFOA 3VYNA 1KCWA 5HDWA 5JDSB 3IDYB 1XCXA 4AQ1A 4WUKL 2YSSA 1AXTL 1G9NH 1PY9A 4MYWB 2SODB 2NUPB 3PWJB 2F53E 3LRSB 2Z7WA 3D0AA 7PCYA 1FO0H 1SHMA 3OKLB 4FLRA 3IETA 1J05B 3TA3C 1QQDB 1OTSC 1LMIA 5EN2A 1KTDB 1TQUA 2QR0A 3JWNH 1DHKA 4Z18A 3K0YA 2CJUH 2PR9A 5CCHE 1D5XB 1XEUA 1F6FB 2VRQA 3ZKMC 3K71B 3BAYA 1PZBA 1WWCA 4PRNB 1NAMH 4TUUA 1AGDB 3CQQA 4R4BB 3PGDA 4UOJA 3TV8A 5F3HB 1L0PA 3B5HA 4HKBA 4ISIL 4FZEH 3WKMH 1EK3A 4ZH8B 1BVZA 2VXQA 3EKCA 3V4VH 3FTSA 3L3HB 1A9BA 1T2QL 1RUKL 4XN8A 5J6HB 4JPQA 2NOYA 1RIHH 1BX2B 3DJ9A 4WW1B 2K45A 2GI7A 4Y7AB 3QEHB 3ZYOA 1BD2A 3ASWA 4JQXA 5KVGH 1TO4A 1F3RB 4P2RA 1PPIA 3LZNA 1XTLA 1U42A 4WENB 3EJCA 1RUAH 1WK0A 3RAJH 2E7LC 4GSUA 2WC7A 4U3XA 1PY4A 3P4NB 5MI0C 1BIHA 4D9LH 5I15H 1LWJA 5I6OA 4JRXB 1JHTB 1A6UL 3KM2A 3F83A 3MLVL 4XWOD 1OAYH 1A4JA 4P9HL 3C5JB 4IRJD 4ZXBD 5BXFB 2FSEB 2IH1B 3IPFA 3VJ6A 3HG5A 5CGTA 5I17B 4YE4H 1MCBA 2LTQC 2H4EA 3QC5X 1F4WL 4UT6H 5DJDA 4G59C 2J4WL 5B38B 5C2BH 5KANI 1YO4A 2NXYD 2CJTA 1NTDA 1DLHA 3GJEA 4V1DD 2XIDA 3NJVA 5J56B 1UCBH 1K72A 3G6JE 4A2EA 4R26H 4NN5C 4ZFFA 2F74A 4KRPB 5CZXC 4U2ZA 1QRNB 5ESQA 4E9SA 3B2UC 2KYIA 3DSFH 1KGXA 4ZSOA 4ZFQA 3VGDA 2YEZB 1QYGH 5IBUB 2DLFL 3EHBC 4QRRE 4PVMA 3T3ME 2H1PL 3NGBC 5ANME 3WFBL 5H2BA 4P2YA 2AKRA 1OSZB 1IVTA 1F7EA 4PS4L 2A9ML 1RZGA 3BAXA 2JI3A 1NCTA 4JPIA 5IFHH 3HNVL 2IMNA 3CFUA 1OAXH 2Z7UA 3ATBA 3RTQB 4HWUA 3A0OA 3NEOA 4JPVH 4BZ1A 1EPHA 4FJ6A 4FTDA 4GH7B 4HMDA 4PRHD 2O5YH 1FYTD 3B37A 2VDOL 5LXGH 1NA8A 1JZFA 4M61B 3LHPH 5TGBB 1F56A 4RNRB 3BZFA 3P1VA 3VX0A 4H8UA 2WTRA 4RMUA 1TVDA 5KTEH 2HLEB 2XWBA 4X5WB 3CFJA 1B6DA 1YECL 1QSZA 4YX2L 1VACB 2W92A 3QUZB 1YNTA 4LAJH 4LDLB 1MHHB 3LNHA 2BVPA 3LMJL 4MJIA 5GS3A 3RX5A 2WSPA 3TYFB 1FVDA 1NAKH 1RV6X 4TQEH 5FM5M 2YEQA 4X4XB 4O2FB 1DBJL 1KN4H 1JUFA 1XSJA 2FT6A 4FQHB 4ZMYA 2Z7ZA 1MDAA 3FF7A 3HE7A 4JG9A 2X4TB 4OFYD 4IIQB 2G5UA 4PWGA 5I9QC 4S1RH 3R1GL 4R90H 4MQXD 3L3OA 1WD8A 1LILA 1P9JA 4FXTA 3EZJB 1TNNA 5DT1L 2N4IA 3U46A 3Q6GH 4LLMA 2OI9B 5C07A 5JHAA 4Y9EA 2AQNA 2CJ3A 3MREB 5KS9B 1JRHH 2BFVH 2ZAGA 1AS7A 4XI5D 3J2PA 3TN0D 2FEEL 1I75A 3VFUB 3ZBMA 2Y7MA 1Z9SA 2F8VA 3BT0A 1CFVL 2J8UA 1S3RA 2DQUH 4KROD 2F8XC 1F4AA 1TQCB 2QPEB 1AZCA 4LCIH 4GSXA 1IM3B 4K3EH 5IKTA 4KNTA 4L1LA 3Q1SL 4WWKB 1CDUA 3AJ7A 3LXUX 1RK0B 2IFFH 3MZTA 5D2NC 2DWSA 5I2IB 1KCLA 1WCQA 5IIEA 2OM5A 4OIAA 2FYVA 3ES6B 2JIXB 4WKZB 5C6TH 3VXQA 1ZEAL 2Z4QA 4JREB 4R3SA 2YN3A 3N3EA 4KOCA 3GI9H 1GY1A 5D4HA 1CLYH 3RDTC 4B5ZA 4PRDA 3ZVVA 2Q2LA 2DN7A 2DQMA 2DYPB 3SB3A 2DY2A 3Q3KB 4QTHA 3B9VA 4PWHA 5GS0H 5JB8E 5EO1B 5ID0A 3VFPA 4Q58C 4YPGB 2PCPB 5GIRB 4M7LH 1N0XH 1G7HA 1TPGA 3L08A 4B97A 5LCVA 3L3KB 5BRZA 3U7AA 1XB6A 4WCYH 1QBMH 1TTGA 2AK4A 4KKRA 3IDGA 4O2EB 5D6CB 2NUTA 3PL6C 1QLEB 4K4KA 1B9KA 4ICXA 5GHWH 4G9DA 1LEKA 3FBYA 2AJ3B 4GW5A 4X8UL 4XT1C 2VZSA 1YPZE 3UZQA 2H7WA 4TVPD 1WDAA 1K4DB 3IFOA 5EZOL 3V0HA 4NHUA 1V1HA 4WAFA 1R3HA 5LGJB 5C0FB 1YNLH 4R5TA 3RVWC 2EDLA 4XHJD 2HT3D 1A6ZA 1H9VA 4GQ9H 4G1MB 4HC1H 1H3VA 5SX4H 2XBYL 3QQDB 2ZYIA 5G4NA 1WIUA 3IPEA 3D2TA 3EJRA 3RWEA 3QIWB 4GRLB 4N8CL 5DEGB 1HRFA 2QT6A 2E46A 3KXFE 5MHSE 1IARB 3RY6C 1JYVA 2E9IA 3WE1A 4BK5A 2Y07H 1BECA 2VQ4A 4ZZFA 3KPMA 4S1QL 1I1YA 2ERJB 1O75A 1TZIB 3DXAD 4HK0A 4YT6L 3BAIA 4QY8A 5TK4A 3VRJA 4U33A 3LH2L 2IAMA 3OLGA 5EZLB 4RMQA 1J88A 2GEEA 5CJOH 3ARGD 1J5IA 2DJSA 3RWDA 4R2GB 3KPSA 1O9VA 2Y7ZB 1Q0EA 5DJAB 3GO1L 4N90E 2VE6A 3C8KA 1QWHA 1QBLL 4PRPE 4F7PB 1JVKA 5C0DB 1LK3H 2AAAA 1X5ZA 4HPYH 3HE6B 5I6NA 1KIUA 1TFHA 3THMH 1EHLL 5KSAC 1DVTA 2V7HB 3AMLA 3UGUA 1WS7A 4GG8B 3G3LA 4N5ED 5JIPA 3IFPB 1U93A 3QJTB 1FUNA 3FSVA 2OJEB 5G55A 3FU8A 1WHEA 4U7SA 2KLTA 3K2UL 2K3TA 4TLTA 3A6BL 4ZPTA 4XBEL 1I3RA 1HDMB 2UVEA 3PAVA 3WNLA 1LHZA 1KTJA 2DEYX 5GRZA 2L3BA 1XEDA 4B5EA 2RMNA 1URLA 2J3SA 4XNUL 4K9EC 4JG0L 4XNYL 2AXFB 3FQRA 3IXAA 3B7TA 3RG1C 2CLVA 4IOFC 1B2YA 4TV3A 4C56D 2VLRA 1MCHA 1ZA3B 1A9EA 4KI5E 5IP4A 4Y2OB 5SV4A 1OAZH 2JK5A 1LO5B 4TOYL 4U1NB 3LSOA 5MEPA 3U0WH 1SY6H 4FA7B 1AS6A 4B95C 4HCRH 1AG6A 3KYKH 5DEFB 5E9DB 1TZ8A 4KKBD 1MQ5L 3SGDH 5F9OL 3GB7A 1YNTF 1WE5A 4ONHB 3DRQA 4GJTB 4OKDA 4BTUA 4X9HA 3JV0A 1DUYA 4UBDD 4PWKA 1LQSR 4UU9B 5FA4A 1S7XB 5C0IB 3KWTA 2PYEB 3NTBA 3UTPD 5DHYB 5AALA 2VN3A 1JPTL 2D7TH 3DYOA 3VGFA 2IMMA 2QL1A 2YFOA 4J3OG 1OEZW 1I8IA 1GIGL 1VZGA 3VACA 1YUHB 3W81A 4G6FD 1DQKA 3FFCA 2BP3A 4W9CC 4DO6A 3CLEH 1UOLA 2AJVH 2P5WE 4X5XB 1SQMA 2B39A 1L6XA 2EDBA 2IANE 4A7GF 2XWDA 2L7JA 3FYEB 1IEAA 1KTLB 1FZOB 2JKRM 3GZOA 5F1NA 4KV5E 4Z76B 3VU2A 4AVHA 2A74A 2OMVB 4HDIA 3MJ8B 2XVKA 4QRBA 3WNKA 1OM3H 3RLSA 1UWXH 3B9DA 4LVHC 1IVOC 5TE7H 1QD0A 1DX5I 1VHPA 4P06A 4FNUA 1QFWI 4G9FA 2ZKHL 1UXSA 2R9HD 3S34H 4JGJA 3WG7B 1AP2B 5IW3A 1IQLL 3GHEL 1BM3L 3D9AL 5F3FA 5HJGA 1QNIA 5F7DB 3UZEC 3FUDA 2GTZA 2N59A 2OMUB 1JD9A 5CP7B 4YDMA 2LABA 2AVGA 4NENB 3O3EA 5CGBA 3VO0A 2R29A 3ZDWA 4UM8B 4FQXD 4Z7UA 3HHSA 3ALXA 2YBRB 4OSUL 2DLIA 1YMMA 4WI4A 2XRAH 5D7LD 3RZCD 4AW7A 3I02A 3PNWB 4Q9BA 2JCCE 3IF1B 4N0RA 4DK5A 1KJMA 2A77L 4CMMA 1NOFA 2YUWA 5DD3H 3GKWL 4JFEB 2ZZUT 2CMRH 3D0LB 1PQZB 3G6DH 1RU9H 1E40A 2X7LA 1ZLUK 3IU3B 2NPRA 5DC4B 1ZRUA 2R23A 4Q4IA 4IBZA 5T1MB 4L3AA 3FT2A 3US0A 3UXFA 2FL5A 2DQGL 3JZYA 4BSJA 3WHXB 5AKTA 3TO2B 4BXVA 1W91A 4N8VA 2WVVB 3MUUA 1T0MA 5L9DH 4HWBL 4HOWA 1YSOA 4F7TA 5IB3A 2ROXA 1IGMH 1U8CA 1HHIA 1B9WA 2VMJA 5FWRA 3FB7B 5DUPL 1QOKA 4KY1L 1TQSA 4M9OA 2NYZA 5KN5B 1KDIA 4WWID 4Z7OE 5I1GH 1FNSH 3LKRB 4D0CA 2QGCA 3P54A 3FNKA 2XT1B 3IDNB 1OQOA 2MHAA 1A7OH 1VFUA 4Z7NE 3UMNA 3ULAB 1ZHBB 5EEWA 4IK6A 2Z91A 4JFWA 4AYEC 5JOPE 3ZE0F 1NMAH 4F80A 1MCRA 2X42A 3F6LA 4FL4B 1NCUA 4JFFD 4IBWA 5IJVA 3MRGA 5HGGS 2IADA 3MLUH 1JV2A 1MN4A 2HFGH 4G6MH 2NQDA 5JA8B 3LZLA 3B2VL 5EG6C 4XAKE 2DEXX 2M8XA 2HVJB 4ODSL 4XNBA 3PWUB 2YLKA 5GRUL 4LLAA 4O58H 2EXSA 4ZMNA 1Q1PA 3E38A 1GC1C 1Y1DA 3CCHB 3NIDF 2GCYB 3LHAA 4IM8A 3KEDA 4LEOA 3MACH 3CS7L 1RUMH 3NIGF 1QSFE 2E76C 1QLEL 2A6KA 3OR7B 4IIZA 4JZDL 1BYOA 3SYPA 5KW9H 3F7VB 4RRWA 1P84J 4E9RA 3ESPA 3DO4A 1R3LA 3D87B 1CE1L 5CD5D 1E9QB 3TK5B 4YLBA 5DJ8B 1D5IH 4W6YB 2WXQA 2EDOA 2I5YH 4OFYA 4PMEA 4Z7VB 4HIHB 2GBAA 4NUGL 4TUJA 3ZL2A 3V65B 3RFZB 1OAQH 4GW1B 1IQEL 4F8PA 5JA9A 2VQ1B 4KBPA 2FX7H 1R3JA 2K4WA 1IX2A 2WJ7A 3EFFB 3U9UB 5IHZA 3KPRE 5LBSL 5KYNA 2J88L 1L0QA 2CDGB 3EGDB 1T22A 3PWPE 4Y19B 2P5ED 1I1AD 4Y4KB 3CSPA 1I82A 1NCCH 2C9AA 3TN0A 3KD4A 3MDJA 2VM4A 2VDKL 5C0JB 2VH5H 4PUBH 1E4XL 5IMMB 5IJKA 5CKNA 3PP3H 2JXMB 1LEIB 4PI0A 3GHBL 3SYQA 3FH5A 5A16A 1W0WB 3FQ2A 5CNHA 1G7IA 3VXRA 5T5NG 3MA9L 4FS0A 2CPUA 2GAZB 4B7IA 3WEAA 4GG6B 2PCXA 1NLDH 2C9VA 4MAUL 1ADQA 3O4LE 8CGTA 5J1SC 1S7VA 4I1PA 2Y7XB 1ZV9A 1JGLL 3CDGA 3LEYL 1OB1A 1R5IB 1NC2A 4I9XA 4L8SA 5ESAA 4HQQL 5IY5B 1QUNA 2TSAA 5BZZA 1FO0B 4BZ2A 3RUGE 5IR1A 5D1XC 4JO2H 4ZHAB 1ZT4B 4JCMA 4MCMA 4JHZA 5F1SA 5C0AD 2BRQA 2CRYA 3LKPA 3ZKXC 3MRFB 1BQKA 3SBWA 3K7UA 5FHAH 3EYUH 1SN5A 2VXSL 1CF1A 3EW3B 1VERA 2FJGB 3RWFA 5T1DL 2C3VA 1X9UA 3OAZK 3TV3L 4OZFA 1NAMB 12E8L 4KDTC 2R0LH 2LLGA 4CBPA 4PJAA 1HL5A 2OMBA 3CDZB 4XP4H 5DHEA 5B21A 4PJ8B 2HWZH 3QJFA 4UANA 3E8UL 4XP1L 1PW3A 3GSXB 3MGOB 1BBDH 4M6MH 4N3TA 1RZKL 2WBJB 1P6AB 5AW8B 4F9LA 4ZI8A 5HDQL 3V4VB 4J5VA 3M1OA 3AC0A 4AC4A 2WWMD 1KG0B 3O9WD 5HVFB 4NHCH 1C12A 3T4YB 4M7KL 2YD0A 3UACA 5FGBA 4EZKA 3NTCH 4R0LB 1KXTA 3CK0L 4IJ3B 5E8OB 3NIFE 1R46A 3HN3A 3DMMA 5ENWB 5GZND 4CILA 5I28A 1B90A 5CSZB 5IVOA 2EXTA 3M45A 1MI5B 4QO1B 2ENQA 2D7MA 3S4SB 1XF4A 2AJSH 1BQHG 3IJYA 4WEMB 3SE4C 2Y36H 3TBYA 4DOHB 5AOJA 4U4BA 5AKVA 1OT1A 4HLJA 2C34A 2R4SH 2AJYL 2ATKA 4G2AA 2K3HA 4HZLB 2OMZB 3RB7A 3RPKA 1KLJL 4K3DL 2APSA 4KK8D 3CTTA 4ZD3L 5T3ZL 1FCGA 1EWHA 1C5MF 3MCKA 3O2VL 1SDYA 2DQDH 1GJUA 1GC1H 2BSTA 3NSDA 3KPQA 1IOXA 3KCWA 2B1AL 2YD6A 5KVDL 1DVFC 5D1ZB 3GD1C 4PLJC 4HLZG 4HBCL 4YQXH 4ZPVA 3GM8A 2UZXA 2BVEA 3ESVF 3JTTB 4MB4A 4HOZA 3HMXA 4CRPA 4OT1L 2PPAA 2UY6B 2CWRA 1PYWB 2XXGA 1T1YB 3BQUA 1RJYA 4Y1AE 4M03A 1TLKA 1XF2B 2IBZX 1FL3A 1KPUA 2ZYRA 4F8OA 3ARGA 1RY7B 3HLKA 4XN9A 2AAVA 3FQ4A 5IB2B 2IVFC 1DBBL 4IBUA 4X7SL 2OBGA 4QHMB 3BKMH 5CWSA 1SJEA 1YMHB 1UM4L 4RETB 3FRUB 1ZE3C 1IAKA 1PCXA 5K39B 1MWAH 5AVVB 1IAII 5T1KB 2W8CA 1W6WA 4PD4J 1RLBA 2ITEA 5FS5A 4X6CA 4LLWA 1TR7A 4G7VL 4YXKL 5LQBL 3ZTCC 4HIIA 5IOPB 3I3DA 1TJGH 2B2XH 1WTGT 4PVLA 2MQ3A 4FG4A 3MV9A 1MCEA 5J6GB 4I88A 5ECGA 4I0CC 3L5XH 1KFGA 4EUPG 3MRCB 2P3FN 4PV8A 5D5MB 3UP6A 5DSCB 2EDFA 3OM3B 1JK8B 2GW5A 5EC1A 1Y6KR 4GAYA 5F1KC 4L2YA 5C0RL 1U95B 2HG5B 1FFMA 2VZ3A 3QFJE 3FSAA 5BQDA 3TA3B 1G7JA 3AS2A 4K8RD 3TIEA 2ZIDA 1MHEA 2OV0A 4EVNB 1SMAA 4K7PH 5M94B 2Y3NA 1T80A 2NW2A 1K4CA 5F7EH 2WQUA 1FFNA 2CUAA 3EJZD 2W9DH 4E9VA 3KL3A 4YSCA 1EZSA 1F42A 3RBGA 1PFXL 1HXYA 9CGTA 3Q2NA 4RMRA 2ADGA 1RK1B 2YD4A 3BE1H 3BUBA 3B4NA 3BISA 4JRXD 5AWNH 3UJJL 3QXAA 4NQCB 5FYKD 4YXLH 3QYNA 3OBAA 3UMTA 1KSNB 3IGAB 3HC4H 1GYVA 3FBKA 3VD5A 2X4UA 3BT2H 5DA0B 2AQ3A 2CK0L 4DP2X 4WTXA 3FHAA 1Q9WA 2KC0A 3VFRB 3D69A 5JMOC 1KMGA 3HG1E 3UZVB 5J7CC 2ESVB 2V7NA 4BQ6A 4JM2A 3A3YB 1Z7JA 2OQJA 1XB8A 3C08H 5BUAA 35C8H 1QLRA 1ECYA 4KRPD 3NA4A 5MI0B 1R4XA 3C2AL 3GSNH 3H9YA 4YHLH 2A73B 1OXYA 2RH0A 4OF7A 2VQTA 3X12B 2DYRB 2NT1A 3F7KA 3UJTH 1TQVA 4MNGA 3QRBA 3RNQA 1BJMA 4MX7B 3V55A 3DV4B 3WFEH 4IKJA 1VENA 1EEZB 5DJCA 4PWEA 1J0IA 2J95B 1LO4L 4OM0L 2LTQB 3N44F 3Q8AA 1HIML 4R7NA 4XPFH 3T0ED 3UG4A 3RGHA 4XWGL 4XVJH 5J4MA 1JDCA 4H4NA 3DTXA 4I7ZC 3ZTNH 3T0XA 3RTQD 1QLFA 4K7FB 2YQ3A 5DRXB 4DN4L 5F7MC 3EDJA 4Y5VC 3GUTB 3VG0L 4QRSB 4H5SA 2ADIB 4FLHA 4NN5B 1QKZL 1SN0A 4FQCH 2VJ8A 5LAXB 1PZUB 3GZPA 2VT0A 4PLKC 1SBBA 2P7TB 3IU4H 3WLWC 4N68A 3NN8A 4G42A 1IQNL 2ZWLT 3VWJC 3WDJA 5D7LA 1VJSA 2Y7QB 3EHBB 1R47A 2GKIA 3NGBB 1EAJA 2EUXA 2IDQA 1SMOA 1F11B 3HNTH 5AW2B 3C09C 5LWYH 2P26A 2JELH 4XRCB 2QVFB 5D96C 1T5WA 4P5RA 3FO0H 2VLJB 4JM4L 3TO4D 5F7FA 5FDWA 5EORH 2VRAA 3CZNA 5DZPA 1NC4B 1NGXA 1EXUB 1RZQA 4LSRL 2PXYD 1CTOA 4NP4L 4LIQE 1FAIL 4PJ7E 4IS6B 2FWUA 4PU2A 1J0KA 2ZOLA 4R4ND 4AL8L 4EO5A 3LIUA 3SKMA 1RIVL 1JNHA 2YN5A 1IVLA 2WO2B 4HLZH 2UZIH 1ZHKA 3QZLA 3U82B 2X9XA 5I1KL 1MFEH 2Z31D 3HG3A 2MPAL 5BS0B 5ID1B 4LLQB 4Y71B 3VW3H 2XV2A 3G5XA 5CEXB 5EZIL 4DKAA 1FO0L 1PKQE 3Q5YA 2XXMB 5ABDE 1SLWA 3LPPA 4EBQL 2ZX8A 3L54A 3L5IA 4RUTA 2GYSA 4WO4C 2BWIA 1LGVA 4JFFA 2XBVL 5I9QB 5IVXB 1FNGA 4U0QB 5C6WH 3MV8A 4UAOC 4HETA 4MRCA 5D1QD 3U48A 2V2WA 1JN6A 1HZLA 3RWIA 2XG4A 3VTTA 2VLKE 1C7TA 1NAML 4UINH 4BCXA 5GRJH 5JW4N 3BIAX 1BZ7B 3TBWB 1MQ8A 2BNRA 3K6NA 4EI5A 1C5CL 1HQRB 2EDHA 1FIEA 3NCYS 4L3ED 5AW7B 2XZZA 2IPTH 2W60A 3RRQA 2ZOKA 3ZUCA 5JHDE 1FFPB 2VR3A 1QSEA 2ARJQ 2R15A 3N41F 4H8VA 5AENA 4WI0A 4LCWE 1TTBA 3S96B 5KVDE 4GO8A 3BESR 1C5BH 5KVGL 1MJJB 3AREB 2LHAA 2MNUA 3HS0C 4BGLA 5KBLA 1ZV2A 4RMWA 2XQ0A 1MOXC 3G5ZB 3K80A 4PY8I 5CBEA 5HJ3B 4NN7C 3PQYD 3RDTB 4YBHA 3PWVA 5FO8A 3AQZA 4U3HA 5CZVL 1DJGA 4X6CF 1QBBA 4WK0B 5CM1A 3VFMB 4JN1H 3T77B 4LMFA 3ABZA 4FXGC 1W16A 4XP9H 5E95B 2O93L 3QQ4A 3L4TA 2HLFC 4P2QB 4NPKA 2BJMH 1T4KA 5EULV 4ODXA 2O5XL 3IJEB 4TVUA 4UQIM 3NZ8A 4XCYA 1JFQH 3BKJL 4YUEH 2B77A 2GHZA 3K6IA 3APNA 4GBXC 3U2SA 4IKLA 4L37A 9PCYA 3IRPX 1EERB 4X5LA 1YEHL 2ZX9A 3ELAT 4G11A 4KO7A 5D70H 4JO1H 3PL6B 3ZDXB 4IQHA 1I1FA 1MRFL 4TYUA 5SWQA 4Z77B 4E5XB 3INUL 1A7NL 4U3SB 5C0AA 1CFSA 1QYGL 1ZHLA 1S9YA 3QXDA 3G9VA 1RUPH 2IDSA 2LGNA 5D7JB 2WB1A 1N6QH 3ZU8A 3I50H 2IPUG 1EAQA 2NW3B 4G72B 1WAAF 5I6PA 3RWGB 2AV1A 4JYVL 4XR8C 4WI9A 2BC4B 1OAXL 1DSFL 1KENH 2Q6WA 4X6DE 1VFAA 5DS1A 4LRIA 1E3XA 3F6IA 3LHPL 5JQIB 2DQEH 3VFOB 2OX5A 3D05A 1NANI 2OYKA 3H42H 3LD8C 3OMIB 2PNDA 1OCOB 1EPFA 1KEML 4LLUA 3O9WA 4OF6A 3QWRD 1MAMH 1MY5A 3C60A 3HN8A 1BVOA 4M7JH 1KCRL 3HPJB 1N64H 3D85A 4WI6A 2RALA 3RX7A 1A3ZA 3V6ZA 5GZNA 5HI4C 1DBML 2X4SB 4KTYA 3KS0H 5JNYB 4M8QB 4OFQA 5JW4M 3LEXA 1ED3B 3BEWA 1A7RL 3GWJA 4OGZA 5GSRA 1N2RA 4F3FB 4LIQH 2J1YA 1J1XH 1TTFA 2B4CC 1NEZA 5IF0A 3ARXA 5I16B 1MOEA 4R90L 2B0SH 3G5YA 5HHXL 5EEUA 3NFSL 5DDHB 1IL1A 4QXGH 3JV6A 2CBPA 3UTTA 3VXUB 4QEGA 5D2LA 3MSPA 2XKNA 4X5RA 4C4KT 1IAIM 1MRDL 1JRHL 5KSAB 1GGBL 4G6AD 3KGTA 2O5NA 1G7MA 2VABB 3N8VA 5B7MA 3MBXL 4HP5A 1LLAA 1NT0A 1F97A 1LEGA 1SMDA 4LPXA 2DQUL 3EYSL 4U0RB 5MEOB 3V6OE 2FBJH 1WFUA 2APTA 3NCJL 2IGLA 1R3IH 4LCIL 4L23A 3CFBB 3FQUA 4QHPA 4Z7QF 1Q94B 1SEBB 4GO6B 3SOQA 2YPLE 3CVHL 5F7HA 3BHBB 1GGUA 2P8PA 4DEUA 2IFFL 3T4AC 4ABVA 3NCXA 4IRZH 5AW4B 1BQLH 3GINA 3LRHA 2UUDH 1T03H 1BM7A 2PYED 3D18B 1H8NA 5IHWA 4HG4K 1SFDA 5C6TL 2PWHA 3COOA 4MMZC 5LNDA 1UWEH 1CLYL 4MA3A 4R96A 2ZKMX 1UD6A 5HTSA 5AB9A 4UT9A 1RZIA 3BIKB 3OKEB 1FPTH 1OIOA 2XWZA 4NKMA 5HYSG 1G7LB 1JNNH 1WZLA 1U8NB 2ADJA 1ZS8A 1WICA 4B9ZA 4M7LL 1DCEA 1N0XL 4F7MB 5K9OA 1Y18A 3CU1A 2WANA 4MAYC 2Y5GL 2MCPH 1TZHB 1QBML 2V17H 1S7WA 1RPKA 5DJ0A 1SLXA 2WLHA 2WYGB 4QRQB 3SCMD 4HWZB 5KYYA 2YS4A 4OLXH 2D2OA 5K1JA 2ZTBA 1OGAD 4KGJA 3GISX 1LPZA 4O02B 4Z0LA 5K0HB 1QPPA 3QZWG 3TH3T 4BCYA 1CYXA 1HXKA 3FRPG 2ZOUA 4XH2A 4OB5L 2XBXL 1MFUA 1WAPA 2CPCA 3VXPA 5CKGA 2P3TA 4GQ9L 1Z9OA 3OX8B 4N28A 1IAOB 3P2BA 1A1NB 4ZMLA 3DI3B 4BHUI 5BW7A 1MVUB 1ZT1B 4NUJB 2AHIA 4Y4FC 2UXFA 3H6AA 2VRSA 5C0EA 1HJCA 2CCLA 1WPCA 2IG2L 2RD0A 1DO6A 2JQAA 5F9JB 4NA9L 1QSVA 2X70B 2BS71 4ZS6C 2B7DT 3MHZA 3L7FB 5D7IA 5AG9A 3HUJB 3CMGA 3N85L 5FWQA 4PJ5A 4RESB 1JI1A 5BZDB 3NSYA 5EZPA 4PRBA 4MD4B 1X5AA 3IBOA 3MRIA 1IT9L 3CGTA 3VI3E 2V5YA 4H26B 3TCLA 5C0CE 1ECZA 4YHNB 1V05A 2B4CH 3H9HB 3F58H 5AL0A 1S7RA 4MJ5A 2NY1B 1MFAL 5IQ7H 4CC1A 5IK3A 4AE0A 1UVQA 4WSJA 4JZFL 4ZS7H 4JMNA 1JZ3A 4LHUA 1TJMA 3D4YA 3T0EA 4X0KB 5DVKA 1D9KC 2DD8H 1SVCP 3LAQA 1MW0A 4GT0A 1KPRA 3L1OH 2W88A 5F2FA 2CLZA 5LJYH 1SF5A 2VSCA 4LRNL 2FCBA 1THAA 3R06B 1M4KA 5HYJD 4F7EB 4F15C 4X8XA 1BQUA 1OSPL 4APXB 1SM3L 2XQYK 4R8WH 3TX4A 2LE9A 1KCSH 2FATH 1P9MC 5AOKA 1KFAH 3OKOB 2JCCB 4I48B 2FEEI 2WQVA 2FLBT 1FVCB 1K6QH 4UV7H 1NCBL 1URZA 3BVNA 4HHAB 3LQAC 4JZJC 4NT6B 4X83A 4Y89A 3QCWA 4AE1A 1AO7B 2A0LC 3OAWA 2H9GA 5GRWA 2NY2C 3TO4A 2PCYA 1DTUA 3E3QC 2EI7B 2K7QA 1YEJL 2V8MA 2HKFH 4CNIA 2AEQH 2YMTA 3SPGA 1J5OL 2AV7B 1D2PA 3T71A 1WC7A 2BDNL 2PPDA 5EOTA 1QI3A 3OMAB 4HJSA 5CKAA 4KDVA 1YY9D 4Q9CA 4NRYB 1Q4GA 5COXA 1JWMA 3KYKL 1OV8A 5AFAA 3IGLA 3N9GL 1WT5C 4PRID 5I1JH 1OD9A 4M1CD 2J56A 2Z31A 4Y19D 2HTKC 2IAAC 4W4OC 1JZEA 3PAUA 3GGWA 2ICEB 3II2A 3MRDA 5LGYA 3LKOB 4P5MB 4WU7A 3TEUA 1Q90A 1Z5YD 4XZUA 4Z7NB 1ZDQA 4OZ4A 5EOQL 4ZDHA 3UBXA 4GAJH 1F4XL 2D7TL 3O6MH 3GBEA 1VKXA 3T04D 4MS8C 5E5MB 2QLVB 4B9CA 4UTBA 1O7DE 5H37A 4K5OA 5CN1A 4WW2A 4ZMZA 4XCNA 2PPEA 2WQXA 3BGFC 5D1QA 4GINA 1HHKA 1IOEL 1TJIL 5D2LF 1FZKA 2Q3XA 3GBMH 1J8HA 2F15A 1OAJA 4DGIL 1LO0H 4BFGA 2XVGA 4JNXA 5B8CA 1NBCA 4QHNA 3L3DA 2VW6A 1EAPA 5C08D 5I1HH 1MWAB 2DQTH 4M56A 1Q4NX 4D8PA 3K72B 1T1XB 2EVJA 3E2HC 2PTTB 1RIUH 4P9MH 4KZDL 4JZOB 3Q5OA 5C9JA 2H9EC 4AYSA 3FU7B 3M8OL 5ADPH 5I0VA 4M62L 4I4WB 4L1SA 2OJ1A 4NGHH 2F61A 3GJFB 4OBRA 2W2PE 1Q9KB 1G5GA 1NBYA 2ZUTA 5EU6E 2DQJL 3EIFA 4A55A 2AQ1A 1XGTA 2CKBA 4F91B 4XVUC 1A5FH 3N1PC 4RGOH 5I82A 1KB9K 1GXEA 3F5WA 2WBJD 1D5BB 5D1XB 1CT8B 4M1GH 1BVNT 2ARJA 3PQYA 5CINL 4H8PA 4I85A 2X0WA 3PWPB 2XCMC 5F97E 3CX5K 4YSDA 3ZKXB 3WAJA 2MHPA 4ETQA 5KSUB 1ET5A 2WLIB 5DD3L 1BBJA 2VSKB 1UM5L 4JO4H 5KJ7E 5A2CA 1NPUA 1HHGB 3GLDA 1MI5D 4XP5L 3V2AR 5JW4Q 3K6OA 2EECA 3IEAA 4GRWE 1F86A 2YWYA 2V3DA 4YE0A 5EU7E 1G6RA 4EIZC 4RRPM 3ZDZB 1YNKH 1FL6B 3DTDA 2DLHA 3FB6B 4QYOB 3UFIA 1BOGA 4BSVB 5L9DL 2DM2A 2G2RB 3LV3B 3DV6A 4NQVA 1AZVA 1ORSA 2IXQA 4A66A 3EG9B 3RUGB 2OR9L 1XX9C 5GS1A 1NJ9B 1ACZA 5JHLH 2CHNA 3BAEH 3CFDB 3MLYH 1PG7X 3L3IB 5FXCH 1HAUA 2JQZA 4OCRL 5D1ZD 4EE2A 2V2TB 4CSYA 1XTMA 1PRHA 1EVUA 3NFPA 4K9EL 2GSGA 5HHNB 5TDNB 2HORA 2XI9A 4J8RA 3LRKA 3ULUD 4K23L 1T6BX 5GSVB 3FCTB 3EAKA 4N0FA 2WZ6A 3PJLA 4L4TE 1O6SA 4KO6A 4F8NA 1LWHA 3QSKB 1EVTC 2GVYA 4UYQA 5KBMA 3GSNB 3TBSB 4YDIH 4ACPA 3NH7L 1KJ2H 4GMTL 4OW6A 1W7XL 4G6ML 4MBRA 3RFRA 5E8EB 1MRCL 1TPXC 2WWOA 5GGVH 4L0PB 3NG5A 3QCUH 3AG1B 4JHWH 4ORZC 4RFOH 4PLNC 4O58L 3BPCA 1J0HA 3QWRA 2MGRA 4MD5A 5AVYB 4Z3EA 2NQ3A 3MDLA 4KKPA 1ZGLM 1G2MB 3ARFC 3U6RA 4HIJA 1AD9A 2OZ4A 2P8MB 1HSAA 4S0SD 2ENJA 1DN0B 3I75A 4P2OA 3LNIA 3DGDA 5KW9L 3CBRA 1APQA 3F7QA 1XXDC 4O02L 3RA7L 3BJ91 1JI2A 2PPFA 5C92A 3RL1B 4RCAA 3GIZH 5JDJA 2FWLB 5JXEC 1WHFA 1DEEB 1FH5L 4ZUWB 1S7SA 4ZT1A 1OAQL 3GSRA 1VADA 3OZ9L 4ZO7A 2UWEA 3PABA 1QVOB 2AJXH 5DD1H 2VISB 1T21B 4YL4A 2FX7L 1JMXA 5CIPA 4YDVA 5EU4B 4CN6A 5AOMA 3CLWA 5EBWA 1OTSD 3L4WA 4I77L 3UAJD 3FN9A 4JM0A 4YHOH 4WO0A 1IQKL 1NCCL 3DETC 2Y5EA 1RJZB 2YAFA 2NY6B 3QORB 3MUY1 3QPQC 1JZ4A 3P5BL 4NI6A 5HGBA 3LEVH 3MRNB 2WV3A 1DJHA 1CVWL 4M02A 3SGJC 2LOEA 1F7MA 1KBPA 1U3ZA 1OWWA 1D5MB 3DOSB 2LW3A 2CO7B 3F2LA 5DMJB 4ZNEA 2JKLA 4R4FL 4XCCH 4QRTA 5I1EH 2F53D 4N2MA 3GSQA 3QUGA 1R5WB 2VH6B 5GRVL 5L2KB 4POUB 1RKRA 4JJHA 4QXWA 3TBVA 3BUPA 4DCQB 4HJUA 1G87A 5HHOA 3BPOC 1WH0A 4AEIH 4BK4A 5A6MA 3ALWA 1ZTXE 1P5UC 3E0GA 3QEQB 4GW4B 3EYUL 5E08L 2GQHA 1I0UA 1IBGL 4WJG3 5KBPA 5KJRL 3LNEA 5EV7A 2XZAL 1W8BL 4FADA 2XA8H 4MZIA 2R0LL 1UH3A 4XP4L 4Y8DC 4PJIE 2HWZL 4LEBA 1XGRB 2R1XB 4P59L 1BBDL 1OAUL 3NAAH 2YHGA 2ZWKA 3SDYH 5E24E 4J3VA 1I3GH 3W37A 3L6FA 1KIRA 2E8YA 4NB7A 4H0HB 5GS0D 1OGAA 2LAAA 5EPMB 4CDGC 1V3LA 4UZSA 2WMPB 2Q8BL 4WW2F 4Q97A 4ZW3A 2NQCA 2D7QA 3RKDD 4PCYA 3ZE2B 1FORL 4ZO6A 5F7UA 3OC8A 4NFCA 4ZQKA 6CGTA 2WTPA 4H1LA 4AQ1C 3QQ9D 4TRPH 3FB5B 3GXNA 3DIFB 2VDLL 3VXMA 4GRWH 4JB9L 3B2UD 2QQLL 2QPDB 3DPBA 1DJZA 3LNGA 3V8OA 1CQKA 3EHBD 3OLIA 4UNTA 1OP3K 5LUMA 3WSQH 1SEQL 2CR0A 2OXGB 1EBVA 4NCC1 3WN5C 1KBGL 3PGHA 3MLXH 4CVXB 2I26N 1I7ZB 2X6MA 2ZPKL 3II3A 2BP0B 3IMUA 5F9AC 3B8YA 3Q2VA 4YEFA 2COQA 2W0FB 3NPSC 4L0ZA 1GC1L 3ZZLA 4OQ1A 1RCYA 3IM1A 1PNCA 4BFRA 3IMWA 1BF2A 3ZR6A 3TFKD 4Y5VB 2ZYSA 4ONOA 2I9LA 4FNLH 5EDSA 2XJLA 3LTFB 1TZGL 2E75C 1K2DB 4ODUB 5IT2H 3B9EA 1U3HA 3P0YH 1X5MA 3IDUA 5CEZL 1OALA 2X3AA 3T2QA 4X6BA 3KW7A 4QLRA 4LBEB 3WE6B 3IGKA 3C2SA 3QJXA 4MB5A 4YOKA 2BNQA 4C83B 5BV7C 4L5FL 4CBZA 3C09B 4LPTA 2ATPB 1M7DA 7FABH 2H0JA 2P94L 1DQMH 3HTLX 5BO1H 1CIUA 2CAKA 4DZBB 5I1AB 5D96B 3KJ6L 4HEPA 3EO1B 1CL7H 3BSZA 2BVTA 4OGAD 3FHEA 5BZWA 3QDJB 4OIIH 3QH0A 3BN9C 4OGXH 5F96H 5IEKA 5IVZB 4PG9B 2HT2D 4H8WC 1FSKC 3MRPA 1H3PL 1T0OA 3DGCR 1XF3A 1FNFA 2JFCA 4ZMWA 2VCOA 1ZSDA 5HYJA 2EEAA 3SDDA 5LHDA 5CJBA 4MQTB 1A22B 5GS2D 3ULSA 3ZIYA 1WZAA 1VGEH 5EIIA 1PZ5B 2PN5A 5CUSL 2DWYA 3HZYA 3MUZ1 4HX1B 4CVZA 5IREA 3ARDA 1HKLH 1JK9B 3D2UD 3FQXA 5DR5L 2UZPA 1P0SL 1L9OA 4EN2A 1W6LA 4Q6IA 3PHQA 1DANU 3GTVA 3U4AA 4I2XE 4ODTH 5D4JA 5BRPA 4U1HA 1E4XI 4JQIL 2J2ZA 3E9UA 1AGBA 3MLZH 3KYAA 3OKKB 1T1ZB 3MV7B 3P77B 4W93A 4WO4B 1KXQE 5HBBA 4OQTL 4AM0Q 3TWYA 3SJVE 1DO5A 1ZVHA 3FOLA 3QIBA 2F7PA 2K6ZA 4PJ7B 2E74C 1CXFA 4G8EB 2GITA 4FKHA 1B4JL 3ARED 4UDTB 1GHFH 2AJZA 4LVNC 2O61B 1E5UI 2PR4L 4ORGB 2W0PA 4NWTL 4QOKE 4E41B 3QZPA 3IDJB 2G9HB 2Z92A 3RIKA 1MLCA 3N42F 1ICTA 2Q1EA 1S4IA 4M8RA 1O6TA 5IKQA 1KLOA 1SDAB 3AU1A 1BP3B 3GTNA 1L7TH 2BVOA 3JVGA 3LVEA 4GQZA 3WO4B 3HRPA 1QIUA 5AWNL 4AT6B 2GD4A 3GMOA 3S98A 1PKQB 4LOUC 4E36A 3OC5A 4XNQB 3OHXB 3WGVB 3SE9H 3GSWA 3OWRA 4KWUA 3K1KC 2O72A 5JIKA 1UZPA 1MFVA 4M3JA 5MEQB 2OW6A 3WFCH 2BZ6L 1I1CA 4PJBA 1ND0A 4HS3A 2QLYA 3HA0A 1DUZA 3HI5L 1KB5L 4FLQA 1ZTXH 3HS0B 2NY4C 3F85A 1JPST 4YHYB 5C8JB 3ZL4H 6FABH 3PL6D 4KXZH 2GTWA 3U4KA 2YR3A 5HVHC 2IFGA 3UPCA 4NN7B 1LWRA 3VXSA 3I9PA 1KT2B 1EH9A 2J8UE 1I3VA 1WFJA 5JPNB 3BLBA 4IRSA 1LVEA 1UA6H 1W9XA 3U1PA 1MW1A 1XCTB 3DUUB 4JVPA 3U2IA 3K0WA 1A3LL 5L7XH 3S5LA 2EI8B 4FXGB 4FEIA 3TT1L 5D7JD 3GXIA 1EA9C 4ZFOA 3HE7C 5BCAA 5HDBF 3CVIL 4NFBA 4ELMB 5DFVC 5IB5B 1CO1A 3L3OC 2ZAIA 2QSCH 2DLTA 2YRLA 3CDYA 4GBXB 1N0LB 1LP9A 1PMYA 4LCWB 2G5BB 4E9LA 3APMA 4ZOCA 2GEQA 4YBLC 2WBWB 2B59B 2BINA 3TJEL 3LN4B 2VXQH 1YYCA 2NTFB 4ERSH 1SXBA 1A0QL 2AJUL 1SBSL 2V9TA 5ETUA 2HXAA 3MXWL 4HUXB 3IU4L 5HPMA 2XV0A 3EJJX 3WTTA 5GQBA 3QI9A 2C4XA 3WIIH 2AC0A 4G43A 1X44A 4FQIH 2CALA 1E5BA 5I8KL 5DMIH 3BKCH 4POZC 3MO1B 5JXAH 3UDWA 5H94A 5LWYL 1U8HB 3KVQA 5AW1B 3WTWA 2M83A 2JELL 3BYTA 3J8F7 1X5GA 2ZWYA 1JDAA 4KK6C 3FO0L 4PJHA 4AUJA 3FPXA 1I8UA 1M71B 3KPOA 1SHWA 2AQQA 4ZODA 3VQMA 4QNPE 3GT6A 4NRZB 3NP4A 4P0DA 4XXDA 1JBUL 4WTWA 3QZOA 5IKCB 2EDRA 4GLRH 2IGFL 3LD8B 3ELQA 4A7QA 3KYNA 3KXFD 3DUSB 4WNQB 2VN6A 2UZIL 4BKLB 4FJZA 4UQEA 3HIZA 5HHQB 1AANA 4ZUVB 2QGBA 4JUSA 5HXMA 5K9QG 1NCNA 1NCHA 1Q8MA 3NOIA 4X4KA 2A6IA 2D31A 3KQEL 1CZ8L 3L5JA 4LP5A 4PFEA 4NKQB 2WUCH 4ISVB 3CFNA 1A14L 4C4BA 2YKLL 4Z6AT 2DM3A 2DWDA 4QTIH 5DZVA 1H6UA 1OTUD 4UZGA 3U36B 3WKYA 4X6DB 4OVUA 3RVXC 3FSOA 3AY4A 3E6HB 3N55A 2COVD 2ZXAA 4MXWL 4XCFH 5ICYB 1U91B 4N90D 3I3BA 3AG3B 1JWSA 4PRPD 4YNYA 1UD4A 3MUJA 4XXWA 1ZLVH 2V3FA 2FLMA 3LB6C 5FYLL 4OCYL 3FB8A 4DT2A 3KBPA 4NZTH 4BFFA 3TASA 1DFXA 2HP4A 3KPLA 4KVCL 1L3YA 3EOAA 4RMSA 1KIQA 3GSVA 2QTEA 1OTTC 4XPHL 3QJOA 3QO1A 3LCYA 3QUYA 3KPSE 3TNMB 3O8XA 3C5SA 1D6VL 5K59E 2BOBB 3DJZA 5E8NB 2ZX7A 1MJ7L 4TSCH 3KWWA 3T4AB 3TT3L 4A7IA 1VFOA 5A2JH 1TEYA 1HTYA 1M57B 4P4KD 3UABA 4BDVA 2NR6D 3N40F 2X9ZA 2WIMA 4U49A 3TM6A 4Y9FA 5CEZE 2M26A 3DGGB 4MMZB 2Q0ZX 4M43L 4KXAA 4ZOAA 1Z5LB 2I60L 3UAJA 5B3JE 3O6KL 3TEYA 4YWGH 5ABAA 3BGAA 4R5XA 3T1FA 2D3LA 3FH8A 4PB9H 3ABKB 2IAMC 4JN1L 4D0FA 3FUMA 4YIQB 5GGRA 4WLCA 2VNCA 2X4PA 4RGNB 3CFMA 2WZAA 3OXSB 5DU7A 2GJJA 3LKNB 2WQAA 2XWCA 4KQ0A 2GFBA 2R39A 4N2IA 2HLAA 4MAYB 4JANA 2XC0L 3BPNC 2E3VA 4U6TA 2Y5TB 5EWIL 1FHNA 1Z2KA 1A1MA 4Y2LA 5BOZG 5JB9E 4ELKA 1VEMA 1UA7A 2RA1A 4WU5A 4R7DA 1Y7VA 5AUMB 1MEXL 1ZD6A 1XIWB 2EKJA 4JKMA 4DKEL 3P9MA 5ALCL 2VR8A 1HESA 4PTTB 4IU2B 5E2UL 3IXTA 5FB8A 4YSPA 1OHZA 3MBWB 4F7KA 1RUPL 1SYVB 4APQD 3BI9X 2EXWD 4GSDH 4HKZB 2C7UB 2BOXA 2JI2A 4G70B 5I19H 2N56A 1N6QL 5FYJL 2ZNWA 4OJAA 4KTEH 5INCA 2P5WD 1HYRC 1HQ4B 1PLCA 1SDDB 2IAND 3ZXAC 3D0VA 2EIZA 4QRAA 5TE4H 2R69L 4J3OD 4Y79B 2NX5B 1TVBA 3REWA 4TNFA 4OD3H 4Y4FB 4UUJA 3KLAA 1OPOA 3GIVB 1JYNA 2NY1D 3NSXA 4HD9A 4WGVB 1BZ9B 1D3CA 3T65A 3QDAA 1KGJA 4GUPA 5HYSB 3SDCA 5HYEA 4JFXB 4YR6B 1HINH 2JTDA 4EJ1C 5CFAA 1DQLL 2IH3A 3ENEA 2R0ZL 3FFCE 1PBYA 5B3NA 4TLKA 1RZFH 1MCIA 4HSQA 2HH0H 5C09B 3CZEA 1ZA6A 1NFWB 1JIBA 4AG4L 3OV6A 3BRGC 2IQ9H 4ZUSB 5LCVH 3GLZA 3P4MB 1UWGH 5F7BA 1JZJA 4HS6A 3QCTH 1K8IA 3BWUF 3FO1A 4MMYA 3FRPB 1AR2A 1SPDA 2HJKA 3GMPB 2E56A 4KH2A 1UB6B 1AQKH 1JZ6A 3G5VB 1BLIA 3NQKA 4K7PY 2ITDA 3QFGA 3O3UN 5B39A 1J1PL 4NQDB 1LK2A 2X53A 1HAWA 1FL5A 3MBEA 1HEHC 3G6AB 4FKKA 2UX7A 3SY0B 2CDFA 5I5JA 3UPRB 4K5MA 5I30H 4Z7UE 1YQVL 1J11A 4HK3N 4YK4C 3LS4L 5SX5K 4NQXA 1KY7A 1UUNA 3O6LL 1ACCA 2ZX6A 4Y5XC 1V55B 5EBMA 1YMME 3FN0H 4AZ8B 4ANWA 4F15B 2KV4A 4PJXB 2OSYA 3F05A 5IB1A 4YDJA 1R24B 2XPGA 3G6JA 3H1ZA 4RIRB 3NJFA 2X28A 1R3IL 2Q9OA 3QA3B 4ZW6A 4BSWA 4UQDA 4HULB 5KSBA 4X9BA 1SXCA 2E7DA 1R0AL 3KL5A 3PPEA 3VA2C 1XBRA 4D2NA 3U30B 3GMRB 5EBLA 4QRRA 1URKA 5ANMA 3CSYB 4QRUA 4JZJB 1YEGH 3TZVD 1PAZA 2C1PB 2VWEC 4LSVH 4WZ9A 1KCVH 2NY2B 1LD9B 1LO3H 4WWNA 3ECVA 4FQQB 5F6HI 1VF5C 1ATBA 2D2CC 2Z65C 3Q43A 4JJ5A 3RWCB 5JOPD 2NY0C 1UWEL 3APCA 2WPIE 3BP6B 3HAEA 4EN3A 4D0DA 2V0AA 3DOHA 1C16A 3W56A 1HL4A 1LK9A 3D3VB 4HOXA 1KJ2B 1CCVA 2EE9A 1GCFA 3PFQA 4FQ2H 1ID2A 3BAKA 2GUOA 3QG6B 5I5IA 1XGUA 2HJFA 1KUMA 4LKCA 4XAKD 4M5TA 5EUKA 2YA1A 3JT2A 4XWOC 3D2UA 1BZOA 4IRJC 2Y3AA 2C9QA 1PZ2A 2VLME 5DHMC 3BP7A 3FCSA 4MJ6B 5LBGA 2Q7AA 1I8AA 3GNMH 4GKSA 3ULUF 1QSFD 1NWOA 1YEEH 4KDWA 3V8CA 3TF4A 2NXYC 4OLXL 2HMIC 4G80A 2VM3A 1COUA 4OCWH 2VITB 1P7QB 4PN6A 4ZX4A 2ZCHH 4YDKL 3VYOA 3O41A 3BGFB 3IN2A 2F8IA 4GNKB 4Y16A 1XR9A 2OL3L 1T0NA 5DQDL 1FZJA 2B1HH 4GMSH 1Q0XH 1RURL 2F58L 3PHSA 3VXNB 5F1IB 2QPFA 1EHXA 2FGZA 4ELDA 3DX2A 4O9HH 2AEOA 2A4EA 3IDIA 3ZE1F 2J6WA 1ZLWK 5FO9B 2X6BA 3PWPD 2ZAHA 3E2HB 2BK8A 1CR9L 1FC1A 2V8LA 2BOCB 1MCPL 1J8SA 1FNEB 1U8MA 3ZGHA 1RLWA 5EA0L 4LF3A 1FJ1A 1AJ7H 3QARA 2VDMB 5FYLE 4AVIA 5D5MF 2WD0A 5EU3A 4HCRA 3TWCH 4Y9GA 5DC0A 1QNZH 3P73B 1A3QA 3O4LD 1A64A 3CVDA 5F44A 4QXTB 4Z3GA 4KRMB 4QF1B 4RX4D 3U0TA 5HHPB 4Z7WB 1OP9A 4MA8L 2GT9A 5E2JA 3PV6B 4ZFZB 2B4CL 4FM5A 3QQ3A 3F58L 3W9DB 1YYLH 4PHXA 4AENA 3R0NA 4HS8H 4ZYKB 3RGVD 4G6JH 4RRPA 3PG2A 1KBWA 1OGTB 3D30A 5DZNA 2RQEA 5FUZH 4A63A 1CURA 3SPVB 4Z1PA 5GRXG 1KGCE 2F6AA 4MQXC 1UURA 2DD8L 4HU8A 2D73A 4WEUD 1DEDA 3FT3B 5E1AA 3L3GB 2NY7H 3HS6A 1HNYA 3LY6A 4KQ4L 5L8KB 4OZFG 4XI5C 1DBKH 1NFIA 1MLBA 3TN0C 3QS3A 32C2A 3MC0A 3UC0H 2Y1YA 2WK2A 5IJKC 3GMLA 1FYHB 1YPZA 2ZF8A 3N8WA 3VFNB 2AABL 4NLAA 1KFAL 5JOFA 2NXZC 3IS0X 4Y2DD 4TPRH 4B3VA 1K9TA 4JQVA 4H7VA 2OK0H 1FZMA 2P93L 2P8LA 3ENSA 5IQLA 5ITBL 2HVKA 4PJAE 4WFEE 4WK4B 4DZ8B 1B0GB 2YBGA 5KEZA 2EZ0D 4NQEB 2R29H 4CSPA 3TIDA 1BQSA 3EFOA 2E9WA 3AAZB 3Q01A 3KL0A 3KHOA 3LPGA 1OB1C 4L8SC 3WD5H 4GRWB 4PJCE 4OLVH 1X9RA 1YA5A 1QA9B 4NZRH 3QPXL 3MRKB 3OJDB 3T1WA 1EHNA 5FYJE 4F2FA 3VFVB 3QXTA 1TPXB 2J72A 2BVUA 1M05A 3KXFA 4LCUA 5IFAH 3SBWC 1UOWA 1UZ8A 1NMBH 3C9NA 4LDCA 3X14A 1V7NL 2CE6A 1WEJL 2FLRL 3RJQB 1DL7L 3ARFB 3N2JA 5E94A 4YAQB 4Q9QH 3AWFA 2NY6D 1CFNB 4YSUA 3ZQXA 2H6PA 1EPGA 3EYFA 3QORD 1KJVA 5DRWB 3C6SA 3VXTB 4GAJL 1VA9A 4WSGA 2YXFA 3FFGL 4F9LC 3SDAD 2VJXA 1NFDE 5IROD 4K0OA 1PX8A 2FECL 3F7YA 4OM1H 5DZOA 4X4MA 5I76B 2Z0BA 3BW9A 2YRZA 1EO5A 4ODVH 2AXJA 3DRTA 3NDYE 3GLEA 2BZDA 2DJMA 3A67L 4L1TA 2R2HB 5M7QA 4NJAH 1LO0L 2BMGA 3H3PL 4PRPA 4F7CB 4XHJC 2HT3C 1PLGL 2VYRE 4JFQA 4DGVL 2OTWB 2P80D 2VZTA 1XWVA 5I1HL 1WUZA 2EIEA 3GSOA 1HH9B 5AVRB 1WZKA 2X41A 4LT7A 3VAEA 2ZCKL 1NIDA 4G82A 1KEGH 3QFDB 3G6JF 3MRRA 1OW0C 5GZOA 5IZ7A 1P7HL 4OJEH 4CDHA 4XE0A 1UG9A 1RFNB 2CDEB 3N40P 3IRZA 3KAAA 1A9VA 2CU9A 2CHXA 5I0YA 1XVSA 5F9WC 3GZKA 5AYUH 3MZGB 5EC2A 4PGDB 1HN1A 3RBSA 3T3MF 1DJSA 3MRLB 3L5WB 4JFDB 4NQSA 4G8GE 4H8QA 1T04B 5GGSB 4DIXA 2I27N 4YL9A 1A5FL 3QB7C 4NDMA 4P4KA 5A1AA 1SGKA 3FQWA 4NNXA 4QT5A 3KCPB 4X7DC 2CRZA 4BHUA 3IK2A 2J71A 3OJVC 2BMKA 4G5AA 2IWEA 5CJ5A 3BPOB 5DYOB 5I1IH 3VFWA 2OTUA 1M2VB 3DURB 3WMSA 3QH3A 1BQRA 3ARGC 2NLJB 5C2UB 3N50A 1IGIH 4JFYB 4LORA 3MRHB 4PS7A 2BNUB 4X98B 2C4FU 2X6AA 1TCRA 5E2VL 1BVKB 1PEWA 4HV8B 5DUML 1EFXB 3MRQB 3TPUA 3ZDYE 1YEDB 3CWGA 5GXBB 1BLNB 2W07A 1YNKL 2G75A 4O5LL 2L4OA 3EJPA 5HY9B 3O2WH 2DKSA 3MLWL 5E1GA 4PY7A 4O2CA 3EGSB 3MJ9A 4JCWA 4XVTH 5DK2B 5DZLA 5IW6A 1DQBA 4PW9A 4O51B 5FPIA 2VSMB 2QJDA 2QADB 3FF8A 2VDNH 5IHUH 5C0GA 1F90H 4LEXL 4N5EC 3WS6C 3CMOL 5JHLL 2VWNL 2W95A 3Q3GB 3QUKA 3VB8A 2G30A 2R7EA 4P46D 4PIBA 4Y9CA 2WVUA 2R8SH 3EZ8A 3ECWA 4PSRA 3LQAL 3UO1L 1ADQH 4APQA 5I46L 2ZF9A 2WP3O 3HG1D 4AQ1B 3C6LD 2YSSB 2GBVA 1CBVH 4AYGA 1R34A 3BPSE