1PFXL

Porcine factor ixa
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
146
structure length
133
Chain Sequence
YNSGKLFVRGNLRCIKCSFARVFNTKTNFWKQYVDGDQCEPNPCLNGGLCKDINSYECWCQVGFEGKNCELDATCNIKNGRCKQFCKTGADSKVLCSCTTGYRLAPDQKSCKPAVPFPCGRVSVSHSPTTLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of clotting factor IXa: active site and module structure related to Xase activity and hemophilia B.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords FACTOR IXA
total genus 22
structure length 133
sequence length 146
ec nomenclature ec 3.4.21.22: Coagulation factor IXa.
pdb deposition date 1995-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
L PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1pfxL02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1pfxL03
4.10.740.10 Few Secondary Structures Irregular Coagulation Factor IX Coagulation Factor IX 1pfxL01
2M74A 5IKVA 1Q4GA 1XKBA 2I9AA 1UZPA 1PXXA 2BO2A 3V64C 4RS0A 1CCVA 4JYUL 4MMYB 2BOUA 1NFUB 3CS7L 4Y71B 3LC5B 3KCGL 3SOVA 3IITB 3H5CB 5K0HB 2UWLB 2W2ME 3DEMA 2G00L 2PHBB 3C9AC 3Q7DA 3KQCL 4CSYA 1F0SB 5JVYA 3HPTA 2WG3C 4XL1A 4RRZA 3FCSB 1HREA 3ASIA 2PR3B 2J2UB 5IKQA 2Y5FL 3HS6A 3R05A 1NFYB 2P26A 2KV4A 3KQDL 2W3IB 1LPGA 1IQGL 4ISHL 2UWOB 2Y5GL 2FZZL 1W8BL 1IQHL 2P3UA 4XLWA 1EAIC 6COXA 1WHEA 2NPRA 1L5GB 2MGRA 3LTGD 3NJPC 1BF9A 2CJIB 2GD4A 3M37L 1ATDA 1RFNB 1G1RA 3GCWE 1B9WA 2P3FL 5JB8E 3KQEL 1K36A 4ZH8B 1PRHA 3EGFA 5JW1A 2YGOA 3ELAL 1U8CB 1U67A 1HT8A 1APQA 5I46L 4BXWA 3F6UL 1AUTL 2MGPA 1LQDA 2Y5HL 3NTBA 3MQEA 3CENL 3NTGA 2F9BL 1IGXA 3HS7A 4RRYA 4X8SL 1HX2A 2WPLE 5JBBE 3P5BL 4A7IA 5E8DA 2XBYL 1IJQA 2RA0L 3FBYA 2DDUA 1YUFA 1G1TA 1EPGA 2J95B 4Y6DB 5KIRA 2VWMK 1FJSL 2BQWA 4E1GA 1KSNB 3ZYIB 2MHPA 2P3FN 5COXA 5FDQA 4BTUA 1EPJA 2VWNL 4BDWA 1KLOA 2XBVL 2K2TA 1UZJA 1IQEL 3ZYGA 4Y7BB 1DVAL 2K2SB 4RRWA 1CVUA 2H9EL 4M11A 1UZKA 1G1QA 1J9CL 3MDLA 1EMNA 3KQBL 1CCFA 3NT1A 5JB9E 1HT5A 1F7MA 4LORA 1IQKL 1Z6EL 3LN1A 3Q3KB 1ZAQA 1NFWB 1XDTR 3N8VA 3SOBB 3QH0A 3CFWA 3N8YA 1OB1C 3CA7A 1GK5A 2J38B 1SZBA 4COXA 3HO3A 1F0RB 2OYEP 1HAFA 2FLBL 3SOQA 1KIGL 5IKTA 4MMXB 3GCXE 4C16A 2Y82B 1G1SA 2W2PE 4ZAEB 1W7XL 2PUQL 2Y7XB 4G1MB 1JV2B 4YZUB 4JZFL 1CVWL 2WFTA 5KN5C 4YT6L 2XBXL 1UZQA 3BT1A 5JVZA 2BOKL 1EQHA 4ISIL 5F19A 3SW2A 1FF7A 2BQ7A 2P95L 1NQLB 1P0SL 2XC5L 2VVVL 2WPKE 4NG9L 1JBUL 1MQ5L 4CUEA 5L30L 3POYA 3LC3B 1EPIA 4O02B 1CEJA 4O1ZA 1JL9A 2WPIE 2WG4B 1ADXA 2WPHE 1I0UA 2XBWL 1LPKA 3KRKA 1HJ7A 2VWLL 3QCWA 1IOXA 1ATAA 1EZQB 1HAEA 2XC4L 1X7AL 3LAQA 1WHFA 4RUTA 4ZHAB 4M10A 2UWPB 4Y7AB 2ADXA 2P28B 5L2YL 1TPGA 2FLGA 2OYUP 1IQIL 2WYGB 4AQTA 1EBVA 2J4IB 1EQGA 1YUGA 3N8ZA 1K37A 5F1AA 3ENSA 1IOEL 1CX2A 2YGPA 2BMGA 1LMJA 2EI7B 4JZEL 1PTHA 2FLRL 3N8XA 2Y81B 1YO8A 2W2NE 2Y38A 3N8WA 3LN0A 2JKHL 1IQJL 3LIWB 3TGFA 1P9JA 2WFXB 4D90A 3RR3A 2P3TA 3N8WB 2WPME 1F7EA 2VVCK 2BZ6L 1FFMA 4MMZB 1PFXL 1LPZA 2J94B 3ZYJB 4ZXYL 1N1IA 2W2QE 4OTYA 1FAKL 1YUKB 3FFGL 1CQEA 1XKAL 2Y80B 2W3KB 1WU1B 1FE2A 2FD6A 1EGFA 2RHPA 4OTJA 1FAXL 2B7DL 2W26B 2KB9A 1M1XB 3U7UG 2P16L 4NGAL 2VH0B 3TH3L 1COUA 2J34B 3OLTA 1ATBA 2VVUL 2WPJE 3IJEB 1KLJL 1KLIL 2KL7A 1DX5I 5IKRA 2VJ3A 5JBAE 1NT0A 2BOXA 5CKQA 3TBDA 1G2LB 3BPSE 1MOXC 4X8UL 2TGFA 3M36L 1C5MF 5CKMA 1HCGB 2Y7ZB 4BTTA 4JYVL 1NFXB 3GISX 2P93L 4X8TL 5JBCE 3K9XA 5EGMB 2RNLA 3KL6B 4D0FA 1A3PA 2EI8B 1Z6CA 2VH6B 1IVOC 1HRFA 4RRXA 3HO5A 4ZXXL 1DIYA 2P94L 4XBMA 4FM5A 2I9BA 1HZ8A 4Z0LA 1G2MB 2W2OE 1MQ6L 2WYJB 1YGCL 1IQFL 4JZDL 3KK6A 3PGHA 1APOA 1DDXA 3N8YB 1O5DL 2XC0L 1IQML 2EI6B 1EPHA 4YT7L 4LMFA 4BXSA 1CFHA 2W86A 1XFEA 3F1SB 3QMOA 1DQBA 1ATEA 1IQLL 1EMOA 3HS5A 2D1JB 3LTFB 1TLEA 1TOZA 3TK6B 3OLUA 4Z0KB 4D0EA 4NA9L 1FSBA 2VWOL 2BOHA 4BTIA 4Y76B 5CISA 1URKA 4Y79B 1QFKL 4BDXA 5L2ZL 1L3YA 3HO4A 4X8VL 3TK5B 4CUFA 1V3XB 2AYLA 1IQNL 1N7DA 4TGFA 2BQ6A 4CUDA 1IGZA 4PH9A 3U73A 1NZIA 1IP0A 3BT2A 1PGEA 3V65B 1NPEB 3TZIA 5CKNA 4Z6AL 2Q1JB
chains in the Genus database with same CATH superfamily
2M74A 5IKVA 1Q4GA 1XKBA 2I9AA 1UZPA 1PXXA 4A94C 2YGQA 2BO2A 3V64C 4RS0A 1CCVA 4JYUL 4MMYB 2BOUA 1NFUB 3CS7L 4Y71B 3LC5B 3KCGL 3SOVA 3IITB 3H5CB 5K0HB 2UWLB 2W2ME 3DEMA 2G00L 2PHBB 3C9AC 3Q7DA 3KQCL 4CSYA 1F0SB 5JVYA 3HPTA 2WG3C 4XL1A 4RRZA 4GU3A 3FCSB 1HREA 3ASIA 2PR3B 2J2UB 5IKQA 2Y5FL 3HS6A 2KNIA 3R05A 1NFYB 2P26A 2KV4A 3KQDL 2W3IB 1LPGA 1IQGL 4ISHL 2Y5GL 2UWOB 2FZZL 1W8BL 1IQHL 2P3UA 4XLWA 1EAIC 6COXA 1LMMA 1WHEA 2NPRA 1L5GB 2MGRA 3LTGD 3NJPC 1BF9A 2CJIB 2GD4A 3M37L 1ATDA 1RFNB 1G1RA 3GCWE 1B9WA 2P3FL 5JB8E 3KQEL 1K36A 4ZH8B 1PRHA 3EGFA 5JW1A 2YGOA 3ELAL 4GU4A 1U8CB 1U67A 1HT8A 1APQA 5I46L 4BXWA 3F6UL 1AUTL 2MGPA 1LQDA 2Y5HL 3NTBA 3MQEA 3CENL 3NTGA 2F9BL 1IGXA 3HS7A 4RRYA 4X8SL 1HX2A 2WPLE 5JBBE 3P5BL 4A7IA 5E8DA 2XBYL 1IJQA 2RA0L 3FBYA 2DDUA 1YUFA 1G1TA 1EPGA 1LK9A 2J95B 4Y6DB 5KIRA 2VWMK 1FJSL 2BQWA 4E1GA 1KSNB 3ZYIB 2MHPA 2P3FN 5COXA 5FDQA 4BTUA 1EPJA 2VWNL 4BDWA 1KLOA 2XBVL 2K2TA 1UZJA 1IQEL 3ZYGA 4Y7BB 1DVAL 2K2SB 4RRWA 1CVUA 1V1IA 2H9EL 4M11A 1UZKA 1G1QA 1J9CL 3MDLA 1EMNA 3KQBL 1CCFA 3NT1A 5JB9E 1HT5A 2JJLA 1F7MA 4LORA 1IQKL 1Z6EL 3LN1A 3Q3KB 1ZAQA 2HORA 1NFWB 1XDTR 3N8VA 3SOBB 3QH0A 3CFWA 3N8YA 1OB1C 3CA7A 1GK5A 2J38B 1SZBA 4COXA 3HO3A 1F0RB 2OYEP 1HAFA 2FLBL 3SOQA 1KIGL 5IKTA 4MMXB 3GCXE 4C16A 2Y82B 1G1SA 2W2PE 4ZAEB 1W7XL 2PUQL 2HOXA 2Y7XB 4G1MB 1JV2B 4YZUB 4JZFL 1CVWL 2WFTA 5KN5C 4YT6L 2XBXL 1UZQA 3BT1A 5JVZA 2BOKL 1EQHA 4ISIL 5F19A 3SW2A 1FF7A 2BQ7A 2P95L 1NQLB 1P0SL 2XC5L 2VVVL 2WPKE 4NG9L 2BT7A 1JBUL 1MQ5L 4CUEA 5L30L 3POYA 3LC3B 1EPIA 4O02B 1CEJA 4O1ZA 1JL9A 2WPIE 2WG4B 1ADXA 2WPHE 1I0UA 2XBWL 1LPKA 3KRKA 1HJ7A 2VWLL 3QCWA 1IOXA 1ATAA 1EZQB 1HAEA 2XC4L 1X7AL 3LAQA 1WHFA 4RUTA 4ZHAB 4M10A 2UWPB 4Y7AB 2ADXA 2P28B 5L2YL 1TPGA 2FLGA 2OYUP 1IQIL 2WYGB 4AQTA 1EBVA 2J4IB 1EQGA 1YUGA 3N8ZA 1K37A 5F1AA 3ENSA 1IOEL 1CX2A 2YGPA 2BMGA 1LMJA 2EI7B 4JZEL 1PTHA 2FLRL 3N8XA 2Y81B 1YO8A 2W2NE 2Y38A 3N8WA 3LN0A 2JKHL 1IQJL 3LIWB 3TGFA 1P9JA 2BSFA 2WFXB 4D90A 3RR3A 2P3TA 3N8WB 2WPME 1F7EA 2VVCK 2BZ6L 1FFMA 4MMZB 1PFXL 1LPZA 2J94B 3ZYJB 4ZXYL 1N1IA 2W2QE 4OTYA 1FAKL 1YUKB 3FFGL 1CQEA 1XKAL 2Y80B 2W3KB 1WU1B 1FE2A 2FD6A 1EGFA 2RHPA 4OTJA 1FAXL 2B7DL 2W26B 2KB9A 1M1XB 3U7UG 3S6XA 2P16L 4NGAL 2VH0B 3TH3L 1COUA 2J34B 3OLTA 1ATBA 2VVUL 2WPJE 3IJEB 1KLJL 1KLIL 2KL7A 1DX5I 5IKRA 2VJ3A 5JBAE 1NT0A 2BOXA 5CKQA 3TBDA 1G2LB 3BPSE 1MOXC 4X8UL 2TGFA 3M36L 1C5MF 5CKMA 1HCGB 2Y7ZB 4BTTA 4JYVL 1NFXB 3GISX 2P93L 4X8TL 5JBCE 3K9XA 5EGMB 2RNLA 3KL6B 4D0FA 1A3PA 2EI8B 1Z6CA 2VH6B 1IVOC 1V1HA 2VRSA 1HRFA 4RRXA 3HO5A 4ZXXL 1DIYA 2P94L 4XBMA 4FM5A 2I9BA 1HZ8A 4Z0LA 1G2MB 2W2OE 1MQ6L 2WYJB 1YGCL 2WZPP 1IQFL 4JZDL 3KK6A 3PGHA 1APOA 1DDXA 3N8YB 1O5DL 2XC0L 1IQML 2EI6B 1EPHA 4YT7L 4LMFA 4BXSA 1CFHA 2BT8A 2W86A 1XFEA 2H9EC 3F1SB 3QMOA 1DQBA 1ATEA 1IQLL 1EMOA 3HS5A 2D1JB 3LTFB 1TLEA 1TOZA 3TK6B 3OLUA 4Z0KB 4D0EA 4NA9L 1FSBA 2VWOL 2BOHA 4BTIA 4Y76B 5CISA 1URKA 4Y79B 1QFKL 4BDXA 5L2ZL 1L3YA 3HO4A 4X8VL 3TK5B 4CUFA 1V3XB 2AYLA 1IQNL 1N7DA 4TGFA 2BQ6A 4CUDA 1IGZA 4PH9A 3U73A 1NZIA 1IP0A 3BT2A 1PGEA 3V65B 1QIUA 1NPEB 3TZIA 5CKNA 4Z6AL 1KKEA 2Q1JB
chains in the Genus database with same CATH topology
2M74A 5IKVA 1Q4GA 1XKBA 2I9AA 1UZPA 1PXXA 4A94C 2YGQA 2BO2A 3V64C 4RS0A 1CCVA 4JYUL 4MMYB 2BOUA 1NFUB 3CS7L 4Y71B 3LC5B 3KCGL 3SOVA 3IITB 3H5CB 5K0HB 2UWLB 2W2ME 3DEMA 2G00L 2PHBB 3C9AC 3Q7DA 3KQCL 4CSYA 1F0SB 5JVYA 3HPTA 2WG3C 4XL1A 4RRZA 3FCSB 1HREA 3ASIA 2PR3B 2J2UB 5IKQA 2Y5FL 3HS6A 2KNIA 3R05A 1NFYB 2P26A 2KV4A 3KQDL 2W3IB 1LPGA 1IQGL 4ISHL 2UWOB 2Y5GL 2FZZL 1W8BL 1IQHL 2P3UA 4XLWA 1EAIC 6COXA 1LMMA 1WHEA 2NPRA 1L5GB 2MGRA 3LTGD 3NJPC 1BF9A 2CJIB 2GD4A 3M37L 1ATDA 1RFNB 1G1RA 3GCWE 1B9WA 2P3FL 5JB8E 3KQEL 1K36A 4ZH8B 1PRHA 3EGFA 5JW1A 2YGOA 3ELAL 1U8CB 1U67A 1HT8A 1APQA 5I46L 4BXWA 3F6UL 1AUTL 2MGPA 1LQDA 2Y5HL 3NTBA 3MQEA 3CENL 3NTGA 2F9BL 1IGXA 3HS7A 4RRYA 4X8SL 1HX2A 2WPLE 5JBBE 3P5BL 4A7IA 5E8DA 2XBYL 1IJQA 2RA0L 3FBYA 2DDUA 1YUFA 1G1TA 1EPGA 2J95B 4Y6DB 5KIRA 2VWMK 1FJSL 2BQWA 4E1GA 1KSNB 3ZYIB 2MHPA 2P3FN 5COXA 5FDQA 4BTUA 1EPJA 2VWNL 4BDWA 1KLOA 2XBVL 2K2TA 1UZJA 1IQEL 3ZYGA 4Y7BB 1DVAL 2K2SB 4RRWA 1CVUA 2H9EL 4M11A 1UZKA 1G1QA 1J9CL 3MDLA 1EMNA 3KQBL 1CCFA 3NT1A 5JB9E 1HT5A 1F7MA 4LORA 1IQKL 1Z6EL 3LN1A 3Q3KB 1ZAQA 1NFWB 1XDTR 3N8VA 3SOBB 3QH0A 3CFWA 3N8YA 1OB1C 3CA7A 1GK5A 2J38B 1SZBA 4COXA 3HO3A 1F0RB 2OYEP 1HAFA 2FLBL 3SOQA 1KIGL 5IKTA 4MMXB 3GCXE 4C16A 2Y82B 1G1SA 2W2PE 4ZAEB 1W7XL 2PUQL 2Y7XB 4G1MB 1JV2B 4YZUB 4JZFL 1CVWL 2WFTA 5KN5C 4YT6L 2XBXL 1UZQA 3BT1A 5JVZA 2BOKL 1EQHA 4ISIL 5F19A 3SW2A 1FF7A 2BQ7A 2P95L 1NQLB 1P0SL 2XC5L 2VVVL 2WPKE 4NG9L 1JBUL 1MQ5L 4CUEA 5L30L 3POYA 3LC3B 1EPIA 4O02B 1CEJA 4O1ZA 1JL9A 2WPIE 2WG4B 1ADXA 2WPHE 1I0UA 2XBWL 1LPKA 3KRKA 1HJ7A 2VWLL 3QCWA 1IOXA 1ATAA 1EZQB 1HAEA 2XC4L 1X7AL 3LAQA 1WHFA 4RUTA 4ZHAB 4M10A 2UWPB 4Y7AB 2ADXA 2P28B 5L2YL 1TPGA 2FLGA 2OYUP 1IQIL 2WYGB 4AQTA 1EBVA 2J4IB 1EQGA 1YUGA 3N8ZA 1K37A 5F1AA 3ENSA 1IOEL 1CX2A 2YGPA 2BMGA 1LMJA 2EI7B 4JZEL 1PTHA 2FLRL 3N8XA 2Y81B 1YO8A 2W2NE 2Y38A 3N8WA 3LN0A 2JKHL 1IQJL 3LIWB 3TGFA 1P9JA 2WFXB 4D90A 3RR3A 2P3TA 3N8WB 2WPME 1F7EA 2VVCK 2BZ6L 1FFMA 4MMZB 1PFXL 1LPZA 2J94B 3ZYJB 4ZXYL 1N1IA 2W2QE 4OTYA 1FAKL 1YUKB 3FFGL 1CQEA 1XKAL 2Y80B 2W3KB 1WU1B 1FE2A 2FD6A 1EGFA 2RHPA 4OTJA 1FAXL 2B7DL 2W26B 2KB9A 1M1XB 3U7UG 3S6XA 2P16L 4NGAL 2VH0B 3TH3L 1COUA 2J34B 3OLTA 1ATBA 2VVUL 2WPJE 3IJEB 1KLJL 1KLIL 2KL7A 1DX5I 5IKRA 2VJ3A 5JBAE 1NT0A 2BOXA 5CKQA 3TBDA 1G2LB 3BPSE 1MOXC 4X8UL 2TGFA 3M36L 1C5MF 5CKMA 1HCGB 2Y7ZB 4BTTA 4JYVL 1NFXB 3GISX 2P93L 4X8TL 5JBCE 3K9XA 5EGMB 2RNLA 3KL6B 4D0FA 1A3PA 2EI8B 1Z6CA 2VH6B 1IVOC 1HRFA 4RRXA 3HO5A 4ZXXL 1DIYA 2P94L 4XBMA 4FM5A 2I9BA 1HZ8A 4Z0LA 1G2MB 2W2OE 1MQ6L 2WYJB 1YGCL 2WZPP 1IQFL 4JZDL 3KK6A 3PGHA 1APOA 1DDXA 3N8YB 1O5DL 2XC0L 1IQML 2EI6B 1EPHA 4YT7L 4LMFA 4BXSA 1CFHA 2W86A 1XFEA 2H9EC 3F1SB 3QMOA 1DQBA 1ATEA 1IQLL 1EMOA 3HS5A 2D1JB 3LTFB 1TLEA 1TOZA 3TK6B 3OLUA 4Z0KB 4D0EA 4NA9L 1FSBA 2VWOL 2BOHA 4BTIA 4Y76B 5CISA 1URKA 4Y79B 1QFKL 4BDXA 5L2ZL 1L3YA 3HO4A 4X8VL 3TK5B 4CUFA 1V3XB 2AYLA 1IQNL 1N7DA 4TGFA 2BQ6A 4CUDA 1IGZA 4PH9A 3U73A 1NZIA 1IP0A 3BT2A 1PGEA 3V65B 1NPEB 3TZIA 5CKNA 4Z6AL 2Q1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M74 A;  5IKV A;  1Q4G A;  1XKB A;  2I9A A;  1UZP A;  1PXX A;  2BO2 A;  3V64 C;  4RS0 A;  1CCV A;  4JYU L;  4MMY B;  2BOU A;  1NFU B;  3CS7 L;  4Y71 B;  3LC5 B;  3KCG L;  3SOV A;  3IIT B;  3H5C B;  5K0H B;  2UWL B;  2W2M E;  3DEM A;  2G00 L;  2PHB B;  3C9A C;  3Q7D A;  3KQC L;  4CSY A;  1F0S B;  5JVY A;  3HPT A;  2WG3 C;  4XL1 A;  4RRZ A;  3FCS B;  1HRE A;  3ASI A;  2PR3 B;  2J2U B;  5IKQ A;  2Y5F L;  3HS6 A;  3R05 A;  1NFY B;  2P26 A;  2KV4 A;  3KQD L;  2W3I B;  1LPG A;  1IQG L;  4ISH L;  2UWO B;  2Y5G L;  2FZZ L;  1W8B L;  1IQH L;  2P3U A;  4XLW A;  1EAI C;  6COX A;  1WHE A;  2NPR A;  1L5G B;  2MGR A;  3LTG D;  3NJP C;  1BF9 A;  2CJI B;  2GD4 A;  3M37 L;  1ATD A;  1RFN B;  1G1R A;  3GCW E;  1B9W A;  2P3F L;  5JB8 E;  3KQE L;  1K36 A;  4ZH8 B;  1PRH A;  3EGF A;  5JW1 A;  2YGO A;  3ELA L;  1U8C B;  1U67 A;  1HT8 A;  1APQ A;  5I46 L;  4BXW A;  3F6U L;  1AUT L;  2MGP A;  1LQD A;  2Y5H L;  3NTB A;  3MQE A;  3CEN L;  3NTG A;  2F9B L;  1IGX A;  3HS7 A;  4RRY A;  4X8S L;  1HX2 A;  2WPL E;  5JBB E;  3P5B L;  4A7I A;  5E8D A;  2XBY L;  1IJQ A;  2RA0 L;  3FBY A;  2DDU A;  1YUF A;  1G1T A;  1EPG A;  2J95 B;  4Y6D B;  5KIR A;  2VWM K;  1FJS L;  2BQW A;  4E1G A;  1KSN B;  3ZYI B;  2MHP A;  2P3F N;  5COX A;  5FDQ A;  4BTU A;  1EPJ A;  2VWN L;  4BDW A;  1KLO A;  2XBV L;  2K2T A;  1UZJ A;  1IQE L;  3ZYG A;  4Y7B B;  1DVA L;  2K2S B;  4RRW A;  1CVU A;  2H9E L;  4M11 A;  1UZK A;  1G1Q A;  1J9C L;  3MDL A;  1EMN A;  3KQB L;  1CCF A;  3NT1 A;  5JB9 E;  1HT5 A;  1F7M A;  4LOR A;  1IQK L;  1Z6E L;  3LN1 A;  3Q3K B;  1ZAQ A;  1NFW B;  1XDT R;  3N8V A;  3SOB B;  3QH0 A;  3CFW A;  3N8Y A;  1OB1 C;  3CA7 A;  1GK5 A;  2J38 B;  1SZB A;  4COX A;  3HO3 A;  1F0R B;  2OYE P;  1HAF A;  2FLB L;  3SOQ A;  1KIG L;  5IKT A;  4MMX B;  3GCX E;  4C16 A;  2Y82 B;  1G1S A;  2W2P E;  4ZAE B;  1W7X L;  2PUQ L;  2Y7X B;  4G1M B;  1JV2 B;  4YZU B;  4JZF L;  1CVW L;  2WFT A;  5KN5 C;  4YT6 L;  2XBX L;  1UZQ A;  3BT1 A;  5JVZ A;  2BOK L;  1EQH A;  4ISI L;  5F19 A;  3SW2 A;  1FF7 A;  2BQ7 A;  2P95 L;  1NQL B;  1P0S L;  2XC5 L;  2VVV L;  2WPK E;  4NG9 L;  1JBU L;  1MQ5 L;  4CUE A;  5L30 L;  3POY A;  3LC3 B;  1EPI A;  4O02 B;  1CEJ A;  4O1Z A;  1JL9 A;  2WPI E;  2WG4 B;  1ADX A;  2WPH E;  1I0U A;  2XBW L;  1LPK A;  3KRK A;  1HJ7 A;  2VWL L;  3QCW A;  1IOX A;  1ATA A;  1EZQ B;  1HAE A;  2XC4 L;  1X7A L;  3LAQ A;  1WHF A;  4RUT A;  4ZHA B;  4M10 A;  2UWP B;  4Y7A B;  2ADX A;  2P28 B;  5L2Y L;  1TPG A;  2FLG A;  2OYU P;  1IQI L;  2WYG B;  4AQT A;  1EBV A;  2J4I B;  1EQG A;  1YUG A;  3N8Z A;  1K37 A;  5F1A A;  3ENS A;  1IOE L;  1CX2 A;  2YGP A;  2BMG A;  1LMJ A;  2EI7 B;  4JZE L;  1PTH A;  2FLR L;  3N8X A;  2Y81 B;  1YO8 A;  2W2N E;  2Y38 A;  3N8W A;  3LN0 A;  2JKH L;  1IQJ L;  3LIW B;  3TGF A;  1P9J A;  2WFX B;  4D90 A;  3RR3 A;  2P3T A;  3N8W B;  2WPM E;  1F7E A;  2VVC K;  2BZ6 L;  1FFM A;  4MMZ B;  1PFX L;  1LPZ A;  2J94 B;  3ZYJ B;  4ZXY L;  1N1I A;  2W2Q E;  4OTY A;  1FAK L;  1YUK B;  3FFG L;  1CQE A;  1XKA L;  2Y80 B;  2W3K B;  1WU1 B;  1FE2 A;  2FD6 A;  1EGF A;  2RHP A;  4OTJ A;  1FAX L;  2B7D L;  2W26 B;  2KB9 A;  1M1X B;  3U7U G;  2P16 L;  4NGA L;  2VH0 B;  3TH3 L;  1COU A;  2J34 B;  3OLT A;  1ATB A;  2VVU L;  2WPJ E;  3IJE B;  1KLJ L;  1KLI L;  2KL7 A;  1DX5 I;  5IKR A;  2VJ3 A;  5JBA E;  1NT0 A;  2BOX A;  5CKQ A;  3TBD A;  1G2L B;  3BPS E;  1MOX C;  4X8U L;  2TGF A;  3M36 L;  1C5M F;  5CKM A;  1HCG B;  2Y7Z B;  4BTT A;  4JYV L;  1NFX B;  3GIS X;  2P93 L;  4X8T L;  5JBC E;  3K9X A;  5EGM B;  2RNL A;  3KL6 B;  4D0F A;  1A3P A;  2EI8 B;  1Z6C A;  2VH6 B;  1IVO C;  1HRF A;  4RRX A;  3HO5 A;  4ZXX L;  1DIY A;  2P94 L;  4XBM A;  4FM5 A;  2I9B A;  1HZ8 A;  4Z0L A;  1G2M B;  2W2O E;  1MQ6 L;  2WYJ B;  1YGC L;  1IQF L;  4JZD L;  3KK6 A;  3PGH A;  1APO A;  1DDX A;  3N8Y B;  1O5D L;  2XC0 L;  1IQM L;  2EI6 B;  1EPH A;  4YT7 L;  4LMF A;  4BXS A;  1CFH A;  2W86 A;  1XFE A;  3F1S B;  3QMO A;  1DQB A;  1ATE A;  1IQL L;  1EMO A;  3HS5 A;  2D1J B;  3LTF B;  1TLE A;  1TOZ A;  3TK6 B;  3OLU A;  4Z0K B;  4D0E A;  4NA9 L;  1FSB A;  2VWO L;  2BOH A;  4BTI A;  4Y76 B;  5CIS A;  1URK A;  4Y79 B;  1QFK L;  4BDX A;  5L2Z L;  1L3Y A;  3HO4 A;  4X8V L;  3TK5 B;  4CUF A;  1V3X B;  2AYL A;  1IQN L;  1N7D A;  4TGF A;  2BQ6 A;  4CUD A;  1IGZ A;  4PH9 A;  3U73 A;  1NZI A;  1IP0 A;  3BT2 A;  1PGE A;  3V65 B;  1NPE B;  3TZI A;  5CKN A;  4Z6A L;  2Q1J B; 
#chains in the Genus database with same CATH topology
 2M74 A;  5IKV A;  1Q4G A;  1XKB A;  2I9A A;  1UZP A;  1PXX A;  4A94 C;  2YGQ A;  2BO2 A;  3V64 C;  4RS0 A;  1CCV A;  4JYU L;  4MMY B;  2BOU A;  1NFU B;  3CS7 L;  4Y71 B;  3LC5 B;  3KCG L;  3SOV A;  3IIT B;  3H5C B;  5K0H B;  2UWL B;  2W2M E;  3DEM A;  2G00 L;  2PHB B;  3C9A C;  3Q7D A;  3KQC L;  4CSY A;  1F0S B;  5JVY A;  3HPT A;  2WG3 C;  4XL1 A;  4RRZ A;  4GU3 A;  3FCS B;  1HRE A;  3ASI A;  2PR3 B;  2J2U B;  5IKQ A;  2Y5F L;  3HS6 A;  2KNI A;  3R05 A;  1NFY B;  2P26 A;  2KV4 A;  3KQD L;  2W3I B;  1LPG A;  1IQG L;  4ISH L;  2Y5G L;  2UWO B;  2FZZ L;  1W8B L;  1IQH L;  2P3U A;  4XLW A;  1EAI C;  6COX A;  1LMM A;  1WHE A;  2NPR A;  1L5G B;  2MGR A;  3LTG D;  3NJP C;  1BF9 A;  2CJI B;  2GD4 A;  3M37 L;  1ATD A;  1RFN B;  1G1R A;  3GCW E;  1B9W A;  2P3F L;  5JB8 E;  3KQE L;  1K36 A;  4ZH8 B;  1PRH A;  3EGF A;  5JW1 A;  2YGO A;  3ELA L;  4GU4 A;  1U8C B;  1U67 A;  1HT8 A;  1APQ A;  5I46 L;  4BXW A;  3F6U L;  1AUT L;  2MGP A;  1LQD A;  2Y5H L;  3NTB A;  3MQE A;  3CEN L;  3NTG A;  2F9B L;  1IGX A;  3HS7 A;  4RRY A;  4X8S L;  1HX2 A;  2WPL E;  5JBB E;  3P5B L;  4A7I A;  5E8D A;  2XBY L;  1IJQ A;  2RA0 L;  3FBY A;  2DDU A;  1YUF A;  1G1T A;  1EPG A;  1LK9 A;  2J95 B;  4Y6D B;  5KIR A;  2VWM K;  1FJS L;  2BQW A;  4E1G A;  1KSN B;  3ZYI B;  2MHP A;  2P3F N;  5COX A;  5FDQ A;  4BTU A;  1EPJ A;  2VWN L;  4BDW A;  1KLO A;  2XBV L;  2K2T A;  1UZJ A;  1IQE L;  3ZYG A;  4Y7B B;  1DVA L;  2K2S B;  4RRW A;  1CVU A;  1V1I A;  2H9E L;  4M11 A;  1UZK A;  1G1Q A;  1J9C L;  3MDL A;  1EMN A;  3KQB L;  1CCF A;  3NT1 A;  5JB9 E;  1HT5 A;  2JJL A;  1F7M A;  4LOR A;  1IQK L;  1Z6E L;  3LN1 A;  3Q3K B;  1ZAQ A;  2HOR A;  1NFW B;  1XDT R;  3N8V A;  3SOB B;  3QH0 A;  3CFW A;  3N8Y A;  1OB1 C;  3CA7 A;  1GK5 A;  2J38 B;  1SZB A;  4COX A;  3HO3 A;  1F0R B;  2OYE P;  1HAF A;  2FLB L;  3SOQ A;  1KIG L;  5IKT A;  4MMX B;  3GCX E;  4C16 A;  2Y82 B;  1G1S A;  2W2P E;  4ZAE B;  1W7X L;  2PUQ L;  2HOX A;  2Y7X B;  4G1M B;  1JV2 B;  4YZU B;  4JZF L;  1CVW L;  2WFT A;  5KN5 C;  4YT6 L;  2XBX L;  1UZQ A;  3BT1 A;  5JVZ A;  2BOK L;  1EQH A;  4ISI L;  5F19 A;  3SW2 A;  1FF7 A;  2BQ7 A;  2P95 L;  1NQL B;  1P0S L;  2XC5 L;  2VVV L;  2WPK E;  4NG9 L;  2BT7 A;  1JBU L;  1MQ5 L;  4CUE A;  5L30 L;  3POY A;  3LC3 B;  1EPI A;  4O02 B;  1CEJ A;  4O1Z A;  1JL9 A;  2WPI E;  2WG4 B;  1ADX A;  2WPH E;  1I0U A;  2XBW L;  1LPK A;  3KRK A;  1HJ7 A;  2VWL L;  3QCW A;  1IOX A;  1ATA A;  1EZQ B;  1HAE A;  2XC4 L;  1X7A L;  3LAQ A;  1WHF A;  4RUT A;  4ZHA B;  4M10 A;  2UWP B;  4Y7A B;  2ADX A;  2P28 B;  5L2Y L;  1TPG A;  2FLG A;  2OYU P;  1IQI L;  2WYG B;  4AQT A;  1EBV A;  2J4I B;  1EQG A;  1YUG A;  3N8Z A;  1K37 A;  5F1A A;  3ENS A;  1IOE L;  1CX2 A;  2YGP A;  2BMG A;  1LMJ A;  2EI7 B;  4JZE L;  1PTH A;  2FLR L;  3N8X A;  2Y81 B;  1YO8 A;  2W2N E;  2Y38 A;  3N8W A;  3LN0 A;  2JKH L;  1IQJ L;  3LIW B;  3TGF A;  1P9J A;  2BSF A;  2WFX B;  4D90 A;  3RR3 A;  2P3T A;  3N8W B;  2WPM E;  1F7E A;  2VVC K;  2BZ6 L;  1FFM A;  4MMZ B;  1PFX L;  1LPZ A;  2J94 B;  3ZYJ B;  4ZXY L;  1N1I A;  2W2Q E;  4OTY A;  1FAK L;  1YUK B;  3FFG L;  1CQE A;  1XKA L;  2Y80 B;  2W3K B;  1WU1 B;  1FE2 A;  2FD6 A;  1EGF A;  2RHP A;  4OTJ A;  1FAX L;  2B7D L;  2W26 B;  2KB9 A;  1M1X B;  3U7U G;  3S6X A;  2P16 L;  4NGA L;  2VH0 B;  3TH3 L;  1COU A;  2J34 B;  3OLT A;  1ATB A;  2VVU L;  2WPJ E;  3IJE B;  1KLJ L;  1KLI L;  2KL7 A;  1DX5 I;  5IKR A;  2VJ3 A;  5JBA E;  1NT0 A;  2BOX A;  5CKQ A;  3TBD A;  1G2L B;  3BPS E;  1MOX C;  4X8U L;  2TGF A;  3M36 L;  1C5M F;  5CKM A;  1HCG B;  2Y7Z B;  4BTT A;  4JYV L;  1NFX B;  3GIS X;  2P93 L;  4X8T L;  5JBC E;  3K9X A;  5EGM B;  2RNL A;  3KL6 B;  4D0F A;  1A3P A;  2EI8 B;  1Z6C A;  2VH6 B;  1IVO C;  1V1H A;  2VRS A;  1HRF A;  4RRX A;  3HO5 A;  4ZXX L;  1DIY A;  2P94 L;  4XBM A;  4FM5 A;  2I9B A;  1HZ8 A;  4Z0L A;  1G2M B;  2W2O E;  1MQ6 L;  2WYJ B;  1YGC L;  2WZP P;  1IQF L;  4JZD L;  3KK6 A;  3PGH A;  1APO A;  1DDX A;  3N8Y B;  1O5D L;  2XC0 L;  1IQM L;  2EI6 B;  1EPH A;  4YT7 L;  4LMF A;  4BXS A;  1CFH A;  2BT8 A;  2W86 A;  1XFE A;  2H9E C;  3F1S B;  3QMO A;  1DQB A;  1ATE A;  1IQL L;  1EMO A;  3HS5 A;  2D1J B;  3LTF B;  1TLE A;  1TOZ A;  3TK6 B;  3OLU A;  4Z0K B;  4D0E A;  4NA9 L;  1FSB A;  2VWO L;  2BOH A;  4BTI A;  4Y76 B;  5CIS A;  1URK A;  4Y79 B;  1QFK L;  4BDX A;  5L2Z L;  1L3Y A;  3HO4 A;  4X8V L;  3TK5 B;  4CUF A;  1V3X B;  2AYL A;  1IQN L;  1N7D A;  4TGF A;  2BQ6 A;  4CUD A;  1IGZ A;  4PH9 A;  3U73 A;  1NZI A;  1IP0 A;  3BT2 A;  1PGE A;  3V65 B;  1QIU A;  1NPE B;  3TZI A;  5CKN A;  4Z6A L;  1KKE A;  2Q1J B; 
#chains in the Genus database with same CATH homology
 2M74 A;  5IKV A;  1Q4G A;  1XKB A;  2I9A A;  1UZP A;  1PXX A;  4A94 C;  2YGQ A;  2BO2 A;  3V64 C;  4RS0 A;  1CCV A;  4JYU L;  4MMY B;  2BOU A;  1NFU B;  3CS7 L;  4Y71 B;  3LC5 B;  3KCG L;  3SOV A;  3IIT B;  3H5C B;  5K0H B;  2UWL B;  2W2M E;  3DEM A;  2G00 L;  2PHB B;  3C9A C;  3Q7D A;  3KQC L;  4CSY A;  1F0S B;  5JVY A;  3HPT A;  2WG3 C;  4XL1 A;  4RRZ A;  3FCS B;  1HRE A;  3ASI A;  2PR3 B;  2J2U B;  5IKQ A;  2Y5F L;  3HS6 A;  2KNI A;  3R05 A;  1NFY B;  2P26 A;  2KV4 A;  3KQD L;  2W3I B;  1LPG A;  1IQG L;  4ISH L;  2UWO B;  2Y5G L;  2FZZ L;  1W8B L;  1IQH L;  2P3U A;  4XLW A;  1EAI C;  6COX A;  1LMM A;  1WHE A;  2NPR A;  1L5G B;  2MGR A;  3LTG D;  3NJP C;  1BF9 A;  2CJI B;  2GD4 A;  3M37 L;  1ATD A;  1RFN B;  1G1R A;  3GCW E;  1B9W A;  2P3F L;  5JB8 E;  3KQE L;  1K36 A;  4ZH8 B;  1PRH A;  3EGF A;  5JW1 A;  2YGO A;  3ELA L;  1U8C B;  1U67 A;  1HT8 A;  1APQ A;  5I46 L;  4BXW A;  3F6U L;  1AUT L;  2MGP A;  1LQD A;  2Y5H L;  3NTB A;  3MQE A;  3CEN L;  3NTG A;  2F9B L;  1IGX A;  3HS7 A;  4RRY A;  4X8S L;  1HX2 A;  2WPL E;  5JBB E;  3P5B L;  4A7I A;  5E8D A;  2XBY L;  1IJQ A;  2RA0 L;  3FBY A;  2DDU A;  1YUF A;  1G1T A;  1EPG A;  2J95 B;  4Y6D B;  5KIR A;  2VWM K;  1FJS L;  2BQW A;  4E1G A;  1KSN B;  3ZYI B;  2MHP A;  2P3F N;  5COX A;  5FDQ A;  4BTU A;  1EPJ A;  2VWN L;  4BDW A;  1KLO A;  2XBV L;  2K2T A;  1UZJ A;  1IQE L;  3ZYG A;  4Y7B B;  1DVA L;  2K2S B;  4RRW A;  1CVU A;  2H9E L;  4M11 A;  1UZK A;  1G1Q A;  1J9C L;  3MDL A;  1EMN A;  3KQB L;  1CCF A;  3NT1 A;  5JB9 E;  1HT5 A;  1F7M A;  4LOR A;  1IQK L;  1Z6E L;  3LN1 A;  3Q3K B;  1ZAQ A;  1NFW B;  1XDT R;  3N8V A;  3SOB B;  3QH0 A;  3CFW A;  3N8Y A;  1OB1 C;  3CA7 A;  1GK5 A;  2J38 B;  1SZB A;  4COX A;  3HO3 A;  1F0R B;  2OYE P;  1HAF A;  2FLB L;  3SOQ A;  1KIG L;  5IKT A;  4MMX B;  3GCX E;  4C16 A;  2Y82 B;  1G1S A;  2W2P E;  4ZAE B;  1W7X L;  2PUQ L;  2Y7X B;  4G1M B;  1JV2 B;  4YZU B;  4JZF L;  1CVW L;  2WFT A;  5KN5 C;  4YT6 L;  2XBX L;  1UZQ A;  3BT1 A;  5JVZ A;  2BOK L;  1EQH A;  4ISI L;  5F19 A;  3SW2 A;  1FF7 A;  2BQ7 A;  2P95 L;  1NQL B;  1P0S L;  2XC5 L;  2VVV L;  2WPK E;  4NG9 L;  1JBU L;  1MQ5 L;  4CUE A;  5L30 L;  3POY A;  3LC3 B;  1EPI A;  4O02 B;  1CEJ A;  4O1Z A;  1JL9 A;  2WPI E;  2WG4 B;  1ADX A;  2WPH E;  1I0U A;  2XBW L;  1LPK A;  3KRK A;  1HJ7 A;  2VWL L;  3QCW A;  1IOX A;  1ATA A;  1EZQ B;  1HAE A;  2XC4 L;  1X7A L;  3LAQ A;  1WHF A;  4RUT A;  4ZHA B;  4M10 A;  2UWP B;  4Y7A B;  2ADX A;  2P28 B;  5L2Y L;  1TPG A;  2FLG A;  2OYU P;  1IQI L;  2WYG B;  4AQT A;  1EBV A;  2J4I B;  1EQG A;  1YUG A;  3N8Z A;  1K37 A;  5F1A A;  3ENS A;  1IOE L;  1CX2 A;  2YGP A;  2BMG A;  1LMJ A;  2EI7 B;  4JZE L;  1PTH A;  2FLR L;  3N8X A;  2Y81 B;  1YO8 A;  2W2N E;  2Y38 A;  3N8W A;  3LN0 A;  2JKH L;  1IQJ L;  3LIW B;  3TGF A;  1P9J A;  2WFX B;  4D90 A;  3RR3 A;  2P3T A;  3N8W B;  2WPM E;  1F7E A;  2VVC K;  2BZ6 L;  1FFM A;  4MMZ B;  1PFX L;  1LPZ A;  2J94 B;  3ZYJ B;  4ZXY L;  1N1I A;  2W2Q E;  4OTY A;  1FAK L;  1YUK B;  3FFG L;  1CQE A;  1XKA L;  2Y80 B;  2W3K B;  1WU1 B;  1FE2 A;  2FD6 A;  1EGF A;  2RHP A;  4OTJ A;  1FAX L;  2B7D L;  2W26 B;  2KB9 A;  1M1X B;  3U7U G;  3S6X A;  2P16 L;  4NGA L;  2VH0 B;  3TH3 L;  1COU A;  2J34 B;  3OLT A;  1ATB A;  2VVU L;  2WPJ E;  3IJE B;  1KLJ L;  1KLI L;  2KL7 A;  1DX5 I;  5IKR A;  2VJ3 A;  5JBA E;  1NT0 A;  2BOX A;  5CKQ A;  3TBD A;  1G2L B;  3BPS E;  1MOX C;  4X8U L;  2TGF A;  3M36 L;  1C5M F;  5CKM A;  1HCG B;  2Y7Z B;  4BTT A;  4JYV L;  1NFX B;  3GIS X;  2P93 L;  4X8T L;  5JBC E;  3K9X A;  5EGM B;  2RNL A;  3KL6 B;  4D0F A;  1A3P A;  2EI8 B;  1Z6C A;  2VH6 B;  1IVO C;  1HRF A;  4RRX A;  3HO5 A;  4ZXX L;  1DIY A;  2P94 L;  4XBM A;  4FM5 A;  2I9B A;  1HZ8 A;  4Z0L A;  1G2M B;  2W2O E;  1MQ6 L;  2WYJ B;  1YGC L;  2WZP P;  1IQF L;  4JZD L;  3KK6 A;  3PGH A;  1APO A;  1DDX A;  3N8Y B;  1O5D L;  2XC0 L;  1IQM L;  2EI6 B;  1EPH A;  4YT7 L;  4LMF A;  4BXS A;  1CFH A;  2W86 A;  1XFE A;  2H9E C;  3F1S B;  3QMO A;  1DQB A;  1ATE A;  1IQL L;  1EMO A;  3HS5 A;  2D1J B;  3LTF B;  1TLE A;  1TOZ A;  3TK6 B;  3OLU A;  4Z0K B;  4D0E A;  4NA9 L;  1FSB A;  2VWO L;  2BOH A;  4BTI A;  4Y76 B;  5CIS A;  1URK A;  4Y79 B;  1QFK L;  4BDX A;  5L2Z L;  1L3Y A;  3HO4 A;  4X8V L;  3TK5 B;  4CUF A;  1V3X B;  2AYL A;  1IQN L;  1N7D A;  4TGF A;  2BQ6 A;  4CUD A;  1IGZ A;  4PH9 A;  3U73 A;  1NZI A;  1IP0 A;  3BT2 A;  1PGE A;  3V65 B;  1NPE B;  3TZI A;  5CKN A;  4Z6A L;  2Q1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...