2FLGA

Solution structure of an egf-like domain from the plasmodium falciparum merozoite surface protein 1
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
48
structure length
48
Chain Sequence
NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, solution structure and immune recognition of an epidermal growth factor-like domain from Plasmodium falciparum merozoite surface protein-1.
pubmed doi rcsb
molecule tags Surface active protein
molecule keywords Merozoite surface protein 1
total genus 2
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12946 EGF_MSP1_1 MSP1 EGF domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2flgA00
2KB9A 1APQA 2GD4A 1KLIL 5F1AA 3N8WB 5JVYA 1KLJL 2P93L 5CKMA 4NA9L 2P28B 2XC5L 3MQEA 1EPIA 1CX2A 1FAKL 2OYEP 2W2NE 2BOXA 2Y81B 3ENSA 3NJPC 1F0SB 2Y7ZB 2VJ3A 3ELAL 1URKA 1LPZA 3CS7L 2RHPA 1P9JA 2WG3C 3MDLA 2BQWA 2J38B 1FSBA 2Y82B 3PGHA 4ZXYL 5JB9E 5JVZA 1XKBA 3ASIA 1DQBA 5CISA 1EPJA 2XC4L 2EI6B 2J4IB 2P3TA 2VH0B 1PTHA 1Z6CA 1IQGL 4BTUA 2J2UB 2BOHA 2VWNL 2UWPB 2BOKL 5K0HB 2RNLA 1EMOA 1M1XB 2D1JB 4MMXB 3KK6A 2JKHL 3BT2A 1NFYB 1UZPA 3GISX 1QFKL 2VWOL 3BT1A 3V64C 1EBVA 3KQEL 4Y7AB 1IQML 4D0EA 4RRYA 1DIYA 2WPHE 2I9BA 2W86A 1FFMA 1AUTL 5I46L 2P3FL 2Y38A 5COXA 2VWLL 1NFXB 4CSYA 4M10A 4E1GA 4M11A 3F6UL 4RRWA 1HCGB 1Q4GA 1WHEA 3TK6B 4Z0KB 5CKQA 5E8DA 5KN5C 1YUGA 2W2QE 4Z6AL 3RR3A 4X8UL 4O1ZA 1XDTR 4Y6DB 2BZ6L 1YO8A 1IP0A 2VH6B 4TGFA 2G00L 3DEMA 4NGAL 1LPGA 1EAIC 2NPRA 3M36L 1IQKL 3R05A 1JV2B 1EGFA 3LC3B 1ADXA 5F19A 1HREA 1GK5A 1G1SA 1EMNA 3TH3L 1U8CB 3TZIA 4A7IA 1C5MF 3K9XA 2W3KB 1PGEA 3ZYGA 2P16L 2BOUA 2Y5HL 4G1MB 3Q7DA 1EQGA 3SW2A 1FE2A 5JBAE 2VVUL 2VVVL 1DDXA 2XBYL 4CUFA 2WYJB 1F0RB 5KIRA 1G2MB 3LTFB 1LPKA 4ZXXL 2H9EL 2WFXB 3LTGD 2PR3B 4JZDL 1IQFL 2KV4A 2P3UA 3LAQA 3EGFA 3TBDA 1F7EA 3SOBB 1N7DA 1B9WA 4MMYB 4RRZA 1MQ5L 3FBYA 1NQLB 2MGRA 4C16A 5CKNA 2K2TA 3SOVA 2XC0L 1IVOC 1X7AL 3LC5B 4YT7L 1ZAQA 2M74A 4ISIL 3LIWB 3N8WA 2K2SB 1G1QA 1IQNL 4O02B 4JYUL 5L2YL 1HT8A 1IQJL 2P26A 1DVAL 2ADXA 3U7UG 3IJEB 3OLTA 4ZH8B 3HO4A 3KCGL 1FF7A 4OTJA 1KSNB 2Q1JB 1TOZA 3F1SB 5EGMB 4ZHAB 5IKTA 5JW1A 1G1RA 2YGOA 1HAFA 2P3FN 3FCSB 1L3YA 2WFTA 3BPSE 4Y71B 2B7DL 2Y7XB 3IITB 1OB1C 3KQDL 1CCFA 1I0UA 1NFUB 2BQ7A 1V3XB 2VVCK 3N8XA 1HRFA 3ZYIB 2BMGA 1LMJA 2FZZL 4JZFL 2FD6A 1HZ8A 1IGZA 3V65B 1IJQA 1W7XL 2F9BL 1EPHA 2MHPA 1HAEA 3N8ZA 2W2ME 1TLEA 2TGFA 4CUEA 3LN0A 1MOXC 1NT0A 2WYGB 4XLWA 1FAXL 2EI7B 2W26B 3QH0A 3LN1A 4MMZB 2PUQL 3Q3KB 1L5GB 1MQ6L 4COXA 3GCWE 4OTYA 2FLRL 3NTBA 3NTGA 1NFWB 3KQCL 1IQIL 5JB8E 4D0FA 2UWLB 2I9AA 2VWMK 4XBMA 3POYA 4BTTA 1BF9A 3TK5B 3U73A 2J94B 2P95L 3NT1A 2YGPA 2WPME 2WG4B 2Y5FL 4JYVL 1IQEL 1IGXA 4Y79B 1PFXL 2CJIB 1P0SL 1A3PA 1IQHL 2FLGA 4X8TL 3CA7A 2KL7A 4X8VL 1UZQA 1F7MA 3N8YA 2J95B 4Z0LA 1PRHA 2Y80B 1ATAA 1HJ7A 2J34B 2DDUA 1TPGA 1ATBA 5L30L 4BDWA 1PXXA 4BXWA 2W3IB 1K37A 1WHFA 3OLUA 3QMOA 3CFWA 3P5BL 2AYLA 1ATDA 1Z6EL 3FFGL 4XL1A 1CEJA 4RUTA 3KRKA 4D90A 1DX5I 5IKVA 4CUDA 1IOXA 3ZYJB 2FLBL 3KQBL 3H5CB 2WPIE 3GCXE 4PH9A 4NG9L 1G1TA 4Y7BB 2Y5GL 1EPGA 1HT5A 2WPJE 1IQLL 1CVWL 2UWOB 1NPEB 4X8SL 3SOQA 3HS6A 1EQHA 4RS0A 2XBWL 1YGCL 3QCWA 5IKQA 1YUKB 1G2LB 2BO2A 1CQEA 1SZBA 2MGPA 5IKRA 4LMFA 4BXSA 2BQ6A 1RFNB 1FJSL 1YUFA 3CENL 3HO5A 1APOA 2WPKE 1WU1B 1KLOA 1U67A 1COUA 1O5DL 3TGFA 1KIGL 2W2OE 4LORA 4ZAEB 1ATEA 1JL9A 3KL6B 5FDQA 2EI8B 2OYUP 2PHBB 4BDXA 3N8VA 1CVUA 5JBBE 1XFEA 1N1IA 1IOEL 2W2PE 3HPTA 4YT6L 3M37L 1UZKA 2P94L 4FM5A 1J9CL 3HS5A 4Y76B 3HO3A 2RA0L 2WPLE 1XKAL 1W8BL 3C9AC 3N8YB 1EZQB 4AQTA 1HX2A 1K36A 1JBUL 1NZIA 5JBCE 1UZJA 1LQDA 6COXA 4BTIA 4JZEL 1CCVA 4RRXA 4ISHL 2XBXL 2XBVL 4YZUB 3HS7A 5L2ZL
chains in the Genus database with same CATH superfamily
2KB9A 1APQA 2GD4A 1KLIL 5F1AA 3N8WB 5JVYA 1KLJL 2P93L 5CKMA 4NA9L 2P28B 2XC5L 3MQEA 1EPIA 1CX2A 1FAKL 2OYEP 2W2NE 2BOXA 2Y81B 3ENSA 3NJPC 1F0SB 2Y7ZB 2VJ3A 3ELAL 1URKA 1LPZA 3CS7L 2BT7A 2RHPA 1P9JA 2WG3C 3MDLA 2BQWA 2J38B 1QIUA 1FSBA 2Y82B 3PGHA 4ZXYL 5JB9E 5JVZA 1XKBA 3ASIA 1DQBA 5CISA 1EPJA 2XC4L 2EI6B 2VRSA 2J4IB 2P3TA 2VH0B 1PTHA 1Z6CA 1IQGL 4BTUA 2J2UB 2BOHA 2VWNL 2UWPB 2BOKL 5K0HB 2RNLA 1EMOA 1M1XB 2D1JB 4MMXB 3KK6A 2JKHL 3BT2A 1NFYB 1KKEA 1UZPA 3GISX 1QFKL 2VWOL 3BT1A 3V64C 1EBVA 3KQEL 4Y7AB 1IQML 4D0EA 4RRYA 1DIYA 2WPHE 2I9BA 2W86A 1FFMA 1AUTL 5I46L 2P3FL 2Y38A 5COXA 2VWLL 1NFXB 4CSYA 4M10A 4E1GA 4M11A 3F6UL 4RRWA 1HCGB 1Q4GA 1WHEA 3TK6B 4Z0KB 5CKQA 5E8DA 5KN5C 1YUGA 2W2QE 4Z6AL 3RR3A 4X8UL 4O1ZA 1XDTR 4Y6DB 2BZ6L 1YO8A 1IP0A 2HOXA 2VH6B 4TGFA 2G00L 3DEMA 4NGAL 1LPGA 1EAIC 2NPRA 3M36L 1IQKL 3R05A 1JV2B 1EGFA 3LC3B 1ADXA 5F19A 1HREA 1GK5A 1G1SA 1EMNA 3TH3L 2WZPP 1U8CB 3TZIA 4A7IA 1C5MF 3K9XA 2W3KB 1PGEA 2YGQA 3ZYGA 2P16L 2BOUA 2Y5HL 4G1MB 3Q7DA 1EQGA 3SW2A 1FE2A 5JBAE 2VVUL 2VVVL 1DDXA 2XBYL 4CUFA 2WYJB 1F0RB 5KIRA 1G2MB 3LTFB 1LPKA 4ZXXL 2H9EL 2WFXB 3LTGD 2PR3B 4JZDL 2HORA 1IQFL 2KV4A 2P3UA 3LAQA 3EGFA 4GU4A 3TBDA 1F7EA 3SOBB 1N7DA 1B9WA 4MMYB 4RRZA 1MQ5L 3FBYA 4GU3A 1NQLB 2MGRA 4C16A 5CKNA 2K2TA 3SOVA 2XC0L 1IVOC 1X7AL 3LC5B 4YT7L 1ZAQA 2M74A 4ISIL 3LIWB 3N8WA 2K2SB 1G1QA 1IQNL 4O02B 4JYUL 5L2YL 1HT8A 1IQJL 2P26A 1DVAL 1V1HA 2ADXA 3U7UG 3IJEB 3OLTA 4ZH8B 3HO4A 2KNIA 3KCGL 1FF7A 4OTJA 1KSNB 2Q1JB 1TOZA 3F1SB 5EGMB 4ZHAB 5IKTA 5JW1A 1V1IA 1G1RA 2YGOA 1HAFA 2P3FN 3FCSB 1L3YA 2WFTA 3BPSE 4Y71B 2B7DL 2Y7XB 3IITB 1OB1C 3KQDL 1CCFA 1I0UA 1NFUB 2BQ7A 1V3XB 2VVCK 3N8XA 1HRFA 3ZYIB 2BMGA 1LMJA 2FZZL 4JZFL 2FD6A 1HZ8A 1IGZA 3V65B 1IJQA 1W7XL 2F9BL 1EPHA 2MHPA 1HAEA 3N8ZA 2W2ME 1TLEA 2TGFA 4CUEA 3LN0A 1MOXC 1NT0A 2WYGB 4XLWA 1FAXL 2EI7B 2W26B 3QH0A 3LN1A 2PUQL 4MMZB 3Q3KB 1L5GB 1MQ6L 4COXA 3GCWE 4OTYA 2FLRL 3NTBA 3NTGA 1NFWB 3KQCL 1IQIL 5JB8E 4D0FA 2UWLB 2I9AA 2VWMK 4XBMA 3POYA 4BTTA 1BF9A 1LMMA 3TK5B 3U73A 2J94B 2P95L 3NT1A 2YGPA 2JJLA 2WPME 2WG4B 2Y5FL 4JYVL 1IQEL 1IGXA 4Y79B 1PFXL 2CJIB 1P0SL 1A3PA 1IQHL 2FLGA 4X8TL 3CA7A 2KL7A 4X8VL 1UZQA 1F7MA 3N8YA 2J95B 4Z0LA 1PRHA 2Y80B 1ATAA 1HJ7A 2J34B 2DDUA 1TPGA 1ATBA 5L30L 4BDWA 1PXXA 2H9EC 4BXWA 2W3IB 1K37A 1WHFA 3OLUA 3QMOA 3CFWA 3P5BL 2AYLA 1ATDA 1Z6EL 3FFGL 4XL1A 1CEJA 4RUTA 3KRKA 4D90A 1DX5I 2BSFA 5IKVA 4CUDA 1IOXA 3ZYJB 2FLBL 3KQBL 3H5CB 2WPIE 3GCXE 4PH9A 4NG9L 1G1TA 4Y7BB 2Y5GL 1EPGA 1HT5A 2WPJE 1IQLL 1CVWL 2UWOB 1NPEB 4X8SL 3SOQA 3HS6A 1EQHA 4RS0A 2XBWL 4A94C 1YGCL 3QCWA 3S6XA 5IKQA 1YUKB 1G2LB 2BO2A 1CQEA 1SZBA 2MGPA 5IKRA 4LMFA 4BXSA 2BQ6A 1RFNB 1FJSL 1YUFA 3CENL 3HO5A 1APOA 2WPKE 1WU1B 1KLOA 1U67A 1COUA 1O5DL 3TGFA 1KIGL 2W2OE 4LORA 4ZAEB 1ATEA 1JL9A 3KL6B 5FDQA 2EI8B 2OYUP 2PHBB 4BDXA 2BT8A 3N8VA 1CVUA 5JBBE 1XFEA 1N1IA 1IOEL 2W2PE 3HPTA 4YT6L 3M37L 1UZKA 2P94L 4FM5A 1J9CL 3HS5A 4Y76B 3HO3A 2RA0L 2WPLE 1XKAL 1W8BL 3C9AC 3N8YB 1EZQB 4AQTA 1HX2A 1K36A 1JBUL 1NZIA 5JBCE 1UZJA 1LQDA 6COXA 4BTIA 1LK9A 4JZEL 1CCVA 4RRXA 4ISHL 2XBXL 2XBVL 4YZUB 3HS7A 5L2ZL
chains in the Genus database with same CATH topology
2KB9A 1APQA 2GD4A 1KLIL 5F1AA 3N8WB 5JVYA 1KLJL 2P93L 5CKMA 4NA9L 2P28B 2XC5L 3MQEA 1EPIA 1CX2A 1FAKL 2OYEP 2W2NE 2BOXA 2Y81B 3ENSA 3NJPC 1F0SB 2Y7ZB 2VJ3A 3ELAL 1URKA 1LPZA 3CS7L 2RHPA 1P9JA 2WG3C 3MDLA 2BQWA 2J38B 1FSBA 2Y82B 3PGHA 4ZXYL 5JB9E 5JVZA 1XKBA 3ASIA 1DQBA 5CISA 1EPJA 2XC4L 2EI6B 2J4IB 2P3TA 2VH0B 1PTHA 1Z6CA 1IQGL 4BTUA 2J2UB 2BOHA 2VWNL 2UWPB 2BOKL 5K0HB 2RNLA 1EMOA 1M1XB 2D1JB 4MMXB 3KK6A 2JKHL 3BT2A 1NFYB 1UZPA 3GISX 1QFKL 2VWOL 3BT1A 3V64C 1EBVA 3KQEL 4Y7AB 1IQML 4D0EA 4RRYA 1DIYA 2WPHE 2I9BA 2W86A 1FFMA 1AUTL 5I46L 2P3FL 2Y38A 5COXA 2VWLL 1NFXB 4CSYA 4M10A 4E1GA 4M11A 3F6UL 4RRWA 1HCGB 1Q4GA 1WHEA 3TK6B 4Z0KB 5CKQA 5E8DA 5KN5C 1YUGA 2W2QE 4Z6AL 3RR3A 4X8UL 4O1ZA 1XDTR 4Y6DB 2BZ6L 1YO8A 1IP0A 2VH6B 4TGFA 2G00L 3DEMA 4NGAL 1LPGA 1EAIC 2NPRA 3M36L 1IQKL 3R05A 1JV2B 1EGFA 3LC3B 1ADXA 5F19A 1HREA 1GK5A 1G1SA 1EMNA 3TH3L 2WZPP 1U8CB 3TZIA 4A7IA 1C5MF 3K9XA 2W3KB 1PGEA 2YGQA 3ZYGA 2P16L 2BOUA 2Y5HL 4G1MB 3Q7DA 1EQGA 3SW2A 1FE2A 5JBAE 2VVUL 2VVVL 1DDXA 2XBYL 4CUFA 2WYJB 1F0RB 5KIRA 1G2MB 3LTFB 1LPKA 4ZXXL 2H9EL 2WFXB 3LTGD 2PR3B 4JZDL 1IQFL 2KV4A 2P3UA 3LAQA 3EGFA 3TBDA 1F7EA 3SOBB 1N7DA 1B9WA 4MMYB 4RRZA 1MQ5L 3FBYA 1NQLB 2MGRA 4C16A 5CKNA 2K2TA 3SOVA 2XC0L 1IVOC 1X7AL 3LC5B 4YT7L 1ZAQA 2M74A 4ISIL 3LIWB 3N8WA 2K2SB 1G1QA 1IQNL 4O02B 4JYUL 5L2YL 1HT8A 1IQJL 2P26A 1DVAL 2ADXA 3U7UG 3IJEB 3OLTA 4ZH8B 3HO4A 2KNIA 3KCGL 1FF7A 4OTJA 1KSNB 2Q1JB 1TOZA 3F1SB 5EGMB 4ZHAB 5IKTA 5JW1A 1G1RA 2YGOA 1HAFA 2P3FN 3FCSB 1L3YA 2WFTA 3BPSE 4Y71B 2B7DL 2Y7XB 3IITB 1OB1C 3KQDL 1CCFA 1I0UA 1NFUB 2BQ7A 1V3XB 2VVCK 3N8XA 1HRFA 3ZYIB 2BMGA 1LMJA 2FZZL 4JZFL 2FD6A 1HZ8A 1IGZA 3V65B 1IJQA 1W7XL 2F9BL 1EPHA 2MHPA 1HAEA 3N8ZA 2W2ME 1TLEA 2TGFA 4CUEA 3LN0A 1MOXC 1NT0A 2WYGB 4XLWA 1FAXL 2EI7B 2W26B 3QH0A 3LN1A 4MMZB 2PUQL 3Q3KB 1L5GB 1MQ6L 4COXA 3GCWE 4OTYA 2FLRL 3NTBA 3NTGA 1NFWB 3KQCL 1IQIL 5JB8E 4D0FA 2UWLB 2I9AA 2VWMK 4XBMA 3POYA 4BTTA 1BF9A 1LMMA 3TK5B 3U73A 2J94B 2P95L 3NT1A 2YGPA 2WPME 2WG4B 2Y5FL 4JYVL 1IQEL 1IGXA 4Y79B 1PFXL 2CJIB 1P0SL 1A3PA 1IQHL 2FLGA 4X8TL 3CA7A 2KL7A 4X8VL 1UZQA 1F7MA 3N8YA 2J95B 4Z0LA 1PRHA 2Y80B 1ATAA 1HJ7A 2J34B 2DDUA 1TPGA 1ATBA 5L30L 4BDWA 1PXXA 2H9EC 4BXWA 2W3IB 1K37A 1WHFA 3OLUA 3QMOA 3CFWA 3P5BL 2AYLA 1ATDA 1Z6EL 3FFGL 4XL1A 1CEJA 4RUTA 3KRKA 4D90A 1DX5I 5IKVA 4CUDA 1IOXA 3ZYJB 2FLBL 3KQBL 3H5CB 2WPIE 3GCXE 4PH9A 4NG9L 1G1TA 4Y7BB 2Y5GL 1EPGA 1HT5A 2WPJE 1IQLL 1CVWL 2UWOB 1NPEB 4X8SL 3SOQA 3HS6A 1EQHA 4RS0A 2XBWL 4A94C 1YGCL 3QCWA 3S6XA 5IKQA 1YUKB 1G2LB 2BO2A 1CQEA 1SZBA 2MGPA 5IKRA 4LMFA 4BXSA 2BQ6A 1RFNB 1FJSL 1YUFA 3CENL 3HO5A 1APOA 2WPKE 1WU1B 1KLOA 1U67A 1COUA 1O5DL 3TGFA 1KIGL 2W2OE 4LORA 4ZAEB 1ATEA 1JL9A 3KL6B 5FDQA 2EI8B 2OYUP 2PHBB 4BDXA 3N8VA 1CVUA 5JBBE 1XFEA 1N1IA 1IOEL 2W2PE 3HPTA 4YT6L 3M37L 1UZKA 2P94L 4FM5A 1J9CL 3HS5A 4Y76B 3HO3A 2RA0L 2WPLE 1XKAL 1W8BL 3C9AC 3N8YB 1EZQB 4AQTA 1HX2A 1K36A 1JBUL 1NZIA 5JBCE 1UZJA 1LQDA 6COXA 4BTIA 4JZEL 1CCVA 4RRXA 4ISHL 2XBXL 2XBVL 4YZUB 3HS7A 5L2ZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB9 A;  1APQ A;  2GD4 A;  1KLI L;  5F1A A;  3N8W B;  5JVY A;  1KLJ L;  2P93 L;  5CKM A;  4NA9 L;  2P28 B;  2XC5 L;  3MQE A;  1EPI A;  1CX2 A;  1FAK L;  2OYE P;  2W2N E;  2BOX A;  2Y81 B;  3ENS A;  3NJP C;  1F0S B;  2Y7Z B;  2VJ3 A;  3ELA L;  1URK A;  1LPZ A;  3CS7 L;  2RHP A;  1P9J A;  2WG3 C;  3MDL A;  2BQW A;  2J38 B;  1FSB A;  2Y82 B;  3PGH A;  4ZXY L;  5JB9 E;  5JVZ A;  1XKB A;  3ASI A;  1DQB A;  5CIS A;  1EPJ A;  2XC4 L;  2EI6 B;  2J4I B;  2P3T A;  2VH0 B;  1PTH A;  1Z6C A;  1IQG L;  4BTU A;  2J2U B;  2BOH A;  2VWN L;  2UWP B;  2BOK L;  5K0H B;  2RNL A;  1EMO A;  1M1X B;  2D1J B;  4MMX B;  3KK6 A;  2JKH L;  3BT2 A;  1NFY B;  1UZP A;  3GIS X;  1QFK L;  2VWO L;  3BT1 A;  3V64 C;  1EBV A;  3KQE L;  4Y7A B;  1IQM L;  4D0E A;  4RRY A;  1DIY A;  2WPH E;  2I9B A;  2W86 A;  1FFM A;  1AUT L;  5I46 L;  2P3F L;  2Y38 A;  5COX A;  2VWL L;  1NFX B;  4CSY A;  4M10 A;  4E1G A;  4M11 A;  3F6U L;  4RRW A;  1HCG B;  1Q4G A;  1WHE A;  3TK6 B;  4Z0K B;  5CKQ A;  5E8D A;  5KN5 C;  1YUG A;  2W2Q E;  4Z6A L;  3RR3 A;  4X8U L;  4O1Z A;  1XDT R;  4Y6D B;  2BZ6 L;  1YO8 A;  1IP0 A;  2VH6 B;  4TGF A;  2G00 L;  3DEM A;  4NGA L;  1LPG A;  1EAI C;  2NPR A;  3M36 L;  1IQK L;  3R05 A;  1JV2 B;  1EGF A;  3LC3 B;  1ADX A;  5F19 A;  1HRE A;  1GK5 A;  1G1S A;  1EMN A;  3TH3 L;  1U8C B;  3TZI A;  4A7I A;  1C5M F;  3K9X A;  2W3K B;  1PGE A;  3ZYG A;  2P16 L;  2BOU A;  2Y5H L;  4G1M B;  3Q7D A;  1EQG A;  3SW2 A;  1FE2 A;  5JBA E;  2VVU L;  2VVV L;  1DDX A;  2XBY L;  4CUF A;  2WYJ B;  1F0R B;  5KIR A;  1G2M B;  3LTF B;  1LPK A;  4ZXX L;  2H9E L;  2WFX B;  3LTG D;  2PR3 B;  4JZD L;  1IQF L;  2KV4 A;  2P3U A;  3LAQ A;  3EGF A;  3TBD A;  1F7E A;  3SOB B;  1N7D A;  1B9W A;  4MMY B;  4RRZ A;  1MQ5 L;  3FBY A;  1NQL B;  2MGR A;  4C16 A;  5CKN A;  2K2T A;  3SOV A;  2XC0 L;  1IVO C;  1X7A L;  3LC5 B;  4YT7 L;  1ZAQ A;  2M74 A;  4ISI L;  3LIW B;  3N8W A;  2K2S B;  1G1Q A;  1IQN L;  4O02 B;  4JYU L;  5L2Y L;  1HT8 A;  1IQJ L;  2P26 A;  1DVA L;  2ADX A;  3U7U G;  3IJE B;  3OLT A;  4ZH8 B;  3HO4 A;  3KCG L;  1FF7 A;  4OTJ A;  1KSN B;  2Q1J B;  1TOZ A;  3F1S B;  5EGM B;  4ZHA B;  5IKT A;  5JW1 A;  1G1R A;  2YGO A;  1HAF A;  2P3F N;  3FCS B;  1L3Y A;  2WFT A;  3BPS E;  4Y71 B;  2B7D L;  2Y7X B;  3IIT B;  1OB1 C;  3KQD L;  1CCF A;  1I0U A;  1NFU B;  2BQ7 A;  1V3X B;  2VVC K;  3N8X A;  1HRF A;  3ZYI B;  2BMG A;  1LMJ A;  2FZZ L;  4JZF L;  2FD6 A;  1HZ8 A;  1IGZ A;  3V65 B;  1IJQ A;  1W7X L;  2F9B L;  1EPH A;  2MHP A;  1HAE A;  3N8Z A;  2W2M E;  1TLE A;  2TGF A;  4CUE A;  3LN0 A;  1MOX C;  1NT0 A;  2WYG B;  4XLW A;  1FAX L;  2EI7 B;  2W26 B;  3QH0 A;  3LN1 A;  4MMZ B;  2PUQ L;  3Q3K B;  1L5G B;  1MQ6 L;  4COX A;  3GCW E;  4OTY A;  2FLR L;  3NTB A;  3NTG A;  1NFW B;  3KQC L;  1IQI L;  5JB8 E;  4D0F A;  2UWL B;  2I9A A;  2VWM K;  4XBM A;  3POY A;  4BTT A;  1BF9 A;  3TK5 B;  3U73 A;  2J94 B;  2P95 L;  3NT1 A;  2YGP A;  2WPM E;  2WG4 B;  2Y5F L;  4JYV L;  1IQE L;  1IGX A;  4Y79 B;  1PFX L;  2CJI B;  1P0S L;  1A3P A;  1IQH L;  2FLG A;  4X8T L;  3CA7 A;  2KL7 A;  4X8V L;  1UZQ A;  1F7M A;  3N8Y A;  2J95 B;  4Z0L A;  1PRH A;  2Y80 B;  1ATA A;  1HJ7 A;  2J34 B;  2DDU A;  1TPG A;  1ATB A;  5L30 L;  4BDW A;  1PXX A;  4BXW A;  2W3I B;  1K37 A;  1WHF A;  3OLU A;  3QMO A;  3CFW A;  3P5B L;  2AYL A;  1ATD A;  1Z6E L;  3FFG L;  4XL1 A;  1CEJ A;  4RUT A;  3KRK A;  4D90 A;  1DX5 I;  5IKV A;  4CUD A;  1IOX A;  3ZYJ B;  2FLB L;  3KQB L;  3H5C B;  2WPI E;  3GCX E;  4PH9 A;  4NG9 L;  1G1T A;  4Y7B B;  2Y5G L;  1EPG A;  1HT5 A;  2WPJ E;  1IQL L;  1CVW L;  2UWO B;  1NPE B;  4X8S L;  3SOQ A;  3HS6 A;  1EQH A;  4RS0 A;  2XBW L;  1YGC L;  3QCW A;  5IKQ A;  1YUK B;  1G2L B;  2BO2 A;  1CQE A;  1SZB A;  2MGP A;  5IKR A;  4LMF A;  4BXS A;  2BQ6 A;  1RFN B;  1FJS L;  1YUF A;  3CEN L;  3HO5 A;  1APO A;  2WPK E;  1WU1 B;  1KLO A;  1U67 A;  1COU A;  1O5D L;  3TGF A;  1KIG L;  2W2O E;  4LOR A;  4ZAE B;  1ATE A;  1JL9 A;  3KL6 B;  5FDQ A;  2EI8 B;  2OYU P;  2PHB B;  4BDX A;  3N8V A;  1CVU A;  5JBB E;  1XFE A;  1N1I A;  1IOE L;  2W2P E;  3HPT A;  4YT6 L;  3M37 L;  1UZK A;  2P94 L;  4FM5 A;  1J9C L;  3HS5 A;  4Y76 B;  3HO3 A;  2RA0 L;  2WPL E;  1XKA L;  1W8B L;  3C9A C;  3N8Y B;  1EZQ B;  4AQT A;  1HX2 A;  1K36 A;  1JBU L;  1NZI A;  5JBC E;  1UZJ A;  1LQD A;  6COX A;  4BTI A;  4JZE L;  1CCV A;  4RRX A;  4ISH L;  2XBX L;  2XBV L;  4YZU B;  3HS7 A;  5L2Z L; 
#chains in the Genus database with same CATH topology
 2KB9 A;  1APQ A;  2GD4 A;  1KLI L;  5F1A A;  3N8W B;  5JVY A;  1KLJ L;  2P93 L;  5CKM A;  4NA9 L;  2P28 B;  2XC5 L;  3MQE A;  1EPI A;  1CX2 A;  1FAK L;  2OYE P;  2W2N E;  2BOX A;  2Y81 B;  3ENS A;  3NJP C;  1F0S B;  2Y7Z B;  2VJ3 A;  3ELA L;  1URK A;  1LPZ A;  3CS7 L;  2BT7 A;  2RHP A;  1P9J A;  2WG3 C;  3MDL A;  2BQW A;  2J38 B;  1QIU A;  1FSB A;  2Y82 B;  3PGH A;  4ZXY L;  5JB9 E;  5JVZ A;  1XKB A;  3ASI A;  1DQB A;  5CIS A;  1EPJ A;  2XC4 L;  2EI6 B;  2VRS A;  2J4I B;  2P3T A;  2VH0 B;  1PTH A;  1Z6C A;  1IQG L;  4BTU A;  2J2U B;  2BOH A;  2VWN L;  2UWP B;  2BOK L;  5K0H B;  2RNL A;  1EMO A;  1M1X B;  2D1J B;  4MMX B;  3KK6 A;  2JKH L;  3BT2 A;  1NFY B;  1KKE A;  1UZP A;  3GIS X;  1QFK L;  2VWO L;  3BT1 A;  3V64 C;  1EBV A;  3KQE L;  4Y7A B;  1IQM L;  4D0E A;  4RRY A;  1DIY A;  2WPH E;  2I9B A;  2W86 A;  1FFM A;  1AUT L;  5I46 L;  2P3F L;  2Y38 A;  5COX A;  2VWL L;  1NFX B;  4CSY A;  4M10 A;  4E1G A;  4M11 A;  3F6U L;  4RRW A;  1HCG B;  1Q4G A;  1WHE A;  3TK6 B;  4Z0K B;  5CKQ A;  5E8D A;  5KN5 C;  1YUG A;  2W2Q E;  4Z6A L;  3RR3 A;  4X8U L;  4O1Z A;  1XDT R;  4Y6D B;  2BZ6 L;  1YO8 A;  1IP0 A;  2HOX A;  2VH6 B;  4TGF A;  2G00 L;  3DEM A;  4NGA L;  1LPG A;  1EAI C;  2NPR A;  3M36 L;  1IQK L;  3R05 A;  1JV2 B;  1EGF A;  3LC3 B;  1ADX A;  5F19 A;  1HRE A;  1GK5 A;  1G1S A;  1EMN A;  3TH3 L;  2WZP P;  1U8C B;  3TZI A;  4A7I A;  1C5M F;  3K9X A;  2W3K B;  1PGE A;  2YGQ A;  3ZYG A;  2P16 L;  2BOU A;  2Y5H L;  4G1M B;  3Q7D A;  1EQG A;  3SW2 A;  1FE2 A;  5JBA E;  2VVU L;  2VVV L;  1DDX A;  2XBY L;  4CUF A;  2WYJ B;  1F0R B;  5KIR A;  1G2M B;  3LTF B;  1LPK A;  4ZXX L;  2H9E L;  2WFX B;  3LTG D;  2PR3 B;  4JZD L;  2HOR A;  1IQF L;  2KV4 A;  2P3U A;  3LAQ A;  3EGF A;  4GU4 A;  3TBD A;  1F7E A;  3SOB B;  1N7D A;  1B9W A;  4MMY B;  4RRZ A;  1MQ5 L;  3FBY A;  4GU3 A;  1NQL B;  2MGR A;  4C16 A;  5CKN A;  2K2T A;  3SOV A;  2XC0 L;  1IVO C;  1X7A L;  3LC5 B;  4YT7 L;  1ZAQ A;  2M74 A;  4ISI L;  3LIW B;  3N8W A;  2K2S B;  1G1Q A;  1IQN L;  4O02 B;  4JYU L;  5L2Y L;  1HT8 A;  1IQJ L;  2P26 A;  1DVA L;  1V1H A;  2ADX A;  3U7U G;  3IJE B;  3OLT A;  4ZH8 B;  3HO4 A;  2KNI A;  3KCG L;  1FF7 A;  4OTJ A;  1KSN B;  2Q1J B;  1TOZ A;  3F1S B;  5EGM B;  4ZHA B;  5IKT A;  5JW1 A;  1V1I A;  1G1R A;  2YGO A;  1HAF A;  2P3F N;  3FCS B;  1L3Y A;  2WFT A;  3BPS E;  4Y71 B;  2B7D L;  2Y7X B;  3IIT B;  1OB1 C;  3KQD L;  1CCF A;  1I0U A;  1NFU B;  2BQ7 A;  1V3X B;  2VVC K;  3N8X A;  1HRF A;  3ZYI B;  2BMG A;  1LMJ A;  2FZZ L;  4JZF L;  2FD6 A;  1HZ8 A;  1IGZ A;  3V65 B;  1IJQ A;  1W7X L;  2F9B L;  1EPH A;  2MHP A;  1HAE A;  3N8Z A;  2W2M E;  1TLE A;  2TGF A;  4CUE A;  3LN0 A;  1MOX C;  1NT0 A;  2WYG B;  4XLW A;  1FAX L;  2EI7 B;  2W26 B;  3QH0 A;  3LN1 A;  2PUQ L;  4MMZ B;  3Q3K B;  1L5G B;  1MQ6 L;  4COX A;  3GCW E;  4OTY A;  2FLR L;  3NTB A;  3NTG A;  1NFW B;  3KQC L;  1IQI L;  5JB8 E;  4D0F A;  2UWL B;  2I9A A;  2VWM K;  4XBM A;  3POY A;  4BTT A;  1BF9 A;  1LMM A;  3TK5 B;  3U73 A;  2J94 B;  2P95 L;  3NT1 A;  2YGP A;  2JJL A;  2WPM E;  2WG4 B;  2Y5F L;  4JYV L;  1IQE L;  1IGX A;  4Y79 B;  1PFX L;  2CJI B;  1P0S L;  1A3P A;  1IQH L;  2FLG A;  4X8T L;  3CA7 A;  2KL7 A;  4X8V L;  1UZQ A;  1F7M A;  3N8Y A;  2J95 B;  4Z0L A;  1PRH A;  2Y80 B;  1ATA A;  1HJ7 A;  2J34 B;  2DDU A;  1TPG A;  1ATB A;  5L30 L;  4BDW A;  1PXX A;  2H9E C;  4BXW A;  2W3I B;  1K37 A;  1WHF A;  3OLU A;  3QMO A;  3CFW A;  3P5B L;  2AYL A;  1ATD A;  1Z6E L;  3FFG L;  4XL1 A;  1CEJ A;  4RUT A;  3KRK A;  4D90 A;  1DX5 I;  2BSF A;  5IKV A;  4CUD A;  1IOX A;  3ZYJ B;  2FLB L;  3KQB L;  3H5C B;  2WPI E;  3GCX E;  4PH9 A;  4NG9 L;  1G1T A;  4Y7B B;  2Y5G L;  1EPG A;  1HT5 A;  2WPJ E;  1IQL L;  1CVW L;  2UWO B;  1NPE B;  4X8S L;  3SOQ A;  3HS6 A;  1EQH A;  4RS0 A;  2XBW L;  4A94 C;  1YGC L;  3QCW A;  3S6X A;  5IKQ A;  1YUK B;  1G2L B;  2BO2 A;  1CQE A;  1SZB A;  2MGP A;  5IKR A;  4LMF A;  4BXS A;  2BQ6 A;  1RFN B;  1FJS L;  1YUF A;  3CEN L;  3HO5 A;  1APO A;  2WPK E;  1WU1 B;  1KLO A;  1U67 A;  1COU A;  1O5D L;  3TGF A;  1KIG L;  2W2O E;  4LOR A;  4ZAE B;  1ATE A;  1JL9 A;  3KL6 B;  5FDQ A;  2EI8 B;  2OYU P;  2PHB B;  4BDX A;  2BT8 A;  3N8V A;  1CVU A;  5JBB E;  1XFE A;  1N1I A;  1IOE L;  2W2P E;  3HPT A;  4YT6 L;  3M37 L;  1UZK A;  2P94 L;  4FM5 A;  1J9C L;  3HS5 A;  4Y76 B;  3HO3 A;  2RA0 L;  2WPL E;  1XKA L;  1W8B L;  3C9A C;  3N8Y B;  1EZQ B;  4AQT A;  1HX2 A;  1K36 A;  1JBU L;  1NZI A;  5JBC E;  1UZJ A;  1LQD A;  6COX A;  4BTI A;  1LK9 A;  4JZE L;  1CCV A;  4RRX A;  4ISH L;  2XBX L;  2XBV L;  4YZU B;  3HS7 A;  5L2Z L; 
#chains in the Genus database with same CATH homology
 2KB9 A;  1APQ A;  2GD4 A;  1KLI L;  5F1A A;  3N8W B;  5JVY A;  1KLJ L;  2P93 L;  5CKM A;  4NA9 L;  2P28 B;  2XC5 L;  3MQE A;  1EPI A;  1CX2 A;  1FAK L;  2OYE P;  2W2N E;  2BOX A;  2Y81 B;  3ENS A;  3NJP C;  1F0S B;  2Y7Z B;  2VJ3 A;  3ELA L;  1URK A;  1LPZ A;  3CS7 L;  2RHP A;  1P9J A;  2WG3 C;  3MDL A;  2BQW A;  2J38 B;  1FSB A;  2Y82 B;  3PGH A;  4ZXY L;  5JB9 E;  5JVZ A;  1XKB A;  3ASI A;  1DQB A;  5CIS A;  1EPJ A;  2XC4 L;  2EI6 B;  2J4I B;  2P3T A;  2VH0 B;  1PTH A;  1Z6C A;  1IQG L;  4BTU A;  2J2U B;  2BOH A;  2VWN L;  2UWP B;  2BOK L;  5K0H B;  2RNL A;  1EMO A;  1M1X B;  2D1J B;  4MMX B;  3KK6 A;  2JKH L;  3BT2 A;  1NFY B;  1UZP A;  3GIS X;  1QFK L;  2VWO L;  3BT1 A;  3V64 C;  1EBV A;  3KQE L;  4Y7A B;  1IQM L;  4D0E A;  4RRY A;  1DIY A;  2WPH E;  2I9B A;  2W86 A;  1FFM A;  1AUT L;  5I46 L;  2P3F L;  2Y38 A;  5COX A;  2VWL L;  1NFX B;  4CSY A;  4M10 A;  4E1G A;  4M11 A;  3F6U L;  4RRW A;  1HCG B;  1Q4G A;  1WHE A;  3TK6 B;  4Z0K B;  5CKQ A;  5E8D A;  5KN5 C;  1YUG A;  2W2Q E;  4Z6A L;  3RR3 A;  4X8U L;  4O1Z A;  1XDT R;  4Y6D B;  2BZ6 L;  1YO8 A;  1IP0 A;  2VH6 B;  4TGF A;  2G00 L;  3DEM A;  4NGA L;  1LPG A;  1EAI C;  2NPR A;  3M36 L;  1IQK L;  3R05 A;  1JV2 B;  1EGF A;  3LC3 B;  1ADX A;  5F19 A;  1HRE A;  1GK5 A;  1G1S A;  1EMN A;  3TH3 L;  2WZP P;  1U8C B;  3TZI A;  4A7I A;  1C5M F;  3K9X A;  2W3K B;  1PGE A;  2YGQ A;  3ZYG A;  2P16 L;  2BOU A;  2Y5H L;  4G1M B;  3Q7D A;  1EQG A;  3SW2 A;  1FE2 A;  5JBA E;  2VVU L;  2VVV L;  1DDX A;  2XBY L;  4CUF A;  2WYJ B;  1F0R B;  5KIR A;  1G2M B;  3LTF B;  1LPK A;  4ZXX L;  2H9E L;  2WFX B;  3LTG D;  2PR3 B;  4JZD L;  1IQF L;  2KV4 A;  2P3U A;  3LAQ A;  3EGF A;  3TBD A;  1F7E A;  3SOB B;  1N7D A;  1B9W A;  4MMY B;  4RRZ A;  1MQ5 L;  3FBY A;  1NQL B;  2MGR A;  4C16 A;  5CKN A;  2K2T A;  3SOV A;  2XC0 L;  1IVO C;  1X7A L;  3LC5 B;  4YT7 L;  1ZAQ A;  2M74 A;  4ISI L;  3LIW B;  3N8W A;  2K2S B;  1G1Q A;  1IQN L;  4O02 B;  4JYU L;  5L2Y L;  1HT8 A;  1IQJ L;  2P26 A;  1DVA L;  2ADX A;  3U7U G;  3IJE B;  3OLT A;  4ZH8 B;  3HO4 A;  2KNI A;  3KCG L;  1FF7 A;  4OTJ A;  1KSN B;  2Q1J B;  1TOZ A;  3F1S B;  5EGM B;  4ZHA B;  5IKT A;  5JW1 A;  1G1R A;  2YGO A;  1HAF A;  2P3F N;  3FCS B;  1L3Y A;  2WFT A;  3BPS E;  4Y71 B;  2B7D L;  2Y7X B;  3IIT B;  1OB1 C;  3KQD L;  1CCF A;  1I0U A;  1NFU B;  2BQ7 A;  1V3X B;  2VVC K;  3N8X A;  1HRF A;  3ZYI B;  2BMG A;  1LMJ A;  2FZZ L;  4JZF L;  2FD6 A;  1HZ8 A;  1IGZ A;  3V65 B;  1IJQ A;  1W7X L;  2F9B L;  1EPH A;  2MHP A;  1HAE A;  3N8Z A;  2W2M E;  1TLE A;  2TGF A;  4CUE A;  3LN0 A;  1MOX C;  1NT0 A;  2WYG B;  4XLW A;  1FAX L;  2EI7 B;  2W26 B;  3QH0 A;  3LN1 A;  4MMZ B;  2PUQ L;  3Q3K B;  1L5G B;  1MQ6 L;  4COX A;  3GCW E;  4OTY A;  2FLR L;  3NTB A;  3NTG A;  1NFW B;  3KQC L;  1IQI L;  5JB8 E;  4D0F A;  2UWL B;  2I9A A;  2VWM K;  4XBM A;  3POY A;  4BTT A;  1BF9 A;  1LMM A;  3TK5 B;  3U73 A;  2J94 B;  2P95 L;  3NT1 A;  2YGP A;  2WPM E;  2WG4 B;  2Y5F L;  4JYV L;  1IQE L;  1IGX A;  4Y79 B;  1PFX L;  2CJI B;  1P0S L;  1A3P A;  1IQH L;  2FLG A;  4X8T L;  3CA7 A;  2KL7 A;  4X8V L;  1UZQ A;  1F7M A;  3N8Y A;  2J95 B;  4Z0L A;  1PRH A;  2Y80 B;  1ATA A;  1HJ7 A;  2J34 B;  2DDU A;  1TPG A;  1ATB A;  5L30 L;  4BDW A;  1PXX A;  2H9E C;  4BXW A;  2W3I B;  1K37 A;  1WHF A;  3OLU A;  3QMO A;  3CFW A;  3P5B L;  2AYL A;  1ATD A;  1Z6E L;  3FFG L;  4XL1 A;  1CEJ A;  4RUT A;  3KRK A;  4D90 A;  1DX5 I;  5IKV A;  4CUD A;  1IOX A;  3ZYJ B;  2FLB L;  3KQB L;  3H5C B;  2WPI E;  3GCX E;  4PH9 A;  4NG9 L;  1G1T A;  4Y7B B;  2Y5G L;  1EPG A;  1HT5 A;  2WPJ E;  1IQL L;  1CVW L;  2UWO B;  1NPE B;  4X8S L;  3SOQ A;  3HS6 A;  1EQH A;  4RS0 A;  2XBW L;  4A94 C;  1YGC L;  3QCW A;  3S6X A;  5IKQ A;  1YUK B;  1G2L B;  2BO2 A;  1CQE A;  1SZB A;  2MGP A;  5IKR A;  4LMF A;  4BXS A;  2BQ6 A;  1RFN B;  1FJS L;  1YUF A;  3CEN L;  3HO5 A;  1APO A;  2WPK E;  1WU1 B;  1KLO A;  1U67 A;  1COU A;  1O5D L;  3TGF A;  1KIG L;  2W2O E;  4LOR A;  4ZAE B;  1ATE A;  1JL9 A;  3KL6 B;  5FDQ A;  2EI8 B;  2OYU P;  2PHB B;  4BDX A;  3N8V A;  1CVU A;  5JBB E;  1XFE A;  1N1I A;  1IOE L;  2W2P E;  3HPT A;  4YT6 L;  3M37 L;  1UZK A;  2P94 L;  4FM5 A;  1J9C L;  3HS5 A;  4Y76 B;  3HO3 A;  2RA0 L;  2WPL E;  1XKA L;  1W8B L;  3C9A C;  3N8Y B;  1EZQ B;  4AQT A;  1HX2 A;  1K36 A;  1JBU L;  1NZI A;  5JBC E;  1UZJ A;  1LQD A;  6COX A;  4BTI A;  4JZE L;  1CCV A;  4RRX A;  4ISH L;  2XBX L;  2XBV L;  4YZU B;  3HS7 A;  5L2Z L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...