1YO8A

Structure of the c-terminal domain of human thrombospondin-2
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
621
structure length
621
Chain Sequence
DGCLSNPCFPGAQCSSFPDGSWSCGFCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords thrombospondin-2
publication title Structure of the calcium-rich signature domain of human thrombospondin-2
pubmed doi rcsb
source organism Homo sapiens
total genus 165
structure length 621
sequence length 621
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02412 TSP_3 Thrombospondin type 3 repeat
A PF05735 TSP_C Thrombospondin C-terminal region
A PF07645 EGF_CA Calcium-binding EGF domain
A PF12947 EGF_3 EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yo8A05
1AX1A 3AK0A 2SLIA 3D4KA 1IS6A 2VW1A 1Z78A 1MZ5A 2P16L 3ZSMA 2A3WA 5GZFA 1HRFA 3N8YB 1TPGA 2EI7B 4BXSA 4ASMB 3WNXA 1Q4GA 3LAQA 4ATFA 4XIKA 4M00A 1W6QB 1NZIA 2VH6B 4Y26A 1LQDA 3SOBB 5GZEA 4JZFL 2GNTA 3OYWB 1WHFA 4XHBA 5CNAA 1AJKA 1UN1A 4ZKTB 1JUIA 2P37A 4XIOA 1K37A 4XJZA 1CCFA 2VVCK 2CWSA 2DTWA 5E8DA 2WJSA 4P14A 4FPHA 4Y1VA 2P3KA 1N47A 2I9AA 2EXKA 2P34A 2NMOA 4Q8LA 4YGBA 1CONA 2ZHKA 5E88A 4BMBA 4PBPA 4AVVA 1Z0HA 2Y7ZB 2BOXA 1Q56A 3MW4A 3HO5A 4HL0A 5JOXA 3NJPC 4XJWA 3MQEA 4BQ1A 1UPSA 4BM8A 2VJ3A 1Q8VA 3IPVA 1APOA 3CNAA 5DZFA 2UWPB 3NT1A 1S1AA 2AH2A 3KQEL 1SBDA 4BDWA 2FHRA 2BOKL 3OLTA 1CX2A 5FDQA 1LCLA 3AXEA 3OBTA 4IQPA 1LODA 2EF6A 3OLUA 2PHFA 1V6LA 4GA9A 3GISX 2EXJA 4Q2FA 2Y5FL 1PGEA 1NPEB 4A7IA 4ZH8B 2P3UA 4E1GA 1BZWA 3IKWA 1W8BL 3V65B 4NA9L 1KJLA 1FV2A 2YV8A 4YM0A 2PHTA 2GN7A 1OKQA 1LULA 1XQNA 3AFKA 1N3QA 1U8CB 2UU8A 2BOUA 3APBA 2XG3A 4YW1A 1UZZA 1FATA 3NV3A 1Y7BA 1DIWA 5L73A 1DQ4A 4YZ4A 4Q27A 4R9BA 3N7KA 4FQZA 2KM2A 2VWMK 2RNLA 3Q7DA 2EIGA 3D6EA 1SBFA 3LN1A 3N7LA 3W59A 1LOGA 1DQ6A 1Z6CA 1W6PB 4D0EA 3V0BA 3IJEB 2EAKA 4YLZA 2J2UB 1LEMA 4R9DA 1UKGA 5T50A 3A0NA 1UZQA 5GLVA 5DUXA 1N3PA 5CA6A 5GLUA 2NP0A 2AYHA 4Q1RA 4R9CA 2J34B 1F0RB 2WT0A 1GSLA 1ADXA 3SH5A 1RIRA 3RMYA 1KLIL 3AYCA 4C1WA 3L2YA 1A8DA 5CAZA 2NZ9A 4FPCA 1EPWA 1GANA 2GMEA 2ZZJA 3PJQA 4XBMA 1V6IA 4FP2A 1JYCA 5F5QA 2RA0L 2WG3C 2W2NE 3ZYJB 3HO4A 5DZEA 3ILRA 4Q8KA 2JKHL 1C1FA 4LBQB 1CN1A 4PCRA 3VKFC 1LPKA 1LOAA 2G00L 2A6WA 3LSDA 2GMMA 1KLOA 1EBVA 4D69A 4LMFA 4FM5A 2DU1A 1G86A 2JDZA 5GJ6A 3BOPA 2Y7XB 4FOVA 2CY6A 2XC4L 1C4RA 4YZ2A 4JZDL 3QCWA 2RHPA 3AJYA 2AGSA 4X8TL 1G1TA 2AENA 3PMEA 2NM1A 1JOJA 2PHBB 3F1SB 2NYYA 1JXNA 3WG3A 1LU2A 2PR3B 2YY1A 4Z6AL 3WDTA 1O4YA 3TK6B 4MMYB 5T54A 2MGPA 2DVAA 4Y71B 1NLSA 3UL2A 3NWKA 1HX2A 5EYYA 3ILFA 2ZGUA 2BQPA 2ZA9A 4XYXA 3O0VA 2ZMNA 2W3KB 3TB0A 3ILNA 3M1HA 1MS0A 4U2AA 1HZ8A 2P26A 2OUHA 1FAXL 1XKAL 2YMZA 3WVJA 1COUA 3SW2A 1U67A 1V6JA 2ZACA 2D7FA 3N3HA 1H30A 2A3YA 1UX6A 4PBOA 5KXEA 3WHTA 3AP7A 1UZJA 2ADXA 4XXAA 4FPFA 2DDUA 3MPPG 2XC5L 1IQML 2YZ4A 4YFZA 4LBQD 1JW6A 1GZCA 2H9EL 3FUOA 4XMIA 4CUFA 2I2SA 3VKNA 4JCKA 1KSNB 2ZBJA 1SLIA 3CS7L 4YM3A 4BTIA 2BQ7A 4BPZA 2K2TA 1ZA4A 3C2UA 3O12A 4YG0A 2DUOA 3IITB 4XE9A 2J4IB 1WUVA 2GDFA 4W65A 4Y22A 3SH4A 1JYIA 2R49A 4Y1UA 3BT1A 3O0XA 5H9RA 4ISRA 2E51A 1SBEA 1AJOA 1A3KA 1LGCA 2JD4A 2XBVL 1F7MA 2ZAAA 1G7YA 4P9WA 2OW4A 3RQ0A 2ZGLA 4Y6DB 4Y24A 2E53A 2WLQA 1W6OA 2I9BA 2VH0B 4XBNA 1MVQA 2ZGKA 4YGEA 2YXSA 2ZHLA 3Q3KB 1D2SA 3U4XA 5JOWA 1AZDA 1EMNA 2VUAA 2P28B 1G9CA 1V6KA 2D3RA 1DBNA 4AGRA 2MGRA 2D6PA 5JLVA 1B09A 1AXKA 3I4IA 4H55A 5KXCA 3ZXLA 3USUA 5IUQA 1EGFA 1BF9A 2G4IA 2V5YA 4FP3A 4XZPA 4YFWA 2UWCA 3FUQA 3SISA 2WG4B 2XBYL 2JECA 1A3PA 4BOWA 1G8WA 2DUQA 3JUUA 2BQ6A 2VW2A 4LBJA 3BTAA 3KQBL 5T55A 1AF9A 1IS4A 3U73A 1MS3A 1APNA 2P2KA 4Y20A 1J9CL 5GALA 1WW5A 4Z0KB 5KXBA 3SLIA 4AGGA 2YGPA 2Y82B 4U36A 1KQRA 3WG4A 5GLZA 4AVSA 4YGDA 1MZ6A 1DYKA 2A3XA 3FLTA 4CUDA 3FLRA 4AQTA 1LHVA 1I0UA 4RRZA 1P9JA 2XB6C 3ZYRA 2PHWA 3TAYA 3OBRA 2D6MA 4LBKA 4Z0LA 3I8TA 5CB7A 2TGFA 2W08A 5F19A 2FLRL 1IOAA 1C57A 1JHNA 2ZMKA 4P9YA 2ZGRA 2NPRA 1GICA 1ATDA 4M3CB 1A78A 1PTHA 3LTGD 1NXD1 3NV1A 4M3CF 1AUTL 3M3EA 4YT7L 4UW4A 1LU1A 5JVYA 3TBDA 3ZSJA 2NMNA 3BODA 1RFNB 3ZPYA 4NOTA 2A6XA 4YM2A 2Y81B 2FLBL 2UWOB 2UWLB 2E7QA 4BLIA 4K1ZA 1VAVA 1MS4A 3AP9A 1ENQA 3T1MA 5GLTA 1YO8A 5H9PA 1FAYA 1LEDA 1WLDA 4XTPA 3CFWA 3ZXKA 2BZ6L 1DHKB 4R9AA 3N8WA 1SZBA 2DWRA 1L5GB 3V0AB 4Y79B 4AVTA 1EAIC 1QFKL 4C16A 3A0KA 2GMPA 1IOEL 1URXA 1IS3A 1O5DL 3N8ZA 2DYCA 4M01A 3AX4A 1UL9A 3AZXA 5E89A 3H5CB 4XOGA 4RL7A 1NFUB 3OY8A 1O4ZA 1FSBA 3AZZA 4C1XA 2DVFA 2D6KA 2WPLE 3ELAL 4FVVA 4Q1PA 2C9AA 1LHOA 4BLJA 3LTFB 3AXDA 1HT5A 3GCWE 3B00A 1BYHA 1CIWA 2WT2A 1VAMA 3WLUA 3IMNA 3N7JA 3R05A 5IKQA 1MOXC 1OB1C 4FOWA 1JBUL 5DG1A 1DQ2A 1IQJL 1LPGA 1CQEA 3KM5A 1WD4A 1BXHA 3AJZA 5EXOA 4PF5A 3AP6A 3K9XA 5DZGA 2R1BA 4DRVA 1EMOA 3IPVB 2WSUA 3SNMA 3KCGL 2A70A 1DFQA 2Y5GL 4XJAA 4LORA 2ZKNA 2A6ZA 3VKLA 1LPZA 4DPNA 4TGFA 2W52A 2JE7A 1YI7A 3OPZA 4XL1A 1WW7A 4MMXB 5GZDA 2B7DL 2B7YA 4OZXA 2W3IB 2WPIE 3N35A 1G1RA 1M1XB 3MW2A 1MR5A 1HLCA 1CVUA 1Q8OA 3UJOA 4JYVL 1MS1A 1WCSA 1W0OA 4KBBA 3QLQA 3RRDA 4D0FA 3M36L 3WDXA 4FPYA 1QDOA 1G2LB 4YZ1A 5AVAA 1IQNL 4YW3A 5LK5A 3V0BB 2PHXA 3B3QE 2WPHE 1ATAA 3U7UG 1V00A 4XBLA 2E6VA 5L30L 3OGGA 1DVAL 1W6MA 1HQLA 2A7AA 3POYA 5JBAE 3GNEA 1KLJL 1LECA 1UZPA 4ATEA 6COXA 3RSJA 1QKQA 1SFYA 2A6YA 1KDKA 1DQ1A 1FNZA 5DUWA 2VWNL 2ZABA 1SLAA 3B01A 1IVOC 1FFMA 1D0HA 5H9QA 3UJQA 3WV6A 2W68A 4YZ3A 4ZXXL 1TLEA 1J1TA 3GCXE 2WSVA 1EPGA 1APQA 1TOZA 3CA7A 2AREA 5JB8E 3M3OA 1NQLB 3B69A 1MS5A 2FMDA 2KV4A 2BO2A 2WQZC 2K2SB 4GALA 1F9KA 3KRKA 1PXXA 3KK6A 3TH3L 2M74A 2V73A 2FD6A 5I46L 1S0CA 3AYAA 3QH0A 5T5JA 3C9AC 1SCSA 1W6NA 2ERFA 3NTGA 1DQBA 1BKZA 1WW4A 1IGXA 2WYJB 1DIYA 4FPKA 1ENRA 2EXHA 3AP4A 3MEPA 1LGBA 3T2TA 1UMZA 4L8QA 4P9XA 1G9AA 2XBWL 2OVUA 3NV4A 1QMJA 1LJ7A 1S0IA 1IQHL 3BPSE 1AXYA 1PZ9A 2P3TA 1EQGA 1DZQA 2WPME 5DUVA 5EYXA 5IK4A 3AYDA 1CVWL 2CWMA 2ARXA 1GZWA 4SLIA 2A75A 4FPOB 1CVNA 1LHWA 5EWSA 4DQAA 5GZGA 1P0SL 1YUKB 3RS6A 2DUPA 3POSA 5HCFA 2R0FA 1IKQA 4DS0A 1JN2P 4DRRA 1IP0A 4OTJA 2A71A 2ES3A 2ENRA 3HPTA 4Y1ZA 1IGZA 2HYKA 4XJUA 1CQ9A 1AX2A 1XFEA 5E8AA 3WCRA 3SH3A 1KITA 1S0BA 3V64A 1X7AL 1C5MF 2WFXB 2OYUP 3M3QA 3FFGL 2EXIA 1ULFA 4CUEA 2D3PA 4Y1YA 5T52A 4GKYA 2VXRA 3HR9A 5CBLA 4I30A 5HCBA 5JOZA 5FREA 4ZAEB 1Q8SA 3VV1A 1NFXB 2Q5TA 3WDUA 1IQEL 2OUJA 1N1SA 1F5FA 4RRYA 1IJQA 4Y22B 3CENL 3AZYA 1MS8A 1V6OA 3WG1A 2VH9A 4BTUA 1HAEA 2J94B 2Z42A 3IM0A 4Y7AB 1DX5I 5KXDA 3KL6B 3ZVXA 4HANA 1R1ZA 2ZHMA 1ONAA 4CZSA 2PHRA 3UK9A 1W6OB 1LENA 2EALA 2F9BL 2CTVA 2PUQL 2CYFA 1YUGA 1YRZA 1URKA 4YZUB 5JMCA 4XDQA 4ISQA 3ATGA 1WLWA 3HS6A 5JBBE 2J38B 4DFSA 1ZAQA 1MQ6L 2P3FL 1L3YA 1SLBA 1HCGB 3LN0A 4ISHL 3USUB 4YZ5A 2GN3A 5DXDA 1YGCL 3LIWB 1HT8A 3WDVA 2P3IA 1N1VA 1DQ0A 1ATEA 1LGNA 1YYNA 1GNZA 4XTMA 3WDWA 1Z6EL 2Y38A 4RA0A 4D90A 3PVNA 3N8YA 5CISA 2Q1JB 3N8XA 2D43A 2VVVL 2D3SA 2E7TA 1S0GA 1X50A 1CCVA 1W6QA 5CKNA 2W26B 2D44A 3N36A 1GLHA 2J95B 1GNHA 3OYWA 1PFXL 4TYSA 3PVEA 4AGVA 4Y20B 4XILA 1CPMA 5KIRA 2BQWA 5HCAA 3LCPA 5JVVA 2KL7A 1AX0A 4X8UL 1IOXA 3AP5A 3RR3A 4ZXYL 3Q9OA 4Q26A 3SITA 1FYUA 1I3HA 2XBXL 2P3FN 5GZCA 4JZEL 2YROA 2AUYA 3QMOA 1HAFA 4M10A 3MDLA 2ZGQA 1SACA 2P94L 2ZGTA 3A4UA 4OTYA 5IKTA 3VKOA 4M3CE 1GBGA 1AXZA 3RMXA 1I1EA 1S0DA 4GWNA 2PHUA 1W7XL 5K0HB 1WD3A 2R0HA 4ZXKA 2FLGA 2WYGB 1ENSA 4AYUA 2GALA 3V65A 4K20A 1ULEA 2P93L 2VWLL 5F1AA 3INAA 4YGCA 5SV8A 1CJPA 1LMJA 2DU0A 3AYEA 3B9CA 3LC3B 3TGFA 2H0BA 1HQWA 1WU1B 1UZKA 3N8WB 1QU0A 2ZGMA 1N1IA 1WHEA 4JYUL 3WOGA 2NN8A 1IQGL 1LOFC 3KQRA 5JB9E 3FFZA 1EPHA 3NV2A 5BYNA 1PRHA 3DEMA 2ZHNA 1KIGL 2ZGOA 2WKKA 1BJQA 2JE9A 2WNEA 1XDTR 1W6PA 2UURA 4UW6A 4X8SL 1MQ5L 4X8VL 1LHUA 3M3CA 1FF7A 4AWDA 3MW3A 3OY8B 2CNAA 2W2QE 5EGMB 2DURA 1YUFA 5COXA 2OYEP 3WCSA 1DGLA 5IKVA 2W2OE 4WV8A 4O1ZA 2EI6B 1CPNA 2LTNA 3P5BL 1DDXA 2UWAA 1LOCA 1QNYA 2GNDA 3R4SA 4JRAA 3FLPA 1U0AA 4NG9L 3KQDL 4FPLA 3TZIA 2EI8B 3ZYGA 2JKBA 5DUUA 2D6OX 4FOQA 3HS5A 3NTBA 1H9PA 4CTEA 4LBQA 4XBQA 3GALA 4COXA 1PZ7A 5H9SA 2W2PE 1OFSA 2XC0L 3ZXJA 3V64C 5IK5A 4PH9A 1EQHA 1ZM1A 2R1DA 1LOBA 1CEJA 1Q8PA 2C5DA 5GLWA 1IQLL 5CKQA 1RITA 2D1JB 1FNYA 1QOTA 1N7DA 4ISIL 3AZWA 5CKMA 5JVZA 4BDXA 3VKMA 1N1TA 1CR7A 3RG0A 5T5LA 1JV2B 1LTEA 1FAKL 2ARBA 1NFWB 1N1YA 3HMYA 1FE2A 4RRXA 3ZXFA 3T1LA 1CESA 4GXLA 1S0JA 4G1MB 1EPJA 3EGFA 1IKPA 1DYPA 2A6VA 3O5SA 3DUIA 3R4UA 1QDCA 4LBOA 4FQ4A 3WG2A 4FPEA 4Y76B 2A5ZA 2WFTA 2W39A 4Y7BB 1LHNA 3BT2A 1VLNA 1NFYB 4RS0A 2DV9A 2VW0A 4LBNA 4YW4A 1FJSL 1QOOA 2BMGA 1W6MB 3BIWE 1G9BA 4K21A 4GKXA 1IQIL 4RUTA 4CRQA 4XLWA 1LESA 5T5OA 1Q8QA 4FOYA 3M37L 3POWA 5JOYA 1HREA 1F7EA 5JDBA 3O0WA 2BOHA 1LOEA 1LOFA 2AR6A 3ENSA 2DVGA 1F31A 3WDYA 1QNWA 4LBLA 5IK8A 4XHXA 3ASIA 2FZZL 3F6UL 4XXPA 2WPKE 4YT6L 2DTYA 3PVOA 1YIFA 3WUDA 3D5OA 1SLLA 2WPJE 3FBYA 3HN1A 1MS9A 5IK7A 1YXWA 1AVBA 5JW1A 5DG2A 2DVDA 4Z8BA 3WUCA 3LC5B 3VUOA 1GZ9A 4CSYA 4YG6A 1V6MA 1UZYA 2W2ME 1W6NB 2P95L 1GYKA 1GV9A 1ATBA 1KDMA 4XMAA 5FRAA 3AZVA 4M11A 1NT0A 4NO4A 5L2ZL 1HJ7A 1PZ8A 1WLCA 4LBMA 1ULGA 4WVVA 3N8VA 3TK5B 1UAIA 5F9TA 2ZGNA 2D6LX 3DGTA 1IQFL 4ITCA 1TEIA 2CL2A 4UW5A 2CJIB 3ENRA 2ZMLA 4YW5A 3ZYPA 4YW2A 4NGAL 4O02B 1HDKA 2VWOL 2LALA 1S0FA 2GNMA 3ZSKA 1WW6A 5KN5C 1H9WA 3N7MA 4GWMA 1V6NA 3HO3A 1GZWB 3PGHA 3ZXEA 2DVBA 1DQ5A 5GM0A 1QF3A 4F83A 3ZYIB 4JC1A 2P3JA 2PELA 1G9DA 2GNBA 2ZGPA 2VVUL 4UW3A 1VIWB 2ZGSA 1WBFA 1JBCA 2VU9A 4FPJA 5JBCE 4BXWA 4YM1A 3KQCL 2D6NA 2KB9A 1K36A 1EZQB 3ZSLA 2GD4A 1XKBA 4MMZB 2JJ6A 1N3OA 4RRWA 2W86A 4K1YA 4PQ9A 1WBLA 2MHPA 3OJBA 2R16A 4XJ8A 2WT1A 2SBAA 3FCSB 4TZDA 1B9WA 1IS5A 4ZHAB 3LSEA 1MVEA 5L2YL 1V3XB 1F0SB 3SOVA 3IN9A 2TEPA 1FV3A 1IQKL 2Y5HL 3HS7A 1VALA 1KRIA 4M3CA 2VY0A 3W58A 4MYEA 4WZFA 1ULCA 2Y80B 4XJ9A 4Y1XA 1G2MB 1C1LA 1DLLA 2AYLA 1GKBA 1FX5A 1BQPA 4BTTA 4FPGA 4WVWA 1QOSA 2YGOA 1W0PA 1GK5A 1JL9A 3WZ1A 1MACA 1KJRA 2UWBA 3M2MA 1EPIA 3JU9A 1OQ1A 5IKRA 4YG3A 1QGLA 1HKDA 1G1SA 5T5PA 1S0EA 1RINA 1ULDA 3SOQA 3V0AA 1G9FA 1SLCA 3H0OA 4BMEA 5IT6A 1SCRA 3WHUA 1G1QA 1SLTA
chains in the Genus database with same CATH superfamily
2PAMA 1AX1A 1SQ4A 2SLIA 3AK0A 3D4KA 1EAH1 1UY1A 1IS6A 2RDSA 2VW1A 1Z78A 1CZTA 3OGJA 4JGYC 3WQBA 1MZ5A 1OVSA 1HRV1 3ETQA 2P16L 5BNNC 5K7PA 2A73B 5CFCC 2VCAA 1HRI2 3TN92 2XBO2 3ZFFB 2A3WA 3T2PA 3ZSMA 3DPRB 4FAHA 5GZFA 1HRFA 4XAAA 1VR3A 3N8YB 4JQRA 1TPGA 1TE1B 5FTTC 5C9AA 5A6QA 1I6XA 2WS93 2EI7B 4BXSA 2PN5A 4ASMB 3WNXA 1Q4GA 2HWD3 1W2NA 1NCRB 1RXFA 2YBKA 1O59A 3M7AA 3WR0A 3LAQA 4I0WB 5FV3A 4ATFA 4FTBA 5C3OA 3Q8FA 4AW7A 4XIKA 4M00A 2X29A 3KT4A 3BALA 4AF9A 1F2NA 1W6QB 1OFNA 1C8M3 1QJEA 1NZIA 1DZTA 2VH6B 1W8HA 4Y26A 1LQDA 3Q8AA 2YUEA 5FP4A 3SOBB 5FYZA 1X8MA 1JYTA 4N43B 4B1LA 2HJIA 5GZEA 4JZFL 3GDBA 1REFA 2GNTA 2WWUA 1WHFA 3OYWB 4XHBA 4DXRA 5CNAA 1AJKA 1UN1A 4ZKTB 3K77A 1JUIA 5E1RA 1CAVA 1PHMA 2YHJA 4C0HA 2RS32 2WNUA 2P37A 1T6GC 4XIOA 1QJX1 3J8F2 1K12A 1K37A 5DAVA 3W5NA 1ENXA 1NZCA 1OHFA 4XJZA 4DEVA 1UNBA 5IAXA 1CCFA 2VVCK 3ZFEA 2FBEA 2CWSA 2DTWA 5E8DA 1S2KA 1W3XA 2WJSA 4KWKA 5D8AC 4ORFA 4P14A 4FPHA 4Y1VA 1RUNA 5FY9A 1RL3A 1DGWX 4BA6A 2P3KA 5A3NA 1N47A 1A8MA 1HXS1 2K0GA 2I9AA 2EXKA 1HJGA 5J3UA 2P34A 2NMOA 4Q8LA 3JD71 4YGBA 3FWEA 1CONA 2ZHKA 3MV01 4N53B 4NWWA 4PBPA 4MADA 1J3PA 5E88A 4AVAA 4BMBA 4AVVA 1RVF1 1Z0HA 5ISLA 2Y7ZB 4YVWA 2BOXA 4MLOA 1XE7A 3MI8A 1Q56A 1D4M2 3HO5A 2OX0A 3MW4A 1VBA3 4HL0A 5JOXA 3FBMA 3NJPC 2C9KA 4XJWA 4D8MA 3MQEA 4BQ1A 1UPSA 4BM8A 2Q8DA 2VJ3A 1Q8VA 3AKQA 3B93A 3IPVA 3M3IA 5FKBA 4IEPA 4PQQA 1OOPB 2QQNA 1APOA 4S2GA 2R042 1NE6A 3CNAA 5FCCA 5DZFA 2UWPB 3T0BA 2QJVA 1OD3A 3NT1A 1S1AA 2AH2A 3BYWA 3KQEL 2ADEA 3EYPA 4RHV1 4OQ9A 5C6CA 1SBDA 1PO13 2ETEA 4BDWA 2FHRA 2BOKL 2RR12 5F2WA 2PAEA 3OLTA 2JWPA 3H8RA 1CX2A 5FDQA 2VBBA 1LCLA 2YC2A 5AC92 4CCEA 1MEC2 5KR7A 3AXEA 3OBTA 2W1UA 3ETPA 4IQPA 1LODA 3K75B 1I5PA 2EF6A 4COZA 3A7QA 1QJY3 4OUSA 1UX7A 2ET1A 2KA3A 5FZGA 5FK7A 4QPWA 4BISA 3OLUA 2PHFA 1V6LA 1O6UA 4GA9A 3GISX 3VBRA 2EXJA 1BVP1 4Q2FA 2Y5FL 1ZZ7A 2XWBB 1PGEA 1NPEB 4A7IA 1NCQA 1HN0A 3P6BA 3CIHA 4OULA 4XABA 5FZ4A 4ZH8B 2P3UA 4E1GA 3FX3A 3WF0A 1BZWA 1H1AA 3IKWA 2Y6GA 3HEIA 4GULA 2BTVC 2X5IA 1UY4A 1W8BL 3FE5A 3UGFA 2VOTA 4NIHA 1RUF3 4AVCA 3V65B 4NA9L 1KJLA 1FV2A 2WS91 1DGRN 4OHVA 4BQ3A 2PAKA 4XFIA 1W39A 1JYXA 2YV8A 3TEWA 1HV0A 4CUBA 3VDAA 2HH9A 4YM0A 2PHTA 5A1FA 3D3AA 2GN7A 3PIJA 4OMCA 1RUG3 3WQ0A 1OKQA 1LULA 2G1MA 2FD8A 1C8M1 1XQNA 2BGCA 3AFKA 2XKOA 1N3QA 4QU1A 1NA1C 1U8CB 2UU8A 4RFRB 5FO7B 2BOUA 4CEYA 3OD0A 3IB3A 4QQLA 4ZS3A 5IVEA 3O1RA 2E9QA 4MVTA 5JXGA 3APBA 2WQ8A 3FN9A 2PQQA 2XG3A 2WFF3 4YW1A 4QB1A 5FXXA 1UZZA 3MFAA 1D4VB 1FATA 4QT6A 3VLBB 2ZX1A 2ORZA 5F37A 2ARCA 3NV3A 3OUJA 5F8PA 1Y7BA 1DIWA 4KNCA 1ZZ8A 4Q0QA 4W6WA 3P5BA 1DQ4A 4X6RB 4W8JA 4ZY9A 5L73A 4YZ4A 4Q27A 3LA7A 4R9BA 3N7KA 4M4RA 1IQAA 4XUNA 4FQZA 5IVCA 5L7OA 2KM2A 2VWMK 4INDA 2RNLA 3Q7DA 3H7YA 5C8WA 2EIGA 4JTOA 3D6EA 1SBFA 1H1MA 3UT0A 3LN1A 2F6BA 3N7LA 3KZ4C 1W8ZA 4D6RA 1O3QA 3E5QA 4QPIB 1OBNA 1LOGA 1DQ6A 1Z6CA 3W59A 2VCMA 5IJRA 1W6PB 4D0EA 3R0RA 3IMMA 4QX2A 3THDA 4HETA 2Y34A 3IJEB 4I3GA 5FZHA 3TN93 3CEWA 1UOBA 4Z1VA 4IEUA 1VBA1 2BW8A 4IGOA 2VCBA 3PUHA 3I3EA 2EAKA 4W50A 4YLZA 1OQEA 2E63A 2J2UB 1LEMA 4MGYE 4R9DA 5FPXA 3POFA 1U5XA 4TWTA 1PVC2 1AL22 1JZ6A 4AHWA 4LHNA 4EN9B 1PK6B 4IE0A 1UKGA 2B46X 5T50A 3CJIB 4FSJA 4DIQA 3A0NA 1U5YA 1UZQA 3ME2A 4UWDA 4CU7A 1PO11 5GLVA 1OMIA 5DUXA 2QZ3A 1N3PA 5CA6A 2HEVF 5GLUA 1XE0A 1AR62 1UOGA 2AYHA 4Q1RA 2NP0A 4YW7A 3S5QA 4R9CA 4GH4B 1WGPA 3I59B 4CEWB 5B4XA 2J34B 5IAVA 4QKDA 2WBKA 1F0RB 1LB2A 2E7AA 2Q0AA 1QJY1 2WT0A 1GSLA 3GZAA 1EV12 1BLZA 1ADXA 2W2IA 3SH5A 3DV8A 1RIRA 1J59A 4CDXC 3RMYA 2OT7A 5J36A 1KLIL 2CDPA 2JDYA 3AYCA 1GQGA 2CHHA 3HWJA 2VG9A 4LJHA 5FZ1A 4RYDA 4XEZA 4C1WA 3L2YA 1A8DA 5CAZA 2NZ9A 1HJFA 4FPCA 2XXZA 1GR3A 1EPWA 2BT7A 4JGYA 4EN0A 4CXYA 2FMYA 4AVBA 4KH9A 1GANA 4ZS2A 4A7YA 2HWB2 1PX3A 2GMEA 4OFGA 5CFCA 2ZZJA 3PJQA 4XBMA 1PNGA 1RUF1 2BYVE 4OI2A 3ZFGC 4CDWC 4AHZA 1V6IA 3W20A 1DP0A 4FP2A 2PHDA 1JYCA 4D6QA 4B7KA 5F5QA 2RA0L 2W9XA 2BOIA 1DDLA 3BN6A 2WG3C 2W2NE 2XQRA 3ZYJB 3HO4A 1ASJ1 3PHMA 2R062 4ZHNA 1RUG1 2ZEWA 2VE1A 2JG9C 3JQXA 1XRUA 2IFRA 4QGNA 5A32A 4Y33A 1A6CA 5DZEA 3ILRA 3VBHB 4Q8KA 3T0DA 2JKHL 4UFMA 5JSOA 4LEJA 1C1FA 2J1RA 2WABA 4LBQB 3GBGA 4XFCA 1XNTA 4CPBA 4HBNA 1CN1A 2R043 3VN4A 4ZU7A 5FR3A 4PCRA 5A7SA 1S55A 2K2SA 2WFF1 2WNVC 1AYN2 5FYSA 4NRQA 1W99A 3VKFC 4Y5SA 3E6CC 5DDJ3 3DN7A 4QDQA 1X82A 1LPKA 1ZYBA 3RNSA 4EN6B 3SXWA 1LOAA 5FXVA 4N7UA 4P5YA 2O8QA 1UXZA 3ZYHA 2G00L 2A6WA 3LPGA 4A3XA 3LSDA 2GMMA 1KLOA 1TMF3 2B4KA 2Y26A 1NY72 1EBVA 1H4HA 4LMFA 4FM5A 2DU1A 5FZKA 4NHKA 1G86A 2JDZA 5LA2A 2QKDA 3KV5A 2QQWA 2IUWA 1EP0A 3BOPA 4PDWC 2D97A 2Y7XB 3EHKA 4NRMA 5GJ6A 1GNYA 3J7LA 4FOVA 1W9SA 5D8AA 2CY6A 3O1SA 1PGL2 1RUE2 1NLRA 1R64A 4E4SA 2EICA 2IC1A 2XC4L 2LRPA 1C4RA 1BEV2 1W06A 4YZ2A 5A3WA 4JZDL 2F17A 1GFF2 2XLFA 2GC3A 3QCWA 4LUKA 3UESA 2RHPA 2DCYA 2AGSA 3AJYA 4X8TL 3TN91 4BE3A 1UU5A 3ES4A 1O5LA 5FZ8A 4COWA 5KC5A 2BEOA 4XFAA 3ZLIA 2DCKA 4XTMA 1G1TA 2AENA 3PMEA 2NM1A 3MLKA 1ODMA 5BNOC 1JOJA 5BNNB 3T0AA 3OSDA 3T2OA 2HWF3 4IEZA 5A80A 4CDUA 3UYJA 5ABJB 2PHBB 3F1SB 2NYYA 1JXNA 3WG3A 3GYDA 4FI9A 3WW3A 4GWJA 4LR4A 3HBKA 1LU2A 3VHRA 4E27A 2PR3B 3WT3A 4BYYA 4LE3A 2YY1A 2JDNA 4Q4W3 4Z6AL 3KCXA 3WDTA 4P9JA 4GWIA 1O4YA 2XJTA 3TK6B 1RMU3 4MMYB 5I0RA 1JZ5A 2OQ7A 5T54A 2MGPA 4IGPA 3LAGA 1W9FA 4S2HA 2DVAA 2ZKLA 4Y71B 1F8VA 1MQTA 3AMNA 3OEAA 1NLSA 4HN0A 4OUEA 5A3OA 3UL2A 3NWKA 5LBBA 2PXJA 1W9YA 1HX2A 5EYYA 3ILFA 2Q8EA 2P1BA 2ZGUA 1EAH2 3BPZA 4AG4A 3BTYA 1Q43A 2BQPA 2P5BA 4X8PA 4JTNA 5C33A 2LM3A 4BQYA 2ZA9A 4QPGB 3ZPOA 4XYXA 4QXKA 2HLEA 3FL7A 3VZNA 5LRSA 1H6XA 2WL1A 3D0JA 1M06G 1OQDA 3O0VA 4YVSA 2ZMNA 4NE9A 2W3KB 2RDNA 2ZEXA 1H8TC 3TB0A 1PNFA 3ILNA 1MS0A 3M1HA 4U2AA 3T30A 1HZ8A 1UO9A 3GHMA 3KCCA 2P26A 1LMMA 2OUHA 5FPLA 1FAXL 1Y4WA 4M0HA 1XKAL 3WINE 2HORA 4OLLA 1E5IA 2YMZA 4XFFA 2F4PA 4RD7A 2BWAA 5FY1A 3WVJA 1AR93 4MSVA 1COUA 4JDNA 1YFXA 5HXMA 3SW2A 3THCA 1U67A 2R32A 5JMOA 4LA3A 4XF1A 5CFDC 3D8CA 1PVC3 3RZLA 1V6JA 2ZACA 1AL23 2BVBA 1NA1A 2D7FA 2VTXJ 3I3BA 3N3HA 2CU5A 3OF1A 4ZPIA 3ZR6A 1H30A 2R041 2A3YA 1UX6A 2BNOA 4PBOA 5DAXA 5KXEA 5C3RA 5A33B 1AR73 1ND3C 5DDJ1 3WHTA 1WZXA 3HVDA 3S30A 2C0ZA 3SCHA 1CAXB 3AP7A 1UZJA 2ADXA 1AR63 3J7MA 3WNPA 4XXAA 4F3JA 2V09A 3OOXA 5FPZA 1XJAA 2FDJA 3OUHA 3S0MA 4FPFA 4NIAA 2DDUA 2W3JA 3MPPG 3NNMA 2XC5L 1IQML 1EV13 2YZ4A 3POJA 5A7WB 1IHMA 4YFZA 3JD72 4LBQD 4E8CA 5C4WA 3ROUA 1JW6A 4LIUA 1VMJA 3RI9A 1GZCA 2QQJA 4YRDA 2H9EL 3FUOA 1RVF2 2RE9A 4KWLA 4XMIA 5EPAA 4HN1A 4XETA 3WP5A 3OGSA 5FZDA 5C9AC 4CUFA 4RQPA 1W8TA 2J7MA 2I2SA 3VKNA 4P9IA 4JCKA 5FOBB 4XURA 3W9AA 1KSNB 2HWB3 1EUTA 1U5IA 4YPJA 4QX3A 2XVGA 3VD3A 1AR83 4O9GA 2ZBJA 4AFCA 4OUMA 2HWF1 1QJZA 1SLIA 3CS7L 3RYPA 3WNNA 4YM3A 1JZ3A 3O1PA 4BTIA 2BQ7A 1IG0A 2VQ0A 5F32A 5FY7A 4BPZA 1KS5A 2K2TA 2WFPA 3WQ1A 1ZA4A 3C2UA 2KD7A 2J1EA 3U37A 4CTEA 1SPPB 4Q4W1 3O12A 1RTVA 4YG0A 2VQTA 2DUOA 1W05A 4LO4B 5IWFA 2WNUC 1RMU1 4JV4A 5JCTA 3IITB 4OI4A 3QACA 4E2SA 4Q5OA 4XE9A 3ZN5A 5K9YA 3G6JB 2J4IB 1WUVA 2GDFA 2W95A 3AKTA 4W65A 4Y22A 1NYWA 3SH4A 1GP5A 4AQ6A 1NG0A 3GHNA 4LXLA 4QQ2A 3ZDVA 2QDNA 4PI0A 3PUQA 3VZLA 1JYIA 2R49A 3ZSEA 2YFZA 3X29B 1AYM2 5FBZA 2VMDA 3GGLA 4Y1UA 3BT1A 3O0XA 4LK7A 3D82A 2RS53 4JQTA 5H9RA 1DG6A 4ISRA 1PGSA 4RS5A 5JZGC 2E51A 1SBEA 1H2KA 3ACHA 1GOFA 3OUIA 2JDKA 3PTRB 2WS92 4YVWC 3O1VA 3SCGA 1IPKA 2HWD2 1AJOA 3ZXAC 1A3KA 1LGCA 2JD4A 2XBVL 3F95A 2XUEA 4CPBD 1P8JA 1L7RA 1JYNA 1ZREA 1D2QA 1F7MA 1JS9A 2UY8A 2XJSA 2ZAAA 1KS4A 1G7YA 4JGZA 2OW4A 4P9WA 5EJ3A 5BPXA 2PTMA 3RQ0A 2ZGLA 4Y6DB 1RC6A 4HFSA 4QU2A 4Y24A 1LAJA 2E53A 2WLQA 4MGZE 1AR91 1W6OA 2I9BA 3H3ZA 4N7IA 3VZOA 4JZRA 2VH0B 3E6DA 2UY9A 3A22A 4XBNA 1MVQA 1PO23 2ZGKA 3DXUA 4YGEA 4DXSA 1W8WA 4XACA 4AFBA 1PVC1 3VHPA 2YXSA 4NWVA 2ZHLA 3Q3KB 1AL21 2W5FA 1XNDA 4TLFA 1D2SA 4A44A 1NQJA 3U4XA 3IAPA 2YC4A 2YU1A 2CGPA 5JOWA 1TG7A 2A1XA 5EIYB 1AR71 5I93A 1AZDA 1W2OA 4GMP3 1EMNA 2WNVA 2W87A 2Y6HA 2VUAA 1CD3G 3N9PA 2P28B 3UV9A 1G9CA 1V6KA 1OC1A 2WLPA 1AR61 2D3RA 1DBNA 1WCUA 3BUCA 4AGRA 2MGRA 2D6PA 5JLVA 5BNQA 1B09A 1AXKA 3I4IA 4H55A 1LKNA 4NRPA 1GQPA 5KXCA 2VQAA 1EV11 3KT7A 3ZXLA 2ZPXA 2ZX0A 4GB33 3USUA 2E26A 5IUQA 4OI0A 1EGFA 1BF9A 3KGZA 2G4IA 2V5YA 4R4XA 3AMPA 4YW6A 4FP3A 1QIQA 4XZPA 4YFWA 5JSPA 2UWCA 3FUQA 3SISA 3ZIWA 2B42B 3DECA 2WG4B 2XBYL 2JECA 1V9U3 3MIDA 3MYXA 4V2WA 3DYOA 4CDXB 1VBA2 2WINB 5EQUA 4LTAA 2VO5A 1A3PA 1XXNA 2HWB1 2GU9A 2FCUA 1Z7S3 4O7XA 3U14A 4BOWA 1AR81 3CBNA 4QQPA 4DXZA 1G8WA 1YQ5A 4PLOA 5BNOA 4NIGA 2IVJA 5FZLA 1YI9A 4L0PA 2DUQA 4LIVA 3JUUA 2VZVA 2ZX2A 2BQ6A 3ZXDA 2VW2A 3E6BA 4LBJA 4LUMA 2WZR3 4CEYC 3ZFGB 3HT2A 1PO12 3KQBL 2RS13 2WWSA 2YBSA 3BTAA 3GZTB 1KD7A 3MHZA 5T55A 5IATA 2YU2A 3BTXA 1XNBA 2IVIB 1VB4A 1VMFA 5JXHA 1AF9A 1PIV3 2MPFA 3LOIA 2QNKA 5G04L 4IE4A 1IS4A 1K5MB 4B8EA 3I2GA 2WYFA 3U73A 4Q0PA 2TBVA 2JG9B 1MS3A 2AACA 2HBUA 4IUGA 1APNA 2P2KA 1QJY2 4Y20A 1UXXX 1J9CL 1ZZ9A 1AYN1 2QQOA 2XVKA 1WW5A 5GALA 1B35B 4NIDA 4Z0KB 2BUKA 5KXBA 1SDWA 1WWYA 5BXXA 3SLIA 4AGGA 3C3VA 3K4AA 2YGPA 1EYBA 2Y82B 4U36A 3E5UA 1KQRA 3WG4A 3HN3A 5GLZA 2FCVA 2OKXA 4AVSA 4ZZ5A 3KD4A 4IE6A 4YGDA 2RS51 3KF5A 1MZ6A 1DYKA 1XSQA 2A3XA 3PUIA 5FLHA 5C7GA 4LHSA 4TTGA 3FLTA 4CUDA 5KHGA 2JIJA 3FLRA 4AQTA 3NNLA 3VZJA 1PGL1 3CQOA 5FK8A 4COYA 1LHVA 2QFEA 4KU7A 1I0UA 5BNPB 3PTYA 4PDWB 4RRZA 1P9JA 1BEV1 2H0VA 4AHXA 3KB5A 1RUG2 2XB6C 1QIUA 2EIBA 2PHWA 3TAYA 3OBRA 4XC9A 2D6MA 4LBKA 3ZYRA 4AOCA 4Z0LA 2J1VA 4EJRA 3ZFFA 5CADA 3VDDA 1Y9QA 3I8TA 5CB7A 2TGFA 1ND2B 2W08A 3F2ZA 1JODA 3MIEA 3VD7A 1JZ7A 5F19A 5JR7B 1S4CA 3R6SA 2FLRL 1IOAA 4WVMA 2RDQA 2TUNA 1CAUA 1C57A 1JHNA 2BOJA 5CFDA 5FP9A 1F15A 2YGMA 3OGRA 5FPVA 2ZMKA 1W28A 3ON7A 4WM8C 2IXLA 5HBAA 4P9YA 3ZN4A 2ZGRA 2NPRA 1GICA 3M4FA 5FZ7A 2YPDA 4GMP1 3RWNA 5LEKA 1ATDA 3LA2A 3LOBA 4M3CB 3MIGA 1ZRCA 1A78A 1PTHA 1UPIA 2BFUL 1Q5OA 4UOJA 3JCIA 3LTGD 4ES9A 2OZJA 2YGLA 3LB9A 1NXD1 3LWCA 1IZ3A 4QKNA 3NAPC 3NV1A 4M3CF 5FP7A 3ORJA 1AUTL 2YPJA 2C24A 2G9FA 4YT7L 3M3EA 5KBFA 2YBPA 1WA4A 2PA7A 4IV3A 3PVBB 1LU1A 4UW4A 1RUI3 5FQ0A 5JVYA 3IDBB 3TBDA 1AYM3 4OHZA 4COVA 3ZSJA 4Z07A 3MUZ1 1CWPA 2VL4A 4N9HA 3ZDSA 1V9U1 2E31A 1WMXA 2NMNA 3BODA 1RFNB 3NJVA 4FAGA 5IVFA 3ZPYA 3RFRA 5ACA2 4NOTA 3DKWA 2CGOA 1GZTA 4IETA 3U10A 1WMDA 4AEDB 1Z7S1 5FUIA 1JTZX 2A6XA 4YM2A 2Y81B 4LITA 5J96B 3BU0A 4RR3C 3DKQA 1JYWA 2FLBL 4OHWA 1H8TB 2VMHA 1UY2A 2UWOB 3I2FA 4CUCA 3PUSA 4QX0A 2UWLB 1DGRA 2VZTA 4UI9L 1UQXA 2VM9A 4Z2WA 4K3UA 3O1UA 2E7QA 4BLIA 5EJZB 4K1ZA 1KEXA 1VAVA 1MS4A 2DF7A 2RS11 5FZOA 2FDGA 3AP9A 1ENQA 3T1MA 5LZ6A 1PIV1 1E5HA 2OIIA 3I54A 5GLTA 1YO8A 2Y6KA 5F5IA 5A6ZA 5H9PA 1VRBA 4UFKA 2O14A 2OYZA 3WF2A 3H50A 2CSGA 1FAYA 1LEDA 1PM4A 1WLDA 4XTPA 3CFWA 4A6SA 3ZXKA 2BZ6L 1DHKB 3E97A 4R9AA 4NR1A 3N8WA 2ZTNA 1KFUL 3OCPA 5A3UA 1SZBA 3OGVA 4N90A 3JXSA 3IT8A 1R1A3 4F7ZA 2DWRA 4EE2A 2HEYF 4LLOA 1L5GB 1UF2C 5JSRA 4Y79B 1ND3B 4AVTA 3V0AB 1EAIC 1TZOA 1OUXA 1QFKL 5HV4A 3LA3A 4J1WA 5CEHA 3S5AA 2VPVA 3BVCA 2ARAA 4C16A 3H8OA 2B45X 1DZRA 4BQXA 2J1SA 3A0KA 4HZFA 2GMPA 4X6QB 1QH7A 1W8OA 1BK1A 3J7HA 1X33A 3ZKYA 5JZGA 1IOEL 1URXA 1IS3A 4IXLA 1O5DL 3PU3A 1ZRFA 1ZZ6A 1UYYA 5DPNA 1W2AX 3U07A 4CDUC 5KHIA 1GU3A 2BWCA 4WM7C 4E4DX 3WF4A 3VBFC 3N8ZA 2DYCA 5L9VA 4M01A 1W8UA 5F6LB 1UWWA 3FC0A 2VOXA 3BTZA 2H6BA 4DINB 3AX4A 3BKZA 1UL9A 3DCQA 1K45A 3AZXA 1OLQA 4LNVA 3RI8A 4W4ZA 4LOSA 1DCSA 5E89A 3H5CB 2KNIA 2QBXA 5DABA 2WIIB 4XOGA 4IEQA 4RL7A 5DDJ2 4C0BA 1NFUB 3OY8A 4UBHA 4AI8A 1O4ZA 3HPNA 2WNOA 4WBBA 3S7EA 2XLGA 4EV0A 4OQ8A 1FSBA 2RMU3 1MQTC 3AZZA 4C1XA 2DVFA 2D6KA 2WPLE 3OBAA 4V2VA 3ELAL 1TMF2 2JDHA 2W1SA 4FVVA 1QEXA 4Q1PA 2C9AA 1LHOA 3RZHA 2P17A 1CAVB 4BLJA 2WNUB 2BRTA 3FZ3A 3LTFB 3AXDA 5J1XA 4Q0SA 1HT5A 4XQWA 3GCWE 3B00A 3KF3A 4YVSC 1BYHA 1JUHA 1CIWA 1AYM1 3KCYA 1Y9GA 4XQ4A 3S7IA 2WT2A 4ZU5A 5C8CC 3B94A 4TXWA 1VAMA 5GKAC 3ZFEB 3WLUA 2XJRA 1DYOA 5I0UA 4CU8A 3RGBA 4JKLA 3S6PA 3WX5A 5HI0A 3IMNA 5I8YA 1VBD3 3WEZA 1F4AA 1W2TA 2HWF2 2LS6A 2BNMA 3R05A 5IKQA 2HWD1 3N7JA 3SMHA 1MOXC 4LO5B 4JX0A 4JHZA 1OB1C 4Q4Y3 4UFLA 4FOWA 4H2AA 5IYYA 4GJYA 4QDSA 4YVWB 1JBUL 5DG1A 1DQ2A 1GQHA 1IQJL 1LPGA 4Q4W2 4XQDA 1CQEA 3KM5A 1WD4A 1BXHA 4QB2A 5FY4A 4CYDA 5DMYA 3AJZA 5EXOA 4PF5A 3BGAA 2QQIA 4JKKA 3AP6A 3K9XA 1RMU2 4KL1A 5DZGA 2R1BA 2WAAA 3AFGA 4DRVA 1EMOA 2XGXA 3IPVB 4AZZA 4BQ5A 2ZJCA 2WSUA 1Y3TA 4QHBA 3SNMA 4A45A 3GBFA 1NE4A 3NKTA 3KCGL 1ACCA 2A70A 3HJRA 2R6QA 1T6BX 2ID4A 1DFQA 2Y5GL 2YFUA 2H9EC 4XJAA 4LORA 2ZKNA 3KLSA 3B7MA 5LY1A 2A6ZA 3VBUA 2TNFA 4NHMA 3KT1A 5G05L 2JG8A 1POV0 3CDZB 2BGPA 2IXCA 3VKLA 1LPZA 1R1A1 5BUVA 4DPNA 2RDRA 2XUMA 5C4WC 3HQXA 4TGFA 5A3PA 3HNMA 2W52A 2ZOEB 3NL1A 2FDKA 3CZUA 4J25A 5L9RA 4Q0UA 4RQPC 3GBWA 3N9QA 2VNVA 2JE7A 1O4TA 3VBRB 2C1FA 2FCTA 3SCFA 3WP4A 3KQ4B 4G9SB 1YI7A 5EZWA 3C7OA 2G9GA 1NCQB 1UY0A 5FIXA 3KV4A 3MIFA 4K8RB 3OPZA 3QH7A 4MXWA 3ZXGA 4UAPA 4B29A 1J58A 4Z2AA 1ST8A 4XL1A 2VGDA 3GCXA 2EVXA 1WW7A 1AR92 1OURA 2X5IB 5HV0A 3ZN6A 4HOOA 4MMXB 5GZDA 4A4AA 3FFQA 1CZSA 4L99A 2B7DL 1VPHA 2B7YA 2QQUA 4MH0E 4GZ9A 4CDWA 3ZMOA 1ODNA 1BBT3 4OHYA 1XPWA 4OZXA 3ZYFA 1VBC3 2W3IB 5BV6A 1OA3A 2E33A 2BSFA 4A6OA 2KXLA 5J7MA 3PLQA 2WPIE 1AR72 2B9VA 2VRSA 4EZ4A 3N35A 4IESA 1G1RA 4CEYB 2RMU1 1M1XB 1YQ8A 1NAEA 5KHHA 4WM8A 3MW2A 1MR5A 4XUTA 1ZRDA 1HLCA 3BOWA 4BZ4A 5TSWA 1CVUA 1Q8OA 3T4HB 1QHDA 1FPN3 1VRH3 2VZOA 3UJOA 4JYVL 1MS1A 1WCSA 1F4HA 3H3UA 3IIAA 1V70A 4LO6B 1W0OA 3MZHA 3NAPA 4KBBA 3QLQA 1OH3A 3RRDA 5A1AA 4MGTA 4NUBA 4D0FA 4RS5C 5FYBA 1DGWA 4IV1C 2I45A 2P6CA 3M36L 3WDXA 3ACIA 1O91A 1WKYA 4FPYA 5L7OB 4LKEA 4FTSA 3VL8A 3H3LA 1YEWA 5C71A 1QDOA 2HWC3 2OPWA 2QE3A 4K8FA 4NMIA 4A42A 1G2LB 2QDRA 1AR82 4BXFA 1VBD1 4JGZC 4YZ1A 2WC2A 3E5XA 5AVAA 2RM23 2IZWA 2JE8A 3EO6A 4AQ2A 1L7QA 1XNCA 3U1XA 1IQNL 4QX5A 2XHNA 4YW3A 5A3LA 5LK5A 3KHBA 5I0DA 4KQ7A 2PHXA 2V4AA 3B3QE 1YQCA 3V0BB 2WPHE 1ATAA 1W0NA 4RR3A 3HIFA 3U7UG 1V00A 2V5DA 2RJLA 1YIPA 2GSYA 4XBLA 5CIRA 2E6VA 2WA4A 4JKMA 5L30L 1YCIA 3NVCA 3OGGA 1DVAL 4FFGA 1W6MA 4LHKA 1HQLA 2A7AA 1ALYA 2CDOA 3POYA 4OVEA 3D0SA 5FZBA 5JBAE 4EWDA 3GNEA 5LCWL 5LA0A 1KLJL 2V4VA 1LECA 1UZPA 4ATEA 3WW2A 4QXHA 2MEV3 2C26A 6COXA 5L9BA 4EN8B 3RSJA 1QKQA 3SKVA 1SFYA 2A6YA 4META 4O9EA 1KDKA 1DQ1A 2X53S 4H7LA 1HB1A 4LULA 1UOFA 1FNZA 5DUWA 2VWNL 2ZABA 5ANNA 1JZ8A 2Z79A 2YDEA 1SLAA 3B01A 3UGHA 3MO4A 3VDCA 1IVOC 2VOKA 3K51A 2RS52 1FFMA 5JR2A 4Y4RA 3V65A 1E5RA 4PLMA 2XMLA 1D0HA 3EMRA 4UYBA 5H9QA 4D7YA 4DY3A 3VBOC 1OD5A 2GC0A 4PLNA 4HPKA 2J22A 3UJQA 3UKTA 3WV6A 2X8KA 1WMFA 2W68A 1E5SA 3O14A 3VBSA 4YZ3A 5FWJA 4GD4A 2VNOA 1O3SA 1CAWB 3HNBM 4ZXXL 4JGYB 1GP4A 2RG4A 1TLEA 1W9TA 4UXAA 3OTFA 2WO1A 3RJRA 5CFCB 1OXCA 5FYTA 1DU3D 3DYPA 3QD6A 4WM7A 1PO22 4E4ZA 1J1TA 1W3VA 3VBFA 1TNRA 3GCXE 2WSVA 5FBJA 5C3PA 1EPGA 1BBT1 1WLTA 3T09A 3JQWA 1APQA 1VBC1 1ZX5A 2JD9A 4AI9A 1TOZA 2WUHA 3CA7A 2AREA 5JB8E 4HXCA 4PHZA 3RVHA 3AVSA 2VMIA 1OA4A 5A32B 5C70A 3M3OA 2WN3A 3FMGA 1NQLB 2I74A 4L97A 3B69A 5FZIA 5CG8A 1MS5A 1OUSA 5FZ9A 5LW9A 2FQPA 3WDWA 2FMDA 3H8XA 2KV4A 2BO2A 3ES1A 4D7TA 2WQZC 3LIGA 2K2SB 4GALA 5FYCA 1F9KA 1CX4A 1OPMA 4I3PA 3MICA 1FPN1 1VRH1 1E57A 1C5HA 4GB32 3KRKA 3ACLA 3WP3A 1PXXA 3LPFA 3HQUA 3LFMA 3KK6A 3TH3L 3THPA 3WNOA 1YJLA 2M74A 2V73A 2FD6A 5I46L 1S0CA 3AYAA 3LEGA 1V9U2 3HNYM 3QH0A 4R52A 4CP9A 4NAOA 5T5JA 3UKNA 1QQP3 3C9AC 1PMJX 1SCSA 5C8CA 1W6NA 2ERFA 2HWC1 3NTGA 1Z7S2 3NJXA 1J84A 2XJUA 3TNQA 1DQBA 1VBB3 1BKZA 5D8AB 1X8EA 3ACFA 3WW4A 4A7KA 2BGOA 1WW4A 3NQHA 1IGXA 4NHYA 2RM21 4UBGA 4EQVA 5HXVA 2VMEA 3ZFFC 3NNFA 3VDDC 3POIA 3PL0A 3B02A 2WYJB 5FYVA 1AUYA 4QWNA 1DIYA 3SQOA 3TYJA 3LFIA 2WZR2 1GOGA 4Y5TA 3VD4A 2VNGA 1ZA7A 2RS12 5DN2A 4EWEA 4FPKA 1ENRA 4AXOA 2X10A 1NCRC 2I07B 3MDPA 2EXHA 1PIV2 2YGQA 1JHJA 2CV6A 3AP4A 3MEPA 1LGBA 1US2A 1UMZA 3T2TA 4CDUB 4L8QA 4FTEA 1J3QA 4P9XA 2XJQA 3N9LA 1G9AA 2XBWL 2OVUA 3NV4A 4NN0A 5DAPA 5JPNB 5K8SA 4E8DA 2WQ4A 4N43C 2WO7A 1POV3 4ET7A 4GU4A 5JXIA 4XVHA 5M0TA 5ACA3 4CCJA 1QMJA 1LJ7A 1S0IA 1BCXA 3AMQA 1IQHL 4XDOA 3BPSE 1AXYA 1C28A 4IW3A 1NXMA 1PZ9A 4IV3C 1TMF1 3VD5A 4D3WA 4JAAA 5FZEA 2DBIA 2P3TA 1EQGA 1RXGA 2ET7A 2JDAA 1DZQA 4HG6B 4AEKA 4ASLA 2WPME 5DUVA 5EYXA 1LNSA 5IK4A 1RUD3 2OA2A 3MIHA 2QQKA 1UD1A 3IDEA 3AYDA 1CVWL 5ANQA 1H2MA 4EYUA 3K4DA 1YUDA 4XW3A 3J7NA 2VZPA 2VVEA 4YVSB 2CWMA 5J98B 2ARXA 4V1PA 1SG3A 4OZOA 4HT1T 1GZWA 3CF6E 4QQHA 4SLIA 2A75A 2GC2A 4BHPA 4BJ0A 4NPRA 4CXXA 5FZFA 2ILMA 2Y64A 4FPOB 4IERA 5CZKA 2RJ2A 5EP9A 2ORXA 4QKFA 3S6XA 1CVNA 1SFNA 1LHWA 5EWSA 4DQAA 5GZGA 1P0SL 1YUKB 1UMHA 1WA6X 3RS6A 3ALQA 2DUPA 3SEPA 4LE4A 3POSA 4DO0A 3RZMA 5HCFA 3VGIA 2R0FA 1IKQA 4DS0A 3GXUA 1JN2P 4CCCA 4LO7A 4DRRA 1IP0A 4OTJA 4N8MA 4EZHA 3HAGA 1NA1B 1DLCA 1KKEA 2A71A 1NUKA 2EA7A 1R092 2ES3A 3PIGA 4HKWA 4LKFA 2ENRA 4QAWA 4ZONA 3HPTA 4LT5A 4Y1ZA 4PIXA 4XF3A 5FPUA 4AEJA 1IGZA 2Y33A 1RUI2 3AL5A 1X9PA 3BU7A 4LK6A 4RGKA 3VZKA 1PX4A 5B2GB 3KVAA 5IFPA 2IFWA 2HYKA 4XJUA 2QVSB 3LEIA 1CQ9A 2BFUS 1C8NA 4IEXA 1AX2A 2HKXA 2Y0OA 4MGIE 5LBCA 1BVVA 1QQP1 4HKLA 4MGKE 1XFEA 3ZIXA 4IV1A 5E8AA 3WCRA 3PURA 5L36A 3AB0A 3B9IA 3SH3A 1KITA 3ST7A 5C3SA 5C4WB 1VBB1 4XFGA 4C8DA 1S0BA 3V64A 5EV7A 1X7AL 1RUC3 1C5MF 2WFXB 4RQPB 2OYUP 2XLAA 3AKPA 1W9WA 3M3QA 1STMA 3OEBA 3FFGL 4QB6A 3ZOIA 5JUVA 2EXIA 2JXAA 3QOPA 2BVVA 1JH5A 1ULFA 3RZGA 4OI1A 2XQXA 4XPVA 5J09A 4RN5A 4CUEA 1KGYA 2D3PA 1AL0G 2D98A 4Y1YA 5T52A 4ARXA 4BCUA 4DXTA 4GKYA 4D94A 1J3RA 2W91A 1MPXA 3IWZA 2VXRA 3HR9A 5CBLA 4I30A 1KFXL 5HCBA 4UF0A 2WR9A 1LR5A 5JOZA 5K0UA 1UIKA 4UFJA 1JMUB 5FLIA 5FREA 1POV1 3URFA 4ZAEB 1Q8SA 3VV1A 5ACA1 1F5JA 1NFXB 5I0SA 1R1A2 3MFCA 2Q5TA 3WDUA 1IQEL 2AC1A 4PT6A 4A7ZA 1YHFA 2OUJA 1N1SA 3EB7A 1F5FA 5BY5A 4RRYA 3I49A 4AI2A 3O7OA 4BIOA 1O3RA 1IJQA 4Y22B 3CENL 2ZEYA 4XF4A 3IZOA 3AZYA 1NQDA 1NLQA 1MS8A 1V6OA 3WG1A 2VH9A 1NOVA 5FUPA 4BTUA 1HAEA 1JZ2A 1RUD1 1LRHA 2J94B 3VBOA 2Z42A 1XYPA 4HVRA 4I0AA 2B9UA 4FBFA 2CAVA 1H2NA 2EAAA 2W1QA 3Q8CA 3IM0A 4CDQA 4XUOA 4Y7AB 2W46A 1RUOA 5FLJA 2P6HA 4BH9A 1MZEA 1DX5I 5KXDA 2WZ8A 3OPTA 3IBMA 4RS5B 3H1MA 4KWJA 4ASKA 4QPIC 3I2OA 3GZEA 4LHLA 5FFOC 1OI6A 2LUWA 3KL6B 2XJPA 4J1XA 4QX7A 2AZ5A 3ZVXA 4JGZB 1YQ6A 5IW0A 4HANA 1PGW2 1R1ZA 2ZHMA 1ONAA 2NQYA 4UT5A 5KC6A 3TNPB 4CZSA 2PHRA 2RMU2 1RJ7A 1W6OB 3UK9A 3NSTA 5FMOS 1LENA 2EALA 3BIEA 2F9BL 1NX9A 2CTVA 2NPIA 3AM2A 2PUQL 3JB4C 3LD8A 4A41A 5AFBA 1YWKA 2CYFA 4O61A 1YUGA 1YRZA 3CJIC 3KVBA 5CYYA 1URKA 1J83A 2XHKA 3JB8A 4H3WA 3VBUC 1UKRA 3OB8A 4EN7B 2JG8C 4G3YC 4YZUB 1GMMA 5JMCA 1FI2A 4XDQA 2VZQA 3H8UA 4ISQA 2WNVB 3ATGA 1WLWA 3HS6A 4KBZA 3S57A 1VBE3 4OMDA 4BIFA 4CEWC 1W8FA 4I2OA 5JBBE 4Q29A 2J38B 4XFBA 4QPYA 4DFSA 1ZAQA 3NO8A 1MQ6L 1QXJA 2P3FL 1GUIA 3MUY1 1L3YA 1SLBA 1VBD2 2XH6A 3ACGA 3CO2A 1HCGB 2R7EB 3U75A 3LN0A 4I09A 4ISHL 3USUB 4YZ5A 2R073 2GN3A 2PYTA 5DXDA 4K40A 4IGQA 1YGCL 4Q4Y2 4CCDA 3LIWB 1HT8A 3WDVA 2P3IA 1RUC1 3KSCA 5FPBA 1N1VA 5FOJB 3O1OA 1DQ0A 3I97A 1ATEA 3OG2A 1LGNA 1YYNA 3VHNA 2YYOA 1GNZA 2LROA 1EUUA 2PHLA 2VZRA 1Z6EL 2Y38A 1REEA 4RA0A 1WCDJ 3DPRA 4Y4YA 1RGSA 5I8TA 4D90A 3PVNA 4IL7A 3N8YA 5CISA 1PO21 3POGA 4DEQA 2Q1JB 3ZX7A 4EROA 1TME2 1QY4A 1NCRA 5BNOB 3N8XA 1FOD3 2D43A 4K9SA 4MHUA 4NROA 1XNKA 2VVVL 4MUVA 4S2DA 2UYAA 2D3SA 2E7TA 3C7HA 3EXUA 4Q4V2 2W1WA 4B1MA 2O0OA 3L2HA 1S0GA 1X50A 3ZYBA 1O8PA 1CCVA 1W6QA 2VTFA 5CKNA 3VBHC 2P4EA 2W26B 5J48A 1VAKA 1NKGA 2D44A 3N36A 4HONA 3AKRA 1GLHA 4N43A 2J95B 1GNHA 3MF6A 2WRAA 3OYWA 2XJVA 3EBRA 1PFXL 4FT8A 3GCWA 3LIHA 4KG0A 4HVOA 4W6XA 1R093 5FYUA 4TYSA 4KGGA 3PVEA 5F39A 2VC9A 4Y20B 3TRSB 2VD7A 4AGVA 1O5UA 3W5MA 2JX9A 4QM8A 4Q4X2 4QX1A 4GB31 1HB4A 4RHV3 4XILA 1CX1A 2DFBA 2JB4A 1HB3A 1JU4A 1CPMA 4COUA 5KIRA 5FYIA 1FMD3 4PIYA 5B4NA 3T08A 2BQWA 4IE7A 5HCAA 2J1UA 2WWJA 1HQNA 3I2DA 2GH8A 4QD2A 5JAXA 1L3JA 3LCPA 3M70A 4XAEA 5A7QA 4HK9A 3KWVA 2K9ZA 5JVVA 2KL7A 2D93A 1AX0A 5LRRA 4X8UL 1IOXA 4NVPA 3SKJE 3AP5A 3CMGA 1SDDB 3RR3A 4ZXYL 2BDRA 3Q9OA 2BP6A 5CU1A 4Q26A 1BBT2 1QJU3 3NMBA 4BQWA 1VBC2 4N53A 2QQPA 3EQEA 4HMZA 3SITA 2WN2A 2WZR1 3RWKX 3K46A 1I9RA 3N9OA 1OLRA 2WO3A 5ABJC 3V0BA 3VDDB 5F6KA 1W90A 2GH2A 1FYUA 1I3HA 2Q8CA 1UU4A 4MGSA 3TEXA 2XBXL 2P3FN 5D2AA 4C91A 5CVRA 4WVMB 5GZCA 4JZEL 1OOPA 2VJXA 2AUYA 2YROA 4L2NA 1CAUB 4DUWA 1FPN2 3QMOA 1HAFA 1VRH2 4M10A 2RVAA 4S2FA 2VAUA 5CFDB 3MDLA 2ZGQA 3HT1A 5L19A 1SACA 4QGLA 5FJKA 3C7GA 2O1QA 2XOMA 5LK7B 3ELNA 1UCXA 1OLME 2QTWB 1VBE1 2P94L 2D40A 2ZGTA 2XPJA 4BB3A 3LKJA 3CL1A 4HK8A 1UIJA 2HOXA 2XKPA 3PDQA 1D7PM 2VMCA 2Y6JA 4KMQA 3POEA 3A4UA 1J1LA 4OTYA 2HWC2 5IKTA 3VBSC 3I3DA 3FJSA 2W47A 3VKOA 4IV3B 4R4ZA 2VZ1A 4M3CE 4QPGC 2RM22 5FQ0B 2FDFA 1GBGA 5A3TA 1AXZA 2R071 3RMXA 1I1EA 1ZVFA 1S0DA 1X7NA 3T3YA 4GWNA 2PHUA 3BCWA 1W7XL 4F8AA 5K0HB 1WD3A 1L7LA 1RUJ2 1M4WA 2R0HA 3H7JA 4L92A 4BU2A 5JPMB 5C9AB 5DAWA 5FMOL 2FLGA 1RHI2 3BB6A 4FXKB 4ZXKA 2WYGB 3SC7X 3AMMA 3U11A 3ZMNA 3BI3A 1ENSA 1U12A 4MZUA 4AYUA 2GALA 3CHXA 3DXTA 3NRUA 2BT8A 4K20A 1ULEA 1ZZCA 1YQ2A 4QHZA 2DFCA 2MEV2 5A3MA 1FOD1 4EWAA 2P93L 3V56A 2JIGA 2VWLL 5F1AA 3INAA 3JZVA 2VZ3A 2AEYA 2GC1A 5FZOB 3RZZA 5AFEA 4AAXA 5F7UA 4YGCA 5SV8A 2JDPA 1CJPA 5JXJA 1LMJA 2JJLA 2DU0A 3AYEA 3B9CA 3LF7A 2HEWF 4E2GA 1IPSA 5KHJA 4QXBA 1REDA 3H9AA 3LC3B 3TGFA 1R091 2ZX4A 1BK0A 2ATFA 5DQ0A 1TVGA 2H0BA 1HQWA 1TQ5A 4O65A 5FY0A 4A2UA 3VDBA 1WU1B 2QCSB 4G4FA 4ZXEA 1UZKA 3N8WB 1QU0A 1RUI1 1N1IA 2ZGMA 1WHEA 3WF1A 3K3OA 2N7GA 3T2QA 3RPQA 1FMD1 4JYUL 3U4SA 1FT9A 1ZBA3 3WOGA 2FZ1A 2NN8A 2ZS6B 4KG8A 4CP0A 1IQGL 1LOFC 2C4XA 4KWUA 4CSWA 3KQRA 5I91A 5JB9E 1DF0A 1KXGA 3FFZA 3MLJA 3NJZA 4I01A 1GWMA 5FAXA 1EPHA 1US3A 3NV2A 5BYNA 1PRHA 3DEMA 2ZHNA 3AC0A 1O7FA 3JBG3 1KIGL 2ZGOA 5JZGB 1QJU1 2VCCA 2WKKA 4QPIA 1BJQA 2JE9A 2WNEA 3J4UH 4MX3A 4Z82A 1XDTR 5IVBA 1W6PA 2UURA 4KGQA 3FHQA 2CAUA 1BMV2 2Z5WA 4UW6A 4BK5A 4X8SL 2J1TA 4DY5A 1MQ5L 4X8VL 1LHUA 1XSRA 1ZBE2 3LZZA 4D7SA 3M3CA 1TME3 1VB2A 2IXIA 2JENA 4CP2A 1H1IA 4Q4V3 4XFHA 5A6XA 5HCHA 1FF7A 3C8XA 3WP6A 3VZMA 1PK6A 1UMIA 3K2OA 4FFFA 3MW3A 3KS7A 3OY8B 3ZO0B 4AWDA 4CUGA 3CJIA 3H42B 1ASJ3 4XF9A 5D1IA 2CNAA 3WNKA 5EHDA 5ERLA 2W2QE 2JDMA 3NNJA 2HWE3 3Q8BA 1VMHA 5EGMB 2ZCWA 2DURA 1HW5A 1XYNA 1QQP2 1R082 5LB6A 1XB9A 2G9ZA 4LA2A 4GH4A 3ZR5A 3I59A 3N9NA 4CEWA 1YUFA 5COXA 5F3GA 3WW1A 2FZ2A 4RGAA 5LBEA 2ZXQA 4Q4X3 3UKVA 3WSOA 1VBB2 2OYEP 1W04A 3WCSA 1DGLA 2VVFA 4XCBA 2IWGB 2VBPA 3I2JA 3RDIA 3B5LB 1OH4A 5D21A 1OSGA 2Y0IA 2J42A 1JYVA 1JOBA 4P00B 5JIUA 4I02A 2R30A 3PU8A 5IKVA 3C7EA 4DOUA 2W2OE 4WV8A 2XVLA 4O1ZA 2EI6B 2BPA2 1C3HA 1CPNA 2IXHA 4ARYA 2LTNA 3P5BL 1DDXA 5FZMA 3USSA 4QKBA 2PLV3 3LDRA 2UWAA 1LOCA 1QNYA 4AHYA 3RJ2X 2GNDA 3R4SA 4JRAA 4Q0VA 4QDRA 1PGW1 4IEOA 3FLPA 5KWRA 1U0AA 1GOHA 4CVUA 2XWJB 4CCLA 5IHRA 2UYBA 4NG9L 3KQDL 1HRI3 4FPLA 1UZVA 3TZIA 2EI8B 3ZYGA 1O8SA 2JKBA 2XBO3 5DUUA 5F2SA 2D6OX 2JICA 3HS5A 2MNGA 4FOQA 4IEWA 3VB9A 4JHTA 5DAQA 5A7OA 3NTBA 1H9PA 2VMGA 2GP5A 3FHAA 2B39A 4LKSA 4ZU4A 3VBHA 1H4GA 4CCNA 4LBQA 1COV2 4XBQA 1JOPA 3NKGA 2VZUA 3GALA 3ECQA 4COXA 4TN7A 5K4LA 2F4LA 1PZ7A 1RUD2 5H9SA 2W2PE 4ONUA 3VBUB 4PF1A 1HN1A 5FJHA 1OFSA 2JG8B 5JIAA 1CGPA 2VOWA 4CCKA 2XDVA 1ZBA1 2AEZA 4AQSA 1RYYA 2WZEA 2XC0L 3ZXJA 1TNFA 3V64C 3VL9A 4CP1A 5FDBA 3AVRA 4QXCA 3PMSA 1H8VA 4XF0A 2RS33 3QH6A 1SEFA 3P3NA 3KMHA 2QUOA 3J8F3 3G7DA 2J1AA 2VOVA 5EFUA 2VULA 5IK5A 4PH9A 3JBG1 1EQHA 4Q4Y1 1ZM1A 2R1DA 4DMIA 5C5TA 5CG9A 1LOBA 5FZAA 4MXWB 1A34A 1K5JA 3LQCA 1RUJ3 1CEJA 1Q8PA 2C5DA 5GLWA 4AI1A 5FP3A 5LBFA 1CZVA 4JVAA 1IQLL 1CAWA 5CKQA 1VP6A 1WCKA 4CUAA 1RHI3 1RITA 4W6YA 3ZN6B 4AEMA 2D1JB 3L9JT 3R4DB 1FNYA 1QOTA 4NIIA 4E2QA 4BK4A 5K0UC 2XL7A 1N7DA 5BNNA 4ISIL 3AZWA 3KGLA 4CDWB 3CZJA 4MV2A 5A70A 5CKMA 5JVZA 1TME1 5ABJA 2VXJA 5LWBA 2Y8KA 1S2BA 4M4PA 4YNIA 2XONA 3QBQA 5T3NA 4BDXA 3BPSA 4Q4V1 3VD9A 1IG3A 1QWRA 2B5HA 4XUPA 3VKMA 5FO9B 1UOJA 1N1TA 1CR7A 3E1F1 3MGUA 4MOAA 3RG0A 5LA1A 1D4M3 5T5LA 1K5MC 1JV2B 4AFDA 1LTEA 1FAKL 2ARBA 2W94A 4BXSV 1ULOA 2HWE1 2JEMA 4HSJA 1NFWB 3CJXA 1N1YA 4WM8B 5IVYA 5LY2A 3HMYA 1FE2A 4RRXA 5I8SA 1H2LA 1B35C 4UFHA 3ZXFA 2C6SA 2Q8OA 3T1LA 1YFYA 1CESA 2Q30A 3Q8EA 4R8HA 4GAZA 1SHWB 3LE0A 5LA9A 4Q4X1 1HV1A 1RUH2 4LKDA 4CDQC 4GXLA 2QQLA 1S0JA 1UZ0A 3I2KA 5IVJA 4G1MB 3NAPB 5SV5A 1EPJA 2W92A 3EGFA 4IEYA 3WXPA 1RUC2 1IKPA 1DYPA 1G6NA 1POQA 1YC61 2A6VA 2RR13 4LLFA 4AK3A 3O5SA 1OVPA 4CU9A 3DUIA 4QPGA 1GWKA 3R4UA 4RFT0 5AC93 3I3MA 1MEC3 1QDCA 1XOYA 4GMP0 4LBOA 4NHXA 2FDHA 3A21A 4FQ4A 3WG2A 1OPOA 4FPEA 4Y76B 1QH6A 1W2UA 1XU2A 2A5ZA 4MO3M 5BNPC 1VE0A 2WFTA 1Y43B 4DUVA 2W39A 5F3CA 4Y7BB 1LHNA 1UY3A 2PLV1 4MXVA 5FZ0A 2FDIA 2XR4A 3BT2A 1HB2A 2VUJA 4D6SA 3KHCA 1VLNA 2D5HA 5JI7A 1NFYB 4RS0A 2DV9A 3WNMA 2VW0A 2P3YA 2RJKA 1VJ2A 3LDBA 4LBNA 4QMAA 4RR3B 4YW4A 1FJSL 1ND2C 1QOOA 2QQMA 4M0NA 1K42A 1HRI1 1GWLA 2XBO1 3RZKA 3GM8A 4P9GA 5FMBA 1ZBE3 2BMGA 5IVVA 1W6MB 3N4MA 4TLGA 3T4VA 3BIWE 1G9BA 5FYMA 1F35A 4K21A 2Y6FA 4MG2A 4URTA 3ZKUA 4GKXA 1IQIL 4RUTA 2WO2A 4CRQA 4AL9A 2GZWA 3J9SA 4XLWA 2BNNA 3U78A 1XNAA 1LESA 5A33A 4QQOA 1UZWA 5T5OA 1Q8QA 4AAPA 5C3QA 3O1MA 2WAOA 4FOYA 4RGGA 3M37L 1XBFA 2VR4A 3POWA 5JOYA 1HREA 2Z4FA 1F7EA 5JDBA 2BZDA 5JI9A 1PM7A 2BOHA 1CAXA 3O0WA 5F3EA 2H6CA 1R083 2JB8A 2LW8A 1LOEA 2NLRA 4QX8A 4DZGA 4FFHA 2ZAHA 2GP3A 3WQ7A 1H6YA 3UGGA 4AE2A 1LOFA 4HPKB 2AR6A 2OXBA 3K3NA 4CU6A 5HPOA 5A7WA 3ENSA 2RS31 2W0XA 3IDAA 3MF9A 4IDZA 4GIQA 4AFMA 2ADDA 3J8F1 2DVGA 3I2IA 2CGNA 3VBSB 1F31A 3DPRC 2HYXA 3WDYA 3WF3A 1HX6A 1HRV2 2YB7A 1RUJ1 3GJAA 4J6GA 4AEDC 1QNWA 3DYMA 4X8NA 5F5AA 4LBLA 4DNYA 5IK8A 1FXZA 1RHI1 4XHXA 3ASIA 3RYRA 5FUNA 2FZZL 4WM7B 3VBFB 4A3ZA 1OKOA 4DB5A 4ES8A 3F6UL 3C7FA 4XXPA 1RJ8A 2MEV1 1YNAA 2WPKE 4URAA 5LATA 2PFWA 3GF6A 1EY2A 2OPKA 4YT6L 2DTYA 2GAUA 3AMHA 1YIFA 2K46A 3PVOA 3O1TA 1LK9A 1SPPA 3UETA 3WUDA 1D4M1 3D5OA 1VBE2 1SLLA 1SFPA 2ZZQA 2WPJE 3FBYA 1OT5A 2ZEZA 3HN1A 2VQUA 1OA2A 1COV3 1MQTB 1MS9A 1X9TA 1SMVA 5FKCA 5IK7A 1YXWA 2Q1FA 1AVBA 3P1IA 4E4HA 5JW1A 5DG2A 3DF0A 2L9LA 4HKOA 5FXWA 4Y5Z0 2DVDA 1QJX2 4Z8BA 3WUCA 2R072 5FZ6A 5A1LA 3LC5B 3VUOA 3KV6A 1GZ9A 1WCQA 4CP9B 3M8LA 2RR11 1ZRRA 4CSYA 5A7NA 5E16A 4YG6A 3A23A 2DBNA 5AC91 2WYSA 1V6MA 1MEC1 4IE5A 1UZYA 2W2ME 1ULPA 5C8CB 1W6NB 4N53C 4XUQA 1OF4A 3IAQA 2HBTA 4OCTA 2P95L 1HXS2 1GYKA 3HQRA 4JDMA 1KDMA 1ATBA 1GV9A 1FOD2 3HOBA 4JDOA 1D0GA 4XMAA 5FRAA 3SEEA 3AZVA 4NAMA 1QJFA 5APAA 4PI2A 5A6YA 1Y9MA 4M11A 4L9BA 5I0TA 1NT0A 4NO4A 1UYZA 1ZNPA 3I2HA 5L2ZL 1W8NA 1HJ7A 1OOPC 1BMV1 1IQDC 1PZ8A 1WLCA 4LBMA 5F5CA 1ULGA 1QXPA 5J37A 3GZUC 4P08A 1ZBE1 5A7PA 1YFWA 1XE8A 4WVVA 3N8VA 1YFUA 3TK5B 4CE8A 3NW4A 4BWOA 1UAIA 2VECA 2ZX3A 1HIXA 2VTXA 3TOJA 2BV4A 4RHV2 4BDVB 5F9TA 3RYKA 2ZGNA 2R063 4K7JA 4NPLA 3POBA 2D6LX 1FMD2 3DGTA 2X05A 1IQFL 3EJKA 4ITCA 4LO8A 1TEIA 5FMDA 2CL2A 4BQ2A 2G19A 4UW5A 2CJIB 3ITQA 3ENRA 3PNAA 1R081 2XL9A 2ZMLA 4YW5A 2V72A 2WDBA 3UNPA 3ZYPA 1RUH3 4CA9A 1AYN3 4XCAA 4YW2A 2EIEA 3U0ZA 4NGAL 2Y60A 2MHFA 4O02B 1HDKA 2Z69A 1QJU2 2VWOL 5FMCA 2LALA 3ZFEC 1S0FA 2GNMA 1PMHX 4FO9A 3ZSKA 1WW6A 2DCTA 5KN5C 4P9LA 1H9WA 2D5FA 4RSUA 1EPZA 3N7MA 4CDXA 4Z92B 4GWMA 2JDUA 4HLTA 4KI5M 3TEYA 1V6NA 3HO3A 1GZWB 4Y3OA 1V1IA 2JKXA 2Q1MA 3PGHA 4YARA 2VUDA 3ZXEA 4NJ4A 1RUE3 2DVBA 3ABZA 5LASA 1DQ5A 5GM0A 3MLLA 1QF3A 4P02B 4YYOA 1BEV3 4B4RA 5LEJA 4LPLA 2IXJA 4AI0A 4F83A 4GU3A 2E32A 3ZYIB 4JC1A 3ZFGA 2P3JA 1IPJA 4WZCA 1C8M2 2PELA 3TEZA 3HD8B 5FYYA 1G9DA 1PMIA 4KU8A 2GNBA 3LDKA 3LGRA 3MPBA 3ZM8A 1C5IA 2PMWB 2EIDA 1K5MA 2ZGPA 4QHOA 2VVUL 3OPWA 4HVQA 2JG9A 1COV1 4N9IA 3HBZA 4UW3A 1VIWB 1XU1A 4NHLA 4B4PA 2ZGSA 3CU7A 4B7EA 2VUCA 1WBFA 1B35A 5FXZA 4YSFA 1JBCA 4PIZA 2VU9A 4FPJA 5JBCE 4FCAA 4MGQA 4BXWA 1YLLA 2YC0A 5FWEA 4YM1A 4E9KA 3KQCL 4K6BA 2D6NA 4D69A 2KB9A 1UU6A 4LQRA 1K36A 4XDPA 1EZQB 3N9MA 3LEKA 4MHRA 4IV1B 4P5HA 3VBRC 3ZSLA 2GD4A 1XKBA 2WA3A 3K4ZA 4MMZB 3WD5A 2JJ6A 1N3OA 4RRWA 2W86A 1NCQC 2Q1ZB 4GQ7A 4OHXA 3OBZA 4K1YA 3CLPA 1EAH3 1V0AA 4PQ9A 1QXRA 5F3IA 1WBLA 5BNPA 1HRV3 3RZJA 1PVXA 2IXKA 4LOTA 2MHPA 2X5IC 3OJBA 2R16A 4OYUA 4PDWA 4PJYA 1UYXA 3MBWA 4XJ8A 2WT1A 5FZ3A 2SBAA 3FCSB 4TZDA 1B9WA 3MIBA 2OQ6A 3K48A 1RB8G 2PQSA 1IS5A 3WY6A 2YG0A 4B4QA 1IGOA 5C5UA 4ZHAB 1PK6C 2KR2A 1XYOA 2B8MA 1ND2A 3LSEA 4QGMA 3PUAA 2O8OA 1MVEA 4GJZA 5FYHA 5L2YL 2Z2SB 1V3XB 1F0SB 1OLMA 4UF0B 4AI3A 3SOVA 4I0BA 5K0UB 3LEMA 3IN9A 4WVZA 2TEPA 3P3PA 1FV3A 1IQKL 2Y5HL 3HS7A 2OZ6A 3WNLA 1WMEA 1VALA 1V1HA 5FZCA 3W21A 5IFTA 4GH4C 2R061 1KRIA 3NJYA 4UFIA 1ZBA2 4H7MA 3SHRA 2VBDA 4H14A 1X36A 3IDCB 4M3CA 2VMFA 2VY0A 3W58A 4MYEA 4D0QA 3FHIB 3OD4A 1JZ4A 1YJKA 2VZSA 5FO8B 3PJYA 4JRLA 1QJX3 1MZFA 1RUH1 3H1WA 3AL6A 3JBG2 3TWIA 2QQVA 5FP8A 3KV9A 2X09A 4WZFA 3VBOB 1ULCA 2BJSA 4FXGB 4NPMA 3GJBA 4IEVA 2VVDA 3I7DA 2Y80B 4XJ9A 5L7OC 4CDQB 4TSVA 1K3IA 4Y1XA 1G2MB 1UW8A 1C1LA 5FY8A 2BERA 4HSLA 4L11A 1AHSA 1S2EA 1NY71 4YWAA 4ZZ8A 1HXS3 1DLLA 2AYLA 1GKBA 1RUF2 1FX5A 1BQPA 2BBAA 3JD73 2WZPP 4AEDA 4BTTA 1CIYA 4FPGA 4WVWA 5E6HA 1QOSA 1RUE1 1RVF3 1H8TA 2YGOA 2DCJA 3DL3A 5KHKA 4CCMA 1BHGA 1W0PA 2Q4SA 1GK5A 1ASJ2 1I5ZA 5FY5A 1JL9A 3WZ1A 5FPAA 1OF3A 1XC6A 1GP6A 2HWE2 1MACA 1KJRA 1U5ZA 1UYPA 2UWBA 3I3QA 3MV11 4B3NA 4AFAA 1Q3EA 3VHOA 3M2MA 5AVPA 1EPIA 5F1RA 3J26N 1JU3A 4A94C 3JU9A 1OQ1A 4CXWA 5JWPA 3H1YA 4FFIA 2WFF2 1W03A 1CJDA 5EJ1B 3THTA 5IKRA 1ZRIA 4QM9A 4YG3A 2RV9A 3NNGA 2DCZA 1T2XA 4C90A 1QGLA 1HKDA 3CKHA 4BQ4A 1G1SA 5T5PA 2BBVA 1S0EA 1RINA 1ULDA 1ZZBA 1H0BA 3SOQA 2BU9A 1ND3A 1JI6A 4AR2A 4SBVA 3IIIA 3V0AA 4DUXA 3AKSA 1G9FA 2VNRA 1SLCA 3H0OA 4BMEA 2Y6LA 4XZUG 2OS2A 4CCOA 1SCRA 2PLV2 5IT6A 3WHUA 1O3TA 1G1QA 2QZ2A 1SLTA
chains in the Genus database with same CATH topology
2PAMA 1AX1A 1SQ4A 2SLIA 3AK0A 3D4KA 1EAH1 3H3ZA 1IS6A 2VW1A 3OGJA 1Z78A 4JGYC 1MZ5A 1HRV1 3ETQA 2P16L 5BNNC 5K7PA 2A73B 5CFCC 1HRI2 3TN92 2XBO2 3ZFFB 2A3WA 3ZSMA 4FAHA 3DPRB 5GZFA 1HRFA 1VR3A 3N8YB 4JQRA 1TPGA 1TE1B 5FTTC 5C9AA 1I6XA 2WS93 2EI7B 4BXSA 2PN5A 4ASMB 3WNXA 1Q4GA 2HWD3 1NCRB 3M7AA 3WR0A 3LAQA 4I0WB 4ATFA 4FTBA 4AW7A 4XIKA 4M00A 2X29A 3KT4A 3BALA 4AF9A 1F2NA 1W6QB 1OFNA 1C8M3 1NZIA 1DZTA 2VH6B 4Y26A 1LQDA 2YUEA 3SOBB 1X8MA 4N43B 2HJIA 5GZEA 4JZFL 1REFA 2GNTA 3OYWB 1WHFA 4XHBA 5CNAA 1AJKA 1UN1A 4ZKTB 1JUIA 5E1RA 1CAVA 1PHMA 2YHJA 4C0HA 2RS32 2WNUA 2P37A 1T6GC 4XIOA 1QJX1 3J8F2 1K37A 1ENXA 1NZCA 1OHFA 4XJZA 1CCFA 2VVCK 3ZFEA 2FBEA 2CWSA 2DTWA 5E8DA 1S2KA 2WJSA 4KWKA 5D8AC 4ORFA 4P14A 4FPHA 4Y1VA 1RUNA 1RL3A 1DGWX 4BA6A 2P3KA 1N47A 1A8MA 1HXS1 2K0GA 2I9AA 2EXKA 5J3UA 2P34A 2NMOA 4Q8LA 3JD71 4YGBA 3FWEA 1CONA 2ZHKA 4NWWA 4N53B 5E88A 4PBPA 4AVAA 1J3PA 4BMBA 4AVVA 1RVF1 1Z0HA 2Y7ZB 4YVWA 2BOXA 4MLOA 1XE7A 3MI8A 1Q56A 1D4M2 3HO5A 3MW4A 4HL0A 1VBA3 5JOXA 3FBMA 3NJPC 4XJWA 3MQEA 4BQ1A 1UPSA 4BM8A 2VJ3A 1Q8VA 3AKQA 3B93A 3IPVA 3M3IA 4IEPA 1OOPB 1APOA 4S2GA 2R042 1NE6A 3CNAA 5FCCA 5DZFA 2UWPB 2QJVA 3NT1A 1S1AA 2AH2A 4RHV1 3KQEL 5C6CA 1SBDA 1PO13 2ETEA 4BDWA 2FHRA 2BOKL 2RR12 2PAEA 3OLTA 1CX2A 5FDQA 1LCLA 5AC92 1MEC2 3AXEA 3OBTA 4IQPA 1LODA 2EF6A 4COZA 1QJY3 4OUSA 2ET1A 2KA3A 3OLUA 2PHFA 1V6LA 4GA9A 3GISX 3VBRA 2EXJA 1BVP1 4Q2FA 2Y5FL 1ZZ7A 2XWBB 1PGEA 1NPEB 4A7IA 1NCQA 4OULA 4ZH8B 2P3UA 4E1GA 3FX3A 1BZWA 1H1AA 3IKWA 4GULA 2BTVC 2X5IA 1W8BL 3FE5A 1RUF3 4AVCA 3V65B 4NA9L 1KJLA 1FV2A 2WS91 1DGRN 4OHVA 2PAKA 4XFIA 1W39A 2YV8A 1HV0A 4YM0A 2PHTA 2GN7A 1RUG3 3WQ0A 1OKQA 1LULA 1C8M1 1XQNA 2BGC