1YO8A

Structure of the c-terminal domain of human thrombospondin-2
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
621
structure length
621
Chain Sequence
b'DGCLSNPCFPGAQCSSFPDGSWSCGFCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thrombospondin-2
molecule tags Cell adhesion
source organism Homo sapiens
publication title Structure of the calcium-rich signature domain of human thrombospondin-2
pubmed doi rcsb
total genus 165
structure length 621
sequence length 621
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02412 TSP_3 Thrombospondin type 3 repeat
A PF05735 TSP_C Thrombospondin C-terminal region
A PF07645 EGF_CA Calcium-binding EGF domain
A PF12947 EGF_3 EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yo8A05
5IUQA 1WLDA 4ISQA 1DHKB 4XJ8A 4DFSA 1Z78A 5GZFA 2ZZJA 3BIWE 4JRAA 4XTMA 2JECA 1S0EA 5K0HB 3FLPA 3U4XA 1AXZA 4FQZA 2EXHA 1S0FA 5EXOA 3N8ZA 1W6QA 5JBBE 1B09A 3ZYPA 3POWA 2UWPB 2PHXA 1F5FA 3B01A 1MZ5A 1CJPA 1NFUB 2JJ6A 4LBMA 2WNEA 2M74A 4XTPA 4Z8BA 2OUHA 1TPGA 1IOEL 4YM2A 5H9RA 2R1BA 4XBQA 5H9PA 2MGPA 1AX1A 1V6OA 2P34A 5IK4A 1SLIA 3K9XA 3R4UA 3SNMA 4AWDA 3M3QA 3SH5A 3AZZA 1C1LA 2DU1A 5FREA 3A0KA 4MYEA 1L3YA 2WT0A 4FOYA 1CPNA 3WDXA 5T50A 3LC5B 1QDCA 3I4IA 1SBFA 4Y26A 3A4UA 4XE9A 2CYFA 2P2KA 6COXA 1UAIA 4E1GA 2AYLA 5GZCA 5JVZA 1EAIC 2P3KA 3V65B 2D6OX 5F5QA 2NMNA 3N8WA 3QCWA 5CISA 4TZDA 4Y22B 3AJYA 4AGVA 1D2SA 2UWBA 2Y5GL 1G1TA 1C5MF 2R16A 3Q7DA 1WW7A 5I46L 2FLRL 2BQ6A 1O4YA 2GMPA 4YFZA 5JOXA 2UURA 1AJOA 1W6PB 2AYHA 2FD6A 1RITA 1DIYA 5T5JA 3OY8B 2E6VA 3VUOA 1Z0HA 1LHVA 3LN0A 4WZFA 4YZUB 1F7EA 1W6PA 5E8AA 2BQ7A 1SLLA 2BQPA 2DWRA 3SOQA 3WOGA 5GLUA 3AP4A 2A70A 1SCSA 5HCFA 3AYAA 4YM1A 3F6UL 3HS7A 1IOAA 3UJOA 3NTGA 1YUFA 4G1MB 1AJKA 3WDWA 3MW4A 4ISHL 5JVYA 5CKQA 1VIWB 4OZXA 1N47A 5JOYA 4ASMB 2YZ4A 4TYSA 2WQZC 2P3TA 4YZ1A 1EQHA 1DGLA 4ISIL 2JD4A 2ARBA 3QLQA 2WG4B 1QOSA 1SLAA 3TBDA 2XG3A 2P95L 4YW4A 4YW5A 1GLHA 2D3SA 3NV1A 1YO8A 1UMZA 3D4KA 1ZM1A 2NYYA 1LESA 2RNLA 4R9DA 1DDXA 3H5CB 3N8VA 5FDQA 3C2UA 3OGGA 1IJQA 4XIOA 1MQ6L 3RG0A 4BOWA 1YUGA 2WYGB 1GZCA 2MGRA 1G7YA 3ZYIB 3Q9OA 2EIGA 4FP3A 5H9QA 1IS6A 2ZGRA 5GALA 4UW5A 1DFQA 1RIRA 4ZXYL 4XDQA 1VALA 1ATEA 5E89A 1G2MB 2PR3B 3WCRA 1YYNA 1GZ9A 4X8VL 1NFWB 2AENA 3ZSJA 3V0BA 1H30A 2W2OE 1N1VA 1JL9A 3O12A 3TK5B 2J4IB 1DZQA 4Y7AB 3DUIA 2DTWA 2Z42A 1DQ5A 1QDOA 2FLGA 4CZSA 1SCRA 1Q8SA 2A3XA 3V0BB 4XBNA 2H9EL 4Q8LA 2D6MA 2OVUA 1J1TA 1Q8OA 1A8DA 1R1ZA 1HDKA 4XHXA 5EYYA 1YUKB 1MVQA 1ATBA 4FPEA 4AGRA 4SLIA 2WPME 1HT8A 5IKVA 2ZGNA 1V6MA 4FOWA 4X8UL 1M1XB 3ZYRA 3ZSMA 3RSJA 5T54A 1WW5A 4Y71B 4RUTA 1W7XL 4L8QA 5AVAA 2DTYA 2ZGQA 4MMZB 2GD4A 1IQGL 4Z0LA 1MS9A 3ZYGA 2GNTA 4K1YA 4Q8KA 2W2NE 5IK7A 2D6PA 1C1FA 4RRXA 2A6VA 4XXPA 2AH2A 3WG2A 3M37L 4F83A 2XC0L 4XJZA 3CNAA 4Y1YA 1GK5A 1CX2A 1WBFA 4Y1ZA 4FPOB 2DVDA 4M3CE 2EI6B 3LC3B 3CENL 2ZGOA 4M3CB 4Y22A 2PHWA 4NGAL 3DEMA 4XXAA 1EPWA 2Q1JB 2ZMLA 4FP2A 1LMJA 1Z6CA 4CTEA 3AJZA 2P28B 1Y7BA 2VY0A 1F0RB 2DU0A 3HS6A 3KK6A 1LOEA 3GALA 1KDMA 2W52A 2VWNL 3MW3A 5CA6A 4DS0A 3HR9A 1HZ8A 1MS0A 3IPVA 1G8WA 2YXSA 5HCBA 1U0AA 3TB0A 5DG2A 1MS4A 4YG0A 1MZ6A 4XJUA 3BTAA 1HRFA 2A7AA 4R9BA 5BYNA 2P26A 1CN1A 1MS3A 3R05A 4RRYA 2ZGUA 2VH0B 2VH6B 1LHWA 2W39A 4NO4A 4FPCA 2ENRA 4AYUA 1HLCA 3BODA 1CIWA 1KDKA 2WSUA 2AREA 1AXYA 3MDLA 2W3IB 2I2SA 3UL2A 2PELA 3LN1A 1RINA 4WV8A 1W6QB 2ZABA 3KQBL 1W6NB 4HL0A 1G9CA 3AYEA 2GNDA 1CVUA 2MHPA 3APBA 1OFSA 1UKGA 1WCSA 4XJ9A 3P5BL 2A75A 3TZIA 3AP6A 3IITB 1HT5A 1UZPA 1GANA 1CQEA 1FATA 3ENSA 2HYKA 1GZWA 1JHNA 1FF7A 3WLUA 3ASIA 3NT1A 4D69A 2W2QE 1W6MB 1PZ9A 2SBAA 1GBGA 5GLTA 3D5OA 4YGDA 1JYIA 1N3PA 1W0PA 4FOVA 2BZ6L 4JCKA 1IQHL 2ZGTA 1CESA 4WVVA 2WKKA 3AZYA 4KBBA 1WW4A 1IQLL 4WVWA 2YMZA 3B00A 2AGSA 2VWOL 1LENA 1UX6A 1N3QA 5HCAA 2W2ME 2W86A 1ATAA 3GISX 1TLEA 1SBDA 2G4IA 1EMNA 1RFNB 1UZKA 1IS5A 5IK8A 2A3WA 3AYCA 4YG6A 1JYCA 3TH3L 2KL7A 5KIRA 3SH3A 5EGMB 1UZQA 2Y5HL 3SLIA 3RS6A 4NG9L 3WG3A 1ULFA 2VJ3A 2GNMA 2Y5FL 1DQ4A 3WDYA 3ILRA 4R9AA 1URKA 1QU0A 1DBNA 1UL9A 5GM0A 4FPYA 1FAKL 1A3KA 3PGHA 5GZDA 1Z6EL 4P9WA 4AQTA 2D43A 3ILNA 3BT1A 1X7AL 2WLQA 3LSEA 3PVOA 1IQIL 4YZ3A 1S0BA 1LECA 4GKYA 1N1IA 3VKFC 1G9FA 1XQNA 3FCSB 3LTGD 4Z0KB 2D3PA 1WHEA 1XKBA 4YT6L 3HPTA 2W2PE 5JDBA 3F1SB 1CONA 2Y82B 1V6KA 3ZSKA 1DIWA 2WFXB 1JN2P 4OTYA 1GICA 3IN9A 1HQWA 2VXRA 4UW3A 3N8YA 3WNXA 1SLTA 3IKWA 1GNZA 4K21A 1BKZA 4M11A 5IKTA 1VAMA 3O0VA 3OPZA 5JBCE 2UWLB 4W65A 4DRVA 1CPMA 2A6WA 2ZHNA 2UWCA 3OBRA 5DXDA 4Q1RA 2DUPA 1LOFC 2V73A 3MQEA 4X8TL 3OYWA 1KLOA 5H9SA 2NZ9A 2J94B 2AUYA 1HKDA 3USUA 2KB9A 1G86A 2J95B 2ZACA 4YGEA 5LK5A 3R4SA 1V00A 1YRZA 2ZMKA 4BTIA 1V6NA 1G1SA 1WUVA 3AP9A 1KJLA 2ZGSA 3NTBA 2JE9A 3RQ0A 2ZGMA 4Y20B 3TK6B 4YW2A 2GDFA 4YZ4A 1DYPA 2NPRA 1MS8A 3HS5A 2FHRA 1EBVA 1I3HA 4P9XA 1H9WA 4CUDA 1BF9A 1VAVA 1G1RA 2PHUA 2ZHKA 5T52A 1HREA 1W0OA 1H9PA 2WYJB 2JKBA 2EAKA 3C9AC 2YROA 3OBTA 2R0FA 2Y7XB 5JW1A 3RRDA 1AVBA 4A7IA 1KITA 2XBWL 4O02B 4RL7A 1GSLA 5CNAA 2D6KA 1W6OA 2ZHMA 4DRRA 3KCGL 2EALA 4XJWA 1HX2A 3W59A 2VWMK 2ZMNA 2PHRA 1ZAQA 3FUOA 1HAEA 4Y79B 1JBUL 4FPFA 3V0AA 2GALA 2D6NA 3UK9A 4LBQB 1ENRA 1F0SB 5EWSA 2G00L 2W68A 2R0HA 4FPGA 2A3YA 4LBQD 3U7UG 4XBLA 2EI7B 2ADXA 1G9BA 5GLWA 2D1JB 1NT0A 1A78A 1WD4A 1ULCA 3HO3A 5CKNA 1WLWA 5T5PA 5F9TA 4JC1A 5JB8E 1IQML 1XKAL 2KV4A 2WPKE 3DGTA 2P93L 1TEIA 2FLBL 4ZH8B 1AXKA 2LTNA 1UZZA 1NLSA 1LOBA 4PCRA 4GKXA 3VKMA 1QNWA 2EF6A 3LTFB 1IKPA 5E88A 1WBLA 1XFEA 1S0GA 2DVGA 1QGLA 3WCSA 3INAA 1J9CL 1V6LA 1LQDA 4ISRA 4YG3A 1IOXA 3KQDL 4ZHAB 3NJPC 2NN8A 3N36A 1OB1C 1W8BL 1WU1B 2WT1A 1EGFA 3WDUA 1S0IA 2YGPA 1LGCA 1JV2B 1V3XB 1YXWA 4GWMA 3V65A 4Y1UA 1IQJL 4Y7BB 2CTVA 2Y7ZB 2WJSA 1WLCA 3W58A 4BDWA 4BTTA 2P3UA 2UWAA 3RR3A 1EPGA 3ZXKA 2W26B 3POSA 3MW2A 2YV8A 5F1AA 4BTUA 5L2ZL 3AZXA 4BMEA 3V0AB 1LEMA 1KRIA 1FE2A 1O5DL 5CB7A 2ZBJA 1G1QA 2CNAA 2H0BA 1EPHA 2J2UB 1I1EA 4D90A 1IGZA 2B7YA 1PRHA 4YGCA 5DUVA 1OQ1A 5JOZA 4M3CA 5DZFA 5GLVA 4PH9A 2GNBA 3WHUA 1N7DA 5T5LA 3SITA 1BJQA 1LHNA 2SLIA 1X50A 3T2TA 1SACA 2EI8B 3JU9A 1LOFA 4YW3A 1G9AA 1AX0A 1C4RA 1FV3A 2WT2A 3NV4A 1IQFL 1IS4A 1PGEA 4YLZA 2CJIB 1YI7A 3LSDA 4ZXXL 1LULA 4FM5A 1Q8PA 3M1HA 4AVTA 3AZWA 2WSVA 5DG1A 5L2YL 4Y76B 3IMNA 1QOOA 4XBMA 5DUUA 4C16A 5E8DA 3HN1A 1ENSA 1FYUA 3HO4A 2PHTA 1F31A 4XYXA 2VUAA 2WFTA 2VVVL 3EGFA 4BQ1A 1LGBA 5DUWA 4AVSA 1MS5A 3SW2A 1ADXA 4JZDL 1AX2A 4P9YA 3TAYA 2DDUA 2ES3A 2PHFA 2EXKA 1FV2A 2TEPA 1SLBA 3N7LA 4PF5A 3GCWE 3FBYA 3AYDA 1KLJL 1LJ7A 2ZHLA 2A6XA 3LAQA 2ZGKA 3B69A 1QKQA 1GZWB 3N7KA 4MMYB 5COXA 1WW6A 4FPJA 4XZPA 4BMBA 2Q5TA 1EQGA 1JOJA 5T5OA 2J34B 1QNYA 1LCLA 2OW4A 1LOCA 4BXWA 3M3EA 4HANA 4D0FA 1LHUA 1KJRA 1DQ1A 2I9BA 4XILA 5EYXA 1JUIA 5IT6A 1EPJA 1EZQB 3IM0A 1IGXA 1V6JA 4LORA 4XIKA 2V5YA 2BO2A 1PZ8A 2JDZA 4LBKA 3FFZA 4JYUL 1P9JA 5L73A 3CA7A 1Q8VA 1Q8QA 3VKNA 4Y1XA 1BYHA 5JBAE 1SLCA 1CVNA 3M2MA 2DVFA 5SV8A 2ZKNA 4FPHA 4FOQA 3FLTA 4LBNA 1F9KA 1LOGA 1ULDA 1URXA 1IVOC 5F19A 1NPEB 3ZXJA 4NOTA 4K1ZA 1NFYB 1LPZA 1U8CB 1ONAA 5JLVA 3SH4A 1HAFA 4XMIA 4GXLA 1IQEL 2NP0A 1JW6A 3PJQA 3WG4A 5IKRA 1EPIA 2E7QA 2I9AA 3WUDA 4BPZA 5KXCA 5GJ6A 4Q2FA 4FVVA 3WV6A 1L5GB 4YW1A 1NFXB 1ULEA 2P3IA 4OTJA 5DZEA 1AZDA 3B9CA 4YZ2A 2XBVL 2K2TA 3AP5A 3LCPA 4MMXB 1SZBA 3WG1A 2FMDA 3WHTA 2B7DL 4ZAEB 5GLZA 4BLIA 1W6MA 4AVVA 4IQPA 4O1ZA 3OLUA 1G2LB 1S1AA 1FX5A 3SOVA 5KXDA 3ELAL 1FFMA 2CWMA 3OY8A 4GA9A 2P3JA 1APNA 1DQ0A 2P3FN 1I0UA 4DQAA 3V64A 4TGFA 2WPIE 3WZ1A 4BXSA 1QF3A 5GZEA 3B3QE 1U67A 2ZAAA 1N1TA 3ATGA 2E51A 1YIFA 4FPLA 3ZSLA 3AXEA 2A71A 1UPSA 1COUA 4CSYA 2XC5L 1MOXC 2FZZL 2YGOA 2BMGA 4YT7L 4XHBA 3WVJA 1GV9A 2Y80B 3RMYA 1SBEA 4Q1PA 4ATEA 1EMOA 4RRWA 1OKQA 2OUJA 2PUQL 4ZKTB 4CRQA 2ZA9A 3ZXFA 4XL1A 1FAYA 2UU8A 3QMOA 2YY1A 3N7JA 1W6OB 1P0SL 1B9WA 3WDTA 2A6YA 1DQ2A 2NM1A 1NQLB 1UZYA 1BXHA 2D6LX 4YGBA 1FSBA 5L30L 5JOWA 4RS0A 1LGNA 3OJBA 2RHPA 2C5DA 3MPPG 2ZGLA 1N1YA 3VKOA 3IPVB 4LMFA 2UWOB 2J38B 1LODA 4R9CA 2CY6A 3PMEA 4NA9L 3N8YB 4PBPA 1S0DA 5JB9E 4XMAA 2XBYL 2VW1A 1IQKL 4U2AA 2OYEP 1XDTR 2GN3A 4U36A 3JUUA 1PTHA 1N3OA 3KL6B 3NWKA 4GALA 2DUOA 1KQRA 2XC4L 4LBQA 4Z6AL 1ENQA 3KRKA 2P3FL 1LEDA 3OYWB 2XBXL 2BOKL 1Q56A 1AUTL 3O0WA 3ENRA 2DV9A 5CKMA 1D0HA 2LALA 3M36L 2E53A 3FLRA 3BPSE 2EXIA 1WD3A 3O0XA 3LIWB 4XOGA 3N7MA 4XJAA 2BOHA 4BDXA 1V6IA 3AZVA 4I30A 2AR6A 1N1SA 3SOBB 3HMYA 3GNEA 1PFXL 2VW0A 3IJEB 3WUCA 3T1LA 4JZEL 1LU2A 5DUXA 3VV1A 3AK0A 3QH0A 2VU9A 2Y81B 5KXEA 4FPKA 3OLTA 3Q3KB 3M3CA 4COXA 2OYUP 1BZWA 1DLLA 3CFWA 1GKBA 5KN5C 5CBLA 1MQ5L 4K20A 1QFKL 3FUQA 1PZ7A 2D3RA 3BT2A 4CUEA 3BOPA 5CAZA 1HQLA 4LBJA 1IKQA 2EXJA 2VVCK 1WHFA 4UW4A 4LBOA 4UW6A 3POYA 3AX4A 5JVVA 2R49A 3ZXEA 3KQCL 2WPJE 2RA0L 2P37A 1JXNA 4YM0A 3SISA 1QMJA 1C57A 5IK5A 3PVNA 1IQNL 1JBCA 3AP7A 1TOZA 3VKLA 2WG3C 1NZIA 4M3CF 2VW2A 2R1DA 3N8WB 3N35A 1FNZA 1A3PA 4ZXKA 3KQRA 4C1XA 4H55A 1CEJA 2VVUL 5T55A 1ZA4A 1FNYA 4RRZA 4Q27A 2D7FA 1CVWL 3RMXA 4PBOA 4YM3A 5IKQA 2WPLE 4JYVL 3USUB 2W3KB 1KIGL 2ZGPA 2ARXA 2BOXA 4RA0A 2BOUA 2DURA 2A6ZA 2CWSA 1CCFA 3GCXE 2GN7A 1HCGB 2JE7A 2W08A 4D0EA 1LPGA 2P94L 3AXDA 3N3HA 4YFWA 2F9BL 1CCVA 2KM2A 1NXD1 1UN1A 2DYCA 2P16L 1MVEA 3ZYJB 1S0CA 1GNHA 3NV3A 4JZFL 1W6NA 2ERFA 1FJSL 3O5SA 2D44A 4AGGA 4ITCA 3AFKA 4Q26A 3WDVA 3ILFA 3N8XA 1DQBA 1LHOA 5FRAA 3FFGL 3KM5A 1LU1A 1DYKA 1LPKA 2BQWA 3D6EA 1MACA 3ZVXA 5GZGA 1HJ7A 3H0OA 4M10A 1S0JA 2XB6C 4YZ5A 3KQEL 1VLNA 4DPNA 2NMOA 4Y24A 1FAXL 3L2YA 1LOAA 4M01A 3U73A 1APOA 5DZGA 1PXXA 4ATFA 1QOTA 4M00A 1MS1A 1GYKA 4P14A 3V64C 2GMEA 1BQPA 1K37A 1IP0A 1KSNB 3TGFA 2DVAA 1ULGA 2JKHL 3UJQA 3M3OA 1G9DA 3I8TA 1AF9A 4Y6DB 1DVAL 4C1WA 1CQ9A 2K2SB 2C9AA 2TGFA 4CUFA 1DQ6A 2DUQA 4GWNA 1UZJA 1Q4GA 4X8SL 2CL2A 1MR5A 4Y20A 1K36A 1SFYA 4Y1VA 3ZPYA 2VH9A 2GMMA 1YGCL 1ATDA 4BLJA 1KLIL 1F7MA 4FQ4A 3PVEA 2Y38A 3CS7L 2VWLL 2WPHE 4BM8A 1CR7A 2E7TA 2A5ZA 2DVBA 3T1MA 2PHBB 1O4ZA 3NV2A 1APQA 1LTEA 4PQ9A 5KXBA 3MEPA 4XLWA 5JMCA 3A0NA 1IS3A 3HO5A 4LBLA 3ZXLA 1DX5I
chains in the Genus database with same CATH superfamily
5IUQA 4EN8B 1WLDA 2WWJA 2J22A 2K9ZA 4ISQA 1DHKB 2HEVF 2TNFA 1BBT3 3NJVA 4QQ2A 3ES4A 3BPSA 4XJ8A 4DXTA 4DFSA 1CAUA 5A6XA 1XNTA 3AVSA 1Z78A 1RUI3 4LUKA 4CEWA 1REDA 5JXJA 5J09A 5GZFA 2Y6KA 1P8JA 1XYOA 2JE8A 3ETPA 4F7ZA 1G6NA 4S2FA 2ZZJA 5FPVA 3J7LA 3BIWE 3KVBA 5JR7B 1DF0A 4JRAA 4XTMA 4Y4YA 1W39A 2JECA 1ND2A 1GMMA 1VBA1 5K0HB 1S0EA 3FLPA 3U4XA 2YGQA 3U10A 2QZ2A 2VQ0A 1AXZA 1AR81 2XLGA 4FQZA 1FOD3 5D21A 3W20A 2EXHA 5JXHA 2IXKA 1S0FA 3LOIA 5EXOA 1UYYA 3N8ZA 1W6QA 5JBBE 1RUI1 1GQGA 4HLTA 4Y5TA 1B09A 5KC5A 1A8MA 3ZYPA 2QNKA 2ZOEB 1ZX5A 1VRH2 3POWA 4H14A 3E5UA 1XSQA 2GH2A 4K8FA 2O0OA 2UWPB 3B93A 1WMDA 1NAEA 2PHXA 3WW4A 5JIAA 4AI0A 2VTXJ 4KH9A 1F5FA 3B01A 3W21A 2QDRA 1F8VA 2QQIA 5IFPA 4CUAA 1W8ZA 4GZ9A 3U11A 5J36A 1MZ5A 4TN7A 5JPMB 1QJY2 3FBMA 3CZUA 3JBG1 4OVEA 4AHXA 2RVAA 2WZ8A 2JDAA 3H1WA 1K5MA 1CJPA 5I0SA 1RGSA 1OBNA 3VZOA 2E26A 1NFUB 4QU2A 1UU4A 4NVPA 4A94C 1GUIA 2JJ6A 4LBMA 3ZKYA 1SPPA 1ZRRA 2WNEA 2WAAA 3RI9A 3IIIA 2M74A 2WLPA 4P9LA 4XTPA 4Z8BA 1ND2B 3WW2A 4LHLA 2W94A 2C1FA 1OKOA 2HWD2 3I2JA 4KQ7A 2OUHA 3BI3A 1SDDB 1OQDA 1TPGA 1IOEL 1ZA7A 4LO6B 4YM2A 3CMGA 2Y60A 5H9RA 3BU0A 4UF0B 1UOFA 2K2SA 2GC3A 2R1BA 4HETA 4J25A 2VZPA 4XBQA 5H9PA 1F4AA 1JOBA 2WR9A 4G3YC 2MGPA 2W46A 4AFMA 1AX1A 1V9U3 3ZFGB 3GGLA 1V6OA 2YUEA 2X29A 3KF5A 4DZGA 1X8MA 2P34A 1TME3 1MEC3 3PMSA 4EROA 4JRLA 5IK4A 2F17A 1SLIA 3K9XA 1AR61 1KFXL 2VBPA 5LB6A 3T0BA 3R4UA 5FPBA 4Q4V1 2YDEA 2Z2SB 1DCSA 3K3OA 1VMFA 4MGSA 4R8HA 3SNMA 4AWDA 1H8TC 4W6XA 3D3AA 2ZPXA 3M3QA 2O14A 1DG6A 3LEMA 3SH5A 3AZZA 3H3LA 1KGYA 1C1LA 2DU1A 5FREA 3A0KA 1R091 4HVOA 1L7LA 3DKQA 4MYEA 2PHLA 2J42A 1L3YA 2WT0A 2D97A 4AEDB 4FOYA 2RS33 1CPNA 1H8VA 2W1WA 3WDXA 4GIQA 1XBFA 4QPIC 5FZ3A 2JDPA 5T50A 1AHSA 1HV0A 1WZXA 3LC5B 1D4M2 1QDCA 1RXFA 1SBFA 3I4IA 2CDPA 3ZIXA 4BA6A 4Y26A 2VVDA 3A4UA 4LPLA 4H7MA 5DDJ1 2VECA 4XE9A 2CYFA 5FMBA 1UW8A 3MO4A 4LLFA 2P2KA 6COXA 4TSVA 1UAIA 1PX4A 3GCXA 3OGSA 1RMU3 3KGLA 1D7PM 3KSCA 4E1GA 2AYLA 2VTFA 1SPPB 4DUWA 5KHIA 5GZCA 5JVZA 4LXLA 1EAIC 5F3EA 1DU3D 2P3KA 3V65B 1JMUB 3DECA 2D6OX 5FP3A 3VBOB 3WW1A 5A3TA 3JZVA 5L7OC 5F5QA 5C71A 2JX9A 2NMNA 1AUYA 3O1OA 3W5MA 3N8WA 2R073 3JB8A 3QCWA 4WVVA 5CISA 2QTWB 4JGYA 4YVSB 4QB2A 2B46X 4X8PA 4TZDA 4Y22B 3AJYA 5A6ZA 5BNNA 1H4GA 1VRH1 5TSWA 4AGVA 1D2SA 1W8TA 2F6BA 4JHTA 4DIQA 3O1PA 2UWBA 2Y5GL 3FN9A 3MV11 1G1TA 1C5MF 2R16A 2RDSA 2YPDA 3Q7DA 2J1SA 2ZX3A 1WW7A 5I46L 2FLRL 2BQ6A 4EWAA 2IXLA 3TEZA 3RPQA 2UYAA 5LK7B 3MV01 1O4YA 3E5QA 5FY5A 2W47A 3BCWA 5FYHA 3KLSA 5JWPA 2GMPA 4WVZA 4YFZA 2CHHA 3PIJA 3CHXA 3R4DB 1ASJ3 2WIIB 5E1RA 1OF3A 2UURA 5JOXA 1AJOA 1W6PB 4KGQA 4CEWC 2X8KA 2XJTA 1VJ2A 2X5IA 5JCTA 1PGL1 3I2IA 5FYCA 1HQNA 3I2HA 4NIAA 2AYHA 1POV0 2FD6A 5ANNA 1KXGA 1RITA 2O8QA 4NPRA 3ZSEA 4A6OA 5C6CA 1DIYA 3P5BA 5T5JA 3OY8B 4UFJA 2GC0A 2E6VA 3GZEA 4LUMA 3VUOA 1H8TB 1Z0HA 5J48A 1LHVA 3LN0A 4WZFA 1R1A1 2WO3A 2VOTA 4YZUB 3VBSB 1VB2A 1XXNA 1UX7A 1YFUA 4Q5OA 5A1AA 1JZ6A 1R083 1F7EA 1FPN1 2RR12 3MFCA 3IMMA 5ISLA 2HWC3 2W87A 2RJ2A 1MEC2 1W6PA 4QXBA 4UFIA 4CCMA 2QQUA 4HZFA 4XQ4A 5E8AA 1U5XA 3FMGA 1YQ6A 4AAXA 4URAA 1PM7A 1REFA 4RHV2 2BQ7A 4GJYA 1UZWA 2D93A 4NAMA 1TMF2 5DAPA 1PO22 1SLLA 2EIEA 4K8RB 4L11A 1F35A 4QT6A 5B4XA 4OLLA 2BQPA 5L7OB 2DWRA 4BHPA 3SOQA 3WOGA 5GLUA 3AP4A 2P1BA 4UT5A 1W3VA 2A70A 2IVJA 4JGYB 4A3XA 1EYBA 1SCSA 1W9FA 2WZR2 2UY9A 2VO5A 4NPLA 5HCFA 2MEV1 1B35A 2VZ3A 1NA1B 1YFYA 4J6GA 1HIXA 5J1XA 3AYAA 4YM1A 4AE2A 5F32A 1EAH3 4BISA 1UWWA 3F6UL 3HS7A 3U75A 1IOAA 1W99A 5EV7A 2FDKA 3UJOA 3NTGA 1YUFA 4G1MB 1AJKA 1IZ3A 4IV1B 4LOTA 2Q0AA 3RZMA 3WDWA 4Y4RA 4N43C 3MW4A 4ISHL 5JVYA 2RR11 5CKQA 1VIWB 4OZXA 1N47A 2Y6FA 4P5YA 5EP9A 4ASMB 5JOYA 1VBE3 1ZREA 4IE4A 3CZJA 1UXXX 2YZ4A 4JKLA 4LEJA 4A44A 3VD9A 3PUHA 4D6RA 1R1A2 4MXWA 4TYSA 2WQZC 1H8TA 2BERA 5JPNB 1OH4A 4UAPA 2P3TA 1E5RA 4F3JA 3H50A 1EQHA 1DGLA 2C6SA 4YZ1A 5LEKA 4ISIL 2JD4A 1FOD1 2ARBA 3QLQA 4BQ2A 3S57A 4QWNA 2WG4B 3ZN6B 1QOSA 1SLAA 4Q0UA 4BQ3A 3TBDA 2XG3A 2DCJA 4XFFA 3FHQA 4BK4A 4IEQA 2P95L 1VBD1 2RS13 2XXZA 5F2WA 4XAAA 4NIGA 4YW4A 3OD0A 4YW5A 4M4RA 1FPN3 3UESA 2IZWA 3BIEA 1GLHA 2D3SA 1V1IA 2VOVA 4Q4W3 5LATA 2WNVB 2VM9A 2WN3A 2UY8A 2PA7A 3NV1A 1YO8A 4EYUA 4IEVA 4CDUC 4N90A 1UMZA 3D4KA 3LZZA 1ZM1A 4ZS2A 2NYYA 4XEZA 4XW3A 1LESA 2XHNA 3AKRA 4AHZA 3PUQA 4A7KA 3GHNA 2RNLA 1H2KA 4R9DA 1DDXA 3PDQA 3LKJA 4GQ7A 3H5CB 3N8VA 4KMQA 5FDQA 3C2UA 4CDXB 3OGGA 3VBUB 1IJQA 4XIOA 2VZOA 4JGYC 1MPXA 3HQXA 3ORJA 1MQ6L 1OLME 2BFUL 4FT8A 1DLCA 5A7QA 3RG0A 2LRPA 5F6LB 1NYWA 4BOWA 1HX6A 1YUGA 5GKAC 1ZRIA 2XJUA 2WYGB 2VNOA 2BYVE 1GZCA 3M4FA 4XETA 1B35B 3M70A 3K51A 2YC2A 4QXHA 4E4SA 2MGRA 1G7YA 3JD72 3ZYIB 3Q9OA 4YVWC 2EIGA 4ZU7A 1AYM2 3NSTA 1YHFA 4FP3A 5H9QA 3ZDSA 1IS6A 2ZGRA 1COV1 2PMWB 2P6HA 4GH4A 1J1LA 5GALA 3BVCA 4UW5A 1Y43B 1DFQA 2J1VA 2ZJCA 1RIRA 2WO1A 1ZBA1 4ZXYL 1ZYBA 2HWB2 4XDQA 3RYKA 3T2PA 1PM4A 3RFRA 4XFBA 1VALA 4JTNA 1ATEA 5E89A 1G2MB 2PR3B 3WCRA 1VRBA 1YYNA 1J58A 1GZ9A 4X8VL 3SC7X 1NFWB 1LRHA 5CFDA 1X9PA 5EJZB 1W2AX 4D3WA 2AENA 1I9RA 4PI0A 4IE0A 3CEWA 4LNVA 3ZSJA 4CU9A 5JXGA 3V0BA 1ZRFA 3RVHA 4P9JA 3ZN6A 4AEJA 1H30A 2JD9A 3ACFA 4L97A 5F6KA 2VMFA 2W2OE 3A22A 3E1F1 4FAHA 1N1VA 2QQMA 5F3IA 4BZ4A 1JL9A 1IPJA 1NCQC 2CGNA 4GJZA 3O12A 2Q8OA 3TK5B 1VAKA 2OIIA 5IVCA 3VBSA 2J4IB 1DZTA 1DZQA 4CUBA 4QPWA 4IEXA 1AYN1 4Y7AB 3DUIA 5IVFA 2DTWA 2Z42A 3I3QA 2ZX2A 2GH8A 3DN7A 1DQ5A 4LO4B 3D82A 4W6WA 1GR3A 5FJHA 3ZKUA 1QDOA 2FLGA 2QVSB 2RR13 5ERLA 4AVAA 4CZSA 1SCRA 5A7WA 1Q8SA 2A3XA 5IJRA 2HWD1 2XBO2 4X8NA 3V0BB 4I09A 2DCTA 3EHKA 2H9EL 4XBNA 3LIGA 5FMCA 3I49A 5DPNA 3VL8A 3ZFFC 4RR3C 2IWGB 2D5HA 1LB2A 4Q8LA 1XE7A 5L19A 2D6MA 4PI2A 2W92A 1C8M3 2OVUA 4DUXA 1J1TA 4XDPA 3E6BA 1Q8OA 1O5LA 1A8DA 1R1ZA 2VRSA 1PO11 4BK5A 1HDKA 4XHXA 3EB7A 1QJY1 4LKDA 4RN5A 3ZO0B 5C8CC 2BWCA 1B35C 4RGKA 1GOFA 3QOPA 4Z82A 5EYYA 1YUKB 1MVQA 4HVQA 1ATBA 4FPEA 2ZXQA 1UKRA 4AGRA 5K0UC 2B5HA 4SLIA 2RS51 1JHJA 2HYXA 4UYBA 3W5NA 2WPME 5F3GA 5A3MA 1HT8A 3FZ3A 3NO8A 2B9VA 3C7GA 5IKVA 1UIJA 1V6MA 2ZGNA 2CGOA 3T2OA 2CAVA 1JU4A 4FOWA 4X8UL 1M1XB 3MBWA 3ZYRA 4E4DX 4H3WA 3RSJA 5T54A 1WW5A 3ZSMA 5C70A 4K6BA 4S2HA 5K0UA 5C4WC 2ET7A 4IV3B 3SCGA 4S2GA 2E31A 4Y71B 4RUTA 3LAGA 4H2AA 1W7XL 4IXLA 5I91A 4QDQA 1YI9A 4L8QA 5AVAA 2DTYA 2ZGQA 4MMZB 3PU8A 1VMHA 4AI2A 2GD4A 2RDNA 2RS32 5CFCA 1CAXB 5JI9A 1IQGL 4Z0LA 1MS9A 3ZYGA 4B4PA 2GNTA 3BB6A 1C28A 2KXLA 2PXJA 4K1YA 3S5AA 1CAUB 4CP1A 1RUH2 5FPXA 3KHCA 3ZFFA 2PHDA 2LUWA 2W2NE 3ACIA 4Q8KA 5IK7A 1RUNA 1RUG2 2D6PA 3QD6A 4QX2A 2HBUA 1K5JA 2YGMA 3POBA 1C1FA 4RRXA 4B1LA 4XQDA 2VUJA 2A6VA 4XXPA 1WA4A 2AH2A 2ORXA 3M37L 3C3VA 3WG2A 4Q0VA 4F83A 1W2UA 2XC0L 3AMPA 4AEMA 4XJZA 4W4ZA 5CFDB 3CNAA 2F4LA 4KWLA 4HKLA 4Y1YA 1IPKA 2YBKA 4LA2A 1GK5A 1CX2A 1WBFA 4Y1ZA 1UCXA 5FK8A 4JX0A 3ZFEC 3BTYA 1RUOA 4Q4X1 3SXWA 4FPOB 3JQWA 1S4CA 2DVDA 1PK6B 4M3CE 2EI6B 1O59A 4KU7A 3LC3B 5I8SA 3CENL 5A6YA 1TVGA 2HWE2 2ZGOA 4M3CB 2C0ZA 4Y22A 2PHWA 2VZRA 4NGAL 3DEMA 4J1XA 4XXAA 1F2NA 1EPWA 2W1QA 2PN5A 4MV2A 1Q3EA 5A7PA 1K45A 2Q1JB 2ZMLA 1VE0A 3KV5A 5C8CB 3JXSA 4FP2A 1LMJA 1Z6CA 2EICA 1UMIA 4CTEA 3IB3A 2XGXA 4LA3A 4C0BA 3AJZA 3O1TA 1NXMA 2FDJA 3ZXAC 3H8UA 1FT9A 2P28B 1VBD3 1Y7BA 2RS11 2VY0A 2VCBA 4Q0SA 3USSA 2VMIA 2QE3A 1F0RB 4UFMA 3VZNA 2DU0A 1X7NA 3HS6A 1NA1A 3KK6A 2IUWA 3ZOIA 3VBUA 3PNAA 3WNLA 1HN1A 2A1XA 3I2KA 2G19A 3DPRB 1LOEA 2XJVA 3GALA 5JIUA 2GZWA 3UGGA 3VD3A 1KDMA 1UYXA 3AMHA 3OG2A 2VQTA 4IV3C 4NPMA 4XF4A 4WM8C 2W52A 4O65A 2VWNL 5I0DA 3GYDA 1IG3A 2Q30A 3MW3A 1EP0A 1AR91 1UOGA 2VVFA 5CA6A 4DS0A 1PK6A 1MQTC 3HR9A 2YG0A 4JDNA 3WF2A 1HZ8A 1MS0A 3IPVA 4Q4Y2 3IBMA 3UKTA 1G8WA 2YXSA 5HCBA 5FQ0A 1U0AA 3TB0A 2P5BA 4CU8A 5DG2A 2WC2A 4K3UA 4Q4W1 2VCMA 2ZKLA 1I6XA 1MS4A 4YG0A 3TWIA 1MZ6A 3I2FA 4XJUA 3OBAA 1PO21 2OZ6A 3WINE 5BNPC 3BTAA 2BV4A 1SEFA 1HRFA 1QJX3 3ZLIA 2A7AA 5FOJB 4R9BA 5FKBA 2J1UA 5FMOL 3O1RA 5BYNA 2VZQA 1XRUA 2ZX4A 3AL6A 3SHRA 2P26A 1W3XA 5FO8B 1RUF1 1CN1A 2MEV3 2WNUC 4RS5A 4CP9A 2RDRA 2R7EB 1MS3A 4MOAA 3R05A 4HN0A 1W90A 4RRYA 4NE9A 2R072 3J7MA 1FPN2 4OI2A 1PGSA 4LKEA 3RJRA 2ZGUA 2VH0B 2VH6B 2ZEXA 1LHWA 1OUSA 3QH7A 2W39A 4NO4A 2JWPA 2VL4A 4NWWA 3I59A 4CDQC 2WFPA 1W9TA 4FPCA 3D0SA 2ENRA 5D2AA 2XMLA 4A45A 3ZR5A 1RJ8A 4AYUA 4IV3A 3MIBA 1HLCA 5FPZA 2ZZQA 3BODA 1ZRCA 3I3MA 1W05A 1CIWA 1KDKA 2JG8C 4WBBA 3RWKX 2WSUA 2RE9A 5LW9A 2AREA 4FTEA 1CZVA 5FXVA 2RMU1 2BVBA 1R1A3 2HWB3 2Z4FA 2ET1A 5K9YA 5D8AC 1ZZ7A 2XL9A 4PIXA 1VBE2 2BTVC 1AXYA 2QQVA 1CAWB 2OKXA 1LR5A 4GAZA 3Q8FA 3MDLA 2W3IB 1S55A 2I2SA 4I0WB 4K40A 2WS91 3UL2A 3WNPA 2I45A 3FC0A 4YVSA 3UETA 1REEA 4COVA 1NX9A 2PELA 3L2HA 3OGRA 2RG4A 5A7SA 3LN1A 5FZGA 1RINA 4S2DA 1QJX2 3OF1A 1OOPA 2QCSB 4WV8A 5C3PA 1W6QB 2Q4SA 4BDVB 3GZTB 5KWRA 2ZABA 1GU3A 3KQBL 2JG9C 4K9SA 1W6NB 3POEA 1TE1B 3WG4A 4HL0A 5J7MA 3C7OA 1G9CA 3NJXA 5FZEA 4IEOA 5BY5A 3KMHA 3L9JT 2XH6A 1I5PA 2GNDA 3AYEA 4R4XA 2QQPA 1CVUA 1PO12 2MHPA 3APBA 2Y0OA 4HPKB 1OFSA 1JTZX 4META 2WNOA 4N9IA 1UKGA 4MO3M 3LA2A 4QHOA 3MIEA 1BVP1 1WCSA 4Q0PA 4XJ9A 3Q8AA 3UT0A 5LEJA 3P5BL 2A75A 3TZIA 3AP6A 3IITB 1HT5A 1UZPA 4D7YA 4KWKA 1GANA 1GWLA 4FO9A 1CQEA 1L7QA 5LBEA 1FATA 3WD5A 3ENSA 1UO9A 2HYKA 5DDJ2 5HBAA 1GZWA 2F4PA 1JHNA 3MYXA 5KHGA 1FF7A 3WLUA 3J8F2 1HRI3 3ASIA 5FBJA 3NT1A 1IGOA 1PIV1 4D69A 4LE4A 3I2GA 1E57A 1RMU1 4CDQA 2J1AA 5B2GB 5FYTA 2W2QE 1W6MB 1OH3A 2FQPA 1PZ9A 3E6DA 2SBAA 2Y64A 5CZKA 4DNYA 1GBGA 5GLTA 5FDBA 3D5OA 5FBZA 1HJFA 3BALA 1Z7S2 4CDUA 4MLOA 4YGDA 3GDBA 1RUC3 3LQCA 1JYIA 1N3PA 1UZ0A 2YFZA 1W0PA 4QKDA 4FOVA 2BZ6L 1EUTA 1IQHL 2ZGTA 1CESA 1D4VB 3LFIA 3OUJA 4JCKA 2ADDA 2WKKA 3AZYA 5FLJA 5FYSA 3UV9A 2FZ2A 4KBBA 3LPGA 1AR62 1T6BX 1WW4A 4O9EA 4CU6A 1IQLL 1RHI3 4WVWA 1LMMA 5APAA 2YMZA 5C33A 5C9AA 2KA3A 3GJBA 1NG0A 3B00A 3VBFC 3AMNA 3OB8A 1QEXA 4LTAA 2AGSA 2IXHA 1RUE3 3MIHA 2VWOL 1LENA 1OLQA 1N3QA 1UX6A 4DINB 5HCAA 2W2ME 2W86A 4B1MA 1PNGA 3ZDVA 4Q4V3 5F39A 3S5QA 1ATAA 1YIPA 3EXUA 1ULPA 5A3NA 3GISX 2YHJA 5A3WA 1YJKA 1W9WA 3CJIA 4CXWA 5FY7A 3URFA 3DF0A 4N53C 3WXPA 4CDWA 3OUHA 1BCXA 3ZYBA 3KV6A 1TLEA 1HRV3 1SBDA 3VHPA 1GWMA 3HNBM 1AYM1 1QHDA 2WS92 2G4IA 2BBAA 1IPSA 1EMNA 3JD71 1RFNB 1UZKA 1UY0A 1OLMA 1W9YA 1IS5A 4RR3A 5IK8A 1VBE1 5M0TA 2EIBA 3S30A 2VZ1A 5FWEA 1QJU1 2A3WA 3AYCA 4YG6A 5D1IA 2XR4A 3JBG2 2BT7A 1JYCA 3AMQA 3NAPA 2H6CA 1LNSA 1GOGA 4P9IA 1VBB3 3SKVA 3VDAA 5C8WA 3TH3L 2KL7A 5KIRA 2PFWA 5EGMB 2VTXA 3IAPA 3SH3A 3VZJA 5IATA 1C8NA 1UZQA 3BKZA 2Y5HL 3GBGA 5FUIA 3DYMA 4BYYA 3KB5A 4ET7A 1OSGA 2RJKA 4P5HA 3SLIA 3UNPA 4B7EA 2WNUA 3RI8A 2FCUA 3RS6A 2YB7A 2TUNA 2ZEYA 5C9AC 3C8XA 5IVJA 2FDGA 4NG9L 2ARCA 4FTBA 1AR82 1YEWA 4OMCA 1HXS1 3WG3A 2CDOA 4RGAA 3IDEA 1ULFA 2VJ3A 1V0AA 2GNMA 3OTFA 2Y5FL 1W8HA 1Y9MA 5KHHA 1DQ4A 3ECQA 3ILRA 4R9AA 3WDYA 4AFDA 1URKA 1AYN3 3K3NA 1JZ7A 2QQJA 1QU0A 1DBNA 1UL9A 1VRH3 4QB6A 5GM0A 4FPYA 4Z2AA 2QJVA 4E2SA 2Z69A 4UF0A 2JDNA 3PUAA 4NRPA 1MQTA 5EJ3A 3WQBA 5F3CA 1FAKL 1A3KA 4JHZA 3PGHA 4DB5A 3CKHA 2X09A 2YU1A 1Z6EL 4P9WA 3KV9A 3KVAA 5GZDA 3VBFB 1QIUA 1QXRA 3HT2A 1AR73 4AQTA 5A3LA 2D43A 3ILNA 3BT1A 1X7AL 2WLQA 3LSEA 2LROA 1O3RA 1TME2 3WY6A 3PVOA 1IQIL 4QPIB 4ZU4A 5FP8A 4PT6A 1LK9A 3HOBA 2RV9A 3LEIA 4YZ3A 2HKXA 4P00B 2BT8A 4NHYA 1S0BA 1LECA 4GKYA 4JTOA 2Y6JA 2X5IC 3VDCA 1N1IA 4QDRA 4JKMA 3VKFC 1G9FA 5FWJA 4NHXA 1XQNA 3FCSB 4KG0A 2BVVA 2H0VA 4R52A 4W50A 4RS5C 3U1XA 2RM21 3LTGD 3FX3A 4Z0KB 4I01A 1GQPA 5FV3A 2D3PA 2A73B 4OFGA 3WEZA 1WHEA 1XKBA 4YT6L 3HPTA 3FHAA 1K5MC 1YC61 4L2NA 1QH6A 2KR2A 3CJXA 4AVBA 4LT5A 4MXVA 2W2PE 2PYTA 4HXCA 4IEYA 4RYDA 5JDBA 2AEYA 1JYNA 1V6KA 3F1SB 1CONA 2Y82B 1QJU3 1K12A 1TNRA 4GMP0 1DIWA 5IAVA 3ZM8A 3ZSKA 5JAXA 3ITQA 1US3A 3P3NA 2WFXB 1JN2P 4OTYA 1GICA 2BDRA 3BTXA 3IN9A 1HQWA 4JDOA 1NQJA 2VNVA 5A7WB 2VXRA 4UW3A 3N8YA 2WUHA 3CLPA 3WNXA 1SLTA 2QQWA 3IKWA 5B4NA 1GNZA 2OS2A 1TMF1 4K21A 4BIFA 1BKZA 3POFA 5D8AA 4M11A 5KR7A 5IKTA 1VAMA 2DCYA 2Q1MA 1QJZA 3O0VA 4WM7B 5I0TA 5FYYA 5LA9A 3OPZA 1RUG3 4AL9A 2WL1A 5FTTC 5LA1A 3GXUA 1HB4A 5JBCE 3OEBA 2UWLB 4W65A 4D0QA 4DRVA 2LW8A 3KF3A 2VZVA 5FP4A 5A1FA 1CPMA 2A6WA 2ZHNA 2UWCA 3OBRA 3OGJA 3JB4C 4HMZA 2ZX1A 2YC0A 4Q1RA 4HK9A 5DXDA 4LULA 4XFAA 3ZIWA 3B02A 1UU5A 3HBZA 4QGNA 3G6JB 2DUPA 1LOFC 2V73A 1F5JA 1O3SA 2VMDA 1OXCA 5FMDA 4CP2A 3MQEA 4X8TL 2VD7A 2CU5A 4N53A 2P3YA 3CJIC 3VL9A 4CDWC 5DMYA 3OYWA 1KLOA 5H9SA 2NZ9A 4C90A 3PJYA 2J94B 1H2LA 1RUH1 2YC4A 2AUYA 2C24A 1HKDA 2KB9A 2XQXA 3USUA 3TN92 1G86A 3VBSC 2XPJA 2J95B 1NE6A 1WMXA 4NHMA 4PLOA 1OC1A 3EMRA 2ZACA 4GWIA 2HWC2 2R6QA 4NRQA 3V56A 1WCDJ 4YGEA 5LK5A 2OX0A 3R4SA 1V00A 4QB1A 1YRZA 3B5LB 1R082 1SQ4A 2MNGA 2ZMKA 3H3UA 4NIIA 4Z1VA 2V09A 4AI1A 4GH4B 5FY1A 5FY0A 4D8MA 4BTIA 1V6NA 2XJQA 3K75B 2XWBB 4QKFA 1G1SA 1FMD1 1KFUL 1SDWA 1WUVA 3AP9A 5KBFA 3DXUA 1DP0A 1UY4A 1XE0A 1KJLA 3WP6A 4KI5M 3T4HB 2ZGSA 5LA0A 5A1LA 4EZ4A 4IERA 2BPA2 3LDBA 1QIQA 1RUG1 3NTBA 4ORFA 2JE9A 2ZAHA 2RS52 3RQ0A 4CCEA 2BP6A 3JQXA 1KKEA 5C5TA 5ABJB 1BMV2 2VBBA 5I0RA 2AZ5A 2ZGMA 4D6QA 3RYRA 1XU2A 1ASJ1 4Y20B 1YLLA 3M8LA 4HK8A 4BQYA 3TK6B 4E8CA 4IE7A 4YW2A 1GNYA 3F95A 2CAUA 2GDFA 1UMHA 4YZ4A 1DYPA 2NPRA 1NA1C 5FZIA 1MS8A 4BH9A 5IFTA 3HS5A 4CXYA 2FHRA 3LDKA 1EBVA 1I3HA 4P9XA 2OPKA 5FZBA 1RL3A 1H9WA 2YBSA 4IESA 5FYUA 4Z92B 1J3RA 4CUDA 3AMMA 2R041 2BOJA 3HVDA 1BF9A 3LE0A 2BUKA 3QACA 1VAVA 3ME2A 2FMYA 1G1RA 1RB8G 2PHUA 3ZYHA 1W9SA 2IXIA 2ZHKA 1GFF2 5T52A 1HREA 4BQ5A 1R64A 4YVWB 1W0OA 4QPGB 2DF7A 1H9PA 1PHMA 1L3JA 2WYJB 2JKBA 5LRSA 1S2BA 1IQDC 1US2A 2EAKA 3C9AC 1STMA 2WZR3 4QKNA 2YROA 3T0AA 1NKGA 2V5DA 1KEXA 2R0FA 3OBTA 3OCPA 1HRI1 3HEIA 2Y7XB 1XSRA 3I3DA 3TN93 5JW1A 4CDWB 5BNOC 3RRDA 1AVBA 2V72A 3SCFA 4A7IA 1RUJ1 5A3PA 1KITA 4SBVA 1T2XA 3ZFGA 2VMHA 3MGUA 4ZHNA 2XBWL 1ACCA 4O02B 4E8DA 4GMP3 4RL7A 1GSLA 1ZBA3 2ZX0A 5CNAA 5DAVA 2D6KA 1W6OA 3RWNA 2ZHMA 4DRRA 3KCGL 2EALA 4LHSA 4XJWA 1JI6A 1XU1A 2XBO1 1UOJA 3GJAA 3VHNA 3W9AA 4AEDC 1CAVA 5ACA1 2BGOA 1HX2A 3W59A 4GH4C 3EQEA 5I8TA 2VWMK 5BNOB 4IGQA 1RMU2 2ZMNA 3VD4A 1RVF2 2GP5A 5FZ1A 2PHRA 4A41A 4DOUA 3RDIA 1ZAQA 3FUOA 1HAEA 4Y79B 4QQPA 4ZXEA 3J8F1 4W8JA 1JBUL 4FPFA 4PLNA 3KHBA 5A33B 3V0AA 2GALA 2BFUS 2Z79A 2BGCA 3FFQA 2D6NA 3H7YA 4WM8A 4V1PA 5EPAA 3UK9A 4QM9A 3O1UA 4LBQB 1BBT1 1ENRA 1F0SB 5EWSA 2G00L 2RS53 4HN1A 1F15A 3LEGA 2W68A 2R0HA 3VBUC 4FPGA 2JKXA 3ALQA 3HT1A 1XNAA 3TNPB 2A3YA 4LBQD 3UYJA 3U7UG 3RGBA 5JSOA 5FZ9A 4XF0A 3AFGA 4HG6B 4XBLA 2B4KA 4ES9A 4FFGA 2EI7B 3T2QA 2HOXA 1ASJ2 1Y4WA 3GHMA 2ADXA 1EAH1 4HSLA 1O6UA 2RMU3 3D0JA 3J4UH 1G9BA 5C3QA 5GLWA 2D1JB 3MIFA 1NT0A 2O8OA 3DYPA 1A78A 4KNCA 3R0RA 1WD4A 2JXAA 4EWEA 1OA3A 1ULCA 4P02B 3RZZA 3HO3A 5CKNA 1WLWA 4LJHA 5T5PA 3WP4A 5F9TA 4JC1A 5JB8E 1IQML 1XKAL 1WCQA 5G04L 5K0UB 4QPGC 4MGTA 2KV4A 3CBNA 5K8SA 2WPKE 3DGTA 3PL0A 4CEWB 2P93L 4XFHA 4UFLA 1TEIA 5LBBA 4I0BA 3OPWA 5FYZA 2FLBL 3HIFA 4ZH8B 1AXKA 1VBA2 3NKTA 3O1MA 2LTNA 1UZZA 4XC9A 3ZMNA 1NLSA 2G9FA 2K46A 3NNGA 2W3JA 4PIYA 2ILMA 4Q4V2 2HWC1 5L9RA 3RNSA 1LOBA 4PCRA 4GKXA 3VKMA 5F37A 3T4VA 3S7EA 5C3OA 1QNWA 1J3QA 2B39A 1DYOA 2EF6A 3LTFB 1H1IA 1IKPA 2VAUA 4INDA 1A6CA 4MH0E 4OHVA 1WBLA 5E88A 1XFEA 1UNBA 1S0GA 1ZZBA 2DVGA 1QGLA 3WCSA 1AR63 1W2NA 4QPIA 1OI6A 1OVSA 3INAA 3OSDA 1YQ5A 5A7OA 3VZLA 4UFKA 5IWFA 2WN2A 3RZHA 1J9CL 1W8FA 5FJKA 1V6LA 1D4M3 4N7UA 1LQDA 1VBA3 4ISRA 4HSJA 4BB3A 2Z5WA 2QFEA 3P1IA 3SEPA 4YG3A 5A6QA 5CFCC 1IOXA 3KQDL 2NPIA 3X29B 4ZHAB 3LWCA 3NJPC 1VBD2 1RUF2 1GP4A 3NVCA 2NN8A 1OUXA 1OFNA 5LY2A 3N36A 1OB1C 4XFIA 4A7YA 1W8BL 3OEAA 3LA7A 1MZFA 2Q1FA 1WU1B 2WT1A 1EGFA 1H2MA 3Q8CA 4JGZA 4MHUA 4MVTA 4OMDA 1VR3A 3K77A 3WDUA 3H42B 4CE8A 1S0IA 2AC1A 2YGPA 1LGCA 4TLFA 1JV2B 1ZBE3 5CFDC 1IHMA 1V3XB 1GP6A 5L36A 2BU9A 1PX3A 1YXWA 1OMIA 3ACHA 5CU1A 4GWMA 3V65A 5A3UA 5AFBA 3ELNA 1UXZA 4Y1UA 1RUC1 1PK6C 2WQ8A 4B29A 1H6YA 3VN4A 3I54A 4RD7A 5BNNC 1W28A 4MG2A 1U5ZA 1IQJL 4Y7BB 3CDZB 3RJ2X 3SCHA 2GAUA 3MZHA 3AB0A 4ZU5A 4FAGA 2CTVA 2PLV1 2RM22 3N9LA 2YFUA 1POV1 2B45X 2ZEWA 3F2ZA 4IV1C 1NY72 2UYBA 4QX7A 5LASA 2Y7ZB 3TNQA 2WJSA 4DEQA 2W1UA 3NAPB 1WLCA 3W58A 4BDWA 5C4WB 4BTTA 1UZVA 2XKPA 2P3UA 2UWAA 3RR3A 1EPGA 5CIRA 3ZXKA 2BSFA 2W26B 1BK0A 2MEV2 3POSA 3MW2A 4Q0QA 1RUE2 5A70A 2BOIA 2YV8A 4MGIE 4QKBA 4OQ8A 5F1AA 1YWKA 4PDWB 4A3ZA 3NQHA 4BTUA 5L2ZL 3AZXA 4BMEA 1AL0G 4BE3A 1U5YA 3U37A 3V0AB 4XFCA 1LEMA 5AVPA 5A33A 1CWPA 1KRIA 4BU2A 1WGPA 2VCAA 1FE2A 4GB31 5FKCA 1O5DL 3WF0A 5CB7A 2P6CA 1UD1A 1QXJA 2WABA 2XLAA 2ZBJA 2HWE1 4JV4A 1PMHX 1G1QA 2PQSA 3ZPOA 1C5HA 1PMJX 1EPHA 2CNAA 2H0BA 3K4ZA 4N7IA 2VVEA 2J2UB 4EE2A 1I1EA 3RZKA 1VBB1 1DGRA 1I5ZA 4D90A 1RYYA 1IGZA 1YNAA 2B7YA 3ZR6A 1PRHA 4AFBA 4YGCA 2GC1A 2X10A 3K4DA 5G05L 5DUVA 1OQ1A 2WNVC 5IHRA 2IXCA 4QGMA 2VGDA 2BNMA 4PIZA 5JOZA 4M3CA 5DZFA 5GLVA 2BBVA 4PH9A 3PUSA 4XUOA 2GNBA 1MEC1 4OUEA 1HXS2 2WWSA 5FZFA 5K4LA 1N7DA 2JDKA 1OF4A 1YQCA 2XJSA 5T5LA 3SITA 1PO23 1BJQA 1LHNA 2P4EA 2QQKA 2SLIA 5FLHA 4XAEA 1JODA 1X50A 3T2TA 1SACA 2XHKA 2EI8B 3JU9A 1WA6X 3WF1A 1LOFA 2YPJA 4YW3A 1G9AA 1AX0A 1C4RA 1FV3A 4BCUA 2WT2A 4FBFA 4I0AA 3NV4A 1IQFL 1IS4A 1PGEA 1PNFA 4N43A 4YLZA 2CJIB 4I3GA 2WFF3 3H1YA 5FOBB 4CEYA 1YI7A 1WKYA 2HH9A 2QUOA 4AAPA 5BUVA 1PGL2 4UFHA 3PLQA 3LSDA 4ZXXL 4XPVA 1LULA 2ZTNA 3LB9A 2VULA 3B9IA 4DMIA 4FM5A 4CCJA 1Q8PA 3M1HA 3MFAA 3THTA 4DEVA 4M0NA 2JG8B 3HBKA 3PHMA 4AVTA 3U14A 4Q4Y3 4EJRA 3AZWA 4XQWA 2WSVA 5DG1A 3K48A 5K7PA 5L2YL 4Y76B 1QWRA 5D8AB 3IMNA 1QOOA 2B8MA 1X82A 4XBMA 5DUUA 5FY8A 4C16A 5E8DA 4OI1A 2KNIA 2BJSA 3HN1A 3QBQA 4IV1A 2Q8CA 5LBFA 1ENSA 4Q29A 3LF7A 1FYUA 3HO4A 4MUVA 2PHTA 4ARXA 1F4HA 4DXRA 1F31A 1TZOA 4XYXA 2VUAA 5CG9A 2WFTA 5IW0A 2VVVL 3TEYA 2Y26A 3EGFA 3SKJE 3PURA 4QQOA 1OLRA 4ZPIA 4ASKA 1LGBA 4BQ1A 5J96B 5JSPA 1E5SA 3WW3A 5F2SA 3RYPA 5BXXA 5DUWA 2WBKA 3M3IA 4XUPA 1TG7A 1NCQB 1RC6A 2XKOA 2VC9A 2VR4A 4FI9A 4LQRA 4AVSA 1MS5A 3WT3A 2JEMA 3SW2A 5LBCA 4V2VA 3LOBA 1COV3 5FIXA 1ADXA 4JZDL 5FXWA 3VD5A 5JZGA 1AX2A 3IT8A 5BNPB 3S6XA 5F5IA 5L7OA 2E9QA 3OGVA 5FZDA 2OQ7A 2XONA 4P9YA 1Y3TA 1H0BA 4DUVA 1Z7S1 2WFF1 3VHOA 1SHWB 1TQ5A 4L9BA 3TAYA 5EIYB 2DDUA 2ES3A 5JUVA 2OPWA 4G9SB 2X05A 3FE5A 3MICA 1D4M1 4IGPA 4BXFA 2PHFA 3C7EA 2EXKA 1WCKA 1FV2A 1NE4A 2WA3A 3A7QA 3CIHA 2TEPA 4FXKB 4OUMA 4NMIA 1SLBA 3N7LA 4PF5A 2YYOA 3WNKA 5BNQA 3BN6A 3GCWE 2XJRA 5A32A 2B9UA 2WAOA 3LA3A 2HEWF 3FBYA 3AYDA 1AYN2 1V1HA 1GQHA 2Q1ZB 1KLJL 1LJ7A 4RSUA 3VBFA 4D6SA 4LHNA 1OHFA 3AC0A 4I3PA 1VB4A 2L9LA 5ACA2 2ZHLA 2A6XA 2XLFA 3LAQA 1UU6A 2VXJA 2ZGKA 4RQPB 4DXSA 3B69A 5BNPA 1K42A 3ZFGC 3WX5A 3ZFEA 1QKQA 2BW8A 4I02A 3VDDB 1CZTA 1GZWB 3N7KA 5HV4A 4MMYB 5F7UA 5COXA 2IFRA 4OCTA 4E4ZA 1WW6A 3EJKA 1E5HA 4HT1T 1RUJ2 3T0DA 4MGZE 4FTSA 4FPJA 3VZKA 2VNRA 3E6CC 4ONUA 1T6GC 2VQAA 4IEPA 4QX1A 4XZPA 4BMBA 3KZ4C 2Q5TA 1EQGA 3E97A 1HJGA 4XUQA 1JOJA 4UXAA 5FCCA 5T5OA 2J34B 1V70A 2FZ1A 2VOWA 3H9AA 5C7GA 4EV0A 1QNYA 1BHGA 1WMFA 1LCLA 1ZBA2 2OW4A 4B4QA 5E16A 1LOCA 1JZ2A 5FAXA 2R063 4BXWA 3M3EA 2MPFA 4HANA 2HWF1 4JKKA 4A42A 4D0FA 4AVCA 5FR3A 1LHUA 2VUCA 3THPA 1KJRA 1X36A 3U4SA 1DQ1A 2I9BA 2Y8KA 3CU7A 3UGFA 1CX1A 4FFHA 4XILA 5EYXA 2PQQA 2VMCA 1W8NA 2JG8A 1JZ8A 1JUIA 4AEDA 5IT6A 1EPJA 4FXGB 5FLIA 2G9GA 4AHYA 5FPLA 1ND3C 1EZQB 4IEZA 3WF4A 3LEKA 3SQOA 1X33A 3IM0A 1XB9A 1IGXA 2H6BA 4XCAA 3ZXDA 1YFWA 2AEZA 3LPFA 4YYOA 1JS9A 1V6JA 4LORA 4BWOA 1ULOA 4XIKA 1UOBA 1BMV1 1ZZ8A 2QDNA 2XWJB 3VDBA 2V5YA 5ABJA 2WRAA 3IDCB 5IYYA 2B42B 2VMGA 1ZZCA 2BO2A 4M4PA 1OA2A 4AOCA 4CCOA 1PZ8A 2JDZA 4KG8A 1QQP3 4LBKA 2J1RA 1XNDA 3ZN5A 2R043 3D8CA 3DYOA 5FZ7A 4YVSC 4YPJA 3FFZA 4B8EA 4EN9B 4JYUL 4XF3A 1P9JA 2XVKA 4KL1A 5L73A 3MIGA 3CA7A 1FMD2 3I59B 1Q8VA 4XURA 3ZFEB 4AK3A 1Q8QA 4JGZB 4URTA 4OZOA 2W2IA 2W0XA 1R081 4E2GA 5C9AB 4UBGA 1Y9QA 3VKNA 2Q8EA 4Y1XA 1BYHA 5JBAE 1V9U1 2VG9A 4J1WA 4L99A 4NJ4A 4RQPC 5FZCA 3AM2A 4NHLA 3FL7A 1SLCA 1CVNA 1FOD2 2P17A 3M2MA 4GD4A 5FUPA 3TN91 1Q43A 3VBHC 5KHKA 2DVFA 4XABA 4LLOA 5SV8A 4XUTA 1CD3G 4CPBA 2ZKNA 4GB32 4FPHA 1O3TA 4FOQA 4RGGA 3FLTA 3I7DA 5LRRA 4LBNA 1VBC1 1F9KA 1LOGA 4YVWA 5FZKA 1H6XA 1ULDA 3VBRB 1URXA 1YQ8A 1IVOC 2ZCWA 3M7AA 1TNFA 4QHZA 1OURA 2EA7A 4KGGA 5FZLA 3WR0A 5JZGB 5ANQA 5IVVA 5F19A 2BWAA 1YJLA 1NPEB 3O1VA 2YU2A 4Z07A 4KWJA 5C4WA 3PVBB 3ZXJA 4NOTA 4AR2A 2QKDA 5HXMA 4NIHA 3HN3A 4K1ZA 1NFYB 1LPZA 2E7AA 4PJYA 1U8CB 1ONAA 1XNKA 3SH4A 1HAFA 4XMIA 5JLVA 5FXZA 2ZS6B 1CAXA 1NY71 1X8EA 3KT1A 4ARYA 2I74A 2HWE3 5HV0A 4GB33 1XJAA 4GXLA 4XF1A 1IQEL 5EQUA 2NP0A 1JW6A 2OT7A 3PJQA 2XVGA 5IKRA 1EPIA 1Q5OA 2RS12 3CQOA 2VE1A 3N9MA 1IQAA 3GBWA 3MIDA 1RUD1 2E7QA 2VJXA 3LDRA 4IEWA 3N4MA 4DXZA 2I9AA 2JG9A 4XACA 4CP0A 3RZLA 3WUDA 4BPZA 5KXCA 1OOPC 2LM3A 3NNFA 4Q2FA 4UI9L 5GJ6A 4FVVA 5JI7A 3P3PA 3WV6A 5KHJA 1L5GB 2DFCA 3KCXA 4YW1A 2BEOA 4ZY9A 1NFXB 2X53S 1K5MB 1LKNA 1ULEA 2YBPA 3KD4A 4IETA 2D98A 2P3IA 1H1AA 4N8MA 3WQ1A 4L0PA 3J7HA 2XBO3 5CVRA 1Z7S3 4OTJA 5DZEA 1AZDA 3A21A 1CJDA 1O8SA 3NJZA 3B9CA 4YZ2A 3ZXGA 2XBVL 2VMEA 1H2NA 3WNMA 5AC92 3KV4A 2K2TA 1QY4A 4XDOA 3AP5A 4CCLA 2XOMA 1RUJ3 5BV6A 2HEYF 2ORZA 3LCPA 4BXSV 4MMXB 1VMJA 3U0ZA 1SZBA 4HOOA 5A32B 4AFCA 3I3BA 5E6HA 3LFMA 3WG1A 2FMDA 3BU7A 2K0GA 2B7DL 4ZAEB 3AKQA 5FFOC 3WHTA 5GLZA 5LCWL 4BLIA 1ZRDA 3N9QA 3VLBB 3FJSA 3NNLA 4ZS3A 5EFUA 1W6MA 4AVVA 2Y6LA 4IQPA 4NN0A 3WP5A 4O1ZA 3OLUA 1G2LB 1BVVA 4BJ0A 1UYPA 1S1AA 4OI4A 1FX5A 4AQ6A 3AKTA 5FXXA 2PTMA 1EPZA 1W2TA 2RS31 4COUA 3SOVA 5KXDA 2BGPA 2W1SA 3VBRC 1QJY3 3ELAL 1SMVA 1FFMA 4LIVA 5JZGC 4OHZA 4YW7A 2CWMA 2PAMA 3IDAA 3KT4A 3OY8A 2P3JA 1APNA 1DQ0A 2P3FN 1WWYA 4GA9A 4CVUA 1I0UA 1ODNA 3AKPA 4DQAA 3MLKA 3RZJA 3V64A 4CSWA 4AFAA 5C3SA 4TGFA 2WPIE 2JG9B 2X5IB 3BTZA 2ETEA 3NJYA 4BXSA 3WZ1A 3WNOA 1QF3A 2IXJA 2WZEA 5GZEA 2XL7A 2W91A 3JD73 5FY4A 3B3QE 1NZCA 1U67A 3LIHA 4PDWA 4CUCA 2ZAAA 5FYBA 3IZOA 4QAWA 3NKGA 1XOYA 1AL22 1EV12 1N1TA 2CGPA 3TEXA 3ATGA 2E51A 1YIFA 1EAH2 4FPLA 2HORA 5DN2A 3AXEA 3ZSLA 2A71A 4RFRB 1OOPB 1UPSA 1COUA 3S0MA 2BZDA 5CYYA 4CSYA 1S2EA 3IWZA 1W8WA 2XC5L 3VBOC 2NQYA 1MOXC 2FZZL 5F1RA 1ND2C 5IVEA 4COWA 2YGOA 1QJU2 4LR4A 3IDBB 4QXCA 4CEYB 1H4HA 1W0NA 1O3QA 2BMGA 3B94A 4YT7L 3I3EA 4JZRA 4XHBA 3HD8B 1GV9A 1NUKA 1S2KA 3WVJA 5KC6A 5JMOA 1XNCA 2Y80B 3LD8A 1BBT2 2FDFA 4AHWA 4AZZA 1YFXA 5DABA 3RMYA 1QQP1 1SBEA 3N9NA 4Q1PA 4ATEA 1C3HA 1DGWA 4P9GA 3VBOA 1EMOA 4AQ2A 4RRWA 1WMEA 4LKSA 4IL7A 1OKQA 2OZJA 1QXPA 2OUJA 1ZBE2 2PUQL 1PMIA 2V4AA 2J7MA 3P6BA 2W5FA 1RVF1 1HV1A 4LHKA 4CRQA 4ZKTB 5HPOA 2ZA9A 3ZXFA 1RUD3 4XL1A 1R092 1J3PA 4Y5Z0 1FAYA 2UU8A 3QMOA 2IVIB 2XUEA 2YY1A 3N7JA 4ZONA 3VD7A 2PAEA 2RDQA 1W6OB 2TBVA 2G9ZA 3PTRB 5FYMA 1JYVA 3H8XA 1BK1A 1P0SL 1BEV3 1PVC3 2R062 4FCAA 1B9WA 2JDHA 2WNVA 3WDTA 1BLZA 1POQA 3FHIB 2A6YA 1JZ4A 1HXS3 1DQ2A 1XYPA 4NIDA 2HWF3 3I97A 1W03A 4CCKA 4GULA 2NM1A 1NQLB 1UZYA 1BXHA 2D6LX 1RUH3 1ODMA 3HPNA 4N53B 4YGBA 5J98B 1FSBA 3PU3A 5L30L 4EQVA 5JOWA 3SMHA 4LE3A 3NL1A 4YRDA 4QQLA 4AI9A 2HWB1 4RS0A 1LGNA 3OJBA 4OHXA 2RHPA 2C5DA 5A80A 3U07A 4BQXA 1PVXA 3MPPG 1YCIA 2Y6GA 1O7FA 1N1YA 2ZGLA 3KS7A 3VB9A 1CGPA 1IG0A 1C5IA 3THDA 5FQ0B 3VKOA 3R6SA 3IPVB 4FSJA 5DQ0A 2ATFA 2WFF2 2R042 4LMFA 3GZAA 2UWOB 2J38B 1LODA 3HJRA 4D7TA 1VP6A 4EN0A 5ABJC 2BNOA 1MZEA 4R9CA 2CY6A 3PMEA 4KWUA 4QX3A 1XNBA 5BPXA 1NLRA 3A23A 3MDPA 4NA9L 5FPAA 4A2UA 1M4WA 4A4AA 3N8YB 4EN6B 4PBPA 1S0DA 5JB9E 4RR3B 4XMAA 5HI0A 2JB8A 2XBYL 4NHKA 4QD2A 4CEYC 4RFT0 2VW1A 1IQKL 1Y9GA 2VZSA 4U2AA 5DDJ3 1JOPA 3PIGA 4N9HA 2WINB 1FXZA 2O1QA 2ZEZA 3MF9A 3H7JA 2OYEP 1QJEA 5F8PA 4E4HA 1XDTR 1O91A 2GN3A 3KCYA 5IAXA 4QGLA 1QJX1 5FZMA 4RHV3 4U36A 1NOVA 4CDXA 4JAAA 5FMOS 1RUI2 3JUUA 3T30A 1PTHA 5C8CA 1R093 1N3OA 3VDDA 4FFIA 3KL6B 1JUHA 5FZ0A 3NWKA 4X6QB 1CIYA 5FZ4A 5FZHA 4GALA 1AR72 3B7MA 3THCA 2DUOA 2D40A 4XVHA 1JZ3A 1KQRA 2XC4L 4LBQA 4Z6AL 4IDZA 5EJ1B 1ENQA 3ACLA 1E5IA 3KRKA 3J9SA 2P3FL 1LEDA 4LO7A 4Y3OA 2W9XA 2OYZA 4OI0A 4JVAA 1UIKA 2OA2A 3OYWB 2XBXL 2IC1A 2BOKL 1QH7A 1Q56A 3O7OA 1AUTL 1BEV1 3DXTA 3O0WA 4UBHA 3ENRA 5FO9B 1JZ5A 4LK6A 5CG8A 2DV9A 5CKMA 1D0HA 4YARA 2LALA 4AI8A 4A7ZA 4DY5A 3M36L 1O4TA 4L92A 2Y34A 4OULA 3MPBA 2E53A 3FLRA 5FYIA 1UY3A 3BPSE 3E5XA 4EWDA 2EXIA 1OPMA 1WD3A 3LIWB 1O8PA 1RJ7A 3O0XA 3N7MA 4MXWB 4XJAA 4XOGA 1GOHA 1RVF3 1U5IA 1AR93 2BOHA 4ASLA 3HQUA 3J26N 1OQEA 5FPUA 5IVBA 2VBDA 3K46A 5A3OA 4RS5B 3HNYM 4BDXA 2Q8DA 5CFCB 1V6IA 4M0HA 1XPWA 3AZVA 4I30A 2AR6A 3POJA 1VBB2 1N1SA 3AKSA 5SV5A 4OQ9A 1ALYA 3SOBB 3HMYA 3GNEA 3JBG3 4AQSA 1PFXL 4GU4A 3IJEB 2IFWA 2VW0A 3O14A 3WUCA 4C91A 2HWD3 4H7LA 1SFPA 2C26A 2VUDA 4GWJA 4PLMA 4HKWA 1W04A 5HXVA 4JZEL 3T1LA 3PUIA 4WVMB 1LU2A 5DUXA 4CDXC 4CCCA 1HB1A 4NAOA 3VV1A 3AK0A 4LKFA 5FP9A 3QH0A 1ZZ6A 2HBTA 2WYSA 1KS4A 1W8OA 3NMBA 4Y33A 2XDVA 5I0UA 1RUD2 2VU9A 1AR92 1OD5A 2ADEA 1UY1A 3MI8A 2Y81B 1W2OA 3S7IA 5BNNB 4IGOA 5KXEA 4FPKA 2CV6A 3OLTA 2GP3A 3Q3KB 3M3CA 3T08A 1UF2C 2CSGA 3EO6A 1GZTA 3CF6E 4O61A 3VBRA 4COXA 1GWKA 4N43B 2OXBA 2DBNA 2QQNA 2OYUP 4AW7A 3KT7A 4RHV1 1EUUA 2H9EC 1BZWA 5FYVA 4COZA 4CYDA 1NQDA 4LITA 1DGRN 3Q8EA 1NCRC 1ND3A 3DL3A 3TRSB 1DLLA 1NCRA 1PIV3 4B3NA 3CFWA 1GKBA 4OUSA 3ON7A 5AC93 4QX8A 5IVYA 4QX5A 1YUDA 1TME1 2MHFA 1C8M2 4DO0A 5J3UA 1CX4A 3CJIB 5KN5C 5CBLA 3FWEA 4PQQA 4CU7A 1MQ5L 4K20A 4BQWA 1QFKL 1RUC2 4PDWC 3FUQA 1OT5A 1BEV2 1PZ7A 2D3RA 4TXWA 1MQTB 3BT2A 4CUEA 2WO2A 3BOPA 4C0HA 5CAZA 3C7HA 4E27A 1HQLA 4LBJA 1IKQA 2EXJA 2DBIA 3I2DA 2VVCK 1RHI1 3H1MA 1JYWA 4LOSA 1WHFA 1V9U2 4UW4A 4QXKA 4LBOA 3HNMA 4HONA 4IW3A 4I2OA 3J8F3 4UW6A 3IIAA 3POYA 2PLV3 5L9VA 4CDUB 5LZ6A 3AX4A 5JVVA 2R49A 4XZUG 4LO8A 3KQCL 1AR71 3ZXEA 1XYNA 2VPVA 2JICA 3G7DA 2WPJE 5JXIA 3ZMOA 5F5AA 1HB3A 2LS6A 2RA0L 1SFNA 1JXNA 2P37A 2WNUB 4ES8A 4YM0A 2EVXA 1AYM3 2WYFA 4JDMA 4FFFA 3SISA 1QMJA 4QMAA 4CPBD 3OBZA 5HCHA 1HN0A 4Y5SA 3JCIA 1KS5A 4XFGA 4UOJA 4X6RB 3BGAA 3Q8BA 3ACGA 3ZFFB 1C57A 5IK5A 3PVNA 4ZZ5A 1IQNL 4Q4X3 1JBCA 4QX0A 2V4VA 2VZTA 4IEUA 4F8AA 3AP7A 1TOZA 5A7NA 4UWDA 3VKLA 4AEKA 3CL1A 1FMD3 1AR83 5FZAA 3NW4A 2WG3C 3DKWA 1NZIA 4GU3A 1WCUA 4M3CF 2VW2A 2R1DA 5DAQA 3SEEA 5C3RA 3N8WB 3N35A 4XF9A 2ARAA 4XUNA 1FNZA 1L7RA 2KD7A 1A3PA 2QQLA 1VBC3 3KQRA 3POGA 4ZXKA 4C1XA 4R4ZA 4TLGA 3MLJA 2BNNA 4H55A 4QPYA 4EN7B 1QJFA 3VZMA 3GM8A 2HJIA 3VGIA 2G1MA 5AFEA 1CEJA 2HWF2 1NCRB 2EAAA 2VVUL 3S6PA 2JJLA 1UYZA 1U12A 4G4FA 2AACA 2Y33A 5T55A 1ZA4A 2OQ6A 2J1TA 1FNYA 5T3NA 4RRZA 1PVC1 2PAKA 3NRUA 2JDYA 3H8OA 3KCCA 2D7FA 4Q27A 1CVWL 1ENXA 1WLTA 3TYJA 4A6SA 4RQPA 4NR1A 1CAWA 4HFSA 5FUNA 3CO2A 4PBOA 3RMXA 3WNNA 4YM3A 4Z2WA 5IKQA 3AL5A 1SG3A 2WPLE 4JYVL 3HWJA 4OYUA 3USUB 4WVMA 4BIOA 4AXOA 2W3KB 2EIDA 5JR2A 1JU3A 3GCWA 1KIGL 4O7XA 4PF1A 3ABZA 1KD7A 2ZGPA 5BNOA 5I8YA 2ARXA 4YNIA 2BOXA 4RA0A 5DAXA 3U78A 1JYTA 2WZPP 2BOUA 2DURA 2A6ZA 2CWSA 1CCFA 3GCXE 1CAVB 3KWVA 3C7FA 1D0GA 2GN7A 3POIA 1UPIA 3K2OA 5FZ6A 1PIV2 4NRMA 1HCGB 2JE7A 2W08A 4MHRA 4D0EA 2XJPA 3ES1A 1UQXA 3ST7A 2YGLA 2W95A 1NCQA 1LPGA 5DAWA 5EZWA 4KBZA 4MGKE 3O1SA 3DCQA 2P94L 1XC6A 3AXDA 4PHZA 3N3HA 4DY3A 4YFWA 2XUMA 3ROUA 1M06G 2F9BL 4WM7A 1CCVA 4TTGA 2KM2A 5ACA3 1K3IA 1NXD1 2D5FA 1UN1A 2R061 2VCCA 3LGRA 1W06A 2DYCA 1HB2A 2P16L 1EY2A 5FZOB 1MVEA 3ETQA 4HPKA 1A34A 2R32A 2FDHA 2VZUA 3ZYJB 2WWUA 4QPGA 3TOJA 4YW6A 2RJLA 1S0CA 4P08A 1HRI2 1GNHA 3BPZA 3IAQA 3NV3A 4D7SA 4QM8A 3ZX7A 2XVLA 3RZGA 2Y6HA 3BYWA 4JZFL 4MZUA 5FK7A 1W6NA 2GU9A 1XE8A 3KQ4B 1PVC2 1ZVFA 1AL21 1EV11 2GC2A 1ZBE1 2ERFA 5FO7B 1FJSL 1VPHA 3K4AA 2J1EA 2D44A 2WDBA 3O5SA 3UKVA 4AGGA 3DV8A 3AFKA 3EBRA 4ITCA 4Q26A 3WDVA 3ILFA 1COV2 4YWAA 1QQP2 3N8XA 1DQBA 1LHOA 3N9OA 3DPRC 5FRAA 4JQTA 3FFGL 2WO7A 3KM5A 4KU8A 3MF6A 3PTYA 1GP5A 4O9GA 4WM8B 1FI2A 1LU1A 5JSRA 1DYKA 5LWBA 1H1MA 4YSFA 3WQ7A 1LPKA 2BQWA 1JH5A 2RMU2 4JQRA 4AF9A 1CZSA 3D6EA 1POV3 4EZHA 2C4XA 1RTVA 2E33A 1MACA 2E32A 3MLLA 2XQRA 2ID4A 3ZVXA 1YQ2A 4TWTA 3VHRA 1HJ7A 5CEHA 5GZGA 3TEWA 4QU1A 2VNGA 2Y0IA 3H0OA 4QHBA 3WHUA 1DZRA 4M10A 1S0JA 3GF6A 2XB6C 4ZZ8A 2JDUA 2WS93 5FZ8A 4YZ5A 3KQEL 1VLNA 4E9KA 3UKNA 1J84A 4DPNA 2N7GA 4MADA 4C8DA 2NMOA 1X9TA 1FAXL 3L2YA 1LOAA 4HBNA 4M01A 3U73A 4Y24A 2WA4A 1JYXA 3NNJA 2DCKA 3KGZA 1D2QA 2FBEA 3HQRA 3EYPA 3MUY1 2R071 4IE5A 2QZ3A 1APOA 4MGYE 5DZGA 1PXXA 4ATFA 4AG4A 4BQ4A 1DGWX 1AL23 1EV13 4CCDA 4CP9B 3MHZA 5AC91 2DCZA 2GSYA 4B4RA 4NWVA 2C9KA 1QOTA 2JDMA 2I07B 4M00A 1MS1A 1GYKA 5L9BA 4P14A 3V64C 4JGZC 4K7JA 1RHI2 1BQPA 2GMEA 2HLEA 3AVRA 5CADA 1K37A 1PGW1 3VDDC 1ZZ9A 1J59A 1IP0A 2NLRA 4LIUA 1KSNB 3UGHA 3TGFA 1HRV1 4MGQA 4OHWA 2DVAA 1ULGA 4Q4W2 2FCTA 5F5CA 3N9PA 4MSVA 3BUCA 2JKHL 3UJQA 3M3OA 4V2WA 5FP7A 1OPOA 1DDLA 3GBFA 1G9DA 3VBHB 2VQUA 3I8TA 4Q4Y1 3J7NA 3I2OA 1AF9A 4Y6DB 2QQOA 4LK7A 1DVAL 4C1WA 4CCNA 5J37A 2VOXA 1CQ9A 2K2SB 2C9AA 1C8M1 5LA2A 2TGFA 3OD4A 4CUFA 1OD3A 1RUE1 3WQ0A 1DQ6A 1RUF3 1OA4A 2DUQA 2JB4A 3NAPC 1UZJA 4GWNA 1Q4GA 4X8SL 1UY2A 2CL2A 1PO13 1O5UA 1MR5A 2JIGA 4E2QA 3DPRA 3H3ZA 4Y20A 1K36A 4MX3A 4CXXA 1SFYA 4Y1VA 5FY9A 3ZPYA 2R30A 2VH9A 2GMMA 1YGCL 1ZNPA 4NROA 2FDIA 1ATDA 2DFBA 3OOXA 1J83A 1TMF3 3QH6A 2JENA 4AI3A 2PLV2 2E63A 4B7KA 4BLJA 1ND3B 3H8RA 3WP3A 2WZR1 4D94A 4XCBA 1KLIL 1F7MA 1HW5A 3OPTA 4FQ4A 3OUIA 5C5UA 1VBC2 4W6YA 4COYA 3BOWA 2FCVA 2Y38A 3PVEA 5I93A 1LAJA 5EHDA 3CS7L 1W8UA 2VWLL 2WPHE 3GZUC 3ZYFA 4HVRA 4BM8A 1HRV2 1ST8A 5LY1A 4GMP1 2QBXA 2VOKA 4IE6A 1CR7A 4QDSA 2FD8A 3MUZ1 1PGW2 2E7TA 4LO5B 3VBHA 2A5ZA 3WF3A 2DVBA 2RM23 4Q4X2 3T1MA 2PHBB 1O4ZA 1OVPA 4NUBA 3T3YA 4CUGA 2JIJA 3NNMA 4WZCA 1RXGA 3NV2A 3WSOA 1NLQA 2BRTA 3ZN4A 2WQ4A 1APQA 3HAGA 4OHYA 1LTEA 4IUGA 4PQ9A 3MEPA 4XLWA 4QQHA 5KXBA 5JMCA 3A0NA 1IS3A 3HO5A 4HKOA 5FZOA 4WM7C 3T09A 4LBLA 4CDQB 3ZXLA 1DX5I 4CA9A
chains in the Genus database with same CATH topology
5IUQA 4EN8B 1WLDA 2K9ZA 4ISQA 1DHKB 2HEVF 2TNFA 1BBT3 4QQ2A 3ES4A 4XJ8A 4DFSA 1CAUA 1Z78A 1RUI3 4LUKA 4CEWA 1REDA 5J09A 5GZFA 1XYOA 4F7ZA 1G6NA 4S2FA 2ZZJA 3BIWE 5JR7B 1DF0A 4JRAA 4XTMA 4Y4YA 1W39A 2JECA 1ND2A 1S0EA 1VBA1 5K0HB 3FLPA 3U4XA 2YGQA 3U10A 2QZ2A 2VQ0A 1AXZA 1AR81 2XLGA 4FQZA 1FOD3 2EXHA 2IXKA 1S0FA 3LOIA 5EXOA 3N8ZA 1W6QA 5JBBE 1RUI1 1GQGA 4HLTA 1B09A 5KC5A 1A8MA 3ZYPA 2QNKA 2ZOEB 1ZX5A 1VRH2 3POWA 4H14A 3E5UA 2GH2A 4K8FA 2O0OA 2UWPB 3B93A 1WMDA 2PHXA 4AI0A 3WW4A 5JIAA 4KH9A 1F5FA 3B01A 2QDRA 1F8VA 5J36A 5JPMB 3U11A 1MZ5A 1QJY2 3FBMA 3JBG1 4OVEA 4AHXA 3H1WA 1K5MA 1CJPA 5I0SA 1RGSA 3VZOA 1NFUB 4QU2A 1UU4A 4NVPA 4A94C 2JJ6A 4LBMA 1ZRRA 2WNEA 3RI9A 4P9LA 2M74A 2WLPA 4XTPA 4Z8BA 1ND2B 3WW2A 4LHLA 2C1FA 2HWD2 4KQ7A 2OUHA 1OQDA 1TPGA 1IOEL 4LO6B 4YM2A 5H9RA 2K2SA 2GC3A 2R1BA 4HETA 4XBQA 5H9PA 4G3YC 2MGPA 4AFMA 1AX1A 1V9U3 3ZFGB 4DZGA 1V6OA 2YUEA 2X29A 1X8MA 2P34A 1TME3 1MEC3 3PMSA 4EROA 4JRLA 5IK4A 1SLIA 3K9XA 1AR61 1KFXL 3R4UA 4Q4V1 2YDEA 2Z2SB 4R8HA 3SNMA 4AWDA 1H8TC 4W6XA 2ZPXA 3M3QA 1DG6A 3SH5A 3AZZA 1C1LA 2DU1A 5FREA 3A0KA 1R091 4HVOA 4MYEA 2PHLA 1L3YA 2WT0A 2D97A 4AEDB 4FOYA 2RS33 1CPNA 1H8VA 3WDXA 4GIQA 4QPIC 5T50A 1AHSA 1HV0A 3LC5B 1D4M2 1QDCA 3I4IA 1SBFA 3ZIXA 4BA6A 5BNOC 4Y26A 2VVDA 3A4UA 5DDJ1 4H7MA 2VECA 4XE9A 2CYFA 1UW8A 4TSVA 4LLFA 2P2KA 6COXA 1UAIA 1RMU3 3KGLA 3KSCA 4E1GA 2AYLA 5KHIA 5GZCA 5JVZA 1EAIC 1DU3D 2P3KA 3V65B 3VBOB 2D6OX 3WW1A 5L7OC 3JZVA 5F5QA 2JX9A 2NMNA 1AUYA 3N8WA 2R073 3JB8A 3QCWA 5CISA 4JGYA 4YVSB 2B46X 4X8PA 4TZDA 4Y22B 3AJYA 5BNNA 1H4GA 1VRH1 5TSWA 4AGVA 1D2SA 2F6BA 2UWBA 2Y5GL 1G1TA 1C5MF 2R16A 4EWAA 3Q7DA 2ZX3A 1WW7A 5I46L 2FLRL 2BQ6A 2IXLA 3RPQA