1YO8A

Structure of the c-terminal domain of human thrombospondin-2
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
621
structure length
621
Chain Sequence
DGCLSNPCFPGAQCSSFPDGSWSCGFCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the calcium-rich signature domain of human thrombospondin-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords thrombospondin-2
total genus 165
structure length 621
sequence length 621
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02412 TSP_3 Thrombospondin type 3 repeat
A PF05735 TSP_C Thrombospondin C-terminal region
A PF07645 EGF_CA Calcium-binding EGF domain
A PF12947 EGF_3 EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yo8A05
3BIWE 2D1JB 2Y5GL 2KM2A 3LSDA 3MEPA 1KIGL 2ZAAA 1W6QA 3OYWA 1LHWA 1DYKA 4FVVA 4TZDA 1A3PA 4YZ3A 1QNWA 5F5QA 1CR7A 1WHEA 4YW4A 2DVAA 3NTGA 2NN8A 2Y82B 2Y81B 1BKZA 3C2UA 3RSJA 1WU1B 2VWMK 1ULEA 3BOPA 3WDUA 2PUQL 3IKWA 2ZHNA 2ZGMA 4G1MB 1SFYA 3TH3L 2YROA 3ILNA 4M3CE 1WD4A 4NO4A 3NV3A 3DGTA 3WDWA 5K0HB 2VH0B 3VUOA 2V5YA 3LN1A 1N3OA 2CYFA 3HR9A 1MZ5A 3B00A 2LTNA 2VU9A 1QGLA 1DIYA 2KL7A 3LTGD 5IK4A 2OW4A 5JB8E 2NP0A 1GNHA 1YXWA 2UWLB 1YRZA 5JBBE 3NV2A 2EXKA 3B01A 3ZSMA 3N8YA 4ISIL 2GNTA 2WPLE 2J95B 5DZFA 4K1YA 1HRFA 2JE7A 1JL9A 3WCRA 3ZSJA 3V0BA 2RNLA 1B9WA 2CY6A 1CONA 1S0GA 1UZZA 1IQML 3MDLA 2PHFA 3VKLA 4MMZB 1SZBA 2P93L 3CFWA 1G1QA 1KLIL 2ZA9A 2BOXA 1B09A 2I2SA 1V00A 4GWMA 1NFXB 5DZEA 1WBFA 1LENA 2DUOA 1HX2A 2VW2A 1NFYB 3MW3A 4Q2FA 1LOGA 1CQ9A 1GICA 3N8WA 4MMYB 4Y6DB 4A7IA 2XBWL 2D44A 1S1AA 1W0PA 2E7QA 2UURA 4FOQA 4Y7BB 4LBKA 4XJUA 2D6LX 2OVUA 4FPOB 2AH2A 1FX5A 1MOXC 1EQGA 4Z0KB 5GLWA 2JKHL 4XBMA 2VY0A 2I9BA 1W6NA 4GKXA 2A7AA 3P5BL 1FYUA 1HAEA 3N8WB 1HCGB 2A75A 1HJ7A 4ZHAB 4FOVA 5HCAA 3VKNA 3RMYA 1Q8QA 1LPZA 1CVWL 2VWLL 2P37A 3AP4A 2VW0A 1A78A 1V6MA 1ENRA 4H55A 1QFKL 1RFNB 1EPIA 1L3YA 5JVZA 1AF9A 1DGLA 2P3KA 1CX2A 3SITA 4FPGA 3BODA 2B7DL 4BTIA 1FF7A 4JYUL 2PR3B 2P3FN 1EPHA 2GNMA 1NFWB 1KRIA 4Y1VA 4JZFL 1O4ZA 1LHUA 1AJKA 5IK8A 2H9EL 4BXSA 3SLIA 1W7XL 1EMOA 2FD6A 2ERFA 1WW6A 2A5ZA 4BDWA 1ULDA 1BQPA 3PVNA 2ZGOA 5IKTA 3WDYA 1LPGA 1TPGA 3OLTA 5H9RA 2PHWA 5JBAE 2EALA 4GKYA 3SH3A 5JOYA 1APQA 3R4UA 3ZXEA 2AENA 1JV2B 4DQAA 1K36A 2GDFA 1PTHA 4YFWA 4M10A 1K37A 2EI7B 1FSBA 5DUVA 4FPEA 2GALA 1APNA 1DZQA 3HN1A 4FQZA 2WFTA 5GJ6A 2GN7A 3NJPC 3N3HA 1DFQA 3FLTA 2D6PA 2EXIA 1V6OA 4HANA 2SBAA 2FLBL 2ZGLA 5GZCA 5GZEA 3IJEB 2WSUA 3GNEA 2A6XA 1LESA 1HQWA 4XXAA 4PF5A 3SH4A 2EAKA 2C5DA 5H9SA 3IPVA 4ITCA 4JYVL 3UJOA 1LQDA 1UX6A 2P3FL 3T2TA 1LOFC 3FLRA 2EI6B 4LORA 2VH6B 4D90A 1Q8VA 4DFSA 1WUVA 3UJQA 4R9CA 3B69A 5E88A 5DUXA 4K20A 3SH5A 3M3EA 1G1RA 3POYA 2BZ6L 3O0XA 1EQHA 5KXCA 1IKPA 2D6NA 1MS3A 1V6LA 1SLTA 1S0FA 1BF9A 3D6EA 1F5FA 5T50A 1ADXA 2GNDA 4BPZA 2JJ6A 3T1MA 1IQEL 5CAZA 6COXA 3LSEA 4XHXA 1F0SB 2NYYA 4Q8KA 5KXDA 3SOQA 4FPJA 1NQLB 1PRHA 2WPHE 3RR3A 3VKOA 1GYKA 1PXXA 2E53A 5T54A 2ZMKA 3ZYJB 3HPTA 1DX5I 4AGVA 4XMAA 1LU1A 2VXRA 4PBOA 2WYJB 4Y1YA 1LOBA 3WDVA 2ZHKA 2VVUL 1N1YA 2W26B 1VAMA 5LK5A 1EBVA 1QNYA 1FATA 2DU0A 2VUAA 1RIRA 2AR6A 2WSVA 1FNZA 2DDUA 3IITB 2R16A 3M37L 3FUOA 4YZ1A 1KDMA 1W6MA 5CKQA 3EGFA 4Y7AB 4W65A 2R0FA 2BOKL 1FAYA 1F31A 2YY1A 4ATFA 1Q8PA 1JN2P 1URKA 1CVUA 2ZGNA 1RINA 5CKNA 1LODA 4Q27A 1V3XB 4YM2A 1MS5A 3M1HA 4ZKTB 3U4XA 2KB9A 5IK5A 3LAQA 3AZWA 2XBYL 4Y1UA 1UPSA 1C1FA 1BYHA 5GLZA 4OTYA 1IQIL 1F9KA 5JVVA 3PGHA 1DHKB 1WHFA 3SW2A 5AVAA 3CNAA 3NTBA 2XBXL 4ZH8B 1HLCA 4BMBA 2ZGTA 1C57A 2D3PA 4KBBA 2P3TA 4LBJA 3R05A 4NOTA 3I4IA 5H9PA 3I8TA 5DUWA 2WPJE 2SLIA 2ZGRA 1IOAA 3FLPA 2WQZC 2PHRA 2R1BA 1QOTA 2ZGUA 4ZXKA 1J1TA 1ATBA 4DRRA 4PQ9A 1IS3A 3MW4A 1HDKA 4SLIA 1NZIA 4WVWA 5DG1A 3AZVA 3M3OA 4D69A 4YG6A 2PHTA 1DQ5A 1COUA 1S0CA 1C1LA 2PELA 3AX4A 4OTJA 4XIKA 2JECA 1DBNA 2BQ7A 4C1XA 1ULFA 2K2TA 1D0HA 2W2PE 4Z8BA 3HS6A 3AXDA 1GSLA 1W6OA 2BO2A 3TK5B 2W39A 1Z6CA 2ZGKA 1QF3A 3FFGL 2R49A 2ES3A 4BOWA 1LECA 2DVGA 2PHUA 1ONAA 3UL2A 5FRAA 1IGXA 1X7AL 2WLQA 2J94B 1J9CL 3CENL 5EYYA 1SLLA 4ISHL 4FPHA 2ZBJA 1GV9A 2MGRA 1TEIA 1MVEA 4CTEA 5T5JA 1LHOA 3ENRA 4FPCA 1MACA 1NFUB 2UWAA 1QKQA 2BQPA 2Y80B 1EZQB 1AX1A 1IQLL 5DXDA 4XIOA 3ILRA 1F7MA 1KSNB 1FE2A 1URXA 2DTYA 1N1IA 3V0AB 1JOJA 3A4UA 4I30A 4D0EA 1NXD1 4CSYA 1SBEA 1JYCA 1MVQA 3W59A 3GCWE 3WG2A 4ZXXL 2ZMLA 1DQ0A 5CBLA 1IS5A 4AWDA 1IGZA 2I9AA 2NM1A 2E6VA 3M3QA 4P9XA 2ADXA 4NA9L 3OJBA 1AXZA 4M00A 4X8UL 3WG4A 2XC4L 3WDXA 2YZ4A 4TGFA 3RQ0A 1PFXL 4COXA 4DPNA 4CUFA 1BZWA 3QMOA 3H0OA 4BQ1A 4XLWA 2WNEA 3N7KA 2W2OE 1V6NA 4AQTA 3TZIA 1CJPA 3AJYA 1S0JA 1DQBA 2GMEA 2ZMNA 1MR5A 4PBPA 1ZA4A 2OYUP 1QDCA 2UWOB 1N47A 4AVVA 5L30L 3M2MA 2RHPA 1G9AA 1UZQA 1LGCA 4F83A 1YO8A 4MYEA 4TYSA 1HZ8A 4PH9A 2JDZA 1ENQA 3KQRA 4XYXA 1MS0A 1S0EA 4RRXA 5IUQA 3QLQA 2AREA 1NLSA 4YM0A 1DQ1A 2BQWA 2FMDA 3AP6A 3KCGL 1XDTR 5KIRA 5KXEA 3F6UL 2ENRA 4K1ZA 3AYCA 2J34B 2EF6A 3BT1A 3ZXLA 2YXSA 2VWNL 1R1ZA 4Y22A 2GMPA 2ZGPA 2D6OX 2E7TA 1YI7A 4RRYA 4ZXYL 2OUHA 1IP0A 1DDXA 1IKQA 3RMXA 4Y1XA 1MS9A 1JBUL 1FAXL 2P16L 3QCWA 4LMFA 2ZKNA 3RRDA 4LBLA 1IVOC 1JBCA 4M11A 2C9AA 2WG4B 1AJOA 3IPVB 1FV2A 2PHXA 1HT8A 2DVDA 1VIWB 2XG3A 2XC5L 5JOZA 1LULA 1N1VA 2UWBA 1KDKA 1QU0A 3GISX 4GA9A 2GD4A 1DYPA 2ARXA 1SLIA 2VJ3A 1UMZA 5EYXA 2G00L 5JOXA 1LOFA 1IQHL 4YZUB 3VV1A 2J2UB 1EPGA 4YT6L 3USUA 3V0BB 1Q56A 3GALA 1SACA 3AZYA 2CTVA 2DWRA 1WLCA 3WG3A 5JLVA 1QDOA 1LOEA 4XTMA 3AYAA 3AYDA 2UWPB 1LOAA 3RS6A 4UW6A 1HAFA 4U2AA 1SBFA 2VW1A 5GLVA 1PZ9A 3Q7DA 2WJSA 1GBGA 4BXWA 4LBQB 1G8WA 1XFEA 5GZGA 1G9DA 1VAVA 3ZSKA 1ATAA 1ULCA 1LMJA 2YGOA 4UW3A 1QOSA 2VVCK 2FLRL 1CPMA 1DLLA 3VKMA 4RRZA 1G9BA 4XBNA 4ISQA 2ZGQA 3WNXA 4Y76B 2Y5HL 2A3XA 1JYIA 1G86A 1XQNA 1IQGL 4NG9L 1YUFA 5IKRA 3LIWB 2J4IB 2P94L 2DURA 2AGSA 2OUJA 4BTTA 4HL0A 1WW7A 1G9FA 4C1WA 1LCLA 4CUEA 3MQEA 2A6YA 2Z42A 3F1SB 1KQRA 1XKAL 4M3CF 4BMEA 1ENSA 1OKQA 1GNZA 4FP2A 2WT1A 3ZPYA 3O5SA 2NMOA 4YLZA 2ZZJA 1PZ7A 1KJLA 3L2YA 4M3CA 4GALA 2DUQA 4RRWA 1W6NB 1IQNL 1MS4A 3ZXFA 3KQEL 3W58A 4Y26A 1DQ6A 3DEMA 4YGDA 3B9CA 2DVBA 3LC5B 3BPSE 2DYCA 2W2QE 2A3YA 1DVAL 3FCSB 1UL9A 4XJAA 1LHVA 1SLCA 3AFKA 3OGGA 5EXOA 4E1GA 1DQ2A 4Y22B 4OZXA 2XC0L 1JXNA 1WW4A 3SISA 1YGCL 1LJ7A 5GLUA 5JW1A 1MS1A 1S0DA 1W8BL 2PHBB 4LBOA 3O0WA 3KQCL 1DIWA 4XILA 4JCKA 4L8QA 3N8ZA 1G9CA 2ARBA 1ZAQA 1KLJL 2DVFA 1BXHA 4BLIA 2W86A 3HS7A 4YM1A 1IOXA 4YZ4A 1G1SA 5CKMA 5FREA 2VH9A 4CRQA 2XBVL 3Q9OA 3WZ1A 3AJZA 1G2LB 4DRVA 4BLJA 4Z0LA 4LBNA 1LEMA 1MQ6L 4Y71B 2ZABA 4FOYA 4LBQA 1Z78A 2WPIE 1CIWA 5E8AA 1EPWA 1KLOA 4XHBA 2YGPA 1KJRA 3WHUA 3INAA 3H5CB 2WPKE 4YGBA 4C16A 3POSA 2WYGB 3KRKA 2BOUA 3USUB 3AYEA 3JUUA 3N8XA 4XJ9A 1Q8OA 3OPZA 1VALA 1SLAA 3HO4A 3V0AA 4YGCA 5I46L 1IS6A 2W2NE 3N7LA 5GZFA 2P26A 3T1LA 1LOCA 2NZ9A 3IN9A 3ILFA 3BT2A 1EGFA 1IQJL 2TEPA 4RUTA 3ZVXA 4XMIA 1CPNA 4AYUA 1WLWA 1WCSA 2CNAA 1N3QA 3C9AC 1F0RB 2GN3A 5SV8A 2W68A 3V65B 2R0HA 5IK7A 3OY8A 1VLNA 1HKDA 3ZXJA 1CVNA 4X8VL 1XKBA 3ZYIB 2GNBA 1EPJA 4BTUA 2E51A 3WDTA 3N7MA 3WG1A 1P0SL 4XL1A 5E8DA 1U8CB 2P34A 3ENSA 1SBDA 1TOZA 3FBYA 5JVYA 1ATEA 2FHRA 2D6MA 4FP3A 2WT2A 3PVEA 4YW3A 5CNAA 5EWSA 2ZGSA 4AGRA 5F19A 3MPPG 2YV8A 4FOWA 3V65A 1YUGA 2UWCA 3CS7L 1UN1A 3WVJA 4CUDA 1EMNA 2P95L 1UZPA 2A71A 5GM0A 3NWKA 4YW1A 3TGFA 5GLTA 3A0NA 2WT0A 5T5LA 4JRAA 3O0VA 4Z6AL 3NT1A 1LGBA 2AYLA 2HYKA 5IT6A 3V64A 2R1DA 2VVVL 3OBRA 2FLGA 3M3CA 2EXJA 2W2ME 5T5PA 4YZ5A 4FPFA 2FZZL 3Q3KB 2D43A 5T55A 1AX2A 4XOGA 2WFXB 3AZXA 4X8SL 2ZHLA 3AZZA 4R9DA 1FAKL 4FPLA 3WUDA 4CZSA 1AVBA 1A8DA 1Z0HA 5IKQA 4O02B 1O4YA 4P9WA 5T52A 2DUPA 4XJZA 4Q1PA 3HO3A 1IQKL 5JMCA 4AGGA 5GALA 2Q1JB 3SNMA 2WG3C 1DQ4A 5HCBA 3LN0A 3V64C 1ATDA 2W3KB 4WVVA 4R9AA 5KXBA 1F7EA 1I1EA 2AUYA 3PMEA 2W52A 1IOEL 2D3SA 3D5OA 3PJQA 3AK0A 2ZACA 4BDXA 4YM3A 1LHNA 4ISRA 4UW5A 2DTWA 3ASIA 3O12A 1CCFA 4O1ZA 4YW2A 3CA7A 4DS0A 1WLDA 1LTEA 4GXLA 4M01A 4U36A 3WOGA 2W3IB 4R9BA 1JHNA 4Q8LA 3D4KA 1OFSA 2Y7XB 5F1AA 1RITA 1GANA 1W6PA 2UU8A 3HO5A 2VWOL 1N1TA 4XDQA 4Q26A 4M3CB 1AXKA 1I3HA 2P3IA 2NMNA 3M36L 2Y7ZB 1D2SA 2H0BA 4FQ4A 3WHTA 4PCRA 1FNYA 1LU2A 5CB7A 1U0AA 2WPME 5JB9E 1I0UA 1W6PB 1QMJA 3IM0A 2DV9A 5IKVA 2D7FA 2D6KA 5KN5C 1HREA 2P3JA 3ZYRA 2B7YA 5GZDA 1W0OA 3RG0A 1AUTL 1H9WA 3N7JA 1CESA 2XB6C 1X50A 1SCSA 1MZ6A 1LPKA 3MW2A 1O5DL 4YT7L 2AYHA 1AZDA 4MMXB 3FUQA 2F9BL 5HCFA 3UK9A 1C4RA 3NV4A 2K2SB 5JOWA 2CWMA 3BTAA 2GMMA 1S0IA 3PVOA 1TLEA 1QOOA 4AVSA 3TAYA 4YW5A 2EI8B 1GZWB 3WUCA 4UW4A 2W08A 4BM8A 3DUIA 3TK6B 3LCPA 3WLUA 3JU9A 4YGEA 2JKBA 1NT0A 2P2KA 3AP7A 1NPEB 2J38B 4WV8A 4K21A 1YYNA 2Y5FL 2CWSA 3N8YB 4RL7A 1OQ1A 1CEJA 2OYEP 4IQPA 1H9PA 3KQDL 3R4SA 1EAIC 4RA0A 4XZPA 4Y20B 3WV6A 3U73A 1SCRA 2M74A 2EIGA 1N7DA 3TBDA 3FFZA 4Q1RA 5L2ZL 1LGNA 1N1SA 3QH0A 4LBMA 2MGPA 2JE9A 4WZFA 4Y20A 3NV1A 1V6IA 1UKGA 4X8TL 1V6JA 2DU1A 3LC3B 1MQ5L 1IS4A 3K9XA 3AP5A 4XJWA 4JZDL 1ULGA 3ZYPA 2RA0L 2CL2A 4D0FA 5T5OA 2LALA 1GK5A 3LTFB 5E89A 2CJIB 4YG0A 2EXHA 1PGEA 1WD3A 2A3WA 2A6ZA 1IQFL 4GWNA 4Y1ZA 1HT5A 3N8VA 4YFZA 3OBTA 1W6QB 3OYWB 4ZAEB 2NPRA 3SOBB 3AXEA 4LBQD 4XJ8A 4ASMB 2Q5TA 1M1XB 1W6OB 2Y38A 2JD4A 2P28B 2A70A 3SOVA 1GKBA 4JZEL 4Y79B 2P3UA 3KK6A 5COXA 1WBLA 1PZ8A 4YZ2A 2G4IA 3A0KA 3TB0A 1APOA 4XE9A 3GCXE 2V73A 3N36A 3ZYGA 4FPKA 1CN1A 4XTPA 1Z6EL 2MHPA 1YUKB 1Q8SA 3POWA 5BYNA 3N35A 3KL6B 3AP9A 3APBA 2D3RA 1GZ9A 3HS5A 1FV3A 1UAIA 5L2YL 3ATGA 4RS0A 1HQLA 3KM5A 3U7UG 4ATEA 5CA6A 3ZXKA 3IMNA 1LEDA 2KV4A 3OLUA 4AVTA 5F9TA 2A6WA 1JUIA 1Y7BA 3B3QE 1UZKA 1W6MB 1FJSL 1U67A 4YG3A 4Y24A 1GZCA 5EGMB 1KITA 1GLHA 1CCVA 1MS8A 1UZYA 1GZWA 1WW5A 1SLBA 2TGFA 1G7YA 1Q4GA 1G1TA 1YIFA 1FFMA 1JW6A 3HMYA 1BJQA 5CISA 1AX0A 1OB1C 4NGAL 5DUUA 1C5MF 1V6KA 1G2MB 3ZSLA 1UZJA 1N3PA 3KQBL 1H30A 4P14A 5JDBA 1P9JA 5H9QA 5JBCE 5DZGA 1ZM1A 3VKFC 2BMGA 3ELAL 4P9YA 4XXPA 5L73A 2WKKA 3WCSA 1L5GB 1S0BA 2BQ6A 5FDQA 2ZHMA 1IJQA 4FPYA 4FM5A 2A6VA 4XBLA 1AXYA 1CQEA 2BOHA 4JC1A 5DG2A 2YMZA 4XBQA 3OY8B 1A3KA
chains in the Genus database with same CATH superfamily
1RUH3 3ZLIA 3BIWE 4JZRA 2D1JB 2Y5GL 2KM2A 3LSDA 3MEPA 3SCFA 2XR4A 1KIGL 4DXSA 4G3YC 5LA0A 2ZXQA 2ZAAA 1OKOA 1W6QA 3OYWA 5A3WA 1LHWA 2WS91 4BB3A 1DYKA 4FVVA 4XCAA 4TZDA 1A3PA 4IGQA 1UYZA 4YZ3A 3DF0A 3TRSB 1QNWA 3WNOA 5KBFA 2VBDA 1PK6B 4UFIA 1DF0A 3ZYHA 5DAXA 2F4PA 1UIKA 2TBVA 2YPDA 1CR7A 4P9GA 1WHEA 5F5QA 2RMU2 2ZCWA 1ZBE3 3UKNA 4JQRA 4YW4A 4C0HA 2XUMA 2DVAA 3NTGA 1X8EA 2NN8A 1D4M2 1H6XA 2Y82B 2Y81B 1BKZA 1R091 3ZDVA 3CJIA 3C2UA 1DGRA 2F6BA 2OA2A 4OYUA 3MHZA 3RSJA 2VTXJ 1YQCA 1WU1B 3EB7A 2VWMK 2VVEA 1ULEA 1YEWA 3KF3A 2VXJA 3CJIC 2DCTA 2BPA2 1K12A 1OA3A 4CXYA 3BOPA 3WDUA 1PVC1 1U5IA 4UXAA 1DYOA 2PUQL 4P9IA 3IKWA 3D0SA 2ZHNA 4JGZB 2ZGMA 3NAPB 1EV11 3VBHA 4G1MB 2B46X 4MGSA 4WM8B 3ACIA 4P9LA 4AEMA 2E31A 3I2GA 5C3QA 4META 1SFYA 3TH3L 1RUG3 2YROA 3IDEA 3ILNA 4JQTA 4O7XA 4ZHNA 3O1PA 2QCSB 2UY8A 2PMWB 3MFCA 4M3CE 4HN1A 3M70A 1UCXA 2BW8A 1WD4A 2BWAA 2CAVA 1ENXA 2R6QA 4NO4A 4HBNA 4TXWA 3NV3A 5DN2A 3DGTA 3JXSA 3K2OA 1SDWA 3WDWA 2WO1A 3H50A 1ZRCA 3LD8A 5K0HB 2VH0B 4B8EA 4G9SB 3VUOA 4NJ4A 1OXCA 2V5YA 3LN1A 5FJHA 2HOXA 5FR3A 1N3OA 2CYFA 4OVEA 3HR9A 2RDRA 3PTYA 4OFGA 1MZ5A 4UF0B 3HJRA 3B00A 1JZ6A 3NNLA 2RVAA 1XE7A 2LTNA 2BSFA 2Y8KA 1UPIA 4S2DA 2IXLA 5A3NA 3HWJA 2X5IB 2VU9A 2QQUA 4W6WA 1QGLA 2BV4A 3J26N 5FZ1A 1DIYA 2JE8A 2KL7A 3LTGD 1RMU3 1CAXB 2V09A 5IK4A 2HWF1 2OW4A 2VOVA 5JB8E 2NP0A 1GNHA 1YXWA 2UWLB 4B7KA 1YRZA 4LKSA 2YGQA 2FD8A 3WF2A 3URFA 3LGRA 4J6GA 1HV0A 4A6OA 5I0UA 5JBBE 4FFIA 4L92A 4IEZA 3NV2A 4JAAA 4COYA 1RUI2 2EXKA 1O3RA 1WA6X 2BVVA 3B01A 3N8YA 2IVJA 1QJY3 5FMCA 3FMGA 4GJZA 3ZN5A 3ZSMA 4LHLA 1RVF1 2JIJA 2MEV1 4ISIL 4CVUA 2R071 1SFNA 2RM21 3WHTA 1VBA1 1AL23 4LO7A 2GNTA 2VG9A 5FYZA 3S7IA 3ZMNA 3CKHA 3I2DA 3ITQA 1VP6A 2WPLE 2J95B 2W94A 2ZX1A 1UXZA 2DBIA 4K1YA 4RGGA 4XUPA 5DZFA 5CADA 1HRFA 4Z82A 5HV4A 5FZOA 2E32A 4LO4B 2ETEA 2JE7A 4PIZA 1JL9A 4LA2A 4CXWA 3WEZA 2QNKA 3WCRA 1UZ0A 2RS11 1OBNA 2WAAA 3MLJA 3LDBA 3ZSJA 4CEYC 3VZJA 1WGPA 3V0BA 2RNLA 4QKDA 2BBAA 1B9WA 1XYOA 4QKNA 3LIGA 5A1AA 4HVQA 4D7TA 3U11A 1PK6C 2CY6A 4CCDA 1CONA 2JICA 4GWJA 1HXS1 4XF9A 1S0GA 2ET7A 1E57A 4KL1A 3RYKA 1UZZA 1IQML 3MDLA 2PHFA 4LUMA 4W6XA 5B4XA 3VKLA 5FDBA 4MMZB 1SZBA 2P93L 1TG7A 2VL4A 3CFWA 1G1QA 1KLIL 1OLQA 1OMIA 2ZA9A 3TOJA 1GQGA 3S0MA 2ZX4A 2IXHA 2BOXA 4V1PA 1B09A 2I2SA 5A3TA 2DCZA 1V00A 4TN7A 5JPMB 3WF4A 3RPQA 1HB2A 3LA3A 5J96B 2H6BA 2WNUB 4IEOA 5C33A 4QU1A 1MEC1 1FOD1 2H0VA 4GWMA 3USSA 1NFXB 2Q8OA 2GP5A 5DZEA 3MIHA 1WBFA 1RGSA 2WBKA 5L19A 1LENA 1Y9MA 2DUOA 1SG3A 3MO4A 1BK1A 1HX2A 1RXFA 2WFF2 3FHIB 1QJZA 2VW2A 1NFYB 4YPJA 3MW3A 3RZMA 1XU2A 2VCMA 4N53A 4Q2FA 1LOGA 1CQ9A 2DBNA 4QGLA 1OH4A 2GSYA 1GICA 3GYDA 3I49A 3N8WA 4MMYB 4Y6DB 4A7IA 2B9UA 4JGYA 2XBWL 1B35B 2XJTA 1OLMA 3BVCA 3RYPA 1RXGA 3LOBA 1MQTC 2D44A 1W0PA 1S1AA 2E7QA 2A73B 2UURA 4FOQA 1KXGA 4FFFA 5LZ6A 5BNQA 1GOHA 4Y7BB 2XHKA 4LBKA 1JHJA 3B94A 2D6LX 4XJUA 2OVUA 3IT8A 3RI8A 5CYYA 4FPOB 2BNMA 4AI3A 1VMJA 4PI0A 2AH2A 4QXHA 1FX5A 1MOXC 1EQGA 4Z0KB 2QDRA 5GLWA 2JKHL 3WT3A 4XBMA 2NPIA 2VY0A 4EJRA 2R063 2VAUA 2I9BA 1NA1C 4WM7A 5CFCC 1W6NA 4G4FA 4LJHA 2BTVC 5FQ0A 3VZKA 3Q8FA 2ET1A 2C26A 2Y6KA 2JX9A 1V9U3 4GKXA 1HJGA 2A7AA 2XQRA 1PNFA 1ASJ1 5FMOL 2W1SA 3CBNA 3P5BL 4PLNA 4QHOA 1ZYBA 4NHLA 1FYUA 4PLMA 5BNNA 3TYJA 4MX3A 1RHI1 5C9AA 1QJY2 1HAEA 3N8WB 1HCGB 5C5UA 2A75A 1HJ7A 4BWOA 5C3RA 4IV1B 5KR7A 5BNNC 4ZHAB 4CCLA 2VQAA 4MGZE 1GP4A 2JENA 4MLOA 5C7GA 2J1VA 4FOVA 4AFCA 3MICA 5HCAA 3WNKA 3VKNA 4QDRA 4WVMB 1Q8QA 3RMYA 1LPZA 1CVWL 2VWLL 2P37A 3HNBM 1UO9A 2RV9A 5JZGA 3AP4A 4HSJA 1NCRC 2VOTA 3VBFB 5F8PA 3WF0A 2VW0A 1H8TC 1A78A 1V6MA 1ENRA 1AYN3 4H55A 3VBOC 1NA1A 4WM7C 3UGFA 5CFCA 1QFKL 2MEV2 1RVF2 4C0BA 1RFNB 1EPIA 1L3YA 5JVZA 1AF9A 1DGLA 2BFUS 1CX2A 2O14A 2P3KA 2X8KA 3SITA 4ES8A 4FPGA 3BODA 3MV11 5JIUA 3GJAA 2B7DL 4BTIA 1FF7A 4JYUL 2PR3B 2P3FN 4A7YA 5KC6A 3POFA 1EPHA 2GNMA 1NFWB 3L2HA 1KRIA 4Y1VA 1D2QA 1QJX2 4MXWB 2IUWA 4CCOA 4YRDA 3POIA 2VUJA 2WRAA 4JZFL 1O4ZA 1LHUA 2PFWA 2WZR1 3GF6A 3O14A 1AJKA 1VMHA 2H9EL 4EE2A 5IK8A 1T6BX 4YSFA 1RC6A 5FPLA 2Q1ZB 4Q4W1 4DUWA 4BXSA 4QPGA 3SLIA 1W7XL 3SKJE 1EMOA 4Q0VA 2FD6A 1X36A 2ERFA 2RE9A 4Q0SA 1U5ZA 1WW6A 4N9IA 1NCQA 2A5ZA 3ZFEA 4BDWA 2N7GA 5DMYA 4Z07A 2WYSA 1ULDA 1BQPA 3I59B 3MF6A 3PVNA 5ANQA 5L7OC 3KVBA 3NL1A 3ZFGC 2ZGOA 5IKTA 3KT7A 4OHYA 1OUXA 1QJX3 5JI7A 2ZX3A 3WDYA 1PGL2 1LPGA 1TPGA 1TNFA 1TZOA 2QQWA 2MNGA 3RVHA 1OOPB 1RJ7A 4V2WA 4YW6A 4E4SA 3OLTA 5H9RA 2PHWA 1FXZA 5JBAE 2EALA 3LIHA 4WBBA 4X8PA 4EZHA 4GKYA 1RUF2 3ZFFA 4B7EA 3MDPA 3SH3A 5JOYA 4JVAA 1HRV1 2HWE3 1RYYA 4KG8A 1APQA 3JB4C 5FBJA 3R4UA 3ZXEA 4DB5A 1EAH1 3UV9A 2BNOA 2OIIA 3ZN6A 1MZEA 4RHV1 5EP9A 2AENA 4Z1VA 5EIYB 5JIAA 1DLCA 1XC6A 1JV2B 4DQAA 2GC0A 4RQPC 5DAWA 4DUVA 1YJLA 4F3JA 5KHKA 2XJQA 3JD73 1VBC1 4IE6A 4I09A 4NPLA 1K36A 1YCIA 4LPLA 3A22A 2GDFA 2Y0IA 3U07A 4OUEA 1PTHA 5FMDA 1AR63 2XDVA 4YFWA 1OLME 3R6SA 4M10A 1K37A 4MZUA 5D8AB 3VKMA 5KHIA 2EI7B 3ME2A 1FSBA 5DUVA 3GZAA 3U78A 1W3VA 3PHMA 4FPEA 2GALA 1CZSA 3LEMA 4MGYE 1APNA 1DZQA 1QH6A 2I45A 3DXUA 1QJU3 2JDKA 3LDKA 4XFAA 5FZFA 2IFRA 1NUKA 3ES1A 3T08A 1JYWA 2QQKA 1RUH1 3HN1A 2ADEA 4FQZA 1ULPA 1OA2A 2WFTA 1OOPA 3WNLA 3A23A 5GJ6A 5A3UA 5F1RA 4FTSA 3JBG2 2GN7A 1YJKA 5FK8A 3NJPC 1ZX5A 5JI9A 5L9BA 1O91A 2C4XA 3N9MA 3N3HA 2VQ0A 5EPAA 1FT9A 4IDZA 2VQTA 1DFQA 3FLTA 3GZTB 2XLAA 2JWPA 1RB8G 5A1LA 1O59A 1HRI3 4QXCA 1F4HA 1ZBE1 2D6PA 4D0QA 3VD3A 2EXIA 1V6OA 5LB6A 2SBAA 1J3RA 2FLBL 3FFQA 4HANA 4JGYB 5FKBA 4CDWA 2ZGLA 4AQSA 2LM3A 3WW2A 1NQJA 1W9TA 3KV5A 4A7ZA 5GZCA 2BU9A 5GZEA 3J8F2 5I0DA 3IJEB 5FOJB 2WSUA 1AR71 5FO7B 1LR5A 4AHWA 3GNEA 1KD7A 2YDEA 3SCHA 3BKZA 3UGGA 2A6XA 4GMP0 3JCIA 4XW3A 1LESA 3VD5A 1HQWA 3OF1A 4PF5A 3K51A 1H4GA 4XDPA 3PL0A 4XXAA 5E16A 3RWKX 1YC61 3SH4A 2Y64A 4LA3A 4KGGA 4BE3A 2EAKA 2VRSA 3MLLA 4Q0PA 5FTTC 1RUJ1 1GOFA 3VHNA 5JSRA 1RUD2 2C5DA 4B29A 4RQPA 4CDUC 3IB3A 2TNFA 3DPRA 4IE0A 5H9SA 3MUZ1 5HI0A 3IPVA 3FHQA 4ITCA 4TWTA 3VGIA 4AEDB 5I8TA 4JYVL 2WNUC 2W5FA 4QX7A 3NO8A 1J3QA 2OX0A 3AMNA 3I3BA 3UJOA 1LQDA 5L9VA 1UX6A 2VCBA 2P3FL 4COVA 3T2TA 2J1RA 3MYXA 5L7OB 1Z7S1 2JDHA 2KD7A 4FAHA 1LOFC 2FQPA 3O1OA 3FLRA 1CWPA 2WS93 2EI6B 5F5CA 5HXMA 5EZWA 4O9EA 4OUSA 5EV7A 4LORA 5FZLA 2VH6B 4D90A 2JG9C 4JKLA 4MUVA 1Q8VA 4DFSA 1WUVA 1XNBA 2AC1A 3KF5A 2GC2A 3NJYA 1BMV1 1C8NA 3UJQA 4E2QA 1TMF2 1VBB1 2BUKA 5A7QA 3OEAA 5CFCB 4XAAA 3CF6E 4AK3A 4R9CA 3B69A 2J1TA 3AVRA 1OSGA 5E88A 5BNPA 5IFPA 4CEYB 5FP3A 3ZR5A 1PGSA 3T3YA 2LW8A 4PIXA 4XFHA 5DUXA 1NOVA 4K20A 4AI0A 5DDJ2 5FY0A 2Q1FA 4Q4V2 3J7LA 4HSLA 4QPGC 4OUMA 3M3EA 3SH5A 4R4ZA 5D8AA 5AFEA 3HBKA 1G1RA 3OGVA 3POYA 2JG8B 2YB7A 3UKVA 4FSJA 2IFWA 2IWGB 2BZ6L 2P1BA 3O0XA 3VDDA 2CV6A 1UX7A 2VMDA 4JGYC 3MFAA 1EQHA 1RUG1 1NY72 1ND2B 1VBE2 2PN5A 3J9SA 1IKPA 3JB8A 2EICA 3LOIA 3QD6A 2D6NA 3OOXA 5KXCA 1MS3A 1V6LA 1X82A 3PIGA 1SLTA 1S0FA 4TLFA 4CE8A 1BF9A 3POBA 3D6EA 3SQOA 1F5FA 3GHMA 4QHZA 3ZPOA 4E2SA 5FLJA 1DCSA 2Y6JA 4BIFA 1COV3 1SHWB 2XVLA 5T50A 1NAEA 1ADXA 2GNDA 2J1AA 4BPZA 1A34A 2D40A 2GH2A 2JJ6A 4Q5OA 4DXRA 3AL5A 5FPAA 2H9EC 3KCCA 3P3PA 4IEUA 3T1MA 1IQEL 1BBT3 3KLSA 5CAZA 1AL0G 1W06A 6COXA 2IXIA 3HQUA 1XOYA 3IWZA 2GAUA 2BBVA 2GC1A 2K46A 3LSEA 1L7RA 4I0BA 4XHXA 1F0SB 1R082 2NYYA 4Q8KA 5KXDA 3GGLA 3SOQA 4GQ7A 4FPJA 1NQLB 1PRHA 2WPHE 5EJ3A 4FO9A 3RR3A 4NUBA 2HWF3 4ARYA 5A7WB 4B4RA 1PIV1 3VKOA 1GYKA 1JS9A 2XJRA 4MSVA 3TNQA 2QKDA 3ZM8A 4AFMA 2RJ2A 4A7KA 1PXXA 1J84A 4RS5B 1FOD3 2E53A 3VBSA 5T54A 2O1QA 4HPKA 4K8RB 2ZMKA 1W2TA 3WP4A 3ZYJB 5D21A 5DQ0A 1QJY1 3TEYA 3HPTA 1UU6A 5KHHA 1DX5I 4AGVA 1KGYA 4XMAA 5SV5A 1BMV2 4QQ2A 1POV1 2R073 2RM23 1W90A 2CDPA 4CDUB 1AL21 2ORXA 5FP4A 3EYPA 1LU1A 3TWIA 3EO6A 3JZVA 4BISA 2VXRA 4LR4A 1EUTA 4PBOA 2WYJB 1JH5A 4OQ9A 3OBAA 1I5PA 3CJIB 4N7UA 4UYBA 4NROA 5HPOA 3LEIA 3BN6A 4XETA 1LB2A 1LKNA 4Y1YA 3W9AA 1LOBA 3WDVA 2ZHKA 4CXXA 2OPKA 4MO3M 1PO13 2QQNA 2B4KA 2BOIA 3SEEA 2VVUL 1ULOA 1N1YA 1DZTA 2W26B 1VAMA 3NW4A 4NHXA 4RS5A 3OSDA 5LK5A 4H2AA 4A41A 1RUD1 4LKEA 3D3AA 3HN3A 1EBVA 1QNYA 1FATA 1V1IA 2FCVA 2JD9A 5FZEA 1XNKA 4EN9B 3KCXA 1GMMA 2DU0A 4PIYA 3O1RA 2XWJB 3CU7A 3HBZA 4ASLA 4PDWC 2VOWA 4WM8A 3THTA 4CEYA 1W9FA 3B5LB 4YVSC 4CEWC 2RDNA 1FPN3 1VBD1 2VUAA 1V9U2 4NPMA 1RIRA 2AR6A 2WSVA 5FZHA 2W92A 2Q8DA 4F8AA 1FNZA 3DXTA 2DDUA 4BHPA 4BQXA 3C7GA 3EBRA 4O61A 3IITB 2HWB2 3PUAA 4M0HA 2R16A 3OGRA 3PTRB 2PLV1 4D94A 3M37L 3FUOA 4YZ1A 4HKWA 3VDAA 3MIDA 1U5YA 1KDMA 5A32A 3I2IA 1W6MA 1YNAA 3ZFFB 5CKQA 2WFPA 3EGFA 4Y7AB 4W65A 3VDDC 1JU3A 2R0FA 1NCRB 3M7AA 2BOKL 1FAYA 1F31A 2YY1A 4ATFA 1QQP2 4CCEA 2CGPA 1Q8PA 2DFCA 3AL6A 1D0GA 4RSUA 1LAJA 3PNAA 1RTVA 2NLRA 1PO23 2OS2A 2FDJA 1KS4A 3BCWA 5JUVA 2VOXA 2CU5A 5CG8A 1JN2P 1O7FA 1BCXA 3ALQA 1URKA 2RJKA 1CVUA 5IAVA 3OEBA 3U1XA 2ZGNA 5FO8B 1RINA 5CKNA 1OC1A 1LODA 1YQ8A 3PUHA 1AYN1 4Q27A 4QKFA 3GDBA 1QWRA 1QJEA 1V3XB 4IV1C 3ZFGB 4YM2A 3NJVA 1MS5A 5JXIA 3HQXA 5DPNA 5K4LA 3M1HA 4ZKTB 5G04L 3U4XA 2KB9A 2ZEYA 1D4VB 5IK5A 3LAQA 2BGOA 3AZWA 5FPXA 2XBYL 3VZOA 4Y1UA 2W91A 4CCNA 1UPSA 4QKBA 4CDQC 2EIEA 1C1FA 1BYHA 4HKLA 4WVZA 5GLZA 2WZR3 5LK7B 4GH4C 4OTYA 4CPBA 4QB2A 3FX3A 1IQIL 1XBFA 1F9KA 5JVVA 1W8OA 2OZJA 3PGHA 1DHKB 1WHFA 4XPVA 3SW2A 3BUCA 4LT5A 1HRV2 5AVAA 2BGCA 1QIQA 3GZEA 3K3NA 5F2WA 1OQDA 3CNAA 3NTBA 3WNMA 2XBXL 4ZH8B 1COV2 1HLCA 4BMBA 1GNYA 2Z4FA 1AR93 3CIHA 2ZGTA 1BVP1 4QB6A 4AHZA 2JEMA 1C57A 2D3PA 5A7SA 4AAPA 1PGL1 4KG0A 2BT8A 4KBBA 2P3TA 4LBJA 3RZLA 3R05A 2WL1A 4NOTA 3I4IA 5H9PA 3H3LA 1G6NA 1RUF3 3I8TA 5DUWA 2WPJE 2XVKA 5DAQA 2RS52 2SLIA 2ZGRA 3AVSA 1IOAA 3FLPA 3O1UA 2JDNA 1PM4A 2WQZC 3POJA 4ZZ5A 2QQVA 2PHRA 2R1BA 1QOTA 2ZGUA 3MIFA 4OMCA 4ZXKA 1J1TA 1HRV3 5K9YA 5C5TA 2FDKA 1ATBA 1UD1A 1IPJA 2LRPA 4PQ9A 5FIXA 1IS3A 3MW4A 3SCGA 4DRRA 1HIXA 5K8SA 1HDKA 4D6QA 3KHBA 4SLIA 4GU3A 3BYWA 1F35A 4JV4A 1NZIA 2W1WA 4WVWA 4IV3C 5DG1A 1WMEA 3AZVA 3M3OA 4D69A 4YG6A 5FY1A 4N53B 2PHTA 1YFWA 1DQ5A 1RMU2 2HWB3 1W3XA 1COUA 1WCKA 1OURA 1KFUL 1S0CA 3J7MA 1C1LA 2PELA 5FUIA 2RS53 2Y6GA 3AX4A 1SPPA 1NE6A 4OTJA 3J8F3 4Q4W3 3KWVA 2LUWA 2JECA 2VMGA 4XIKA 4AI2A 4XUQA 1DBNA 1VMFA 2QZ2A 1VE0A 2BQ7A 4HFSA 3WP5A 3QH6A 2HEYF 1JYTA 3N9LA 4C1XA 1ULFA 2K2TA 4JDOA 1IG3A 4JTOA 2KA3A 4L2NA 1D0HA 3U14A 4UFMA 2W2PE 5FYVA 5CG9A 2J42A 1Y9GA 3HS6A 2QQJA 4Z8BA 3ABZA 3VBSB 5J09A 3AXDA 1CX1A 1GSLA 4N8MA 4X8NA 1W6OA 2XMLA 1O8SA 1US2A 2BO2A 5AFBA 4W8JA 5F37A 4I3PA 3TK5B 2OT7A 3ZXAC 2W39A 1Z6CA 5LY1A 2ZGKA 1QF3A 4IEXA 4ZPIA 3UESA 4IV3A 3FFGL 2RMU1 2R49A 2ES3A 2JDPA 4PDWA 4WM8C 5KHGA 3C7OA 2ZZQA 3B02A 4BOWA 4Q4X2 5F2SA 1AYN2 1FI2A 4L9BA 2PYTA 1LECA 2DVGA 2PHUA 1ONAA 2PHDA 2QZ3A 4S2FA 5FYBA 5FZMA 3UL2A 5BNNB 2FZ1A 1X8MA 5FY4A 3ZR6A 4UF0A 3JQXA 1IPKA 2WS92 3NJXA 1H6YA 2Q8CA 1UXXX 3WY6A 5FYTA 5FRAA 5J36A 2PA7A 1IGXA 4BK5A 1X7AL 2WLQA 2E26A 3C7HA 2BGPA 3G6JB 5FZBA 2J94B 3BTZA 5FMBA 1J9CL 1K5MA 3FWEA 2GC3A 3CENL 4AF9A 3LFIA 4GB32 4QU2A 4XACA 1QJFA 2V72A 5EYYA 1SLLA 4ISHL 4FPHA 1CZVA 4KWUA 3GBWA 1RUJ3 4QMAA 5FYHA 1UMHA 2JB4A 2ZBJA 1GV9A 2MGRA 4QPIC 1SEFA 1TEIA 1MVEA 2WNVA 5T5JA 4CTEA 1LHOA 3ENRA 4COWA 3BTXA 4FPCA 1MACA 3S7EA 4H3WA 1L7LA 1UY2A 3H1MA 4CYDA 3GBGA 3I3QA 3OPTA 1NFUB 4O9GA 1Z7S3 3VDBA 2UWAA 4P00B 4XUTA 1QKQA 1BEV1 5A32B 4QM8A 2BQPA 2Y80B 1F8VA 1O3TA 1EZQB 1AX1A 5FZKA 2VD7A 4QX2A 4DOUA 5F3GA 1IQLL 3RWNA 5DXDA 4HOOA 4XIOA 3ILRA 1F7MA 5FYIA 1HRI1 1Y9QA 1KSNB 1FE2A 4RYDA 1URXA 2DTYA 2IXJA 1TME3 3RNSA 3UYJA 4AHXA 1N1IA 1KKEA 3D8CA 4JDNA 3V0AB 4QHBA 2FDHA 5FZ8A 1UYXA 1JOJA 3A4UA 3JD72 3VBSC 4I30A 3QOPA 5FO9B 4D0EA 2WN2A 1NXD1 5FPUA 4INDA 4CSYA 1SBEA 5LBFA 1JYCA 1MVQA 3W59A 4D6SA 3GCWE 1CAVA 3KHCA 1O3SA 3WG2A 4D6RA 4ZXXL 4IETA 2O0OA 3BU7A 2ZMLA 1DQ0A 4OHXA 4XUOA 5IATA 2PHLA 5CBLA 5JR2A 3M8LA 1IS5A 4AWDA 4L11A 4FTBA 3ZIXA 4FXKB 4A44A 2VUCA 1IGZA 2I9AA 2NM1A 2E6VA 3M3QA 3ACHA 1DZRA 4P9XA 3MUY1 3VBFA 2HJIA 2ADXA 2V4VA 2VQUA 3THCA 3X29B 4AFAA 4MGKE 4X6QB 4NA9L 2MPFA 3OJBA 1AXZA 4GAZA 4M00A 2VTFA 4X6RB 5FJKA 5JXHA 3I2FA 4QXKA 2WDBA 3E5XA 3RZHA 4NIGA 4KQ7A 3GXUA 1CAVB 5EJ1B 1OD5A 4X8UL 2R072 2RM22 4IGOA 4A94C 4QT6A 1VBC3 3WG4A 1UWWA 1ZZ8A 4QX3A 3AB0A 1OLRA 2XC4L 5FPVA 2YZ4A 5IJRA 3WDXA 4TGFA 3RQ0A 1SFPA 4YVWC 1PFXL 1WMDA 3Q8BA 4QPYA 4COXA 1RUC3 1POQA 4MADA 2VNRA 1J59A 4LIVA 3WF1A 4I2OA 4MGQA 4K9SA 5AC92 2VZTA 1AL22 1ZBA3 4DPNA 4LE4A 4CUFA 1BZWA 2V5DA 5FZ6A 3QMOA 3KD4A 3LEKA 3H0OA 2ZKLA 4XLWA 4BQ1A 4EROA 5K0UC 3T30A 1W8FA 4BQ3A 5JMOA 2WNEA 3N7KA 3WQBA 3PIJA 2W2OE 3H7JA 3ZFEB 1V6NA 4AQTA 1VRH2 4BQ2A 3TZIA 5A3MA 2A1XA 1CJPA 1QXPA 1U5XA 3AJYA 4IXLA 4CP1A 1PIV2 4AOCA 4NAMA 1S0JA 1DQBA 3KZ4C 5G05L 2GMEA 5C8CB 4A42A 1QIUA 1E5HA 1MR5A 2ZMNA 1QEXA 1W39A 2OYUP 1QDCA 1OF3A 1ZA4A 4HMZA 1ZVFA 4PBPA 3W20A 2FDFA 5DDJ1 2UWOB 1N47A 3KQ4B 4NVPA 2ZEXA 2YGMA 5L30L 4AVVA 4Q4X3 2VE1A 3M2MA 2Z5WA 2RHPA 1I6XA 4EN0A 2C0ZA 2RS13 4BU2A 2VCCA 1G9AA 1UZQA 1LGCA 1PM7A 4F83A 1HQNA 2VNOA 1RUI3 1YO8A 1S2KA 4MYEA 1HZ8A 4TYSA 1YFYA 1BLZA 3DKWA 3HT2A 1IQDC 4ZONA 4PH9A 2JDZA 1ENQA 3KQRA 3H42B 4XYXA 3I97A 1MS0A 1S0EA 4RRXA 2YGLA 5AC91 2XBO3 4PI2A 4XEZA 4A3ZA 3C7EA 4WZCA 1WMXA 3FE5A 2XH6A 5IUQA 3QLQA 3BTYA 2AREA 1NLSA 4HVOA 4YARA 4YM0A 1DQ1A 2BQWA 1NY71 2CSGA 2AACA 3M4FA 1UZVA 4B4QA 2FMDA 1PVXA 3F95A 1E5IA 3AP6A 4CU7A 3KCGL 4PF1A 2PLV3 3EQEA 4K7JA 1R092 1WCDJ 2J1UA 2QBXA 4PQQA 2QTWB 4BXSV 1XDTR 2EAAA 5IAXA 5J3UA 1OVSA 3ACLA 5KIRA 3AMHA 4PT6A 1P8JA 3BI3A 5KXEA 3F6UL 5A7PA 3TEXA 2ENRA 2HORA 4K1ZA 3AYCA 4CEWB 1JYVA 1JZ8A 3CZJA 2XL7A 3NSTA 2J34B 1W8WA 2EF6A 3BT1A 5B2GB 3ZXLA 2YXSA 2VWNL 1R1ZA 4ONUA 2G9GA 4LO8A 4Y22A 1H2MA 1PO21 2D93A 2GMPA 4FI9A 2ZGPA 2D6OX 2E7TA 3PUSA 3OUJA 1NCQB 3PUQA 4RGAA 1YI7A 4RRYA 1QH7A 4ZXYL 1H4HA 2OUHA 2W1QA 3J7HA 3KSCA 4NE9A 5BXXA 2WO3A 3ZFEC 3KV9A 4DIQA 1PO11 1IP0A 2C1FA 5FP9A 1DDXA 1IKQA 3RMXA 3ZFFC 1JU4A 3GBFA 5FY5A 2W3JA 2HWD3 4Y1XA 1W8HA 1GUIA 1MS9A 5C4WA 3VN4A 4ZZ8A 1JBUL 1F5JA 4E8DA 4RR3A 5FXVA 1Z7S2 1RL3A 1AR62 3WP6A 2WABA 4FFGA 4KWJA 2WO2A 2VOKA 4GIQA 2BJSA 1FAXL 2P16L 3QCWA 4LMFA 2ZKNA 5JZGB 3OCPA 4IERA 3RRDA 4NPRA 3KV4A 2G9FA 5CFDC 4LBLA 1IVOC 1DGRN 1JBCA 1ZRDA 4GZ9A 5TSWA 4JHTA 4M11A 1GR3A 1PGW1 3PURA 4BXFA 2C9AA 1TE1B 5I91A 2WG4B 1Y3TA 2WQ8A 5J37A 1ND2C 1CAXA 1RUH2 1UY3A 3T2OA 3SMHA 2X53S 1AJOA 3T0AA 2JJLA 3IPVB 4AEDA 4BA6A 2VULA 1RUNA 1S55A 1FV2A 2PHXA 2YFZA 1HT8A 1JZ7A 3NQHA 5B4NA 2DVDA 5J1XA 2B39A 1VIWB 1UU4A 1OF4A 5C8CA 4JRLA 2B45X 1IGOA 2XC5L 2XG3A 1CJDA 2DFBA 1WCUA 1LULA 5JOZA 1N1VA 2XOMA 1OPOA 1KDKA 1VBC2 2UWBA 3GJBA 1BBT1 4CP0A 1QU0A 3GISX 4GA9A 3LPGA 4XFGA 5JAXA 2GD4A 4ES9A 1BHGA 1DYPA 2ARXA 4O65A 1OQEA 1JOBA 1SLIA 5FWEA 2VJ3A 5LATA 3BALA 4AI9A 5A33B 1UMZA 5EYXA 2G00L 1VRBA 1XB9A 1ZZ9A 2OKXA 1ND3C 3PLQA 5JOXA 1LOFA 1IQHL 4YZUB 3VV1A 4JGZA 4COZA 2J2UB 2AZ5A 3AKPA 4Q4Y1 5LRSA 3FL7A 4MGTA 1ND3A 1EPGA 1ZRIA 1BK0A 4HG6B 4UFLA 3LF7A 4IUGA 4YT6L 3LFMA 3USUA 5I0RA 4FTEA 4FBFA 2QE3A 3V0BB 3KB5A 1Q56A 3GALA 5E6HA 4EN8B 4URTA 1SACA 2LROA 3AZYA 3H1YA 2GP3A 2CTVA 2DWRA 1WLCA 5C3OA 4P5YA 1YI9A 1FPN2 3CJXA 3WG3A 4R52A 5JLVA 1QDOA 1I9RA 1LOEA 1O6UA 1SMVA 3IDBB 3AYAA 1NG0A 3AYDA 4XTMA 4Y5SA 2VZPA 4XFCA 4ASKA 2YBSA 4OZOA 3G7DA 2UWPB 1H8VA 1LOAA 2CDOA 1H1AA 3RS6A 5C6CA 1W9YA 4UW6A 3GHNA 1HAFA 4QWNA 4U2AA 5AVPA 2Y26A 3R4DB 3U37A 2XJPA 4QM9A 1SBFA 2VW1A 3H3UA 4BQ5A 4BK4A 2EIDA 3P6BA 4CEWA 4OI2A 1W8ZA 2B5HA 2P6HA 1PK6A 5GLVA 5A3OA 1PZ9A 2WZR2 3Q7DA 1RUD3 2WJSA 2RS33 3K4DA 3ZKYA 4YWAA 1PX3A 1GBGA 2VZSA 1QJX1 4KMQA 3N9OA 4BXWA 2Y6LA 3CO2A 4QPIB 4LBQB 5FYMA 4AI8A 1RUF1 1G8WA 2VMIA 1XFEA 5GZGA 1G9DA 1VAVA 4PDWB 3ZSKA 2QVSB 3DCQA 1POV0 1ATAA 2C6SA 1Y4WA 1ULCA 2VZOA 2RMU3 4HONA 4GMP3 4YYOA 4DO0A 2HEWF 5F6KA 1LMJA 4DY3A 4EZ4A 2YGOA 1CAWA 3WW4A 2VNVA 2FCUA 3C8XA 4UW3A 3T2PA 1RUE3 1QOSA 4K3UA 4AEDC 4AQ2A 5IVCA 2BNNA 2ZEZA 2VVCK 3Q8AA 5A3PA 4KWKA 1AYM3 4IGPA 2FLRL 1CPMA 1DLLA 1GQPA 4RRZA 1K5MB 1UOGA 2JXAA 2W1UA 3MBWA 1TNRA 4LK7A 3EXUA 1G9BA 4XBNA 3ZXDA 1UQXA 4ISQA 2ZGQA 4AXOA 2OQ6A 3WNXA 4Y76B 2Y5HL 2A3XA 4B4PA 4LXLA 4MHUA 1JYIA 1G86A 2RS51 1LK9A 4CDWB 1XQNA 1IQGL 4TLGA 5HXVA 3HPNA 4Q4V3 3CMGA 5FP8A 1J3PA 2ARAA 5FPBA 1XNDA 2JIGA 3LDRA 3LE0A 2ZAHA 4NG9L 3K3OA 1QJU1 4AFBA 2WQ4A 2AEZA 1VB2A 2VPVA 3CLPA 3NAPA 3VBHB 1YUFA 5IKRA 1F2NA 4NRQA 2RDSA 3LIWB 2J4IB 4R8HA 1JZ3A 2R32A 2P94L 1M06G 1VR3A 2DURA 4B1MA 1HB1A 2AGSA 5IFTA 2OUJA 2K9ZA 5FZ0A 4CCMA 4BTTA 3IAPA 5BNPB 2YBKA 5A33A 2VZVA 4HL0A 2WZPP 2X5IA 3AMMA 1WW7A 4OHVA 3VD7A 1NZCA 1G9FA 2C9KA 4C1WA 3J4UH 3HT1A 4WVMA 1WMFA 2V4AA 3LPFA 1LCLA 4GH4B 4CUEA 4B1LA 1AUYA 3MQEA 1ND3B 2D5HA 1AYM2 5BPXA 2A6YA 2Z42A 3I3EA 3F1SB 1TME1 2C24A 1KQRA 3K4ZA 4IE5A 4E2GA 3DPRC 3WQ1A 3ORJA 3DL3A 1XKAL 5GKAC 5BV6A 3VBOB 2VMHA 2IXCA 2YBPA 4ZU5A 4NWVA 4N90A 4M3CF 4XCBA 3WNNA 2I74A 4OQ8A 2PQSA 1ENSA 4BMEA 2WWUA 4DMIA 1OKQA 1VPHA 1RHI2 2O8OA 4I0AA 1GNZA 3TN91 4E4ZA 4FP2A 2VO5A 3E6BA 1NCRA 1ZZ7A 2WT1A 1GFF2 3ZPYA 1UF2C 2WFF1 3KCYA 2UYAA 4QDSA 3N4MA 3O5SA 1KS5A 1C8M1 2NMOA 3BOWA 3OBZA 4YLZA 1OA4A 1WZXA 4PHZA 2ZZJA 1PZ7A 1KJLA 3L2YA 4M3CA 1JMUB 2G9ZA 4GALA 2DUQA 1M4WA 4Z92B 4TTGA 4GD4A 2QQIA 4RRWA 1VRH3 2Q4SA 4YVWA 1W6NB 3KVAA 1IQNL 4XFIA 1MS4A 1ZZCA 4L97A 3KQEL 1AR83 1PMJX 2XLGA 4Q29A 3VL8A 3W58A 3ZXFA 1C8M2 3H1WA 5T3NA 4Y26A 1AR82 3DEMA 1DQ6A 1EY2A 2QFEA 4YGDA 3B9CA 2DVBA 3LC5B 3BPSE 2DYCA 3AMPA 2W2QE 2WZ8A 2VJXA 4IEQA 1ND2A 2ID4A 1XE0A 2A3YA 2YC0A 3TN92 1VBB3 3ZX7A 3NKGA 3Q8EA 5BY5A 1HN0A 2HWB1 1DVAL 3FCSB 1UL9A 2OXBA 4XJAA 1LHVA 1K5JA 1SLCA 1NX9A 2RR11 3AFKA 3OGGA 5FOBB 2XKPA 2NQYA 5I8YA 4A2UA 1JI6A 2RR12 1RUC1 4HPKB 3VD4A 4E1GA 1D7PM 1DQ2A 1HB3A 5EXOA 5IT6A 3DYMA 3WW3A 4LO6B 4Y22B 2XONA 3NRUA 2WUHA 4GU4A 4OZXA 2RS32 2BFUL 4IE7A 4PJYA 2Q8EA 2XC0L 1JXNA 3MZHA 1WW4A 1NLQA 3SISA 3E6CC 5F3CA 4NRPA 1YGCL 1LJ7A 2YC4A 5GLUA 5JW1A 1UYYA 3VBUC 1MS1A 1S0DA 1W8BL 3ZOIA 3ZSEA 3MIGA 2PHBB 4YVWB 4LBOA 3ZKUA 3O0WA 3KQCL 1DIWA 3SC7X 4XILA 4JCKA 4L8QA 4EN6B 1UKRA 3N8ZA 4R4XA 1LMMA 2ARCA 2VUDA 5K7PA 1G9CA 1S2BA 4MOAA 2ARBA 1ZAQA 5DDJ3 1KLJL 5C9AC 2DVFA 1BXHA 4BLIA 2W86A 3IDCB 5I0TA 3EJKA 4Q4X1 3HS7A 2WC2A 1IOXA 4YM1A 3ZN4A 5ACA1 5JWPA 4Y33A 2E33A 4YZ4A 1G1SA 5CKMA 4XC9A 5FREA 1TVGA 3HNYM 3K48A 2VH9A 1XNAA 4CRQA 2XBVL 3Q9OA 4UWDA 3WZ1A 4FCAA 3AJZA 1G2LB 2G1MA 4DRVA 4BLJA 1B35C 2Q0AA 4Z0LA 1GP6A 4IEVA 4LBNA 3WD5A 5C8CC 5I93A 3I54A 3OUIA 4Q0UA 4A4AA 1X33A 5JXJA 1LEMA 4QGMA 1MQ6L 4AR2A 1TME2 2E9QA 3WSOA 2QQPA 1RUOA 1NXMA 3S30A 4Y71B 2ZABA 4FOYA 4LBQA 1Z78A 5C9AB 1J1LA 1VAKA 2WPIE 3R0RA 3T0BA 1CIWA 1R081 5E8AA 2HWD2 1EPWA 1XU1A 5D1IA 1KLOA 1W99A 1ZBA1 2YGPA 3OD4A 4XHBA 5FZOB 5A7OA 1KJRA 5IVVA 4QQHA 4CCKA 1H8TA 3WHUA 1EYBA 4JTNA 3INAA 3H5CB 5C8WA 2WPKE 3D82A 2VZ3A 4YGBA 1LNSA 3O1SA 4C16A 3POSA 4A3XA 1E5SA 3J7NA 2WYGB 3KRKA 2BOUA 3H9AA 4KGQA 1POV3 4AG4A 3USUB 3AYEA 1WWYA 3I2KA 4IEYA 1KEXA 3JUUA 1MQTB 3N8XA 4E4DX 2HWF2 4QGNA 3S57A 4LEJA 4XJ9A 1Q8OA 3OPZA 2W0XA 4QDQA 5A70A 3WX5A 1HN1A 1VALA 1SLAA 3HO4A 1VBE1 5LCWL 3V0AA 4YGCA 2OYZA 4NN0A 3U0ZA 4Y4RA 5I46L 3HAGA 3RJRA 1IS6A 2W2NE 3N7LA 3P3NA 2P26A 2BEOA 3AKRA 4RR3B 4UAPA 5GZFA 2CGOA 2VZUA 3T1LA 5JXGA 1UY0A 2ILMA 1LOCA 1S4CA 2XXZA 2NZ9A 3IN9A 4JHZA 3ILFA 2B9VA 4BQWA 1H2NA 4ZS2A 4A45A 3BT2A 2OZ6A 4CPBD 2WWSA 4CUGA 1W8NA 5KC5A 3WQ7A 2BVBA 1EGFA 3HNMA 2TUNA 4AVAA 1IQJL 2TEPA 3KGZA 5AC93 1FPN1 1VBD3 1ZNPA 4RUTA 1J58A 5IVEA 3ZVXA 3H8XA 2DCKA 4XMIA 2JG9B 4D7YA 1CPNA 4CDXB 3LA2A 4AYUA 1EUUA 3Q8CA 3ZIWA 4K8FA 1TMF1 2J7MA 4EWEA 1WLWA 4MGIE 3AKTA 1XSRA 2R043 1WCSA 2CNAA 2Y34A 1N3QA 1XYPA 3C9AC 4XF1A 5FY8A 2W95A 3DYOA 5FCCA 5CVRA 1F0RB 2GN3A 5SV8A 2Y33A 3KGLA 4BJ0A 2W68A 4N7IA 1E5RA 3V65B 2R0HA 4CP9B 1KFXL 5IK7A 1QXJA 2GU9A 2E63A 1VLNA 2VGDA 3L9JT 3OY8A 4NIIA 2XGXA 3VDDB 1HKDA 3ZXJA 5A3LA 1JZ2A 1CVNA 4BYYA 4X8VL 4BIOA 1XKBA 1D4M1 4AQ6A 4L99A 5BNOA 3ZYIB 2XJUA 2GNBA 1EPJA 2Y60A 4BTUA 2E51A 2YHJA 3WDTA 4EV0A 1O3QA 4LUKA 3POGA 2X10A 4IE4A 1UYPA 3N7MA 3WG1A 1P0SL 1Y43B 2BDRA 3B7MA 4XL1A 1V0AA 3D0JA 2ZTNA 3BIEA 5E8DA 1K42A 1U8CB 5C3SA 2P34A 3ENSA 1ACCA 5ERLA 1SBDA 4UOJA 3VHPA 3AKQA 1TOZA 3RZZA 3FBYA 5JVYA 5FBZA 3E1F1 4Y3OA 3PJYA 1ATEA 2XJSA 2FHRA 4OI1A 5HBAA 3E6DA 4DZGA 1NE4A 2D6MA 4OMDA 4FP3A 2WT2A 2ADDA 2MEV3 3N9QA 3PVEA 4Q4Y2 4YW3A 4NAOA 5CNAA 5EWSA 4LKFA 2VVFA 4CUAA 2QQOA 1H8TB 2ZGSA 3ZXGA 4AGRA 5F19A 3MPPG 3VD9A 3P5BA 1YWKA 2WN3A 2YV8A 4FOWA 3MV01 1YUGA 1RUE2 2VBPA 5F5IA 3RJ2X 3V65A 2UWCA 1R64A 3CS7L 4OI0A 1UN1A 3OUHA 1BBT2 4HETA 3WVJA 4CUDA 3FZ3A 1EMNA 2P95L 1QQP3 3S6XA 2RDQA 5BNOB 1UZPA 2A71A 4QQLA 3FN9A 5GM0A 2QQMA 3FJSA 1AR91 1GOGA 3VHOA 1UOJA 3NWKA 4PLOA 4CP9A 4ZU4A 3GZUC 3T4HB 4YW1A 3TGFA 3WW1A 4MH0E 5GLTA 3A0NA 2WT0A 1CAUB 3NMBA 4EN7B 3KT1A 5FYCA 2WINB 5T5LA 5IVJA 3FBMA 5L7OA 1JYXA 2HWE2 4JRAA 1SPPB 1C3HA 3O0VA 4Z6AL 4XZUG 1NLRA 1Q5OA 3EMRA 2JG8C 3HQRA 4ORFA 4Z2AA 3WR0A 3NT1A 2D98A 1US3A 3GCXA 2QQLA 3S5AA 1LGBA 2AYLA 2HYKA 5FPZA 2OPWA 4IESA 4Q4Y3 5FZ4A 2B8MA 5CIRA 3THPA 3V64A 2R1DA 4BCUA 2VMFA 1GWKA 1FMD2 2VVVL 3OBRA 2FLGA 3M3CA 1MEC3 4UT5A 3T2QA 4DEVA 2EXJA 4N43B 1DGWA 2JG9A 2W2ME 5T5PA 3I59A 4ET7A 4JKMA 4YZ5A 4FPFA 4BH9A 2FZZL 3Q3KB 1PO12 3MI8A 2D43A 2HH9A 4D8MA 4DNYA 4Y4YA 3AMQA 4IV3B 5T55A 3H8UA 4HN0A 4M0NA 5C3PA 1AX2A 4XOGA 2CAUA 3ECQA 2WFXB 1R1A2 3AZXA 4N53C 4YVSB 3WQ0A 4F7ZA 3VZLA 3MIBA 4X8SL 4V2VA 2CHHA 2JB8A 1XPWA 2WYFA 4HZFA 5BNOC 2ZHLA 3AZZA 1CAUA 1FAKL 2ZOEB 4FPLA 4R9DA 3WUDA 1I5ZA 1S2EA 1AVBA 4CZSA 3IAQA 3PMSA 4S2HA 4BZ4A 5F32A 1A8DA 3RGBA 4KU8A 2Z79A 1Z0HA 5IWFA 1YHFA 4JDMA 5IKQA 3E5UA 2EVXA 4O02B 4N9HA 2VMCA 5D2AA 1O4YA 4P9WA 1RJ8A 1WKYA 5T52A 1ALYA 1FMD3 2DUPA 4J1WA 4UBHA 5D8AC 1YQ5A 4E8CA 2X5IC 4XJZA 2R061 5FAXA 4Q4W2 5A7NA 2BRTA 4Q1PA 1WCQA 4I0WB 3HO3A 4GULA 4KU7A 2HWC1 3CL1A 1QXRA 4AVCA 1H1MA 5E1RA 3ZDSA 2W47A 1IQKL 1OD3A 3OPWA 5JMCA 2XPJA 1W8UA 1W2OA 4AGGA 1H2LA 4QPIA 5GALA 2Q1JB 1ZRFA 3SNMA 2WG3C 1ODNA 2HBTA 5BNPC 1RHI3 2P5BA 4I3GA 4YVSA 4QB1A 1DQ4A 5KWRA 1QHDA 5HCBA 2PAMA 3U4SA 5KHJA 3LN0A 3V64C 1ATDA 2XLFA 2W3KB 3E5QA 4OLLA 5F7UA 1DG6A 4WVVA 4H7MA 4HLTA 1W04A 2HLEA 3TN93 3NKTA 1ST8A 4HK8A 4R9AA 1MZFA 3VBFC 5KXBA 1ZBA2 1F7EA 1I1EA 3DKQA 2AUYA 3ES4A 4DY5A 4Q4V1 2X09A 2X29A 3PMEA 1H1IA 2W52A 3W5MA 1IOEL 2D3SA 2YG0A 4NHYA 5FZ9A 1REEA 2D5FA 3D5OA 3NNJA 4XURA 3PJQA 5F6LB 2IC1A 3AK0A 4ZY9A 2KNIA 1UIJA 1W9WA 2Q30A 2ZACA 2PTMA 2XVGA 5CEHA 1VRH1 2VR4A 1HB4A 4BDXA 2QUOA 4YM3A 3KS7A 3THDA 3ZMOA 1BEV3 1LHNA 1VBB2 1IQAA 4Z2WA 4ISRA 4UW5A 3DN7A 5ACA2 4RFRB 4HXCA 2DTWA 4QX8A 3IBMA 3JQWA 4GH4A 3ASIA 1J83A 4W4ZA 3O12A 1JODA 1CCFA 4O1ZA 1DP0A 4Q0QA 4YW2A 3WXPA 3RYRA 1REFA 3CA7A 4AVBA 4DS0A 1R093 1WLDA 1LTEA 3QH7A 2Y6HA 1C5HA 2XUEA 4GXLA 4LK6A 5M0TA 4M01A 3UGHA 2WA4A 4U36A 2BT7A 1B35A 2W3IB 1OH3A 4FT8A 3WOGA 2KR2A 5LRRA 4QX5A 3V56A 2FDGA 2WIIB 4R9BA 1EPZA 1JHNA 4P08A 5A1FA 2ZS6B 4BQ4A 4Q8LA 2RS31 1PHMA 3D4KA 2J22A 4J1XA 2O8QA 1OFSA 5FLIA 2Y7XB 3SEPA 5FYSA 1OHFA 1VJ2A 5F1AA 1BEV2 5JSPA 1RITA 1GANA 1OUSA 1W6PA 3HO5A 2UU8A 3HOBA 4C91A 3H8OA 2VWOL 1N1TA 5FXWA 4XDQA 2ZX2A 1X9TA 4LOSA 4RGKA 4I02A 1IG0A 4GMP1 4Q26A 4M3CB 3DYPA 5CU1A 4CSWA 1AXKA 4XF0A 4CDXA 1I3HA 3IIAA 4H7LA 2E7AA 2P3IA 4HVRA 2NMNA 3POEA 3QACA 3RI9A 1RUE1 1LRHA 1AR81 1JYNA 4RHV3 3VHRA 5LW9A 3M36L 4P02B 1ZA7A 1Q3EA 2J1EA 3BGAA 4XAEA 5HCHA 2Y7ZB 1D2SA 2H0BA 1C5IA 1MEC2 2UYBA 2YYOA 4FQ4A 4J25A 4PCRA 5EQUA 2H6CA 1HJFA 1FNYA 1LU2A 1NA1B 2ORZA 3JD71 4LQRA 3LKJA 5CB7A 4CDWC 1JZ5A 2BWCA 4LTAA 1U0AA 2WPME 5JB9E 1I0UA 5EHDA 4DXTA 1T6GC 2P17A 2WWJA 3DECA 3UT0A 4MG2A 5IVYA 3JBG1 1W6PB 1R1A3 1QMJA 5LEJA 3IM0A 2DV9A 1DDLA 5IKVA 2D7FA 2D97A 1YLLA 3I2JA 4IEWA 5FZ7A 1HRI2 2D6KA 3I3MA 3K77A 5KN5C 1ODMA 3K4AA 1HREA 1GP5A 3OGSA 2P3JA 3ZYRA 2VNGA 2B7YA 4AAXA 5GZDA 4K6BA 5FZCA 1L3JA 1W0OA 1PX4A 5FUNA 3RG0A 1AUTL 1H9WA 2FDIA 2FMYA 3N7JA 2RS12 1XYNA 3O1TA 1CESA 1RVF3 5F39A 3NJZA 2VZQA 4CDQA 2XB6C 1X50A 4XDOA 5ABJC 3N9PA 1SCSA 1MZ6A 5FZAA 1LPKA 2YUEA 5JSOA 4XFFA 3I2HA 4UFJA 5C4WB 3VBRB 4AHYA 3MW2A 3WINE 4B3NA 3SXWA 1O5DL 1NKGA 4YT7L 1EAH2 1QY4A 5IYYA 3SHRA 2YU1A 1W2UA 2JDYA 1IZ3A 3FC0A 4LLFA 2AYHA 1AZDA 4MMXB 3FUQA 1IPSA 1YFXA 3RFRA 1UNBA 2W9XA 2F9BL 1CAWB 1CD3G 1RUI1 4YW7A 5HCFA 5FP7A 3CEWA 1UU5A 3UK9A 5FZ3A 3I7DA 5FZGA 1C4RA 4IEPA 1XSQA 3NV4A 2K2SB 1WA4A 4JX0A 5JOWA 5FUPA 2CWMA 1XRUA 3BTAA 2GMMA 1S0IA 4QX0A 5K0UA 3VB9A 2XBO1 3PVOA 1TLEA 4QAWA 1W2AX 1QOOA 4ZS3A 5IHRA 3WP3A 3OD0A 4AVSA 2PXJA 3W21A 3TAYA 4YW5A 2EI8B 2MHFA 5I8SA 4GB33 2HBUA 4XQWA 1A6CA 2ATFA 1TMF3 1F4AA 4IL7A 5ISLA 4JKKA 5LA9A 4N43C 1GZWB 1O5UA 3WUCA 3C3VA 4UW4A 2W08A 4BM8A 5JCTA 2I07B 1WLTA 3DUIA 1EP0A 3TK6B 1L7QA 1UOBA 2YFUA 3ELNA 3LCPA 4DXZA 2BZDA 3WLUA 3T0DA 2K2SA 3JU9A 2HEVF 4YGEA 4S2GA 2XBO2 2JKBA 4Y5TA 2EA7A 1SDDB 1JOPA 1NT0A 2P2KA 1OOPC 4MXVA 1X7NA 3AP7A 1NPEB 3M3IA 3NAPC 3ST7A 2J38B 3O7OA 4WV8A 4EWDA 1CGPA 4LOTA 2VVDA 5FY9A 2RR13 3CDZB 5CFDA 5J48A 1VBE3 5DAVA 3KV6A 4K21A 4P5HA 1YYNA 4LULA 2Y5FL 2CWSA 2DCYA 3N8YB 2WR9A 1RMU1 2YPJA 4RL7A 4GJYA 2X05A 2HWD1 1UZWA 2ZX0A 4OULA 5FYYA 1OQ1A 1PVC3 3W5NA 5ABJA 1CEJA 2OYEP 5APAA 4IQPA 5LBCA 1PVC2 2XQXA 3BB6A 2ZEWA 3BPSA 3I3DA 2B42B 1H9PA 4MXWA 5FV3A 4AEKA 4AW7A 3KQDL 1EV13 5A6YA 3R4SA 2XL9A 3H7YA 4CU8A 2WA3A 3PU8A 1EAIC 1VBA3 4QQOA 4RA0A 4XZPA 3ZYFA 3IMMA 4D7SA 1REDA 5LWBA 2YC2A 3S5QA 2ZPXA 5DABA 4NIAA 5JZGC 4Y20B 4FAGA 5FQ0B 4FFHA 3WV6A 2CGNA 3GM8A 3OGJA 1ASJ2 3U73A 5F3EA 3VZMA 1SCRA 2M74A 4NHKA 3H3ZA 2EIGA 4KNCA 3VL9A 1N7DA 2ZJCA 1COV1 3TBDA 3OTFA 4BQYA 3FFZA 3ETQA 2L9LA 3VBRA 2JDAA 4LITA 5L2ZL 2YU2A 4Q1RA 3UETA 4AEJA 2FBEA 1ZRRA 5C4WC 2DCJA 3MGUA 4CUCA 1LGNA 1GWLA 5IW0A 4DINB 3C7FA 4UFKA 1HW5A 5A6XA 3AFGA 1N1SA 1UW8A 1CIYA 5A80A 4AFDA 3QH0A 4XVHA 1GZTA 4LBMA 5IVFA 1W0NA 1OPMA 2MGPA 3F2ZA 4QPWA 2WAOA 4LHNA 3N9NA 2JE9A 3MF9A 2VCAA 3P1IA 3WF3A 4KH9A 2W46A 4WZFA 4Y20A 5J98B 4E9KA 1Q43A 1F15A 1PIV3 1BVVA 1VB4A 3EHKA 1V6IA 3HEIA 3NV1A 3LA7A 4LHSA 5CZKA 3PVBB 2RJLA 3DPRB 1UKGA 4X8TL 1RUC2 1V6JA 2DU1A 3ACGA 3LC3B 4MV2A 5F5AA 5JR7B 5LBEA 4XQ4A 1C28A 3RZKA 4NWWA 1PMHX 2J1SA 1MQ5L 1VBD2 4NHMA 1IS4A 3K9XA 3ROUA 4NIHA 1MQTA 4OHWA 3LAGA 3ACFA 5ANNA 2GZWA 3UNPA 1W05A 2R30A 3AP5A 5LASA 2WNOA 4XJWA 4NIDA 2Q1MA 1PNGA 3VBOA 1PGW2 1OI6A 3WNPA 1YIPA 4EQVA 4JZDL 1FOD2 5ABJB 1W28A 4RR3C 2JG8A 2XWBB 4QPGB 1ULGA 4C8DA 1PMIA 2HKXA 3HD8B 4CCCA 3ZYPA 1QQP1 3ETPA 2RA0L 3PDQA 2CL2A 5A7WA 1JTZX 4D0FA 5T5OA 1GWMA 2LALA 2WNVC 4BDVB 3VBHC 2LS6A 1YFUA 1GK5A 2XKOA 4QQPA 3LTFB 3E97A 2BERA 4KI5M 5E89A 3MPBA 5FKCA 1MPXA 3AC0A 1W9SA 1HXS3 2EIBA 2VC9A 1HXS2 2PLV2 2CJIB 4YG0A 2EXHA 5LA2A 5LBBA 1PGEA 1WD3A 2A3WA 2A6ZA 1IQFL 4W6YA 3ON7A 4XUNA 4GWNA 2HWC3 1PO22 3K46A 2BOJA 2JDMA 1V9U1 4LLOA 2VECA 3O1MA 4Y1ZA 1HT5A 1O4TA 2JKXA 4MHRA 4EYUA 2G19A 4LKDA 2R041 3IZOA 3N8VA 4YFZA 3OBTA 4KBZA 3CZUA 1JUHA 1W6QB 3OYWB 3B93A 4CA9A 4ZAEB 2WNUA 1AYM1 2Y0OA 5FY7A 5J7MA 4CP2A 2NPRA 2F17A 4ZU7A 3SOBB 3AXEA 4LBQD 1VBA2 4XJ8A 4ASMB 2Q5TA 2Y6FA 2VZRA 3LEGA 3HVDA 4M4PA 3OG2A 3RZJA 4OCTA 1M1XB 1W6OB 1GU3A 5FXXA 4KWLA 2GH8A 2Y38A 2JD4A 4SBVA 2P28B 2A70A 2QJVA 5LA1A 4FXGB 3RDIA 5C70A 1D4M3 2WLPA 3SOVA 3PUIA 1GKBA 3ZYBA 4RS5C 2W87A 3H8RA 1GQHA 4JZEL 4Y79B 2P3UA 3KK6A 5COXA 1ZZBA 2W2IA 3IDAA 3VDCA 1WBLA 2IXKA 1PZ8A 5L36A 1JZ4A 4YZ2A 2BYVE 2G4IA 1QJU2 3A0KA 3FHAA 3KMHA 3TB0A 3UKTA 1H2KA 1W2NA 1APOA 1HV1A 3GCXE 2V73A 2HWC2 3ZYGA 3N36A 1CN1A 4FPKA 4XE9A 5FYUA 4ARXA 1YQ2A 4CUBA 4XTPA 1Z6EL 2R062 4OI4A 2MHPA 4RFT0 1YUKB 4LE3A 1Q8SA 4L0PA 3POWA 1AHSA 4AL9A 4HKOA 1TQ5A 3AM2A 4NMIA 3TEZA 5BYNA 2F4LA 3N35A 4QD2A 1V1HA 3KL6B 4M4RA 3GCWA 3MLKA 3AP9A 3APBA 3A7QA 1ZREA 1OT5A 2HYXA 1XNCA 2D3RA 3VBUB 1GZ9A 3HS5A 1FV3A 2P4EA 1UAIA 1ASJ3 3NNMA 5L2YL 3ATGA 4RS0A 3NNFA 1A8MA 2WNVB 5FK7A 3VZNA 4CDUA 5CFDB 1HQLA 1OVPA 5FZIA 4E27A 1UY4A 1YQ6A 3KM5A 5L9RA 3U7UG 4ATEA 1T2XA 5CA6A 3TNPB 2UY9A 3ZXKA 3IMNA 4C90A 1LEDA 3OB8A 2KV4A 4TSVA 1O5LA 2KXLA 4AZZA 3OLUA 1K3IA 4D3WA 5A6QA 4AVTA 4CU9A 5FZDA 5F9TA 1EV12 4H14A 2A6WA 4RD7A 2VTXA 2WFF3 1JUIA 4W50A 3T4VA 2BP6A 5I0SA 3LZZA 3I2OA 1Y7BA 3B3QE 3BU0A 1C8M3 3CHXA 1UZKA 5BUVA 1W6MB 5FWJA 3PU3A 3QBQA 4XQDA 3ZN6B 1FJSL 1XXNA 4K40A 3VBUA 3DV8A 2VM9A 1U67A 1W03A 5K0UB 1SQ4A 2PAKA 1RUG2 1V70A 4EWAA 4MVTA 4P9JA 4HT1T 4A6SA 4YG3A 4Y24A 4DUXA 1GZCA 4OHZA 1O8PA 4CCJA 4N43A 5EGMB 1KITA 5LEKA 1W8TA 1GLHA 1CCVA 1MS8A 5FFOC 3BPZA 1UZYA 1XE8A 1GZWA 1WW5A 2WZEA 1SLBA 2TGFA 1G7YA 2RG4A 4UFHA 1Q4GA 2R042 1G1TA 3ZFGA 5FMOS 2P6CA 1YIFA 1FFMA 4XF3A 3LQCA 3MIEA 2AEYA 4LNVA 2Z2SB 4Y5Z0 4YNIA 3JBG3 1JW6A 1CX4A 2OQ7A 3HMYA 5FXZA 1R1A1 1AR72 3IIIA 1DU3D 1YUDA 1IHMA 4HK9A 1K45A 4NRMA 3J8F1 3NNGA 4RN5A 4CDXC 4URAA 4CU6A 1BJQA 2VZ1A 4UI9L 5CISA 1XNTA 1AX0A 4IW3A 2PAEA 1XJAA 2DF7A 5DAPA 3SKVA 1STMA 2VBBA 2XHNA 5EFUA 1OB1C 4NGAL 4XF4A 4WM7B 2FCTA 4CDQB 1UOFA 5DUUA 1C5MF 2QDNA 3VLBB 4COUA 4LO5B 4DEQA 3T09A 3U10A 4AI1A 1V6KA 3CQOA 4NR1A 1FMD1 2VMEA 4LHKA 3TEWA 1U12A 3KT4A 4QX1A 5F3IA 1G2MB 3ZSLA 3A21A 2XJVA 1ZZ6A 3AKSA 1UZJA 1N3PA 3KQBL 1H30A 1NYWA 4P14A 2P3YA 1P9JA 5JDBA 5H9QA 5JBCE 3HIFA 5DZGA 1ZM1A 1RUJ2 4UBGA 5LY2A 3VKFC 4IV1A 2HWE1 3RZGA 2BMGA 3O1VA 3ELAL 4P9YA 4AE2A 5ACA3 4XXPA 5L73A 5FLHA 1EAH3 5JPNB 2WKKA 3NVCA 3K75B 4I01A 3WCSA 3ZO0B 1L5GB 2K0GA 2Z69A 1AR73 1S0BA 1NQDA 2BQ6A 1AR92 5FDQA 1DGWX 1IJQA 1UY1A 1X9PA 2JDUA 2ZHMA 5IVBA 2R7EB 4ZXEA 3S6PA 4FPYA 4FM5A 5A6ZA 4XFBA 2IVIB 2A6VA 3B9IA 4XBLA 1NCQC 2IZWA 1AXYA 1CQEA 3VBRC 2BOHA 4XABA 1AR61 4JC1A 5DG2A 1K5MC 2PQQA 4QXBA 1CZTA 1OFNA 4RQPB 5EJZB 3U75A 4JGZC 4GWIA 1ZBE2 4LIUA 4RHV2 1R083 5HV0A 2WO7A 4E4HA 5C71A 3LWCA 2YMZA 2FZ2A 3LB9A 4XBQA 1H0BA 4GB31 1HX6A 1UMIA 3OY8B 1A3KA
chains in the Genus database with same CATH topology
1RUH3 3BIWE 2D1JB 2Y5GL 2KM2A 3LSDA 3MEPA 3SCFA 1KIGL 4G3YC 2ZAAA 1W6QA 3OYWA 1LHWA 2WS91 1DYKA 4FVVA 4TZDA 1A3PA 4YZ3A 3DF0A 3TRSB 1QNWA 5KBFA 1PK6B 1DF0A 2F4PA 1UIKA 2TBVA 4P9GA 1CR7A 5F5QA 1WHEA 3UKNA 2RMU2 2ZCWA 1ZBE3 4C0HA 4JQRA 4YW4A 2XUMA 2DVAA 3NTGA 1X8EA 2NN8A 1D4M2 2Y82B 2Y81B 1BKZA 1R091 3CJIA 3C2UA 1DGRA 2F6BA 2OA2A 3RSJA 1WU1B 2VWMK 2VVEA 1ULEA 3CJIC 2DCTA 2BPA2 1OA3A 3BOPA 3WDUA 1PVC1 1U5IA 4UXAA 2PUQL 4P9IA 3IKWA 3D0SA 2ZHNA 4JGZB 2ZGMA 3NAPB 1EV11 3VBHA 4G1MB 2B46X 4WM8B 4P9LA 4AEMA 1SFYA 3TH3L 1RUG3 2YROA 3IDEA 3ILNA 2QCSB 2UY8A 3MFCA 4M3CE 4HN1A 3M70A 1UCXA 2BW8A 1WD4A 2BWAA 2CAVA 1ENXA 2R6QA 4NO4A 4HBNA 3NV3A 3DGTA 1SDWA 3WDWA 3H50A 1ZRCA 5K0HB 2VH0B 4B8EA 4G9SB 3VUOA 2V5YA 3LN1A 1N3OA 2CYFA 4OVEA 3HR9A 3PTYA 4OFGA 1MZ5A 3B00A 1XE7A 2LTNA 1UPIA 4S2DA 2IXLA 3HWJA 2X5IB 2VU9A 4W6WA 1QGLA 3J26N 1DIYA 2KL7A 3LTGD 1RMU3 1CAXB 2V09A 5IK4A 2HWF1 2OW4A 2VOVA 5JB8E 2NP0A 1GNHA 1YXWA 2UWLB 4B7KA 1YRZA 2YGQA 3URFA 3LGRA 4J6GA 1HV0A 5I0UA 5JBBE 4L92A 4IEZA 3NV2A 4JAAA 4COYA 1RUI2 2EXKA 1O3RA 3B01A 2BVVA 3ZSMA 3N8YA 1QJY3 3FMGA 3ZN5A 4LHLA 1RVF1 2MEV1 4ISIL 2R071 1SFNA 2RM21 1VBA1 1AL23 4LO7A 2GNTA 2VG9A 3S7IA 3ZMNA 3I2DA 1VP6A 2WPLE 2J95B 2ZX1A 4RGGA 5DZFA 4K1YA 5CADA 5ABJB 1HRFA 4Z82A 4LO4B 2ETEA 2JE7A 4PIZA 1JL9A 4LA2A 2QNKA 3WCRA 2RS11 3MLJA 3ZSJA 4CEYC 3VZJA 1WGPA 3V0BA 2RNLA 1B9WA 1XYOA 4HVQA 4D7TA 3U11A 1PK6C 2CY6A 1CONA 2JICA 1HXS1 4XF9A 1S0GA 2ET7A 1E57A 4KL1A 3RYKA 1UZZA 1IQML 3MDLA 2PHFA 4LUMA 4W6XA 5FDBA 3VKLA 4MMZB 1SZBA 2P93L 3CFWA 1G1QA 1KLIL 1OLQA 1OMIA 2ZA9A 3TOJA 1GQGA 3S0MA 2ZX4A 2IXHA 2BOXA 4V1PA 1B09A 2I2SA 2DCZA 1V00A 5JPMB 3RPQA 3LA3A 5J96B 2H6BA 2WNUB 4IEOA <