1YO8A

Structure of the c-terminal domain of human thrombospondin-2
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
621
structure length
621
Chain Sequence
DGCLSNPCFPGAQCSSFPDGSWSCGFCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thrombospondin-2
publication title Structure of the calcium-rich signature domain of human thrombospondin-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 165
structure length 621
sequence length 621
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02412 TSP_3 Thrombospondin type 3 repeat
A PF05735 TSP_C Thrombospondin C-terminal region
A PF07645 EGF_CA Calcium-binding EGF domain
A PF12947 EGF_3 EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1yo8A03
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yo8A05
1QGLA 1OQ1A 5CKNA 1UZPA 4LBQB 4K20A 1IQHL 5GM0A 1LOAA 3IKWA 1G1QA 3LC5B 1HT8A 4YT6L 1QOTA 2YROA 1N3QA 4DPNA 2VWNL 1V6JA 1W6PA 5COXA 1W6PB 1HLCA 2JECA 1ENQA 2P26A 2GNDA 1YUKB 1OFSA 2YV8A 3B9CA 3DEMA 2Z42A 3KCGL 3AFKA 4NGAL 3N8VA 1EMNA 4RRZA 2Y5FL 1ZM1A 3NWKA 3U73A 2JD4A 2XB6C 1DQ6A 1KDMA 3ZYIB 3NV1A 1DGLA 1FFMA 2RNLA 1NFUB 1MS4A 3USUA 2BZ6L 3WDWA 1ZAQA 3HS7A 1IQNL 1CX2A 1KITA 4CUDA 1LEDA 4DFSA 1KQRA 5CKQA 1FAYA 2A6YA 3V0BA 5JOWA 1QDCA 4FQ4A 4YW5A 1NT0A 1LHOA 5JOZA 1UN1A 1ULEA 3H5CB 1AXYA 4BOWA 3SW2A 3SOVA 2R1DA 1MS3A 2D6OX 5I46L 1AZDA 3KQBL 3HPTA 3HO3A 2P3TA 1AXZA 2A71A 1SLAA 3ASIA 4D0FA 4DRRA 1GLHA 3FUQA 3WUCA 3RQ0A 3V0AA 4Z6AL 4JZFL 3AK0A 3PJQA 1J9CL 2PHXA 2ZA9A 4OTYA 3WCRA 1MACA 2GN7A 2ZGRA 3ZSJA 1GNZA 1MZ5A 3IMNA 2Y5GL 3ZXLA 3FLTA 2Y38A 2AYLA 1ULDA 2ZGTA 2DTWA 1S0CA 3A0NA 2Y80B 1KLOA 3VKNA 4ITCA 2NMOA 1F0SB 4Y76B 3FCSB 2PUQL 3M3OA 2BOXA 4FPLA 1GZ9A 5KXEA 4FP2A 2P3FL 3AP5A 2A3YA 4K1YA 3GISX 3TB0A 2YGPA 2J2UB 4Y6DB 4M00A 3LCPA 5CISA 3W59A 1KSNB 1A3PA 3MW3A 2RA0L 1LESA 4YT7L 4Q8LA 1CPNA 3RS6A 3BIWE 3O0WA 2WPJE 2DURA 3GALA 4Y22A 3VKLA 4GXLA 3TGFA 4RRXA 1CCVA 3NT1A 3JUUA 5L73A 2ZGPA 3N7MA 4Q1RA 1F7EA 4YZ5A 1NZIA 3OLUA 3AYEA 1LEMA 2D6PA 1JYIA 4X8TL 3O0VA 2WT2A 2E51A 2BOKL 1UKGA 5KN5C 2DVDA 4ISRA 4XLWA 1IJQA 1AXKA 3WNXA 1DHKB 1ZA4A 2BMGA 2WJSA 5JDBA 1A3KA 2TEPA 3R4UA 2A6ZA 2RHPA 1F5FA 3WDYA 5JOYA 3EGFA 3CA7A 4FOVA 4RA0A 4YM1A 1UZJA 3CFWA 2ZMLA 3ATGA 2GMMA 4MMYB 1VLNA 4FPCA 3O5SA 4GALA 1RFNB 3FFZA 2J4IB 4XDQA 5LK5A 4CTEA 1G1SA 1APOA 1URKA 4GA9A 2P95L 2WPKE 1N1TA 1LU1A 1YGCL 5E8DA 1ADXA 1DZQA 1LODA 2W2QE 1IKPA 4BTIA 2J95B 1DYPA 1DQBA 1VAVA 1ONAA 2D3PA 3POSA 1SLBA 2V5YA 4O1ZA 2ERFA 4Q27A 3V64C 1F7MA 2W2OE 4BTTA 4ISHL 1WCSA 3TK6B 4XTPA 1G9CA 1DIYA 2VWLL 2P34A 1GBGA 3Q3KB 3N8WA 2DVBA 3N8WB 1XKAL 2W52A 1LMJA 1YIFA 4SLIA 2ES3A 2D1JB 5KXBA 1C1LA 1GZWB 1SLTA 1SLIA 3RRDA 2XBWL 4XOGA 2EXIA 1D0HA 2Q5TA 5DZEA 2ZGOA 2GNMA 4BDWA 1SZBA 3AX4A 1Q8QA 2A3XA 2Q1JB 4YG3A 2D6NA 4U2AA 5CB7A 1C5MF 1KJLA 1PFXL 2GNBA 2EF6A 4H55A 4PQ9A 4XJ9A 2SBAA 5T50A 1XKBA 2OUHA 4JZEL 1LTEA 1WW6A 2WKKA 1F0RB 2BQ7A 3CENL 3L2YA 3V64A 2ENRA 4FOQA 1G1TA 1QNYA 1PXXA 4XBMA 1WBLA 2WYJB 2W39A 1HAFA 2VH6B 3OYWA 3OYWB 2BO2A 2VH0B 3N7JA 3TAYA 1EPWA 4XXAA 5DZGA 4PCRA 1R1ZA 4YZ4A 2EIGA 4R9AA 4XILA 2E7QA 1S0DA 2W2ME 4BMEA 3TH3L 3B00A 3TZIA 5SV8A 6COXA 3U7UG 3OY8A 1FYUA 3OY8B 1MS9A 1S1AA 4Y1ZA 1TEIA 1DIWA 1G2MB 4YLZA 1RINA 2KM2A 1K36A 5GJ6A 4RL7A 4FPHA 4YG6A 4XJ8A 3ILNA 1V6OA 5IKRA 1V6MA 4YFZA 3N8XA 4YZ3A 1DBNA 2FMDA 3F1SB 2NMNA 1GNHA 4Y7BB 2UWCA 3HR9A 2E7TA 5GZGA 1WU1B 2P3FN 4DRVA 1LOBA 1SBEA 3CNAA 4JCKA 1DQ0A 2MGPA 1LGNA 1N47A 1S0FA 3WLUA 3M3QA 3IPVA 2NYYA 5E89A 4ZAEB 1LHVA 2D6MA 1IQIL 4UW6A 4Y7AB 5GLTA 1C57A 3SOBB 4C1XA 1V3XB 1G2LB 4UW4A 4BMBA 3WDVA 4GWNA 2R0FA 1C4RA 3ZYGA 2A7AA 3AXDA 2PELA 1DFQA 2AGSA 2P28B 4BXSA 1DQ4A 1LGCA 1S0JA 1LPZA 1HDKA 2EI6B 2DVAA 2JKBA 5JOXA 4XBNA 1JW6A 3MQEA 5CKMA 1HRFA 5T55A 2XBVL 4YZ1A 4YGDA 4P14A 5JBCE 4FM5A 4NG9L 3GCXE 3LAQA 1MVEA 2WPLE 5H9RA 2YGOA 5DXDA 1KIGL 5H9PA 2DVFA 3KQRA 2M74A 1IQGL 3WHTA 3N7KA 2OUJA 5GLUA 2W86A 4BDXA 1OKQA 1MS8A 2OW4A 4FPYA 3HO4A 5F5QA 2VVCK 1HQLA 1CR7A 4YG0A 2W2PE 5T5LA 2VJ3A 3INAA 1NLSA 2LTNA 1CESA 4Y26A 2EI7B 4M3CE 3HMYA 3IJEB 2GDFA 5IK5A 2VH9A 1BYHA 3TK5B 1LOFC 2D7FA 1YO8A 4YW4A 1M1XB 2D43A 5F19A 4R9BA 1ULCA 2YY1A 1G9BA 2EI8B 1KLJL 1BF9A 4TYSA 5FDQA 2D3RA 3N35A 5JVVA 3RSJA 3USUB 2EAKA 2ARBA 1RITA 5JVZA 1EBVA 4IQPA 3ELAL 2MGRA 3RR3A 3WG4A 5IK8A 4ATEA 5CNAA 1TLEA 1QDOA 4X8VL 4AVTA 2EXJA 5GZDA 3V0BB 1HZ8A 1EPGA 3ZXEA 4AWDA 4Y1VA 1MR5A 2G00L 1LPGA 2WG3C 4Q2FA 3OBTA 4CZSA 2W26B 4F83A 2ZGUA 4E1GA 1UZZA 2PHTA 2ZMNA 3NJPC 5CAZA 2ZGLA 1AF9A 4FP3A 1L3YA 5DUUA 4AGRA 4JZDL 1IQML 4LMFA 3BT1A 4XJZA 2P3IA 4G1MB 3T2TA 1LOFA 1XQNA 1LHNA 1LU2A 3V0AB 5IKTA 1Q56A 4C16A 2B7YA 4YGEA 3VKOA 3H0OA 4ASMB 2I9BA 1GKBA 2SLIA 1G9DA 4ATFA 4YGCA 4X8UL 2G4IA 4PBOA 5IK4A 1FF7A 3AYDA 1ATAA 4R9DA 5EWSA 1EQHA 4AVSA 1DQ2A 1WLWA 1GYKA 2AENA 2P3KA 1LQDA 3NTBA 2GN3A 1JXNA 2ZABA 1U67A 1HAEA 1UAIA 2WFTA 1HQWA 4Y71B 2C9AA 1NFYB 2ZHLA 4CUFA 3N3HA 5T5JA 4D0EA 2I2SA 3PMEA 4GKYA 1J1TA 2H0BA 4UW3A 2P16L 4K21A 2DUOA 1W7XL 3AXEA 5GLWA 1JL9A 5F1AA 3CS7L 4Y22B 4TGFA 2DWRA 1ENSA 2DDUA 4Y79B 1IQFL 2ZHKA 2CY6A 1YYNA 3WDXA 1NQLB 2W68A 4Z0LA 2YXSA 3M3CA 4ZKTB 1N7DA 3W58A 1N3PA 4Z0KB 2ZKNA 4FPEA 5GLZA 3MW2A 3AZXA 2YZ4A 2Y7ZB 3WG1A 1Z6EL 4AVVA 1MZ6A 2UWLB 3SLIA 2JKHL 2XC4L 2WPIE 4FVVA 1YRZA 1JBCA 1Z0HA 3SH4A 1FNYA 2WNEA 1O5DL 5DUXA 4CRQA 3RG0A 4RS0A 2Y81B 2W3KB 4YM2A 3B69A 4YZ2A 4ZHAB 3GCWE 3AJYA 3VV1A 3NV3A 2BQ6A 3RMYA 1LECA 1Q4GA 3HO5A 5FRAA 1CJPA 1CN1A 5JVYA 3VKFC 2DUPA 4ZXYL 5GALA 1HREA 2XC5L 4YFWA 5E88A 2A3WA 1N3OA 1WLCA 5EGMB 3AZWA 1WLDA 4YGBA 2OYUP 1W6MA 2ZZJA 1W6MB 2P3JA 1O4YA 4WV8A 5F9TA 5CA6A 3LN0A 2JE7A 3ZSMA 2GNTA 2WLQA 1DQ1A 2A70A 1PTHA 1S0BA 1IS3A 1BZWA 3N8YA 1HX2A 4P9WA 4UW5A 3N8YB 4AYUA 1FSBA 2CJIB 4HL0A 4HANA 1WBFA 1D2SA 3TBDA 3DUIA 2Y82B 1N1SA 4PH9A 1A78A 3QMOA 2DYCA 3BOPA 2CL2A 2A6XA 2WFXB 4LORA 2ARXA 3ZXFA 4YM3A 1UZKA 4ISIL 2D44A 1FJSL 5EYYA 2KV4A 1JYCA 2CWSA 1EPHA 1FV3A 1NPEB 3O12A 2DTYA 3P5BL 4PBPA 2MHPA 1AX0A 4FPFA 4YW2A 5HCBA 1DLLA 2WT0A 2JJ6A 1RIRA 2R1BA 2NN8A 3LSDA 1C1FA 2AYHA 3KL6B 5GZEA 1LJ7A 4FPGA 1B09A 2H9EL 1LGBA 3WDUA 1FX5A 1V00A 1NXD1 3PVEA 1CONA 5JMCA 2PHUA 2P94L 1Y7BA 4FPOB 2BQWA 1MS5A 1B9WA 1W0PA 5K0HB 4M3CA 3MEPA 3QCWA 2D6KA 4M3CB 1GICA 3WZ1A 2PHBB 2A6VA 1CVUA 1SCRA 2W2NE 1WW7A 4Y20A 2FLRL 1N1VA 4Y20B 3LTFB 4U36A 4XZPA 2PHFA 1DDXA 4M01A 4ISQA 4XXPA 2E6VA 5DG2A 3FUOA 1FE2A 1ULGA 5FREA 1IKQA 1JN2P 1IVOC 3SH5A 1H9WA 1W6OA 5IKVA 4BLIA 1HJ7A 1L5GB 1CVNA 2EXHA 3HS5A 5JB8E 1UMZA 3C2UA 2K2TA 3IPVB 1V6IA 2P2KA 1PGEA 1SBDA 1G8WA 1S0IA 1CQEA 5KXDA 3OPZA 5IT6A 3APBA 2ADXA 1TOZA 2EALA 2HYKA 1FAKL 4P9XA 3I4IA 4MMXB 3OLTA 3T1MA 1W0OA 5HCAA 1LULA 4XIKA 3LIWB 1CCFA 2KL7A 1CQ9A 1QOSA 4Y1YA 3N8ZA 4RRYA 3AZZA 4LBKA 1DX5I 1F31A 1MS0A 1LHWA 1AJKA 1LENA 1UZQA 2WQZC 1Z78A 1GANA 1AX2A 1IGZA 3SISA 4Y1UA 4XTMA 2VWOL 4XMIA 3VUOA 1EPJA 1QU0A 3AYAA 2CNAA 3UJQA 1HKDA 1I1EA 2VXRA 3C9AC 3ZYRA 1SLCA 4BTUA 2EXKA 1W6NA 4PF5A 4M3CF 1IQLL 2J34B 1W6NB 2NM1A 2DV9A 4XJUA 1IOXA 1GSLA 1QF3A 2ZACA 1W6QA 4RRWA 1TPGA 2WG4B 1W6QB 3MPPG 4FOYA 3POYA 1QMJA 4R9CA 1F9KA 2ZHNA 5IUQA 3NV2A 3JU9A 4LBQA 3ZVXA 3OJBA 2NP0A 2FZZL 1IQEL 3POWA 4M10A 4LBLA 4DQAA 1BXHA 4NOTA 3QLQA 5HCFA 4LBOA 4BXWA 2GMPA 5H9QA 1P9JA 3IITB 4AQTA 2JDZA 1LPKA 3UJOA 2D6LX 4FPKA 3I8TA 3ZYPA 3AP4A 3WDTA 4X8SL 1HCGB 1IQKL 1V6NA 4CUEA 3A4UA 1IOEL 4CSYA 2NPRA 1FATA 1IQJL 2A6WA 2Y7XB 1SBFA 1X50A 3WCSA 1YUGA 4Q1PA 4XJAA 1Q8SA 2LALA 5KIRA 1K37A 1NFWB 2CYFA 4XIOA 1WD3A 3ZSKA 4JC1A 1AJOA 1BJQA 3HS6A 1IS6A 3LC3B 4D69A 2ZGMA 4RUTA 2ZBJA 2P93L 4XHXA 2VVVL 4Q8KA 5BYNA 2WPME 1BQPA 2TGFA 2XG3A 2XBYL 2JE9A 3PVNA 3FLPA 1S0EA 1UL9A 3QH0A 1QKQA 1P0SL 2P3UA 3FLRA 4XBLA 2VVUL 1VALA 1WD4A 3KQEL 3B01A 1MS1A 1JUIA 1ULFA 2FLGA 3K9XA 2PHWA 3MDLA 5L30L 3WG2A 1AX1A 4ZXKA 3Q9OA 4M11A 1EPIA 4ZH8B 1YI7A 1FAXL 3ZPYA 3ILRA 1KDKA 2PHRA 2E53A 2F9BL 1IGXA 2BOUA 4Q26A 3FFGL 2W08A 4YZUB 1XDTR 1SCSA 2BQPA 3KQCL 3ZXJA 3IN9A 2DU1A 3BODA 3M37L 5JLVA 3NV4A 1SLLA 2R16A 1LOEA 1LHUA 5EYXA 3M36L 3U4XA 1VIWB 5JW1A 2ZGNA 2NZ9A 4K1ZA 2J38B 4GKXA 4LBNA 3SNMA 1JOJA 1SACA 4WVVA 1DQ5A 3KRKA 1KRIA 1NFXB 4BQ1A 1V6LA 1U8CB 1WHEA 4LBQD 1XFEA 2ZGQA 4MYEA 4ZXXL 1AUTL 3UL2A 1IP0A 3LTGD 2AREA 4XYXA 5T5OA 3AZVA 3WG3A 2UWAA 2WPHE 1MVQA 5GZFA 1QNWA 4OZXA 3D6EA 3N7LA 4AGGA 4NA9L 3KK6A 1CPMA 2J94B 1N1IA 2AH2A 4I30A 1PZ7A 1FNZA 4JYUL 1JV2B 4BLJA 5L2YL 2VWMK 2WYGB 1APNA 4XL1A 1QOOA 3OGGA 4FOWA 4FPJA 1MQ6L 2A75A 2VU9A 1S0GA 1IS4A 3WHUA 1CVWL 1URXA 2UWPB 2ZHMA 3WUDA 2XC0L 2PR3B 3M2MA 2AR6A 5T52A 2DUQA 2OYEP 1QFKL 1Q8OA 4C1WA 3AZYA 3AYCA 2UWOB 1DYKA 3ZXKA 1UX6A 2ZAAA 2VY0A 4Y24A 3BPSE 1APQA 4TZDA 2KB9A 3D4KA 5KXCA 1GV9A 1A8DA 3M3EA 3AP7A 3KM5A 3WVJA 1YUFA 3SH3A 1Z6CA 2UURA 2FLBL 1W8BL 4NO4A 4JYVL 1WHFA 2ZGSA 2VW1A 1I3HA 1PRHA 3KQDL 4W65A 3V65A 3V65B 4BPZA 1Q8PA 1GK5A 1GZWA 1H30A 1WW5A 1EZQB 3BTAA 3VKMA 1WW4A 5IK7A 1UPSA 1JHNA 4A7IA 1IOAA 3DGTA 4Y1XA 3WOGA 4LBJA 4YW1A 3Q7DA 3LSEA 1ENRA 3F6UL 2OVUA 5E8AA 2FD6A 4DS0A 1EMOA 5DZFA 5L2ZL 4WZFA 2B7DL 2DVGA 3ZYJB 3O0XA 2CWMA 5T5PA 2R0HA 2R49A 3R05A 4GWMA 3ZSLA 3AP9A 3ENRA 4L8QA 2WT1A 1JBUL 1LOCA 4P9YA 5IKQA 2UU8A 1X7AL 1V6KA 3PGHA 1ATDA 2AUYA 1N1YA 3ENSA 2CTVA 4KBBA 3SOQA 1DVAL 4COXA 2YMZA 3AJZA 4D90A 2V73A 3RMXA 4XMAA 1Q8VA 2ZGKA 4XBQA 4O02B 4Z8BA 2A5ZA 1VAMA 3N36A 3B3QE 4FQZA 1MQ5L 1COUA 3GNEA 1EAIC 2W3IB 1AVBA 1EGFA 3R4SA 1LOGA 2XBXL 1PZ8A 1UZYA 4LBMA 3T1LA 2DU0A 2I9AA 2GMEA 3A0KA 1W6OB 1G86A 2ZMKA 3UK9A 4XHBA 2GALA 3D5OA 1G9FA 1G1RA 3LN1A 1CIWA 1IS5A 1GZCA 2K2SB 4MMZB 1MOXC 1OB1C 5CBLA 3OBRA 2VW0A 4YM0A 3FBYA 5GZCA 1HT5A 1ATEA 1H9PA 5JBAE 1EQGA 2VW2A 4XJWA 2WSVA 2BOHA 5DUVA 1I0UA 3IM0A 1LCLA 3AP6A 4YW3A 4OTJA 3PVOA 1G9AA 2D3SA 5H9SA 5T54A 5AVAA 2VUAA 1U0AA 1WUVA 5EXOA 3WV6A 4AGVA 2UWBA 1SFYA 3M1HA 2Y5HL 5GLVA 4XE9A 4BM8A 1KLIL 1CEJA 5DG1A 3SITA 1FV2A 1BKZA 2P37A 1YXWA 1KJRA 5DUWA 1PZ9A 3HN1A 2C5DA 1G7YA 4WVWA 3NTGA 5JBBE 2WSUA 2FHRA 4JRAA 2GD4A 3MW4A 1ATBA 5JB9E 3BT2A 3ILFA 1O4ZA
chains in the Genus database with same CATH superfamily
1QGLA 1UY0A 1ND3A 2VULA 4CEYB 2IXCA 1UY4A 1OA3A 1ND3B 5CKNA 1OQ1A 1UZPA 1W0NA 5LRRA 4XURA 2VAUA 4LBQB 4K20A 1IQHL 5GM0A 1LOAA 3IKWA 5IVCA 2XVKA 4BHPA 4ZONA 1J59A 1G1QA 3LC5B 2VZPA 3H50A 1HT8A 4NHMA 4YT6L 1HRV3 1WZXA 1WMFA 4AXOA 1QOTA 2YROA 3JB4C 4CP9B 1N3QA 4IERA 4S2FA 3RPQA 3ZN4A 2Y6HA 4DOUA 4DPNA 5C3PA 2VWNL 1V6JA 1W6PA 1RXFA 3F95A 3T09A 1XNAA 5COXA 1W6PB 2LS6A 2MHFA 1HLCA 1NY72 5FKCA 1QHDA 1L7QA 2JECA 2WQ8A 1BK1A 1Y9MA 4QQHA 5AVPA 1ENQA 1UY1A 1OQDA 1YUDA 2P26A 2GNDA 2XXZA 1OFNA 4CDUC 2XL7A 1YUKB 1OFSA 4AI8A 5FZ9A 1TMF3 4BXFA 2YV8A 4CU8A 5FMBA 4A94C 3B9CA 4Q0QA 4C0HA 3PIGA 3DEMA 2HBUA 2Z42A 1D4M1 4Y4RA 3WQBA 3KCGL 3AFKA 4NGAL 4Y5SA 4A7YA 5KHGA 1HB3A 3N8VA 1UOJA 4CCNA 2ORXA 1EMNA 4RRZA 1YQ8A 4IEPA 4EJRA 4AEDA 2YGQA 2Y5FL 1JU3A 1ZM1A 2F6BA 3NWKA 3U73A 4AEDB 1HN1A 2JD4A 5EPAA 1TZOA 2XB6C 3Q8BA 1DQ6A 4FI9A 4QX5A 1KDMA 4NVPA 3ZYIB 2FDJA 3NV1A 4EV0A 1DGLA 1POV1 1OURA 1IGOA 1FFMA 3BALA 1VPHA 4WM8B 4AFAA 4S2GA 2RNLA 1JHJA 1AYN3 3KD4A 2VVEA 2P6HA 1W2UA 5EP9A 5FJKA 4WBBA 4CCKA 1NFUB 3D0SA 1MS4A 4L92A 1RUD3 1UOFA 3NW4A 1YFWA 2BZ6L 3IB3A 1BEV3 5FPLA 5IW0A 5JR7B 3S30A 3USUA 4RFRB 1HRV2 3WDWA 1ZAQA 5DAWA 4EZHA 5JXIA 1O91A 2YGLA 3HS7A 1IG0A 4WVMA 2BSFA 1IQNL 3ELNA 5C9AA 1CX2A 4WVMB 3VZKA 4QPIB 4JGYA 1PNFA 2VR4A 3J9SA 3LD8A 1KITA 1YFYA 4L99A 4CUDA 1LEDA 1QJY1 4JGYB 4DFSA 1KQRA 5CKQA 5LCWL 4XAEA 1FAYA 4QT6A 4LHSA 2A6YA 2VZTA 4AAXA 1TMF2 3V0BA 5JOWA 5A33A 5CAZA 1VMHA 1QDCA 3H7YA 4FQ4A 4YW5A 5A33B 3VBOB 1NT0A 4QQPA 1LHOA 4X8PA 5JOZA 1VBD1 1UN1A 5A1AA 2ZEYA 2Q4SA 1O4TA 1ULEA 1POV0 3ES4A 3H5CB 1AXYA 4BOWA 4E4DX 5CFCC 3ACGA 3KCXA 1JYNA 2BT8A 3SW2A 3SOVA 2R1DA 1MS3A 3F2ZA 2D6OX 3SC7X 5I46L 1AZDA 4OMDA 3KQBL 3HPTA 5F1RA 3HO3A 1GWMA 2KR2A 2P3TA 5FMCA 1LMMA 4BCUA 2ZEXA 4Q29A 1AXZA 3ECQA 5K0UC 2A71A 1SLAA 3ASIA 2G9GA 2QVSB 3MPBA 2D40A 4D0FA 1GOGA 3Q8CA 1AYN2 2DFBA 2HEWF 2W9XA 5A32A 1UNBA 4IV1C 3POEA 4DXTA 4ES9A 5A32B 4DRRA 4PDWA 1RUD2 1T2XA 3JBG3 1GLHA 5FP9A 3PU8A 3FUQA 3WF1A 5A3UA 3BPSA 1BEV2 3WUCA 4CDUA 1REDA 5A7PA 2Q8OA 3J7HA 4QB1A 4CDQC 4CDUB 1ST8A 4IE6A 3RQ0A 4KBZA 2F4PA 4Z6AL 2JDKA 2RR11 4L11A 5CVRA 4E4ZA 4JZFL 3V0AA 1NOVA 4QPGC 5FYBA 5F7UA 4IEUA 3K3OA 3AK0A 4JHZA 4OULA 3PJQA 1J9CL 2PHXA 5DAVA 2ZA9A 4OTYA 3WCRA 4D3WA 1MACA 3SKVA 1L3JA 1HRV1 1WCKA 2GN7A 2IC1A 2ZGRA 3BKZA 4FTSA 5F8PA 2WZ8A 3ZSJA 3WW1A 1H8TC 1GNZA 1MZ5A 2NPIA 3IMNA 2Y5GL 3S7IA 2Q0AA 3RI9A 3CIHA 4ZZ5A 3NJYA 2BU9A 3OEBA 3HJRA 4JZRA 3ZXLA 3FLTA 4Z2WA 2Y38A 3FJSA 2AYLA 2QDRA 2DCKA 3A23A 1ULDA 1Y3TA 3RNSA 3RYPA 5FPXA 2ZGTA 5L36A 1H1AA 1S0CA 2DTWA 3RJRA 4JKKA 4D8MA 4E4SA 3A0NA 3LIGA 1EUTA 1TMF1 3IAQA 2Y80B 3EQEA 5FZ8A 4D6RA 1KLOA 2C9KA 3VKNA 5IVJA 1ZVFA 1JOPA 4UT5A 3SEEA 1W3XA 4JQRA 2P1BA 3CZJA 4IEWA 4ITCA 1GP4A 2NMOA 2HBTA 5IVYA 3IMMA 1F0SB 3WNLA 5C7GA 3CO2A 1VBB3 4Y76B 3AFGA 3FCSB 1UYXA 4YVWA 3ZOIA 1R083 3UNPA 2PUQL 3H8OA 3M3OA 3S7EA 1CAUB 5FZ3A 2BOXA 4HSJA 4FPLA 1XB9A 1OLQA 1GZ9A 5FYIA 3JBG2 5KXEA 4FP2A 2QKDA 1ENXA 4N9IA 5JSPA 4JDOA 1A6CA 1SMVA 2P3FL 1CAXA 2E31A 2W1SA 3AP5A 2A3YA 4K1YA 3GISX 1BVVA 1D7PM 3WF3A 4LNVA 2YGPA 3TB0A 3ZYFA 2IXLA 2J2UB 4Y6DB 1CZVA 1JUHA 1RUI2 3AL6A 3LCPA 4M00A 4AEJA 4BE3A 4LA2A 3UGGA 1W2NA 5CISA 1ZA7A 2WFF3 5FYMA 3W59A 1KSNB 1A3PA 3AMNA 3DECA 4CP0A 4A42A 3MW3A 2RA0L 1LESA 5CFCB 4YT7L 1H2NA 4QX1A 3U78A 4C91A 3OBAA 4Q8LA 2Q30A 5KHKA 1CPNA 1QY4A 1JU4A 1XPWA 5EFUA 3RS6A 3BIWE 4BU2A 2QCSB 3O0WA 2QQNA 1PK6C 5K0UB 2WPJE 2DURA 3GALA 4N9HA 4Y22A 3VKLA 3QH7A 2Z2SB 4GXLA 3TGFA 1JOBA 1W8ZA 2XJVA 3MV11 2IXHA 3DKQA 4IV1A 3PUHA 4RRXA 1CCVA 3W20A 5HI0A 3NT1A 3JUUA 3VBSA 4IV1B 5L73A 4AG4A 2ZGPA 3N7MA 4Q1RA 1TME3 1XNTA 3K2OA 4CDQA 3GJBA 4BQWA 1F7EA 3AVRA 4YZ5A 1NZIA 5J3UA 1VBB2 4CDQB 4TTGA 1R082 4QPGA 3OLUA 4LOTA 2HWC3 3AYEA 5BNOC 1J3QA 1LEMA 5CADA 4N7UA 2D6PA 1JYIA 3TYJA 4X8TL 3O0VA 2XJRA 3I59B 3WW4A 2IVJA 5FYSA 5JPMB 3C7OA 3DXUA 5F37A 5DPNA 2XOMA 4GU3A 3HQXA 3Q8EA 2WT2A 3SXWA 1H8TB 2E51A 4HK8A 4CCJA 4EWEA 2BOKL 1UKGA 5KN5C 2DVDA 3D82A 3E5QA 4ISRA 4LJHA 1KFXL 2VOXA 4UFJA 4RD7A 5CU1A 2WFF2 4FSJA 3LDKA 4PIXA 4XLWA 1IJQA 1AXKA 3WNXA 1DHKB 1ZA4A 2BMGA 1R64A 3MICA 4GWJA 2WJSA 3H1WA 5JDBA 5LA0A 1A3KA 1RUI1 1PX3A 2IVIB 2MNGA 2A6ZA 2TEPA 2WWUA 3MIBA 3R4UA 4RN5A 2RHPA 4F3JA 1XYNA 2JEMA 1F5FA 4ORFA 3WDYA 4BA6A 4CP2A 1FPN1 5JOYA 3EGFA 3CA7A 2WWJA 1GOHA 4MLOA 4FOVA 4CDXA 4FTEA 4RA0A 4YM1A 3U4SA 1UZJA 3HNYM 2XLFA 3NNLA 1OH4A 1NLRA 1O5LA 1GQPA 1PO21 3CFWA 1C5IA 1XNDA 4XUTA 3ZMOA 2B9VA 2VMIA 2ZMLA 1TME2 2J1SA 1I6XA 3ATGA 4QX2A 2GMMA 3GBFA 5I0RA 3O1VA 4MMYB 1VLNA 2X09A 4FPCA 3O5SA 2QQKA 4IEVA 4GALA 4YSFA 2HWC2 1RFNB 4N90A 4QKBA 2RDNA 1VBA1 3FFZA 2J4IB 2HYXA 2JKXA 2OXBA 3NMBA 4XDQA 4AFCA 1UY3A 5LK5A 2Z69A 4CTEA 1G1SA 1APOA 2IXJA 1URKA 3IT8A 3A21A 3PDQA 1RXGA 3CHXA 3PIJA 4GA9A 2V09A 2P95L 2XDVA 4X6RB 1V9U1 4K9SA 2WPKE 1PK6A 3S6PA 1DF0A 1N1TA 1LU1A 1YGCL 2O0OA 5E8DA 3BOWA 1PK6B 1ADXA 1JS9A 1XE7A 3T08A 1DZQA 2C24A 1LODA 2VQ0A 5ANNA 2W2QE 1IKPA 2X29A 4UFMA 3H9AA 4XCBA 1EAH1 1WMXA 4BTIA 2J95B 4MXVA 3H7JA 3MF9A 1DYPA 1DQBA 1VAVA 2ID4A 3MGUA 2YBPA 3NSTA 4Q4X1 3WT3A 3OPWA 5FO8B 5HPOA 3OPTA 2PMWB 3I49A 1ONAA 2D3PA 1W03A 4AHXA 2WABA 3POSA 1SLBA 2W91A 5FR3A 2BOJA 2V5YA 2CV6A 3HAGA 4CCDA 4O1ZA 2ERFA 4RQPC 4Q27A 5BNOB 3JXSA 3V64C 3CU7A 3K3NA 1QQP1 2XONA 2CAVA 1W05A 4TXWA 3EO6A 3NJZA 5FMOL 1F7MA 2W2OE 4BTTA 2K0GA 1H1MA 5FZIA 4M4RA 4ISHL 2RS31 4N43C 3T0DA 2VOWA 4RGGA 5AC93 1RJ8A 4QX3A 1WCSA 1OHFA 3TK6B 4XTPA 1G9CA 1DIYA 2VWLL 5FY0A 2P34A 3VDBA 4X6QB 2R6QA 2XQXA 1OMIA 5G05L 4V2VA 5DMYA 1GBGA 2OIIA 2ZAHA 3I2HA 4P9IA 5APAA 3Q3KB 3N8WA 5A1FA 5L7OA 2X5IC 2DVBA 3N8WB 4OCTA 3ACHA 2OA2A 1XKAL 2E33A 4A44A 2W52A 1LMJA 4FXKB 3TEZA 1YIFA 2I45A 4SLIA 4OZOA 4BISA 1TE1B 3THTA 3KGLA 1F35A 4D7TA 2ES3A 3E1F1 1HB1A 2D1JB 3GYDA 4J25A 1FT9A 1C1LA 1GZWB 1P8JA 2CDOA 4W50A 5KXBA 1SLTA 3ROUA 3ZN6B 1SLIA 1ZRDA 3RRDA 2XBWL 4XOGA 2EXIA 1D0HA 2CDPA 2Q5TA 3KS7A 5DZEA 4CUAA 2ZGOA 4QU2A 2XVLA 1VRH1 4BQXA 1ULPA 2GNMA 2XLGA 1Y9QA 5FXZA 4BDWA 1SZBA 2Y33A 3AX4A 1Q8QA 2A3XA 2B4KA 2VBBA 2Q1JB 4YG3A 3MO4A 3MUY1 3WP6A 2W0XA 2ZX0A 1UOBA 2ZS6B 4BQ4A 4UAPA 1J58A 3GZEA 2D6NA 4HVOA 4OUMA 4U2AA 5FIXA 4IV3A 3C7HA 2HOXA 1Z7S3 3ZFFC 5JI7A 2JG9C 4RS5B 5CB7A 1C5MF 1KJLA 5HV0A 3ZPOA 1F15A 3HPNA 4PI2A 1PFXL 2EIBA 2GNBA 2EF6A 2WS91 1VMJA 4LPLA 4NHLA 1JZ7A 5K9YA 4H55A 4PQ9A 5J98B 5AFEA 1RUG1 4E2GA 4UFIA 4XJ9A 2SBAA 2WR9A 3C7EA 1XKBA 4GIQA 4LR4A 4XDOA 5T50A 2B8MA 2OUHA 4MGSA 4JZEL 4QX7A 4AI1A 1LTEA 4IGPA 1WW6A 2WKKA 2Z4FA 3N9NA 1X9TA 1F0RB 3IIIA 2VRSA 1PIV1 2BGCA 2OS2A 4COWA 5JCTA 3KV5A 2BQ7A 4YPJA 5LBCA 2XGXA 3CENL 1UY2A 1ZBE3 3L2YA 5BNNC 2BFUL 3NRUA 1YFXA 3ZIXA 4PI0A 3WF4A 3V64A 3PUAA 2BNMA 2ENRA 4RQPB 3HT1A 5FK7A 3U14A 2ZEZA 4FOQA 1G1TA 4WVZA 4NJ4A 1QNYA 5FPBA 1PXXA 4XBMA 1UD1A 1WBLA 2WYJB 2W39A 1HAFA 3AKSA 3I2FA 4JVAA 5FCCA 2XHNA 4XQ4A 1RHI3 5LBEA 2VH6B 3U1XA 5IVBA 3OYWA 1W8WA 2QZ3A 1YQ2A 1HXS3 1QJU3 4CXYA 3OYWB 1QXPA 1RUE3 4N43B 3VHRA 4XW3A 1VAKA 2GU9A 4NUBA 3VHOA 1VBE3 1JTZX 4V2WA 5BV6A 2BO2A 2VH0B 2I07B 3N7JA 1COV2 3TAYA 1IQDC 1EPWA 1Z7S2 4XXAA 5A7WA 5B4XA 4AL9A 2EAAA 4PCRA 5DZGA 5A7WB 2X5IB 1R1ZA 4UXAA 4YZ4A 1QXRA 3V56A 1B35C 1DGWX 4J6GA 3FWEA 5ANQA 1W8OA 1W2OA 5A7OA 1JMUB 4XFIA 2EIGA 4R9AA 4XILA 2DFCA 4ZS3A 2E7QA 3R6SA 1GWKA 1S0DA 1UXXX 3VDDC 4CXXA 3O7OA 2W2ME 4BMEA 3TH3L 3B00A 3TZIA 2RG4A 2JXAA 2J7MA 1UOGA 5SV8A 3LEGA 3VD4A 6COXA 3U7UG 1H2LA 3OY8A 2A1XA 1FYUA 3UKTA 2QQPA 5SV5A 2ORZA 3OY8B 2XJSA 1MS9A 1ASJ3 1S1AA 1ZBE2 2Y60A 4Y1ZA 1TEIA 3VL8A 5CFDC 4MG2A 1DIWA 3GZAA 4LHLA 2R073 1G2MB 1O3RA 2BV4A 2K9ZA 4GJZA 4YLZA 5FO7B 3T0AA 1I5ZA 1RINA 3WNNA 4TN7A 4ZU5A 3ZFFA 1WGPA 1PVC3 4RYDA 2KM2A 1K36A 5D1IA 5GJ6A 1RHI2 4RL7A 2JG9B 4FPHA 4YG6A 1XNBA 1HXS2 4XJ8A 4L0PA 2FQPA 3ILNA 1V6OA 5IKRA 2ADEA 4AQ2A 1V6MA 4YFZA 3N8XA 4YZ3A 4DY5A 3KT1A 1DBNA 3H8XA 2FMDA 5FLJA 3F1SB 2VMGA 1VRBA 1YWKA 3LPGA 4MSVA 2VOKA 4IE7A 2NMNA 4XF4A 1JZ6A 1GNHA 1QXJA 4Y7BB 2UWCA 4LO8A 1D0GA 4Q0SA 3NQHA 3HR9A 2E7TA 1NZCA 1OQEA 1YQCA 5GZGA 1WU1B 2P3FN 3ZXGA 3S6XA 1LOBA 2WNVB 1SBEA 3CNAA 4R4XA 4DRVA 5J1XA 1ALYA 2GC3A 1COV1 2IUWA 3KF5A 4Q4W2 1AR71 4JCKA 1TVGA 3U0ZA 1DQ0A 2MGPA 5FZHA 1LGNA 2VJXA 5BNNB 1N47A 3MLJA 1NYWA 3KHBA 2WLPA 1DGWA 1S0FA 4P9JA 3EJKA 3WLUA 3M3QA 3IPVA 4OHYA 1YIPA 3K51A 1H8VA 4LTAA 3JQXA 3MI8A 2X53S 2NYYA 1GP5A 3GHMA 3GHNA 5E89A 4ZAEB 1LHVA 2D6MA 2JX9A 5LRSA 4RHV2 1GU3A 1ASJ2 3LEKA 3LFIA 1IQIL 2JDAA 4B1LA 2R072 5C3SA 2YFZA 3T2QA 4UW6A 1KFUL 3GF6A 4P5HA 1RGSA 3CEWA 4Y7AB 2ZJCA 5EZWA 5GLTA 2YUEA 3W5MA 1C57A 1OUXA 3FMGA 3RZHA 1UZVA 3SOBB 4C1XA 1D4M3 1PVC2 2JIGA 3U75A 1V3XB 1X8MA 4BZ4A 5D2AA 2BBVA 1ZZ8A 1B35A 3H1YA 1G2LB 4UW4A 1B35B 4BMBA 4NHYA 4X8NA 3WDVA 4EWAA 1YQ6A 4GD4A 1AR83 2JENA 1HW5A 1BVP1 4GWNA 1W04A 3VDDA 2E32A 4CDWC 5I8SA 5FZ4A 5LATA 2R0FA 1C4RA 2VTXJ 3ZYGA 3VDDB 2A7AA 3AXDA 3P6BA 1POV3 2PELA 3FZ3A 3SCHA 1YI9A 1DFQA 4AI2A 4XUOA 4KWJA 2AGSA 2P28B 1U5IA 3PTYA 4BXSA 1DQ4A 1KXGA 4ZZ8A 3H1MA 3RYKA 1LGCA 4KL1A 1S0JA 4P5YA 3J7LA 4XQDA 1W9WA 3PURA 1OH3A 3POFA 1PGW1 3H3LA 3VB9A 5CFDB 1KS4A 1V70A 3IWZA 1RTVA 3OD0A 1LPZA 4XUNA 3VBRC 3B93A 1YQ5A 3ZSEA 1HDKA 2EI6B 1R1A1 2DVAA 2W3JA 1OOPC 2JKBA 2YPDA 4D0QA 1RMU1 4QB6A 5LWBA 1U5ZA 4Q4W1 3KT4A 1UYZA 1QJY3 4XBNA 5JOXA 1JW6A 3UETA 3MQEA 3KHCA 1GMMA 5CKMA 2WN3A 4FAHA 5JSRA 3NO8A 3WNMA 1HRFA 4MADA 5T55A 3OG2A 3I2OA 2UY9A 3ZMNA 4A7KA 3NJVA 4KQ7A 2XBVL 4KNCA 2WINB 4MV2A 3WY6A 3I97A 1LK9A 4RHV1 1PM7A 4YZ1A 2VUJA 4YGDA 4IXLA 5F2SA 1VBD3 1NLQA 4F7ZA 4E2SA 4CCOA 5EQUA 4P14A 5JBCE 3EB7A 4FM5A 4NG9L 1EY2A 3AMHA 4K40A 1W8NA 4RGAA 3UYJA 5C9AC 1AR82 3GCXE 3T30A 2WIIB 3LAQA 1MVEA 2WPLE 4L9BA 1HQNA 1NE4A 5D21A 2YGOA 4NHKA 5FPAA 5H9RA 5DXDA 4LO5B 1KIGL 3RGBA 5H9PA 5L9RA 2FMYA 2DVFA 4IETA 1X8EA 3KQRA 4K3UA 1W9SA 2AACA 3LF7A 4QHBA 3LDBA 2M74A 1IQGL 3DF0A 2V72A 3WHTA 3RJ2X 3N7KA 4DZGA 3BCWA 3U11A 2XMLA 4AHZA 4D6SA 2OUJA 3ZFGC 5GLUA 2W86A 4BDXA 1OKQA 1YC61 2WO7A 2JDHA 2J42A 1MS8A 4A4AA 1E5IA 2OW4A 4XC9A 5FLHA 4LT5A 2RR13 4FPYA 4DNYA 3HO4A 5F5QA 2VVCK 2Z5WA 4QQOA 4QM8A 3WXPA 1HQLA 4DB5A 3OOXA 1QJY2 1CR7A 4AQ6A 4YG0A 4CXWA 1GQHA 3DN7A 3K4AA 4D94A 3C7FA 1JZ3A 2RMU1 2W2PE 5T5LA 4BWOA 3P1IA 5FPUA 1ZZBA 2VJ3A 4XF3A 3INAA 2VBPA 3RFRA 3MIDA 1RUNA 2Y8KA 3KSCA 4CDWA 1UYPA 1NLSA 2Y34A 1RUF1 4W8JA 1KKEA 4LIVA 2LTNA 4UFKA 4PDWC 4CDWB 1CESA 1JZ2A 4Y26A 1VBD2 4MHRA 4Y5Z0 2EI7B 1OT5A 4LEJA 4M3CE 3KT7A 3HMYA 3IJEB 3VD7A 2XWJB 1NUKA 3ZFEA 4A7ZA 2GDFA 5IK5A 2R061 2VH9A 1BYHA 2RM21 3TK5B 1LOFC 3PNAA 4IEYA 5TSWA 1E57A 2D7FA 4GWIA 4MGZE 1JI6A 3PUIA 4MGKE 2EA7A 3VBRA 4JX0A 4XF1A 3B94A 5I0UA 4Q0PA 3VBRB 4DIQA 4HOOA 2RS51 1OOPA 2Y64A 1W9YA 3RZKA 2XUMA 1AR81 1OOPB 3LA3A 3CF6E 1MEC1 4E8CA 4PIYA 5A3OA 1YO8A 4YW4A 3ZKYA 1M1XB 4XF9A 1CX4A 2D43A 2H0VA 5F19A 4R9BA 2HJIA 5IWFA 4K6BA 3MIGA 5JXJA 1ULCA 1FMD1 1RUC1 4ASKA 2RR12 1CIYA 2YY1A 2EI8B 1Q3EA 2P17A 5FY4A 5HXVA 1QIQA 1G9BA 2PXJA 2XJPA 1KLJL 2GSYA 2C4XA 1BF9A 4UBGA 1S4CA 4TYSA 4CUCA 5FDQA 2D3RA 3N35A 5JVVA 1CGPA 4IEXA 4GJYA 3S0MA 3RSJA 4E2QA 3USUB 1ZREA 3AMQA 4AFBA 1XOYA 4YVWC 2EAKA 4XACA 1OKOA 2ARBA 1XE8A 4CE8A 1RITA 2W1QA 3RZJA 5C9AB 5LY1A 2R041 4TSVA 5JVZA 4O7XA 4KGQA 5LA2A 1EBVA 4IQPA 3ELAL 2MGRA 3RR3A 1UU6A 3VBHA 3WG4A 4ATEA 4CCLA 5IK8A 5CNAA 1TLEA 5F5CA 2GC1A 1QDOA 4X8VL 1KGYA 2YU1A 2FCTA 4AVTA 2EXJA 5GZDA 5FY7A 3V0BB 4AQSA 3BYWA 5C4WA 5FZ7A 1HZ8A 1EPGA 2ZEWA 3ZXEA 3ZFGA 1VBC1 4KG0A 4NWVA 4NE9A 5FY8A 5FP7A 4AWDA 3ZFGB 4MHUA 4Y1VA 1M06G 1MR5A 2OPWA 3MBWA 4B7EA 2XPJA 3TNQA 2G00L 1LPGA 2ZXQA 1GP6A 2WZEA 2WG3C 2TBVA 3FC0A 1C8NA 2BYVE 3QD6A 4Q2FA 1PNGA 3OBTA 1S55A 4CZSA 1XXNA 1ZBA1 5CEHA 1T6GC 2W26B 4J1XA 4F83A 3LGRA 5E16A 2UY8A 4NR1A 1WWYA 2Y26A 2ZGUA 4E1GA 1UZZA 2PHTA 4NIGA 2ZMNA 3NJPC 3VBSC 5FY9A 3I3DA 5FZGA 1UXZA 4OHWA 3B02A 4PDWB 5C71A 2ZGLA 1AF9A 2W92A 1L3YA 4FP3A 5DUUA 5E6HA 4JZDL 1OLRA 1IQML 4AGRA 4LMFA 3AKTA 3BT1A 3LEIA 4XJZA 2P3IA 1UIKA 5FZFA 3ME2A 4G1MB 3B5LB 4OMCA 1LOFA 2W1WA 1XQNA 2BBAA 2RE9A 1LHNA 1LU2A 5FY5A 1RUI3 3WDTA 2GH8A 3V0AB 3MFCA 4W6YA 5IKTA 1HRI1 1U5XA 1HB4A 3ACFA 1FPN3 1F4HA 4UF0A 3N9PA 5IATA 4QQ2A 1Q56A 4C16A 2OYZA 3BI3A 4K7JA 2B7YA 3VL9A 3DYMA 2VQUA 3IBMA 4YGEA 4R52A 3VKOA 3O1MA 1Y43B 4A41A 3H0OA 4QHZA 4XFBA 1R091 2PAEA 2I9BA 4ASMB 1GKBA 2SLIA 3WW2A 3OF1A 1G9DA 4Z1VA 4S2DA 1PO23 5T3NA 4YGCA 4ATFA 2WO2A 5K7PA 3O1SA 5FYYA 5HXMA 4PLNA 4LO7A 4X8UL 4PF1A 5FZDA 4PIZA 2HKXA 2XBO1 4LK7A 2G4IA 3EYPA 4PBOA 2Y0IA 4META 5IK4A 1XSQA 1DU3D 3RZZA 1FF7A 3GXUA 3HIFA 5JMOA 3AYDA 5IFTA 2XKOA 4I01A 5DABA 2J1TA 5AFBA 1O6UA 1ATAA 4OI2A 1VBA3 3M3IA 1WLTA 4R9DA 5EWSA 1EQHA 2KD7A 2J1VA 4AVSA 2FD8A 3X29B 1DQ2A 1WLWA 1W99A 3T2PA 1GYKA 2AENA 4CDXC 2P3KA 4YVWB 1LQDA 3NTBA 2JIJA 5FZLA 5FWJA 3T0BA 1I9RA 4I2OA 1V9U3 2GN3A 1JXNA 5FKBA 1IHMA 2ZABA 1U67A 3LOBA 4XUQA 1HAEA 4A3XA 2TUNA 4I0WB 2YPJA 1CAXB 2Y6KA 2B9UA 1PGL1 1DP0A 1UMHA 1PO11 1UAIA 4CEWA 4QXCA 2VCBA 2WFTA 3FE5A 2YFUA 1HQWA 4IEZA 2W94A 4O9EA 5A3MA 4Y71B 1EAH3 1NFYB 1NCRC 2C9AA 3AL5A 2ZHLA 1VR3A 4QB2A 1FPN2 4Q4X3 5FUNA 4CUFA 3LZZA 4BJ0A 3N3HA 5T5JA 4D0EA 3AKPA 2I2SA 3PMEA 5JZGC 4GKYA 1J1TA 2H0BA 3K4ZA 4N53C 4UW3A 4A6OA 5A6QA 5FDBA 1PO22 2XLAA 3E6BA 2P16L 3IZOA 4LXLA 4K21A 1QQP3 1SDDB 2OQ7A 2DUOA 1W7XL 4A3ZA 3AXEA 2J1RA 5GLWA 3VZMA 3CL1A 5DN2A 3PVBB 1JL9A 4CU6A 1DGRA 5F1AA 1IPSA 1I5PA 2IZWA 3MUZ1 3T2TA 3VBFC 4AE2A 3CS7L 3BN6A 3NAPA 2RS33 4Y22B 2WQ4A 4PLOA 4TGFA 5FPVA 1KEXA 2AZ5A 3MV01 5KHIA 1VBA2 3VBSB 4CUGA 2DWRA 4IEQA 1ENSA 2DDUA 4Y79B 3SQOA 1HX6A 4B4RA 3I2GA 1IQFL 2ZHKA 4W6XA 4QPGB 2CY6A 4BXSV 1YYNA 3WDXA 2V4VA 1V9U2 1NQLB 3DPRC 4J1WA 2ZCWA 3KV9A 5EIYB 4INDA 5LY2A 2VXJA 2E63A 2W68A 4MGIE 3ZDVA 3RZMA 2Q1ZB 2H6CA 2AEZA 1VJ2A 4Z0LA 3N9LA 5J09A 2X10A 4DUWA 4A2UA 3S57A 2YXSA 3M3CA 1GOFA 1EAH2 3PL0A 4QGNA 4OQ9A 4ZKTB 2QQVA 2RJ2A 4GMP1 2VZRA 1N7DA 4Q4X2 1ZZCA 1UIJA 3R4DB 2VNOA 3O1TA 1VRH3 2YYOA 3OGJA 5F6KA 3W58A 4B1MA 3H42B 1QH7A 2VMHA 4EZ4A 1N3PA 1PVXA 2BUKA 5L7OC 2BT7A 4ZHNA 3U07A 1BBT3 4Z0KB 1REEA 3J8F1 2ZKNA 3AVSA 1ZRFA 2J1UA 4FPEA 5GLZA 3MW2A 2YDEA 1QQP2 2O1QA 3AZXA 1OVPA 2YZ4A 2Y7ZB 3KQ4B 3C3VA 1UCXA 1QIUA 5FTTC 4XFCA 1NA1A 1OF4A 3E5XA 4PT6A 5EJ1B 1AL0G 3MLLA 3WG1A 4CDXB 2RS32 1OXCA 2VVFA 2WS93 5JIAA 1Z6EL 3WF2A 4I09A 3MIEA 4CU7A 4AVVA 2WZR1 1RUG3 3PTRB 4QU1A 1QWRA 5ACA1 1GZTA 1MZ6A 2JDPA 3HNBM 2UWLB 3SLIA 2JKHL 2XC4L 2WPIE 4FVVA 1NCRA 1YRZA 1UF2C 1JBCA 1Z0HA 1PIV3 2DCZA 4COZA 1NCRB 4BDVB 3D8CA 2LM3A 2VZ1A 5FP4A 3SH4A 2WO1A 4Q5OA 5JWPA 1FNYA 2WNEA 1O5DL 4IV3C 4EN0A 3I3BA 5I0TA 4QX8A 5DUXA 4AZZA 5FJHA 4CRQA 2JICA 4DXSA 4N53A 5JZGA 3P3PA 4O9GA 3MF6A 5F39A 5JZGB 3RG0A 4RS0A 2Y81B 1RUH1 4HG6B 4N53B 5FP3A 4CCEA 2W3KB 1OA2A 1UQXA 1XYPA 2ETEA 4YM2A 4AW7A 5FV3A 5CG9A 1IPKA 3B69A 1Y9GA 4JKLA 2P3YA 4YZ2A 3A22A 2BGOA 4ZHAB 2HEVF 3GCWE 1CAVA 3AJYA 1VRH2 3G6JB 3HD8B 3NV3A 3VBFA 3VV1A 2BQ6A 1OLME 1CAVB 1LECA 1Q4GA 2PA7A 3RMYA 3VBFB 5FPZA 1VE0A 5IJRA 1BBT2 4E27A 4LLOA 4BQ3A 3SEPA 1NXMA 2ZZQA 2CGPA 3N9MA 3HO5A 1AHSA 4G4FA 5FRAA 1CJPA 4PHZA 1CN1A 4LKFA 3WP3A 2VOTA 5JVYA 4AI0A 4AR2A 2GH2A 3VKFC 1V1IA 2DUPA 3WF0A 4ZXYL 5GALA 1D2QA 1ZNPA 1HREA 2XC5L 2WS92 1Q5OA 3DPRA 2WYSA 4K8RB 4RGKA 4Q0UA 4YFWA 2O8QA 3DPRB 1HIXA 1RUG2 3RWNA 5E88A 4FTBA 2A3WA 5DAPA 1N3OA 1WLCA 5K4LA 4HONA 3VZOA 2C1FA 3OTFA 1FXZA 3THCA 5EGMB 3AZWA 1PIV2 1WLDA 1XSRA 4YGBA 1X9PA 3ABZA 2OYUP 1LRHA 1W6MA 2ARCA 4NIIA 1ODNA 2V5DA 2VUDA 2ZZJA 2W46A 5C3QA 3B9IA 1W6MB 2EIEA 2P3JA 4HVRA 4XVHA 4YARA 1O4YA 2HLEA 4WV8A 3S5AA 2ZOEB 4NAMA 3AKRA 5F9TA 5CA6A 5L7OB 3LN0A 2HWB1 2IXIA 1AR61 2JE7A 3ZSMA 4DINB 4YWAA 4URAA 4QD2A 2GNTA 5FYHA 2WA3A 2WLQA 1DQ1A 2L9LA 2A70A 1JYVA 3WW3A 3WINE 1HN0A 4AEMA 1PTHA 1QJEA 1CZSA 1K5JA 1S0BA 1IS3A 2VM9A 1BZWA 3K48A 5C3OA 4HBNA 3N8YA 1HX2A 1QJFA 2ZPXA 4P9WA 4UW5A 2VMDA 3FHIB 4AVBA 5A6ZA 3SHRA 3N8YB 3BUCA 4AYUA 1FSBA 4IGQA 4DXRA 1ZZ7A 1X36A 2CJIB 4HL0A 4E8DA 4HANA 4GB31 1WBFA 1D2SA 1RC6A 3TBDA 2HWE1 3DUIA 4A6SA 2Y82B 2AC1A 1N1SA 3AKQA 5F2WA 1BBT1 2EIDA 4PH9A 1Q43A 1XU2A 1A78A 3QMOA 2JB8A 3WEZA 3T2OA 2ARAA 2DYCA 2YGMA 5A7NA 3OD4A 3ZM8A 3BOPA 1COV3 2CL2A 1OBNA 1AR73 2WFXB 4LORA 2A6XA 2ARXA 2YC2A 3LA2A 4IV3B 3ZXFA 4YM3A 3RZGA 1UZKA 4ISIL 1TQ5A 2D44A 4HKWA 3IDEA 5LBBA 3SMHA 3ST7A 1FJSL 1SDWA 1U12A 2QQJA 5A6XA 2RDRA 2VPVA 1W8HA 2BNNA 1YCIA 2KV4A 4IESA 4P9LA 4Q4V1 5EYYA 3TEWA 1JYCA 4KH9A 4BQ2A 5HV4A 2CWSA 1EPHA 2EVXA 4KG8A 1KS5A 1W3VA 3GBGA 3U37A 5I93A 3UKVA 1AR91 4ZPIA 4JTNA 3JB8A 1FV3A 4KI5M 1NPEB 1SPPA 2W2IA 3O12A 4PQQA 2DTYA 3P5BL 4PBPA 2MHPA 1AX0A 4FPFA 3GCXA 2XVGA 2QFEA 1DLLA 2JG8C 4LKSA 4YW2A 5HCBA 3VZJA 2WT0A 2JJ6A 1UKRA 1RIRA 4WZCA 5FXWA 4AFMA 2W47A 1VB4A 2R1BA 2PYTA 1S2EA 2NN8A 2P6CA 3LSDA 2GP5A 1ZRCA 1C1FA 2JJLA 2AYHA 3KL6B 4NN0A 5GZEA 1LJ7A 2R7EB 4FPGA 2ZX1A 2W1UA 1B09A 2H9EL 1ULOA 1UZWA 4DO0A 3C8XA 5JSOA 3SCGA 4UOJA 1LGBA 1X7NA 2WZPP 3WDUA 2PAMA 5FQ0A 4DUXA 4CCCA 2IFRA 2XJQA 4OYUA 3WQ0A 3WR0A 1FX5A 1AR72 1V00A 2LW8A 4FFGA 5C5TA 1NXD1 3PVEA 1CONA 2PTMA 4QXBA 5JMCA 4XPVA 3K4DA 5LASA 1UW8A 2PHUA 2P94L 1Y7BA 2H6BA 4FPOB 2BQWA 2QQIA 1R1A3 2IFWA 2CU5A 3M8LA 1MS5A 1B9WA 1EP0A 1RMU3 2YC0A 2Q1FA 4Q4W3 4GAZA 1L7LA 3KF3A 1W0PA 5K0HB 2OQ6A 2PHLA 2G19A 4M3CA 3MEPA 3QCWA 4ZU7A 2RS11 2D6KA 2D98A 3I2KA 2MEV1 4M3CB 1J3RA 1GICA 1POQA 3QOPA 2VZ3A 3WZ1A 3FFQA 2CHHA 3POJA 3HQUA 2PHBB 2A6VA 1CVUA 3LIHA 1EYBA 1C28A 1SCRA 4KGGA 4RHV3 5LW9A 3T4VA 1EPZA 1RUJ1 2WC2A 4OUEA 2W2NE 4HT1T 1WW7A 2FZ2A 1RB8G 1LB2A 4XETA 4Y20A 2VOVA 4XUPA 2FLRL 5A3WA 1N1VA 4NAOA 4Y20B 4B29A 4B7KA 4MH0E 2FZ1A 3ZFFB 4B8EA 3LTFB 1ODMA 4U36A 2D5FA 3VBUC 2N7GA 3DYPA 3I2JA 4NIHA 3MYXA 4H14A 4XZPA 1E5HA 3USSA 5LB6A 1REFA 2PHFA 2QQOA 3I54A 2QNKA 1DDXA 1G6NA 4M01A 4ISQA 1M4WA 3NNJA 4EWDA 5IAXA 4XXPA 5FOJB 2E6VA 5DG2A 2OKXA 3S5QA 3FUOA 1FOD1 1FE2A 1ULGA 4COVA 4FBFA 3WSOA 5FREA 1PGW2 4ZY9A 1IKQA 1K5MA 4E4HA 1PGSA 1JN2P 3AMPA 1IVOC 3SH5A 1H9WA 1R1A2 1W6OA 4DS0A 5IKVA 4BLIA 3WP4A 2IWGB 2JG8A 1HJ7A 3ZDSA 1L5GB 1RMU2 2HORA 4P9GA 3ZLIA 2VZQA 2JG8B 1CVNA 2PLV1 2EXHA 2DBNA 3HS5A 5JB8E 3NKGA 1BHGA 3ZYHA 1UMZA 2ZTNA 2RMU3 4AEKA 1GUIA 3C2UA 1HV0A 4LO6B 2K2TA 3IPVB 1C3HA 2G9ZA 2WWSA 1CAWA 1V6IA 1E5SA 1CAWB 1RUF3 2BZDA 1PGEA 2P2KA 2Q8DA 3RDIA 1RUOA 2BEOA 1SBDA 1G8WA 5FBJA 1S0IA 3I3QA 1CQEA 5KXDA 3KCYA 3OPZA 5IT6A 1UX7A 3ZXAC 3APBA 4G9SB 2ADXA 1TOZA 2EALA 2R063 4YW6A 2HYKA 2RM23 2BWCA 1GWLA 1TNRA 1ZYBA 2JB4A 4IGOA 1FAKL 4P9XA 3OGRA 4NRMA 3I4IA 4GQ7A 3HQRA 2RS53 4D7SA 2A73B 2FDHA 4MMXB 3OLTA 3DCQA 1MEC3 1DCSA 3T1MA 1YFUA 2E26A 2WFPA 2XQRA 4W4ZA 1W0OA 4O65A 1UPIA 3DV8A 4RR3C 3LOIA 5HCAA 4PLMA 5F5IA 2NQYA 4RFT0 1W39A 2VG9A 1LULA 1C5HA 1FMD3 1RUC3 4QDQA 3UESA 3ZFEC 3MZHA 3O14A 4XIKA 3LIWB 1CCFA 2KL7A 3MDPA 2GZWA 5B4NA 3BIEA 1W2TA 3M7AA 3I7DA 1CQ9A 1QOSA 2WN2A 4O61A 4Y1YA 4CPBD 3N8ZA 3W21A 2FDGA 2VCMA 1OD3A 1H6YA 3LFMA 3OB8A 2CAUA 2RMU2 4RRYA 2VNVA 3MFAA 3AZZA 2KNIA 3EMRA 4LBKA 1DX5I 3VD9A 1F31A 1MS0A 1PX4A 2O14A 1O3QA 2R043 1LHWA 2HWF1 4Q4Y2 2VGDA 1RUF2 1AJKA 1LENA 4LKEA 5F3EA 1UZQA 3VBUA 2WQZC 1F2NA 3JCIA 1Z78A 5FUPA 5KWRA 1SG3A 2F4LA 1ZRIA 5EJ3A 3VBUB 4A45A 1QJZA 5FYTA 3LE0A 1GANA 4LULA 2R062 1AX2A 1IGZA 2RM22 3GM8A 3SISA 4XAAA 2KA3A 4Y1UA 4MGQA 1W06A 4XTMA 1VBC3 1NG0A 1YJKA 1RVF1 2VWOL 4XMIA 5FMOS 4P02B 3FN9A 5C8CC 4I02A 1EPJA 1QU0A 3AYAA 4I3GA 3VUOA 4QXHA 2RS52 2R30A 4COYA 1W9FA 3N4MA 2CNAA 1HJFA 5G04L 3UJQA 1MEC2 5GKAC 1HKDA 1LR5A 4XF0A 5D8AC 1I1EA 2FDFA 3LWCA 1SHWB 2VXRA 4WM8C 3C9AC 2WDBA 3SCFA 4DXZA 2VE1A 2VZUA 3VBHC 5C33A 1ZBA3 2XL9A 1SLCA 1FMD2 3ZYRA 1RUC2 2YU2A 2OT7A 4ARYA 5FYUA 4BTUA 2EXKA 1VMFA 5KC6A 3AM2A 2VD7A 1W6NA 4IUGA 3OUHA 4M3CF 1IQLL 4PF5A 2J34B 4E9KA 3R0RA 5C4WC 4R4ZA 1W6NB 3VZLA 2NM1A 2DV9A 4XJUA 1IOXA 2B5HA 1GSLA 1QF3A 2VZOA 2LROA 2ZACA 2PN5A 2Y6JA 4QM9A 4IDZA 1W6QA 3HNMA 4RRWA 2YBSA 4H2AA 1TPGA 2WG4B 2AEYA 5C3RA 2R042 1W6QB 3LA7A 1C8M1 1HRI3 2BTVC 2HWD2 1OA4A 5FZ6A 4QKNA 4QKDA 3MPPG 4FOYA 1XE0A 4QGMA 2JDMA 3POYA 1QMJA 1EV11 4M4PA 5HBAA 2HEYF 4R9CA 1L7RA 1F9KA 1ZX5A 2FCVA 2ZHNA 1R093 5IUQA 4Z82A 5F3IA 4H7LA 4AHYA 5A6YA 3ETQA 3VBOC 3NV2A 3BTYA 3HOBA 3JU9A 4QQLA 4CEYA 4Q4Y1 4RR3A 2FDKA 1VBC2 2YB7A 4WM7C 2LUWA 4LBQA 4RR3B 3O1RA 1X82A 1H2KA 3ZVXA 3OJBA 2NP0A 2TNFA 2XBO3 3E6CC 2VQAA 2FZZL 3ZFEB 5I0DA 5BNPC 1IQEL 2XJTA 3POWA 4S2HA 4COUA 4M10A 4CP9A 4LBLA 3I2IA 2O8OA 2JDYA 4CU9A 1STMA 4Y5TA 1OC1A 1ZBA2 2PAKA 2QQLA 1BXHA 4DQAA 4NOTA 2DCJA 3QLQA 2VECA 5ISLA 2PQSA 1K42A 3H3UA 3E97A 4JQTA 4MX3A 4PJYA 5HCFA 4LBOA 4KWKA 4BXWA 5IVFA 4NMIA 2GMPA 4NPMA 5H9QA 1W28A 5A3NA 1P9JA 1YLLA 4JTOA 5A80A 4OI1A 5F6LB 5J48A 2WL1A 2BFUS 2OPKA 4OHZA 3IITB 3JD71 4R8HA 1PO13 3BU0A 1DG6A 5FY1A 4HVQA 5BNQA 5A3LA 4AQTA 3PUQA 5KHHA 3CQOA 1HRI2 4HKOA 2JDZA 1LPKA 1A8MA 3UJOA 2VNGA 5CYYA 3ZX7A 5C8CA 2ET7A 2J1EA 2GAUA 1IQAA 5A70A 4NPLA 1A34A 4JGZC 1MZEA 2D6LX 5C8CB 4FPKA 4LLFA 4FAGA 1R092 1PM4A 1QJX1 1XU1A 2QJVA 2ZX2A 3I8TA 3PHMA 3J7MA 3ZYPA 5D8AA 1J3PA 3AP4A 5J36A 3TEYA 1FI2A 2HWD1 3IAPA 4WM8A 4X8SL 1HCGB 1IQKL 1NQDA 1V6NA 5D8AB 5B2GB 1NCQC 2WNUC 4HFSA 4CUEA 1JZ4A 3VBHB 2XBO2 2XR4A 4OI0A 1WCDJ 1PMHX 3A4UA 5DDJ1 1IOEL 4ET7A 4CSYA 4FO9A 2NPRA 1FATA 4CEWC 1UO9A 1IQJL 3URFA 2QBXA 3NNMA 4H3WA 3ZXDA 5C4WB 2A6WA 3N9QA 2Y7XB 1SBFA 1X50A 4FFHA 3WCSA 3HN3A 4QPIA 1YUGA 2BERA 4Q1PA 1RYYA 4XJAA 2WAAA 3ZR5A 4LHKA 1Q8SA 2LALA 5KIRA 1JH5A 2RJKA 5FZ0A 1K37A 2JDUA 1NFWB 2CYFA 3GCWA 4XIOA 5JPNB 3AB0A 3UT0A 1OLMA 1S2KA 3BPZA 1WD3A 1PGL2 1GQGA 3ZSKA 1PO12 3VBOA 4UFHA 3P3NA 4L2NA 3O1OA 3WNOA 1NY71 4Z07A 3NAPC 4YRDA 2E9QA 2OX0A 4JC1A 1AJOA 1BJQA 4WM7A 4QPWA 3HS6A 3H8UA 4GMP3 4CUBA 4WM7B 1IS6A 4NWWA 4HSLA 3LC3B 4KU8A 3E6DA 5BNPA 3T3YA 3IDBB 4AI9A 4D69A 4MO3M 5BNPB 1V0AA 2ZGMA 4RUTA 3J8F3 2ZBJA 1DYOA 5FZ1A 1AUYA 2P93L 2XHKA 3PUSA 4NRQA 4XHXA 3VZNA 2VVVL 4Q8KA 5BYNA 4UF0B 2WPME 3KMHA 3KV6A 3FL7A 3CJIC 2GC0A 1BQPA 2TGFA 1LNSA 4IL7A 2XG3A 4MZUA 2XBYL 2JE9A 3PVNA 4MVTA 3HT2A 2ET1A 1XRUA 2WA4A 1S0EA 1UL9A 2WZR3 3FLPA 3Q8FA 3QH0A 1QKQA 3POIA 5ACA3 1P0SL 2P3UA 3FLRA 3KV4A 2Q8CA 4YYOA 3TOJA 4XBLA 4QX0A 2V4AA 2VVUL 5IHRA 4UFLA 5DAQA 1VALA 2Y0OA 5LZ6A 3D0JA 4L97A 1NAEA 1PMIA 2WRAA 3CZUA 1H0BA 1WD4A 3W9AA 3PLQA 4JGZA 3K46A 3KQEL 1BLZA 2BVBA 1WA6X 3B01A 3EBRA 2J1AA 3M70A 3PJYA 2QUOA 4OVEA 4JGZB 1IG3A 2ZX3A 1V1HA 3MIFA 1NA1C 2G9FA 2OZJA 3QACA 1MS1A 1RUH3 3BU7A 4KU7A 1PMJX 5IFPA 1LAJA 1JUIA 4B4PA 1NCQA 2WNUA 4XZUG 1ULFA 3D3AA 1ACCA 2PQQA 5FAXA 3RI8A 1NCQB 2WNUB 3HVDA 1AYM3 2FLGA 3K9XA 1W9TA 3VLBB 5FZKA 4QGLA 5FZCA 2JD9A 1CZTA 3MDLA 2PHWA 5L30L 3J8F2 4ZU4A 2VL4A 2CGOA 3WG2A 4CEWB 4I3PA 4ARXA 4BH9A 1IZ3A 4HN0A 1AX1A 4DMIA 4UWDA 1CAUA 5FZAA 4ZXKA 3FHQA 3Q9OA 4M11A 1EPIA 3CBNA 4ZH8B 2QQUA 1RL3A 2RDQA 4EN7B 1YI7A 2Z79A 3UGHA 1BMV2 1FAXL 3ITQA 3ZPYA 4CSWA 3ILRA 5IAVA 1KDKA 2QQWA 1YEWA 2W95A 2PHRA 3FHAA 2WZR2 3POGA 1Y4WA 5FYZA 4ZXEA 4LUMA 2E53A 4JKMA 3RWKX 5ACA2 4LITA 2F9BL 1XBFA 5KR7A 1IGXA 2BOUA 1AYN1 4Q26A 5IYYA 3FFGL 1ZZ6A 4YZUB 2W08A 2VMFA 1XDTR 3WNKA 5BY5A 4Z92B 1SCSA 1RUD1 2BQPA 4FFIA 3NAPB 3KQCL 4GZ9A 3U10A 1BEV1 3ZXJA 3O1UA 2XJUA 3IN9A 3VD5A 4KMQA 2DU1A 5CFCA 4CVUA 5BXXA 1W8TA 3BODA 3M37L 3DYOA 4AOCA 5JLVA 1GNYA 3NV4A 1SLLA 1RUH2 2R16A 4NHXA 4D6QA 5L9VA 3ACIA 2HWB3 3WD5A 1AR63 1LOEA 2W5FA 5K0UA 4AF9A 5JIUA 3L9JT 3CDZB 2QE3A 1AYM2 4LA3A 1LHUA 4N7IA 5EYXA 5BPXA 2VNRA 4LKDA 3CJIA 4IE5A 1EUUA 3TEXA 3VHNA 4Q0VA 3RYRA 2YBKA 3NNFA 3M36L 3CJIB 1NX9A 5JW1A 1VIWB 2ZGNA 4TWTA 4QMAA 3U4XA 2NZ9A 4K1ZA 4V1PA 5FZMA 2J38B 4GKXA 3HWJA 5J37A 4LK6A 4YVSC 3B7MA 3BB6A 4LBNA 4GB33 1US2A 3SNMA 2HWE3 1JOJA 1SACA 3I59A 3OSDA 1CD3G 4WVVA 1DQ5A 3VDCA 3LAGA 5FXVA 3KRKA 1KRIA 1BCXA 2BDRA 4DEVA 1NFXB 2BWAA 1T6BX 3MLKA 4BQ1A 2Y6LA 3BVCA 1H8TA 1V6LA 5KBFA 1U8CB 1SQ4A 1WHEA 4OLLA 2DCTA 4LBQD 1XFEA 2ZGQA 4EROA 2Y6GA 4MYEA 4BQYA 4RSUA 4EE2A 5A3PA 5I91A 3H8RA 1NA1B 4ZXXL 4LO4B 3ZKUA 3JBG1 1AUTL 3BTZA 1OI6A 3UL2A 4MGTA 1BMV1 1IP0A 3WQ1A 4Q4V3 2PFWA 3LTGD 2AREA 4XYXA 4K8FA 5T5OA 3AZVA 4XFGA 1AR93 3EHKA 3WG3A 2UWAA 2WPHE 1MVQA 5FYVA 1LKNA 1QNWA 1WCUA 5GZFA 4OZXA 1OPOA 4QHOA 5LK7B 2BP6A 2HWB2 3D6EA 2ILMA 4JHTA 1AR62 3KWVA 3TN93 3ES1A 4GMP0 5CZKA 1OVSA 3N7LA 3LPFA 4AGGA 4AHWA 4NA9L 3KK6A 3THPA 3CJXA 3LB9A 1CPMA 2J94B 1N1IA 2AH2A 4I30A 2FBEA 1WMDA 1DZTA 1HV1A 1XC6A 1PZ7A 1FNZA 4TLGA 3GZUC 5LA9A 1TG7A 3OUIA 4JYUL 1JV2B 4BLJA 3VGIA 5L2YL 1JZ5A 2VWMK 2WYGB 1APNA 2QDNA 3J4UH 4XL1A 1AYM1 1QOOA 3OGGA 3EXUA 4FPJA 3G7DA 4FOWA 1MQ6L 2GC2A 2A75A 2VU9A 1S0GA 1IS4A 4GB32 2HWE2 2WYFA 3NKTA 3WHUA 4NIDA 1CVWL 1URXA 4HKLA 2UWPB 2EICA 2ZHMA 3OGSA 3WUDA 1X33A 2VQTA 2QQMA 4BK5A 3T4HB 2XC0L 4RS5C 1VBB1 5L9BA 1R081 2PR3B 3M2MA 5LEKA 3OEAA 1JODA 1CWPA 2AR6A 5F5AA 5T52A 2E7AA 2DUQA 4NIAA 2OYEP 1US3A 1JZ8A 1WA4A 4FXGB 5KC5A 1QFKL 1O5UA 4Q4V2 2CGNA 4FT8A 1Q8OA 4HETA 4C1WA 3AZYA 4JAAA 5ERLA 4HZFA 3AYCA 4CPBA 2UWOB 2VMEA 1AR92 1DYKA 4OI4A 3RVHA 3JZVA 1YJLA 3FX3A 4XFAA 3ZXKA 5IVVA 1UX6A 2ZAAA 3GJAA 1SEFA 4OHVA 1RJ7A 2VY0A 3KLSA 3L2HA 2HH9A 2RS13 3N9OA 2BRTA 2MEV3 2WFF1 4Y24A 3TN92 3VDAA 3BPSE 3IDCB 3NL1A 3Q8AA 1UZ0A 3KZ4C 2CSGA 1APQA 1J84A 3A7QA 3BGAA 3NVCA 5JXHA 2G1MA 1K3IA 4TZDA 2KB9A 4YVSA 3GZTB 3D4KA 5BNOA 3LEMA 1CJDA 3J7NA 1RUJ3 4YVSB 5FP8A 5JXGA 1MQTC 4LOSA 5FWEA 1UU5A 1DGRN 4FFFA 1GV9A 5FMDA 1A8DA 5KXCA 3M3EA 3AP7A 3KM5A 5LA1A 3W5NA 3WVJA 5DAXA 1YUFA 5I8TA 5FK8A 1OF3A 3SH3A 2MPFA 3I2DA 4C90A 1Z6CA 1F5JA 2B46X 2UURA 2VTXA 1H4GA 4KWUA 4XFHA 3TNPB 2FLBL 5A7QA 1O7FA 5FUIA 4BYYA 4JDMA 1TME1 1W8BL 1D4VB 3LQCA 4NO4A 2NLRA 4JYVL 1K45A 1WHFA 3NJXA 2Q1MA 2VO5A 2BW8A 1FOD3 5A1LA 2ZGSA 2HWC1 2VZSA 2WNOA 4IW3A 3ZYBA 2VVDA 1WCQA 2VW1A 2VCAA 1I3HA 3KVAA 4JRLA 1PRHA 3KQDL 1K12A 2QTWB 1H6XA 4W65A 2RV9A 4LE3A 3V65A 4CCMA 3WNPA 4UBHA 1W90A 5EJZB 3V65B 4BPZA 1DLCA 1Q8PA 3ON7A 4F8AA 1XJAA 1GK5A 1GZWA 1H30A 2GP3A 2PLV3 4MXWA 4AFDA 3ZN6A 1JYWA 2VTFA 1WW5A 1EZQB 1KD7A 3BTAA 4MXWB 4Y33A 4OQ8A 3VKMA 1OD5A 1WW4A 2RS12 5JI9A 2MEV2 5IK7A 1UPSA 1UWWA 4XABA 3KCCA 4BIFA 4LE4A 1JHNA 1WKYA 4EQVA 4A7IA 5LBFA 1IOAA 1RUJ2 3CMGA 1YNAA 3DGTA 4GH4C 4Y1XA 4AI3A 3WOGA 4LBJA 5I0SA 3TWIA 4YW1A 3WQ7A 2BVVA 1K5MC 4EYUA 1SPPB 1UU4A 4TLFA 2BOIA 3Q7DA 3LSEA 1ENRA 1U5YA 4RS5A 3TN91 1MZFA 4DY3A 3F6UL 2BJSA 2I74A 2OVUA 2FD6A 2ATFA 2C0ZA 2WUHA 1EMOA 3I3EA 5DQ0A 5DZFA 5E8AA 5L2ZL 1NE6A 2J22A 2W87A 4I0BA 5ABJC 5IVEA 2ZX4A 5AC92 5FFOC 4WZFA 5J96B 4GU4A 4LUKA 3UGFA 2YG0A 3ACLA 4EN8B 2B7DL 2DVGA 2VC9A 4BIOA 3ZYJB 3O0XA 3IDAA 1H2MA 2CWMA 4M0NA 4Z2AA 1FOD2 5T5PA 4B4QA 2WNVC 4IE4A 1J1LA 5F32A 4EN6B 2K46A 2R0HA 2QZ2A 2R49A 3R05A 3WP5A 5FZOA 4GWMA 4AK3A 5FQ0B 2DF7A 3ZSLA 3AP9A 3ENRA 4L8QA 5FZOB 4NPRA 2WT1A 1DZRA 5C8WA 2PLV2 5K8SA 1MQTA 4QDSA 4RQPA 1JBUL 1J83A 1LOCA 4P9YA 1MQTB 1HJGA 1SFNA 1VP6A 5IKQA 4KWLA 3H3ZA 4QPYA 1OSGA 4W6WA 2YHJA 4P00B 4HK9A 2UU8A 1X7AL 1V6KA 3PGHA 3UKNA 3AC0A 5CG8A 1GR3A 1ATDA 2AUYA 2FDIA 2HWF3 1N1YA 2ZKLA 4N43A 4YW7A 3ENSA 3HBKA 2CTVA 4KBBA 5FYCA 3SOQA 2XKPA 1DVAL 5FZBA 3ETPA 2Q8EA 1F8VA 1NKGA 3HEIA 5EV7A 5JR2A 1QEXA 5FLIA 5EHDA 4COXA 2YMZA 3OGVA 3AJZA 4D90A 2V73A 1CX1A 5FZEA 2X5IA 1QH6A 1JYTA 3RMXA 4XMAA 1O59A 1Q8VA 1RVF3 2OZ6A 2ZGKA 5J7MA 1W2AX 3MHZA 3ORJA 4XBQA 4O02B 5BUVA 5JUVA 3K77A 4Z8BA 1O8PA 2BGPA 2WBKA 2A5ZA 1VAMA 3N36A 3B3QE 3MIHA 3QH6A 4FQZA 2BPA2 4FCAA 3QBQA 4CYDA 1MQ5L 1COUA 3GNEA 5AC91 1EAIC 2W3IB 1AVBA 1EGFA 3R4SA 4UYBA 1BK0A 3VHPA 1LOGA 2XBXL 4ASLA 2R32A 4JDNA 5L19A 1S2BA 3ZR6A 4H7MA 1PZ8A 2UYAA 1UZYA 4LBMA 4QWNA 4GH4A 2DU0A 3T1LA 2I9AA 2ADDA 4GH4B 3AMMA 2GMEA 1K5MB 3RZLA 1UMIA 3A0KA 4BB3A 4CP1A 2JG9A 5ABJA 1W6OB 1G86A 2ZMKA 3DL3A 2HWF2 3OUJA 1C8M3 3UK9A 1AL23 3DXTA 5ABJB 2B42B 1QJU2 2C6SA 2VZVA 4XDPA 1RUE2 4HN1A 1IPJA 1E5RA 4XHBA 4OHXA 1EV13 3THDA 1VBE2 2GALA 3JQWA 1XYOA 3D5OA 3HBZA 1G9FA 1G1RA 3IIAA 2D5HA 4LHNA 5CIRA 4QDRA 4HPKA 1F4AA 2F17A 3LN1A 1CIWA 1IS5A 5E1RA 5FOBB 1PHMA 4HPKB 4XQWA 4B3NA 1GZCA 1WMEA 4Q4Y3 4QAWA 4QXKA 2K2SA 3GGLA 1XNKA 2WNVA 2RDSA 1RVF2 1TNFA 2RVAA 3CLPA 4ONUA 2K2SB 4MOAA 4ES8A 4OUSA 5F3CA 3UV9A 2JDNA 2P4EA 3WX5A 2UYBA 1ND2C 4AAPA 4MMZB 1Z7S1 5BNNA 5C70A 1MOXC 4XEZA 4MUVA 1OB1C 3OBZA 2D97A 2YC4A 4JV4A 3LDRA 5CBLA 3OBRA 2VBDA 2VW0A 4YM0A 3FBYA 5GZCA 5KHJA 2H9EC 4DEQA 3ZO0B 2WO3A 1HT5A 1ATEA 1H9PA 5JBAE 4DUVA 3E5UA 1EQGA 3VN4A 4IEOA 2JE8A 2VW2A 4HLTA 4XJWA 5C5UA 4NROA 2WSVA 5JAXA 4CEYC 2BOHA 3I3MA 1ND3C 5DUVA 1I0UA 2B45X 2KXLA 3K75B 4YNIA 1XNCA 1W8UA 1VB2A 4CA9A 1OUSA 3IM0A 3JD73 3J26N 1LCLA 3PU3A 3AP6A 1ZBE1 4C8DA 2D93A 1C8M2 1AL22 4YW3A 1JYXA 3PMSA 4LQRA 4OTJA 3GBWA 2B39A 1EV12 3PVOA 3KVBA 5FO9B 1G9AA 2D3SA 5H9SA 5FXXA 1UYYA 2LRPA 4HMZA 1QJX3 5A7SA 5T54A 4OFGA 3O1PA 5AVAA 2VUAA 3KGZA 1RHI1 2VUCA 2IXKA 2HWD3 1U0AA 1H1IA 1HXS1 1QJU1 1WUVA 1YHFA 1RUE1 3C7GA 5I8YA 5EXOA 3WV6A 4IE0A 1VBE1 4AGVA 3ZIWA 4M0HA 5DDJ3 3POBA 3NNGA 1ZZ9A 2UWBA 1SFYA 4HXCA 4UI9L 5CFDA 4EN9B 5FBZA 2BNOA 3DKWA 2Y5HL 3M1HA 5GLVA 4AVCA 1W8FA 2PHDA 4XE9A 3GDBA 4BM8A 1KLIL 4URTA 1CEJA 2JWPA 1H4HA 4AEDC 4SBVA 3ZN5A 3TRSB 4N8MA 4GULA 5DG1A 3BTXA 3SITA 2P5BA 4XFFA 3VD3A 3SKJE 4C0BA 1FV2A 2FCUA 1BKZA 4MGYE 2P37A 5M0TA 1YXWA 1KJRA 2RJLA 5DUWA 4ZS2A 1PZ9A 2DCYA 2DBIA 1MPXA 3HN1A 4BK4A 2VCCA 2XH6A 3CKHA 2C5DA 3JD72 1D4M2 5C6CA 3P5BA 1ASJ1 1G7YA 1NQJA 4I0AA 4WVWA 5HCHA 1ZRRA 2R071 3NTGA 1O3TA 2XWBB 4QKFA 5JBBE 1O8SA 1OPMA 2WSUA 2X8KA 4XCAA 1ND2A 4Y4YA 4BQ5A 1GFF2 4NRPA 1SFPA 4QPIC 4AVAA 1ND2B 2VMCA 5LEJA 1PVC1 1QJX2 4G3YC 1O3SA 2WAOA 1HB2A 2Y6FA 2XUEA 3FBMA 2FHRA 3KB5A 4JGYC 4JRAA 5F3GA 1AL21 2C26A 2GD4A 4Y3OA 3MW4A 3LKJA 4D7YA 5A3TA 1DDLA 1ATBA 3M4FA 5JB9E 5DDJ2 4LIUA 2X05A 3BT2A 3ALQA 4P08A 3OCPA 3ILFA 1O4ZA
chains in the Genus database with same CATH topology
1QGLA 1ND3A 2VULA 4CEYB 2IXCA 1OA3A 1ND3B 5CKNA 1OQ1A 1UZPA 5LRRA 4LBQB 4K20A 1IQHL 5GM0A 1LOAA 3IKWA 2XVKA 4BHPA 1J59A 1G1QA 3LC5B 3H50A 1HT8A 4NHMA 4YT6L 1HRV3 4AXOA 1WMFA 1QOTA 2YROA 3JB4C 1N3QA 4IERA 4S2FA 3RPQA 3ZN4A 4DOUA 4DPNA 2VWNL 1V6JA 1W6PA 5COXA 1W6PB 2MHFA 1HLCA 1NY72 1QHDA 5AVPA 2JECA 4QQHA 1BK1A 1ENQA 1OQDA 1YUDA 2P26A 2GNDA 1OFNA 4CDUC 2XL7A 1YUKB 1OFSA 4AI8A 1TMF3 2YV8A 4A94C 3B9CA 4Q0QA 4C0HA 3DEMA 2Z42A 1D4M1 3KCGL 3AFKA 4NGAL 4A7YA 5KHGA 3N8VA 1EMNA 4RRZA 4IEPA 4EJRA 4AEDA 2YGQA 2Y5FL 1ZM1A 2F6BA 3NWKA 3U73A 4AEDB 2JD4A 2XB6C 1DQ6A 4QX5A 1KDMA 4NVPA 3ZYIB 3NV1A 4EV0A 1DGLA 1POV1 4WM8B 1IGOA 1FFMA 3BALA 4AFAA 4S2GA 2RNLA 3KD4A 1AYN3 2VVEA 1W2UA 4WBBA 1NFUB 3D0SA 1MS4A 4L92A 1RUD3 3NW4A 1YFWA 2BZ6L 5JR7B 1BEV3 3S30A 3USUA 3WDWA 1HRV2 1ZAQA 1O91A 2YGLA 3HS7A 4WVMA 5C9AA 1IQNL 3ELNA 1CX2A 4WVMB 3VZKA 4QPIB 4JGYA 1PNFA 3J9SA 4L99A 1KITA 1YFYA 4CUDA 1LEDA 1QJY1 4JGYB 4DFSA 1KQRA 5CKQA 1FAYA 4QT6A 2A6YA 1TMF2 3V0BA 5JOWA 5A33A 1QDCA 3H7YA 4FQ4A 4YW5A 5A33B 3VBOB 1NT0A 4QQPA 1LHOA 4X8PA 5JOZA 1VBD1 1UN1A 2Q4SA 1O4TA 1ULEA 1POV0 3ES4A 3H5CB 1AXYA 4BOWA 4E4DX 5CFCC 3KCXA 3SW2A 3SOVA 2R1DA 1MS3A 2D6OX 5I46L 1AZDA 3KQBL 3HPTA 5F1RA 3HO3A 2P3TA 1LMMA 4BCUA 4Q29A 1AXZA 3ECQA 5K0UC 2A71A 1SLAA 3ASIA 2G9GA 2QVSB 3MPBA 2D40A 4D0FA 1AYN2 2DFBA 2HEWF 5A32A 4IV1C 4ES9A 5A32B 4DRRA 4PDWA 1RUD2 3JBG3 1GLHA 3FUQA 1BEV2 3WUCA 4CDUA 1REDA 2Q8OA 4CDQC 4CDUB 3RQ0A 2F4PA 4Z6AL 5CVRA 2RR11 4L11A 4E4ZA 3V0AA 4JZFL 1NOVA 4QPGC 4IEUA 3AK0A 4OULA 3PJQA 1J9CL 2PHXA 2ZA9A 4OTYA 3WCRA 4D3WA 1MACA 1L3JA 1HRV1 1WCKA 2GN7A 2IC1A 2ZGRA 4FTSA 3ZSJA 3WW1A 1H8TC 1GNZA 1MZ5A 2NPIA 3IMNA 2Y5GL 3S7IA 2Q0AA 3RI9A