1TLEA

Le (laminin-type egf-like) module giii4 in solution at ph 3.5 and 290 k, nmr, 14 structures
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
58
structure length
58
Chain Sequence
RPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the nidogen binding LE module of the laminin gamma1 chain in solution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Glycoprotein
molecule keywords LAMININ
total genus 3
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00053 Laminin_EGF Laminin EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1tleA00
1F7MA 3U73A 3HO3A 4LMFA 1CX2A 1CVUA 1EQGA 1O5DL 3KRKA 4X8VL 2P16L 4RRXA 3ZYGA 3TK6B 1CCFA 5CKMA 1L5GB 5K0HB 3EGFA 4MMXB 2FLRL 1IQIL 2BQ6A 1LPKA 4FM5A 2RHPA 4Z0KB 3N8YA 3KQDL 4YT7L 2Y5FL 2P93L 1IQJL 4TGFA 3LTGD 3CENL 5JVYA 3ZYJB 2W2PE 1IQLL 3P5BL 2BO2A 2D1JB 4BTUA 5CKQA 4YZUB 1PFXL 1NQLB 1JBUL 1UZPA 2Y82B 3KQBL 3NT1A 3PGHA 4G1MB 2AYLA 3LN1A 2TGFA 2XC0L 1P9JA 1FAXL 4PH9A 1CQEA 5FDQA 4AQTA 4BDXA 3U7UG 1WHFA 3NTGA 2WPJE 1MQ5L 1DDXA 3QH0A 4CUFA 2XBVL 4JZDL 2MHPA 3POYA 4NA9L 1UZQA 1EPJA 4XBMA 2H9EL 1FE2A 2FLBL 2UWPB 1DVAL 2J38B 1CEJA 2J94B 4JZEL 1W8BL 4C16A 1BF9A 1K37A 3N8ZA 1AUTL 2I9AA 2WPLE 2NPRA 1TPGA 1PTHA 4O02B 4A7IA 1KSNB 1X7AL 4Y7AB 2XBWL 2KV4A 3KL6B 4ZXYL 2W2ME 5KIRA 2Y7ZB 2XC4L 3N8YB 2VH6B 4X8SL 3N8XA 3LTFB 4Z0LA 1A3PA 2UWLB 1LPZA 1G2MB 2XBXL 4JYUL 2XC5L 1HREA 2VVVL 3M36L 2WPME 2FZZL 5JBCE 2P94L 2WFTA 3LC5B 5F1AA 3TGFA 1EAIC 3BT2A 3KK6A 2VWOL 2WYJB 5IKVA 3N8VA 1IVOC 5E8DA 3TH3L 1IOEL 4ISIL 1YGCL 1HX2A 1OB1C 4NGAL 1MOXC 1CCVA 3N8WA 3N8WB 1KLIL 4BTTA 3H5CB 1XFEA 4ISHL 4BXSA 1ZAQA 3BT1A 3IITB 2VVCK 4RUTA 2PR3B 4OTJA 3ZYIB 2BOKL 2K2TA 3SOBB 1GK5A 3DEMA 3MQEA 5L2ZL 1XKAL 1NFUB 2CJIB 1G1SA 3F6UL 3FBYA 3HPTA 3Q3KB 3RR3A 1F0SB 1QFKL 2BMGA 3ASIA 1IQNL 3MDLA 1HAEA 2EI8B 4E1GA 1EPIA 1PRHA 1YUKB 2I9BA 3M37L 1ATBA 1IQHL 1N7DA 1FF7A 4NG9L 1IQGL 3Q7DA 2PHBB 2Y80B 2J4IB 1DIYA 4RRYA 1G1TA 1HAFA 1EBVA 5F19A 2VJ3A 3HS6A 5IKQA 3V65B 4D0FA 1EMOA 1KLJL 4XLWA 2W2NE 2W2QE 2BOUA 4COXA 1WU1B 2Y38A 2P26A 3HO5A 2WG3C 5EGMB 5IKRA 2P95L 2J34B 3CS7L 1ADXA 2WG4B 1ATEA 2RNLA 1PXXA 3OLUA 1V3XB 3CA7A 3LC3B 1J9CL 4CUDA 2KB9A 1UZJA 4O1ZA 5JB8E 2MGRA 2KL7A 3KQEL 5CISA 1HZ8A 2FD6A 1W7XL 2EI6B 1EZQB 2EI7B 5CKNA 2BOHA 5JVZA 1XDTR 1IQEL 2Q1JB 2UWOB 4Y79B 1IP0A 3QMOA 1APQA 2W2OE 2Y5GL 1DX5I 3LN0A 4M10A 4MMZB 1K36A 1HJ7A 3GCWE 1ATDA 1NFWB 1EPGA 4BXWA 1G1QA 2GD4A 1EPHA 2BZ6L 2BQ7A 2P3FN 5L30L 3TBDA 5KN5C 1Z6CA 2BQWA 4RRZA 3QCWA 2Y7XB 4JZFL 1U67A 1IQML 2WPKE 4ZHAB 4ZH8B 4ZAEB 1G1RA 2YGPA 1P0SL 2PUQL 2P28B 2B7DL 1TLEA 3OLTA 1IOXA 3HS7A 4D0EA 5JBBE 1C5MF 2ADXA 4RS0A 5IKTA 4CUEA 3V64C 2DDUA 2W26B 5JW1A 2K2SB 4XL1A 1FSBA 2P3UA 2RA0L 1HRFA 1HT8A 1ATAA 1FJSL 1PGEA 1SZBA 2WYGB 1IJQA 3KCGL 4X8TL 2OYEP 1LMJA 4OTYA 4BTIA 1NFYB 3FCSB 2P3FL 1NT0A 3FFGL 3SOVA 1YO8A 2WPIE 4Y6DB 5L2YL 2WFXB 2JKHL 1IQKL 1HCGB 3NTBA 4Y76B 2FLGA 1APOA 1NPEB 2Y5HL 2OYUP 2Y81B 3C9AC 4X8UL 3NJPC 1U8CB 5JB9E 1RFNB 1DQBA 1FAKL 4Z6AL 2G00L 5JBAE 1LPGA 2YGOA 3TZIA 5I46L 1EMNA 1YUGA 3CFWA 1F7EA 3GISX 3SW2A 2VWLL 2W86A 1F0RB 3ENSA 1G2LB 1NFXB 1L3YA 3GCXE 1CVWL 3ELAL 3KQCL 3F1SB 4JYVL 2WPHE 1URKA 6COXA 4CSYA 2F9BL 3SOQA 1TOZA 1Q4GA 1KLOA 3R05A 2J95B 1IQFL 1WHEA 4YT6L 1XKBA 1HT5A 2J2UB 3HO4A 1I0UA 1B9WA 1YUFA 3IJEB 1COUA 4LORA 2XBYL 1EQHA 2P3TA 4Y71B 1IGZA 3HS5A 1NZIA 1MQ6L 5COXA 3K9XA 4RRWA 4Y7BB 2VWNL 2W3KB 1EGFA 1UZKA 1IGXA 1Z6EL 2VWMK 4D90A 4MMYB 1KIGL 4M11A 3LAQA 2VVUL 2BOXA 1N1IA 2MGPA 1LQDA 4ZXXL 3TK5B 2VH0B 3LIWB 1JV2B 3BPSE 2M74A 1FFMA 1M1XB 2W3IB 4BDWA 1JL9A
chains in the Genus database with same CATH superfamily
1F7MA 3U73A 3HO3A 4LMFA 1CX2A 1CVUA 1EQGA 1O5DL 3KRKA 4X8VL 2P16L 4RRXA 3ZYGA 3TK6B 1CCFA 5CKMA 1L5GB 5K0HB 3EGFA 4MMXB 2FLRL 1IQIL 2BQ6A 1LPKA 2JJLA 4FM5A 2RHPA 4Z0KB 3N8YA 3KQDL 4YT7L 2Y5FL 2P93L 1IQJL 4TGFA 3LTGD 3CENL 5JVYA 3ZYJB 2W2PE 1IQLL 3P5BL 2BO2A 2BSFA 2D1JB 4BTUA 5CKQA 4YZUB 1PFXL 1NQLB 1JBUL 1UZPA 2Y82B 3KQBL 3NT1A 3PGHA 4G1MB 2AYLA 3LN1A 2TGFA 2XC0L 1LK9A 1P9JA 1FAXL 1QIUA 4PH9A 1CQEA 5FDQA 4AQTA 4BDXA 3U7UG 1WHFA 3NTGA 2WPJE 1MQ5L 1DDXA 3QH0A 4CUFA 2XBVL 4JZDL 2MHPA 3POYA 4NA9L 1UZQA 1EPJA 4XBMA 2H9EL 1FE2A 2FLBL 2UWPB 1DVAL 2J38B 1CEJA 2J94B 4JZEL 1W8BL 4C16A 1BF9A 2HOXA 1K37A 3N8ZA 1AUTL 2I9AA 2WPLE 2NPRA 1TPGA 4A94C 1PTHA 4O02B 4A7IA 1KSNB 1X7AL 4Y7AB 2XBWL 2KV4A 1V1HA 3KL6B 4ZXYL 2W2ME 5KIRA 2Y7ZB 2XC4L 3N8YB 2VH6B 4X8SL 3N8XA 3LTFB 4Z0LA 1A3PA 2UWLB 1LPZA 1G2MB 2XBXL 4JYUL 2XC5L 1HREA 2VVVL 3M36L 2WPME 2FZZL 5JBCE 2P94L 2WFTA 3LC5B 5F1AA 3TGFA 1EAIC 3BT2A 3KK6A 2VWOL 2WYJB 5IKVA 3N8VA 1IVOC 5E8DA 3TH3L 1IOEL 4ISIL 1YGCL 1HX2A 1OB1C 4NGAL 1MOXC 1CCVA 3N8WA 3N8WB 1KLIL 4BTTA 3H5CB 1XFEA 4ISHL 4BXSA 1ZAQA 3BT1A 3IITB 2VVCK 4RUTA 2PR3B 4OTJA 3ZYIB 2BOKL 2K2TA 3SOBB 1GK5A 3DEMA 3MQEA 5L2ZL 1XKAL 1NFUB 2CJIB 1G1SA 3F6UL 3FBYA 3HPTA 3Q3KB 3RR3A 1F0SB 1QFKL 2BMGA 3ASIA 1IQNL 3MDLA 1HAEA 2EI8B 4E1GA 1EPIA 1PRHA 1YUKB 2I9BA 3M37L 1ATBA 1IQHL 4GU4A 1N7DA 1FF7A 4NG9L 1IQGL 3Q7DA 2PHBB 2YGQA 2Y80B 2J4IB 1DIYA 4RRYA 1G1TA 1HAFA 1EBVA 1KKEA 5F19A 2VJ3A 3HS6A 5IKQA 3V65B 4D0FA 1EMOA 1KLJL 4XLWA 2W2NE 2W2QE 2BOUA 4COXA 1WU1B 2Y38A 2P26A 3HO5A 2WG3C 5EGMB 5IKRA 2P95L 2J34B 3CS7L 1ADXA 2WG4B 2BT7A 1ATEA 2RNLA 1PXXA 3OLUA 1V3XB 3CA7A 3LC3B 1J9CL 4CUDA 2KB9A 1UZJA 4O1ZA 5JB8E 2MGRA 2KL7A 3KQEL 5CISA 1HZ8A 2FD6A 1W7XL 2EI6B 1EZQB 2EI7B 5CKNA 2BOHA 5JVZA 1XDTR 1IQEL 2VRSA 2Q1JB 2UWOB 4Y79B 1IP0A 3QMOA 1APQA 2W2OE 2Y5GL 1DX5I 3LN0A 4M10A 4MMZB 1K36A 1HJ7A 3GCWE 1ATDA 1NFWB 1EPGA 4BXWA 1G1QA 2GD4A 1EPHA 2BZ6L 2BQ7A 1LMMA 2H9EC 2P3FN 1V1IA 5L30L 3TBDA 5KN5C 1Z6CA 2BQWA 2KNIA 3QCWA 2Y7XB 4RRZA 4JZFL 1U67A 1IQML 2WPKE 4ZHAB 4ZH8B 4ZAEB 1G1RA 2YGPA 1P0SL 2PUQL 2P28B 2B7DL 1TLEA 3OLTA 1IOXA 3HS7A 4D0EA 5JBBE 1C5MF 2ADXA 4RS0A 5IKTA 4CUEA 3V64C 2DDUA 2W26B 5JW1A 2K2SB 4XL1A 1FSBA 2P3UA 2RA0L 1HRFA 1HT8A 1ATAA 1FJSL 1PGEA 1SZBA 2WYGB 1IJQA 3KCGL 4X8TL 2HORA 2OYEP 1LMJA 3S6XA 4OTYA 4BTIA 1NFYB 3FCSB 2P3FL 1NT0A 3FFGL 3SOVA 1YO8A 2WPIE 4Y6DB 5L2YL 2WFXB 2JKHL 1IQKL 1HCGB 3NTBA 4Y76B 2FLGA 1APOA 1NPEB 2Y5HL 2OYUP 2Y81B 3C9AC 4X8UL 3NJPC 1U8CB 5JB9E 1RFNB 1DQBA 1FAKL 4Z6AL 2G00L 5JBAE 1LPGA 2BT8A 2YGOA 3TZIA 5I46L 1EMNA 1YUGA 3CFWA 1F7EA 3GISX 3SW2A 2VWLL 2W86A 1F0RB 3ENSA 1G2LB 1NFXB 1L3YA 3GCXE 1CVWL 3ELAL 3KQCL 3F1SB 4JYVL 2WPHE 1URKA 6COXA 4CSYA 2F9BL 3SOQA 1TOZA 2WZPP 1Q4GA 1KLOA 3R05A 2J95B 1IQFL 1WHEA 4YT6L 1XKBA 1HT5A 2J2UB 3HO4A 1I0UA 1B9WA 1YUFA 3IJEB 1COUA 4LORA 2XBYL 1EQHA 2P3TA 4Y71B 1IGZA 3HS5A 1NZIA 1MQ6L 5COXA 3K9XA 4RRWA 4Y7BB 2VWNL 2W3KB 1EGFA 1UZKA 1IGXA 1Z6EL 2VWMK 4D90A 4MMYB 1KIGL 4M11A 3LAQA 2VVUL 2BOXA 1N1IA 2MGPA 1LQDA 4ZXXL 3TK5B 4GU3A 2VH0B 3LIWB 1JV2B 3BPSE 2M74A 1FFMA 1M1XB 2W3IB 4BDWA 1JL9A
chains in the Genus database with same CATH topology
1F7MA 3U73A 3HO3A 4LMFA 1CX2A 1CVUA 1EQGA 1O5DL 3KRKA 4X8VL 2P16L 4RRXA 3ZYGA 3TK6B 1CCFA 5CKMA 1L5GB 5K0HB 3EGFA 4MMXB 2FLRL 1IQIL 2BQ6A 1LPKA 4FM5A 2RHPA 4Z0KB 3N8YA 3KQDL 4YT7L 2Y5FL 2P93L 1IQJL 4TGFA 3LTGD 3CENL 5JVYA 3ZYJB 2W2PE 1IQLL 3P5BL 2BO2A 2D1JB 4BTUA 5CKQA 4YZUB 1PFXL 1NQLB 1JBUL 1UZPA 2Y82B 3KQBL 3NT1A 3PGHA 4G1MB 2AYLA 3LN1A 2TGFA 2XC0L 1P9JA 1FAXL 4PH9A 1CQEA 5FDQA 4AQTA 4BDXA 3U7UG 1WHFA 3NTGA 2WPJE 1MQ5L 1DDXA 3QH0A 4CUFA 2XBVL 4JZDL 2MHPA 3POYA 4NA9L 1UZQA 1EPJA 4XBMA 2H9EL 1FE2A 2FLBL 2UWPB 1DVAL 2J38B 1CEJA 2J94B 4JZEL 1W8BL 4C16A 1BF9A 1K37A 3N8ZA 1AUTL 2I9AA 2WPLE 2NPRA 1TPGA 4A94C 1PTHA 4O02B 4A7IA 1KSNB 1X7AL 4Y7AB 2XBWL 2KV4A 3KL6B 4ZXYL 2W2ME 5KIRA 2Y7ZB 2XC4L 3N8YB 2VH6B 4X8SL 3N8XA 3LTFB 4Z0LA 1A3PA 2UWLB 1LPZA 1G2MB 2XBXL 4JYUL 2XC5L 1HREA 2VVVL 3M36L 2WPME 2FZZL 5JBCE 2P94L 2WFTA 3LC5B 5F1AA 3TGFA 1EAIC 3BT2A 3KK6A 2VWOL 2WYJB 5IKVA 3N8VA 1IVOC 5E8DA 3TH3L 1IOEL 4ISIL 1YGCL 1HX2A 1OB1C 4NGAL 1MOXC 1CCVA 3N8WA 3N8WB 1KLIL 4BTTA 3H5CB 1XFEA 4ISHL 4BXSA 1ZAQA 3BT1A 3IITB 2VVCK 4RUTA 2PR3B 4OTJA 3ZYIB 2BOKL 2K2TA 3SOBB 1GK5A 3DEMA 3MQEA 5L2ZL 1XKAL 1NFUB 2CJIB 1G1SA 3F6UL 3FBYA 3HPTA 3Q3KB 3RR3A 1F0SB 1QFKL 2BMGA 3ASIA 1IQNL 3MDLA 1HAEA 2EI8B 4E1GA 1EPIA 1PRHA 1YUKB 2I9BA 3M37L 1ATBA 1IQHL 1N7DA 1FF7A 4NG9L 1IQGL 3Q7DA 2PHBB 2YGQA 2Y80B 2J4IB 1DIYA 4RRYA 1G1TA 1HAFA 1EBVA 5F19A 2VJ3A 3HS6A 5IKQA 3V65B 4D0FA 1EMOA 1KLJL 4XLWA 2W2NE 2W2QE 2BOUA 4COXA 1WU1B 2Y38A 2P26A 3HO5A 2WG3C 5EGMB 5IKRA 2P95L 2J34B 3CS7L 1ADXA 2WG4B 1ATEA 2RNLA 1PXXA 3OLUA 1V3XB 3CA7A 3LC3B 1J9CL 4CUDA 2KB9A 1UZJA 4O1ZA 5JB8E 2MGRA 2KL7A 3KQEL 5CISA 1HZ8A 2FD6A 1W7XL 2EI6B 1EZQB 2EI7B 5CKNA 2BOHA 5JVZA 1XDTR 1IQEL 2Q1JB 2UWOB 4Y79B 1IP0A 3QMOA 1APQA 2W2OE 2Y5GL 1DX5I 3LN0A 4M10A 4MMZB 1K36A 1HJ7A 3GCWE 1ATDA 1NFWB 1EPGA 4BXWA 1G1QA 2GD4A 1EPHA 2BZ6L 2BQ7A 1LMMA 2H9EC 2P3FN 5L30L 3TBDA 5KN5C 1Z6CA 2BQWA 2KNIA 3QCWA 2Y7XB 4RRZA 4JZFL 1U67A 1IQML 2WPKE 4ZHAB 4ZH8B 4ZAEB 1G1RA 2YGPA 1P0SL 2PUQL 2P28B 2B7DL 1TLEA 3OLTA 1IOXA 3HS7A 4D0EA 5JBBE 1C5MF 2ADXA 4RS0A 5IKTA 4CUEA 3V64C 2DDUA 2W26B 5JW1A 2K2SB 4XL1A 1FSBA 2P3UA 2RA0L 1HRFA 1HT8A 1ATAA 1FJSL 1PGEA 1SZBA 2WYGB 1IJQA 3KCGL 4X8TL 2OYEP 1LMJA 3S6XA 4OTYA 4BTIA 1NFYB 3FCSB 2P3FL 1NT0A 3FFGL 3SOVA 1YO8A 2WPIE 4Y6DB 5L2YL 2WFXB 2JKHL 1IQKL 1HCGB 3NTBA 4Y76B 2FLGA 1APOA 1NPEB 2Y5HL 2OYUP 2Y81B 3C9AC 4X8UL 3NJPC 1U8CB 5JB9E 1RFNB 1DQBA 1FAKL 4Z6AL 2G00L 5JBAE 1LPGA 2YGOA 3TZIA 5I46L 1EMNA 1YUGA 3CFWA 1F7EA 3GISX 3SW2A 2VWLL 2W86A 1F0RB 3ENSA 1G2LB 1NFXB 1L3YA 3GCXE 1CVWL 3ELAL 3KQCL 3F1SB 4JYVL 2WPHE 1URKA 6COXA 4CSYA 2F9BL 3SOQA 1TOZA 2WZPP 1Q4GA 1KLOA 3R05A 2J95B 1IQFL 1WHEA 4YT6L 1XKBA 1HT5A 2J2UB 3HO4A 1I0UA 1B9WA 1YUFA 3IJEB 1COUA 4LORA 2XBYL 1EQHA 2P3TA 4Y71B 1IGZA 3HS5A 1NZIA 1MQ6L 5COXA 3K9XA 4RRWA 4Y7BB 2VWNL 2W3KB 1EGFA 1UZKA 1IGXA 1Z6EL 2VWMK 4D90A 4MMYB 1KIGL 4M11A 3LAQA 2VVUL 2BOXA 1N1IA 2MGPA 1LQDA 4ZXXL 3TK5B 2VH0B 3LIWB 1JV2B 3BPSE 2M74A 1FFMA 1M1XB 2W3IB 4BDWA 1JL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7M A;  3U73 A;  3HO3 A;  4LMF A;  1CX2 A;  1CVU A;  1EQG A;  1O5D L;  3KRK A;  4X8V L;  2P16 L;  4RRX A;  3ZYG A;  3TK6 B;  1CCF A;  5CKM A;  1L5G B;  5K0H B;  3EGF A;  4MMX B;  2FLR L;  1IQI L;  2BQ6 A;  1LPK A;  4FM5 A;  2RHP A;  4Z0K B;  3N8Y A;  3KQD L;  4YT7 L;  2Y5F L;  2P93 L;  1IQJ L;  4TGF A;  3LTG D;  3CEN L;  5JVY A;  3ZYJ B;  2W2P E;  1IQL L;  3P5B L;  2BO2 A;  2D1J B;  4BTU A;  5CKQ A;  4YZU B;  1PFX L;  1NQL B;  1JBU L;  1UZP A;  2Y82 B;  3KQB L;  3NT1 A;  3PGH A;  4G1M B;  2AYL A;  3LN1 A;  2TGF A;  2XC0 L;  1P9J A;  1FAX L;  4PH9 A;  1CQE A;  5FDQ A;  4AQT A;  4BDX A;  3U7U G;  1WHF A;  3NTG A;  2WPJ E;  1MQ5 L;  1DDX A;  3QH0 A;  4CUF A;  2XBV L;  4JZD L;  2MHP A;  3POY A;  4NA9 L;  1UZQ A;  1EPJ A;  4XBM A;  2H9E L;  1FE2 A;  2FLB L;  2UWP B;  1DVA L;  2J38 B;  1CEJ A;  2J94 B;  4JZE L;  1W8B L;  4C16 A;  1BF9 A;  1K37 A;  3N8Z A;  1AUT L;  2I9A A;  2WPL E;  2NPR A;  1TPG A;  1PTH A;  4O02 B;  4A7I A;  1KSN B;  1X7A L;  4Y7A B;  2XBW L;  2KV4 A;  3KL6 B;  4ZXY L;  2W2M E;  5KIR A;  2Y7Z B;  2XC4 L;  3N8Y B;  2VH6 B;  4X8S L;  3N8X A;  3LTF B;  4Z0L A;  1A3P A;  2UWL B;  1LPZ A;  1G2M B;  2XBX L;  4JYU L;  2XC5 L;  1HRE A;  2VVV L;  3M36 L;  2WPM E;  2FZZ L;  5JBC E;  2P94 L;  2WFT A;  3LC5 B;  5F1A A;  3TGF A;  1EAI C;  3BT2 A;  3KK6 A;  2VWO L;  2WYJ B;  5IKV A;  3N8V A;  1IVO C;  5E8D A;  3TH3 L;  1IOE L;  4ISI L;  1YGC L;  1HX2 A;  1OB1 C;  4NGA L;  1MOX C;  1CCV A;  3N8W A;  3N8W B;  1KLI L;  4BTT A;  3H5C B;  1XFE A;  4ISH L;  4BXS A;  1ZAQ A;  3BT1 A;  3IIT B;  2VVC K;  4RUT A;  2PR3 B;  4OTJ A;  3ZYI B;  2BOK L;  2K2T A;  3SOB B;  1GK5 A;  3DEM A;  3MQE A;  5L2Z L;  1XKA L;  1NFU B;  2CJI B;  1G1S A;  3F6U L;  3FBY A;  3HPT A;  3Q3K B;  3RR3 A;  1F0S B;  1QFK L;  2BMG A;  3ASI A;  1IQN L;  3MDL A;  1HAE A;  2EI8 B;  4E1G A;  1EPI A;  1PRH A;  1YUK B;  2I9B A;  3M37 L;  1ATB A;  1IQH L;  1N7D A;  1FF7 A;  4NG9 L;  1IQG L;  3Q7D A;  2PHB B;  2Y80 B;  2J4I B;  1DIY A;  4RRY A;  1G1T A;  1HAF A;  1EBV A;  5F19 A;  2VJ3 A;  3HS6 A;  5IKQ A;  3V65 B;  4D0F A;  1EMO A;  1KLJ L;  4XLW A;  2W2N E;  2W2Q E;  2BOU A;  4COX A;  1WU1 B;  2Y38 A;  2P26 A;  3HO5 A;  2WG3 C;  5EGM B;  5IKR A;  2P95 L;  2J34 B;  3CS7 L;  1ADX A;  2WG4 B;  1ATE A;  2RNL A;  1PXX A;  3OLU A;  1V3X B;  3CA7 A;  3LC3 B;  1J9C L;  4CUD A;  2KB9 A;  1UZJ A;  4O1Z A;  5JB8 E;  2MGR A;  2KL7 A;  3KQE L;  5CIS A;  1HZ8 A;  2FD6 A;  1W7X L;  2EI6 B;  1EZQ B;  2EI7 B;  5CKN A;  2BOH A;  5JVZ A;  1XDT R;  1IQE L;  2Q1J B;  2UWO B;  4Y79 B;  1IP0 A;  3QMO A;  1APQ A;  2W2O E;  2Y5G L;  1DX5 I;  3LN0 A;  4M10 A;  4MMZ B;  1K36 A;  1HJ7 A;  3GCW E;  1ATD A;  1NFW B;  1EPG A;  4BXW A;  1G1Q A;  2GD4 A;  1EPH A;  2BZ6 L;  2BQ7 A;  2P3F N;  5L30 L;  3TBD A;  5KN5 C;  1Z6C A;  2BQW A;  4RRZ A;  3QCW A;  2Y7X B;  4JZF L;  1U67 A;  1IQM L;  2WPK E;  4ZHA B;  4ZH8 B;  4ZAE B;  1G1R A;  2YGP A;  1P0S L;  2PUQ L;  2P28 B;  2B7D L;  1TLE A;  3OLT A;  1IOX A;  3HS7 A;  4D0E A;  5JBB E;  1C5M F;  2ADX A;  4RS0 A;  5IKT A;  4CUE A;  3V64 C;  2DDU A;  2W26 B;  5JW1 A;  2K2S B;  4XL1 A;  1FSB A;  2P3U A;  2RA0 L;  1HRF A;  1HT8 A;  1ATA A;  1FJS L;  1PGE A;  1SZB A;  2WYG B;  1IJQ A;  3KCG L;  4X8T L;  2OYE P;  1LMJ A;  4OTY A;  4BTI A;  1NFY B;  3FCS B;  2P3F L;  1NT0 A;  3FFG L;  3SOV A;  1YO8 A;  2WPI E;  4Y6D B;  5L2Y L;  2WFX B;  2JKH L;  1IQK L;  1HCG B;  3NTB A;  4Y76 B;  2FLG A;  1APO A;  1NPE B;  2Y5H L;  2OYU P;  2Y81 B;  3C9A C;  4X8U L;  3NJP C;  1U8C B;  5JB9 E;  1RFN B;  1DQB A;  1FAK L;  4Z6A L;  2G00 L;  5JBA E;  1LPG A;  2YGO A;  3TZI A;  5I46 L;  1EMN A;  1YUG A;  3CFW A;  1F7E A;  3GIS X;  3SW2 A;  2VWL L;  2W86 A;  1F0R B;  3ENS A;  1G2L B;  1NFX B;  1L3Y A;  3GCX E;  1CVW L;  3ELA L;  3KQC L;  3F1S B;  4JYV L;  2WPH E;  1URK A;  6COX A;  4CSY A;  2F9B L;  3SOQ A;  1TOZ A;  1Q4G A;  1KLO A;  3R05 A;  2J95 B;  1IQF L;  1WHE A;  4YT6 L;  1XKB A;  1HT5 A;  2J2U B;  3HO4 A;  1I0U A;  1B9W A;  1YUF A;  3IJE B;  1COU A;  4LOR A;  2XBY L;  1EQH A;  2P3T A;  4Y71 B;  1IGZ A;  3HS5 A;  1NZI A;  1MQ6 L;  5COX A;  3K9X A;  4RRW A;  4Y7B B;  2VWN L;  2W3K B;  1EGF A;  1UZK A;  1IGX A;  1Z6E L;  2VWM K;  4D90 A;  4MMY B;  1KIG L;  4M11 A;  3LAQ A;  2VVU L;  2BOX A;  1N1I A;  2MGP A;  1LQD A;  4ZXX L;  3TK5 B;  2VH0 B;  3LIW B;  1JV2 B;  3BPS E;  2M74 A;  1FFM A;  1M1X B;  2W3I B;  4BDW A;  1JL9 A; 
#chains in the Genus database with same CATH topology
 1F7M A;  3U73 A;  3HO3 A;  4LMF A;  1CX2 A;  1CVU A;  1EQG A;  1O5D L;  3KRK A;  4X8V L;  2P16 L;  4RRX A;  3ZYG A;  3TK6 B;  1CCF A;  5CKM A;  1L5G B;  5K0H B;  3EGF A;  4MMX B;  2FLR L;  1IQI L;  2BQ6 A;  1LPK A;  2JJL A;  4FM5 A;  2RHP A;  4Z0K B;  3N8Y A;  3KQD L;  4YT7 L;  2Y5F L;  2P93 L;  1IQJ L;  4TGF A;  3LTG D;  3CEN L;  5JVY A;  3ZYJ B;  2W2P E;  1IQL L;  3P5B L;  2BO2 A;  2BSF A;  2D1J B;  4BTU A;  5CKQ A;  4YZU B;  1PFX L;  1NQL B;  1JBU L;  1UZP A;  2Y82 B;  3KQB L;  3NT1 A;  3PGH A;  4G1M B;  2AYL A;  3LN1 A;  2TGF A;  2XC0 L;  1LK9 A;  1P9J A;  1FAX L;  1QIU A;  4PH9 A;  1CQE A;  5FDQ A;  4AQT A;  4BDX A;  3U7U G;  1WHF A;  3NTG A;  2WPJ E;  1MQ5 L;  1DDX A;  3QH0 A;  4CUF A;  2XBV L;  4JZD L;  2MHP A;  3POY A;  4NA9 L;  1UZQ A;  1EPJ A;  4XBM A;  2H9E L;  1FE2 A;  2FLB L;  2UWP B;  1DVA L;  2J38 B;  1CEJ A;  2J94 B;  4JZE L;  1W8B L;  4C16 A;  1BF9 A;  2HOX A;  1K37 A;  3N8Z A;  1AUT L;  2I9A A;  2WPL E;  2NPR A;  1TPG A;  4A94 C;  1PTH A;  4O02 B;  4A7I A;  1KSN B;  1X7A L;  4Y7A B;  2XBW L;  2KV4 A;  1V1H A;  3KL6 B;  4ZXY L;  2W2M E;  5KIR A;  2Y7Z B;  2XC4 L;  3N8Y B;  2VH6 B;  4X8S L;  3N8X A;  3LTF B;  4Z0L A;  1A3P A;  2UWL B;  1LPZ A;  1G2M B;  2XBX L;  4JYU L;  2XC5 L;  1HRE A;  2VVV L;  3M36 L;  2WPM E;  2FZZ L;  5JBC E;  2P94 L;  2WFT A;  3LC5 B;  5F1A A;  3TGF A;  1EAI C;  3BT2 A;  3KK6 A;  2VWO L;  2WYJ B;  5IKV A;  3N8V A;  1IVO C;  5E8D A;  3TH3 L;  1IOE L;  4ISI L;  1YGC L;  1HX2 A;  1OB1 C;  4NGA L;  1MOX C;  1CCV A;  3N8W A;  3N8W B;  1KLI L;  4BTT A;  3H5C B;  1XFE A;  4ISH L;  4BXS A;  1ZAQ A;  3BT1 A;  3IIT B;  2VVC K;  4RUT A;  2PR3 B;  4OTJ A;  3ZYI B;  2BOK L;  2K2T A;  3SOB B;  1GK5 A;  3DEM A;  3MQE A;  5L2Z L;  1XKA L;  1NFU B;  2CJI B;  1G1S A;  3F6U L;  3FBY A;  3HPT A;  3Q3K B;  3RR3 A;  1F0S B;  1QFK L;  2BMG A;  3ASI A;  1IQN L;  3MDL A;  1HAE A;  2EI8 B;  4E1G A;  1EPI A;  1PRH A;  1YUK B;  2I9B A;  3M37 L;  1ATB A;  1IQH L;  4GU4 A;  1N7D A;  1FF7 A;  4NG9 L;  1IQG L;  3Q7D A;  2PHB B;  2YGQ A;  2Y80 B;  2J4I B;  1DIY A;  4RRY A;  1G1T A;  1HAF A;  1EBV A;  1KKE A;  5F19 A;  2VJ3 A;  3HS6 A;  5IKQ A;  3V65 B;  4D0F A;  1EMO A;  1KLJ L;  4XLW A;  2W2N E;  2W2Q E;  2BOU A;  4COX A;  1WU1 B;  2Y38 A;  2P26 A;  3HO5 A;  2WG3 C;  5EGM B;  5IKR A;  2P95 L;  2J34 B;  3CS7 L;  1ADX A;  2WG4 B;  2BT7 A;  1ATE A;  2RNL A;  1PXX A;  3OLU A;  1V3X B;  3CA7 A;  3LC3 B;  1J9C L;  4CUD A;  2KB9 A;  1UZJ A;  4O1Z A;  5JB8 E;  2MGR A;  2KL7 A;  3KQE L;  5CIS A;  1HZ8 A;  2FD6 A;  1W7X L;  2EI6 B;  1EZQ B;  2EI7 B;  5CKN A;  2BOH A;  5JVZ A;  1XDT R;  1IQE L;  2VRS A;  2Q1J B;  2UWO B;  4Y79 B;  1IP0 A;  3QMO A;  1APQ A;  2W2O E;  2Y5G L;  1DX5 I;  3LN0 A;  4M10 A;  4MMZ B;  1K36 A;  1HJ7 A;  3GCW E;  1ATD A;  1NFW B;  1EPG A;  4BXW A;  1G1Q A;  2GD4 A;  1EPH A;  2BZ6 L;  2BQ7 A;  1LMM A;  2H9E C;  2P3F N;  1V1I A;  5L30 L;  3TBD A;  5KN5 C;  1Z6C A;  2BQW A;  2KNI A;  3QCW A;  2Y7X B;  4RRZ A;  4JZF L;  1U67 A;  1IQM L;  2WPK E;  4ZHA B;  4ZH8 B;  4ZAE B;  1G1R A;  2YGP A;  1P0S L;  2PUQ L;  2P28 B;  2B7D L;  1TLE A;  3OLT A;  1IOX A;  3HS7 A;  4D0E A;  5JBB E;  1C5M F;  2ADX A;  4RS0 A;  5IKT A;  4CUE A;  3V64 C;  2DDU A;  2W26 B;  5JW1 A;  2K2S B;  4XL1 A;  1FSB A;  2P3U A;  2RA0 L;  1HRF A;  1HT8 A;  1ATA A;  1FJS L;  1PGE A;  1SZB A;  2WYG B;  1IJQ A;  3KCG L;  4X8T L;  2HOR A;  2OYE P;  1LMJ A;  3S6X A;  4OTY A;  4BTI A;  1NFY B;  3FCS B;  2P3F L;  1NT0 A;  3FFG L;  3SOV A;  1YO8 A;  2WPI E;  4Y6D B;  5L2Y L;  2WFX B;  2JKH L;  1IQK L;  1HCG B;  3NTB A;  4Y76 B;  2FLG A;  1APO A;  1NPE B;  2Y5H L;  2OYU P;  2Y81 B;  3C9A C;  4X8U L;  3NJP C;  1U8C B;  5JB9 E;  1RFN B;  1DQB A;  1FAK L;  4Z6A L;  2G00 L;  5JBA E;  1LPG A;  2BT8 A;  2YGO A;  3TZI A;  5I46 L;  1EMN A;  1YUG A;  3CFW A;  1F7E A;  3GIS X;  3SW2 A;  2VWL L;  2W86 A;  1F0R B;  3ENS A;  1G2L B;  1NFX B;  1L3Y A;  3GCX E;  1CVW L;  3ELA L;  3KQC L;  3F1S B;  4JYV L;  2WPH E;  1URK A;  6COX A;  4CSY A;  2F9B L;  3SOQ A;  1TOZ A;  2WZP P;  1Q4G A;  1KLO A;  3R05 A;  2J95 B;  1IQF L;  1WHE A;  4YT6 L;  1XKB A;  1HT5 A;  2J2U B;  3HO4 A;  1I0U A;  1B9W A;  1YUF A;  3IJE B;  1COU A;  4LOR A;  2XBY L;  1EQH A;  2P3T A;  4Y71 B;  1IGZ A;  3HS5 A;  1NZI A;  1MQ6 L;  5COX A;  3K9X A;  4RRW A;  4Y7B B;  2VWN L;  2W3K B;  1EGF A;  1UZK A;  1IGX A;  1Z6E L;  2VWM K;  4D90 A;  4MMY B;  1KIG L;  4M11 A;  3LAQ A;  2VVU L;  2BOX A;  1N1I A;  2MGP A;  1LQD A;  4ZXX L;  3TK5 B;  4GU3 A;  2VH0 B;  3LIW B;  1JV2 B;  3BPS E;  2M74 A;  1FFM A;  1M1X B;  2W3I B;  4BDW A;  1JL9 A; 
#chains in the Genus database with same CATH homology
 1F7M A;  3U73 A;  3HO3 A;  4LMF A;  1CX2 A;  1CVU A;  1EQG A;  1O5D L;  3KRK A;  4X8V L;  2P16 L;  4RRX A;  3ZYG A;  3TK6 B;  1CCF A;  5CKM A;  1L5G B;  5K0H B;  3EGF A;  4MMX B;  2FLR L;  1IQI L;  2BQ6 A;  1LPK A;  4FM5 A;  2RHP A;  4Z0K B;  3N8Y A;  3KQD L;  4YT7 L;  2Y5F L;  2P93 L;  1IQJ L;  4TGF A;  3LTG D;  3CEN L;  5JVY A;  3ZYJ B;  2W2P E;  1IQL L;  3P5B L;  2BO2 A;  2D1J B;  4BTU A;  5CKQ A;  4YZU B;  1PFX L;  1NQL B;  1JBU L;  1UZP A;  2Y82 B;  3KQB L;  3NT1 A;  3PGH A;  4G1M B;  2AYL A;  3LN1 A;  2TGF A;  2XC0 L;  1P9J A;  1FAX L;  4PH9 A;  1CQE A;  5FDQ A;  4AQT A;  4BDX A;  3U7U G;  1WHF A;  3NTG A;  2WPJ E;  1MQ5 L;  1DDX A;  3QH0 A;  4CUF A;  2XBV L;  4JZD L;  2MHP A;  3POY A;  4NA9 L;  1UZQ A;  1EPJ A;  4XBM A;  2H9E L;  1FE2 A;  2FLB L;  2UWP B;  1DVA L;  2J38 B;  1CEJ A;  2J94 B;  4JZE L;  1W8B L;  4C16 A;  1BF9 A;  1K37 A;  3N8Z A;  1AUT L;  2I9A A;  2WPL E;  2NPR A;  1TPG A;  4A94 C;  1PTH A;  4O02 B;  4A7I A;  1KSN B;  1X7A L;  4Y7A B;  2XBW L;  2KV4 A;  3KL6 B;  4ZXY L;  2W2M E;  5KIR A;  2Y7Z B;  2XC4 L;  3N8Y B;  2VH6 B;  4X8S L;  3N8X A;  3LTF B;  4Z0L A;  1A3P A;  2UWL B;  1LPZ A;  1G2M B;  2XBX L;  4JYU L;  2XC5 L;  1HRE A;  2VVV L;  3M36 L;  2WPM E;  2FZZ L;  5JBC E;  2P94 L;  2WFT A;  3LC5 B;  5F1A A;  3TGF A;  1EAI C;  3BT2 A;  3KK6 A;  2VWO L;  2WYJ B;  5IKV A;  3N8V A;  1IVO C;  5E8D A;  3TH3 L;  1IOE L;  4ISI L;  1YGC L;  1HX2 A;  1OB1 C;  4NGA L;  1MOX C;  1CCV A;  3N8W A;  3N8W B;  1KLI L;  4BTT A;  3H5C B;  1XFE A;  4ISH L;  4BXS A;  1ZAQ A;  3BT1 A;  3IIT B;  2VVC K;  4RUT A;  2PR3 B;  4OTJ A;  3ZYI B;  2BOK L;  2K2T A;  3SOB B;  1GK5 A;  3DEM A;  3MQE A;  5L2Z L;  1XKA L;  1NFU B;  2CJI B;  1G1S A;  3F6U L;  3FBY A;  3HPT A;  3Q3K B;  3RR3 A;  1F0S B;  1QFK L;  2BMG A;  3ASI A;  1IQN L;  3MDL A;  1HAE A;  2EI8 B;  4E1G A;  1EPI A;  1PRH A;  1YUK B;  2I9B A;  3M37 L;  1ATB A;  1IQH L;  1N7D A;  1FF7 A;  4NG9 L;  1IQG L;  3Q7D A;  2PHB B;  2YGQ A;  2Y80 B;  2J4I B;  1DIY A;  4RRY A;  1G1T A;  1HAF A;  1EBV A;  5F19 A;  2VJ3 A;  3HS6 A;  5IKQ A;  3V65 B;  4D0F A;  1EMO A;  1KLJ L;  4XLW A;  2W2N E;  2W2Q E;  2BOU A;  4COX A;  1WU1 B;  2Y38 A;  2P26 A;  3HO5 A;  2WG3 C;  5EGM B;  5IKR A;  2P95 L;  2J34 B;  3CS7 L;  1ADX A;  2WG4 B;  1ATE A;  2RNL A;  1PXX A;  3OLU A;  1V3X B;  3CA7 A;  3LC3 B;  1J9C L;  4CUD A;  2KB9 A;  1UZJ A;  4O1Z A;  5JB8 E;  2MGR A;  2KL7 A;  3KQE L;  5CIS A;  1HZ8 A;  2FD6 A;  1W7X L;  2EI6 B;  1EZQ B;  2EI7 B;  5CKN A;  2BOH A;  5JVZ A;  1XDT R;  1IQE L;  2Q1J B;  2UWO B;  4Y79 B;  1IP0 A;  3QMO A;  1APQ A;  2W2O E;  2Y5G L;  1DX5 I;  3LN0 A;  4M10 A;  4MMZ B;  1K36 A;  1HJ7 A;  3GCW E;  1ATD A;  1NFW B;  1EPG A;  4BXW A;  1G1Q A;  2GD4 A;  1EPH A;  2BZ6 L;  2BQ7 A;  1LMM A;  2H9E C;  2P3F N;  5L30 L;  3TBD A;  5KN5 C;  1Z6C A;  2BQW A;  2KNI A;  3QCW A;  2Y7X B;  4RRZ A;  4JZF L;  1U67 A;  1IQM L;  2WPK E;  4ZHA B;  4ZH8 B;  4ZAE B;  1G1R A;  2YGP A;  1P0S L;  2PUQ L;  2P28 B;  2B7D L;  1TLE A;  3OLT A;  1IOX A;  3HS7 A;  4D0E A;  5JBB E;  1C5M F;  2ADX A;  4RS0 A;  5IKT A;  4CUE A;  3V64 C;  2DDU A;  2W26 B;  5JW1 A;  2K2S B;  4XL1 A;  1FSB A;  2P3U A;  2RA0 L;  1HRF A;  1HT8 A;  1ATA A;  1FJS L;  1PGE A;  1SZB A;  2WYG B;  1IJQ A;  3KCG L;  4X8T L;  2OYE P;  1LMJ A;  3S6X A;  4OTY A;  4BTI A;  1NFY B;  3FCS B;  2P3F L;  1NT0 A;  3FFG L;  3SOV A;  1YO8 A;  2WPI E;  4Y6D B;  5L2Y L;  2WFX B;  2JKH L;  1IQK L;  1HCG B;  3NTB A;  4Y76 B;  2FLG A;  1APO A;  1NPE B;  2Y5H L;  2OYU P;  2Y81 B;  3C9A C;  4X8U L;  3NJP C;  1U8C B;  5JB9 E;  1RFN B;  1DQB A;  1FAK L;  4Z6A L;  2G00 L;  5JBA E;  1LPG A;  2YGO A;  3TZI A;  5I46 L;  1EMN A;  1YUG A;  3CFW A;  1F7E A;  3GIS X;  3SW2 A;  2VWL L;  2W86 A;  1F0R B;  3ENS A;  1G2L B;  1NFX B;  1L3Y A;  3GCX E;  1CVW L;  3ELA L;  3KQC L;  3F1S B;  4JYV L;  2WPH E;  1URK A;  6COX A;  4CSY A;  2F9B L;  3SOQ A;  1TOZ A;  2WZP P;  1Q4G A;  1KLO A;  3R05 A;  2J95 B;  1IQF L;  1WHE A;  4YT6 L;  1XKB A;  1HT5 A;  2J2U B;  3HO4 A;  1I0U A;  1B9W A;  1YUF A;  3IJE B;  1COU A;  4LOR A;  2XBY L;  1EQH A;  2P3T A;  4Y71 B;  1IGZ A;  3HS5 A;  1NZI A;  1MQ6 L;  5COX A;  3K9X A;  4RRW A;  4Y7B B;  2VWN L;  2W3K B;  1EGF A;  1UZK A;  1IGX A;  1Z6E L;  2VWM K;  4D90 A;  4MMY B;  1KIG L;  4M11 A;  3LAQ A;  2VVU L;  2BOX A;  1N1I A;  2MGP A;  1LQD A;  4ZXX L;  3TK5 B;  2VH0 B;  3LIW B;  1JV2 B;  3BPS E;  2M74 A;  1FFM A;  1M1X B;  2W3I B;  4BDW A;  1JL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...