1EQHA

The 2.7 angstrom model of ovine cox-1 complexed with flurbiprofen
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
551
structure length
551
Chain Sequence
VNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of NSAID binding by prostaglandin H2 synthase: time-dependent and time-independent inhibitors elicit identical enzyme conformations.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROSTAGLANDIN H2 SYNTHASE-1
total genus 192
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 2000-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 1eqhA02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1eqhA01
1GK5A 1CX2A 2QQTA 1YUGA 3HO4A 3NT1A 4G1MB 3M37L 3NIUA 2PT3A 1XFEA 2H9EL 2AYLA 5JB8E 2GD4A 1XKBA 4HHRA 2BZ6L 5FDQA 1EGFA 3M36L 1HAEA 2Y81B 3LN0A 2OYEP 2WYJB 2J4IB 5L30L 2XBXL 1N1IA 2WPIE 1NZIA 2D1JB 4ZAEB 2MGPA 3KQBL 4BXWA 1HCGB 3ELAL 3LIWB 1IQIL 3HO5A 3R5QA 2I9BA 5JB9E 3KQDL 4ZXYL 3U7UG 3HS7A 1MHLC 4CUEA 3KL6B 1ATEA 5KIRA 1IQEL 1IOXA 5IKVA 1M1XB 2TGFA 3Q3KB 2YGPA 3IITB 1PXXA 3QL6A 1L5GB 1Z6EL 5CKNA 2WPHE 2XBWL 2R5LA 3V6QA 1UZJA 3TK5B 3PGHA 4JZEL 3QF1A 2OYUP 3GCLA 1IGXA 4D0EA 2UWOB 4TGFA 5HPWA 4JYUL 6COXA 2W3KB 5JVZA 4FM5A 3NAKA 2BQWA 3U73A 2J2UB 4MSFA 3ZYGA 1EBVA 3BPSE 3QH0A 1U8CB 1RFNB 4CUDA 1TOZA 3N8YA 2IKCA 1J9CL 3MDLA 3FNLA 1KIGL 1NFWB 1NFYB 1EQHA 1SZBA 4Y71B 4PNXA 2P28B 1P0SL 5EGMB 4Y79B 1AUTL 3BT2A 1FSBA 3N8ZA 3OLUA 2PUQL 3OLTA 4OEKA 3GC1A 2XC5L 1CVUA 4KVJA 1YUFA 3Q7DA 3NTGA 2W3IB 4GN6A 2BO2A 1IJQA 3ENSA 1G2MB 4PH9A 1EZQB 1HRFA 1DVAL 1A3PA 2J94B 3R4XA 2WYGB 3K9XA 1FFMA 3TK6B 1APQA 2OJVA 1IQLL 1U67A 1F7MA 5JW1A 1ADXA 5CKQA 2FLRL 5CISA 2Z5ZA 2P3UA 4Z0KB 2W2OE 2VVVL 1IQML 2Y80B 4ZXXL 1W8BL 1EPIA 1DQBA 2VWNL 2FD6A 4HHSA 1EPHA 4MMXB 3FCSB 3HS6A 2EI6B 3TBDA 4X8TL 1CQEA 5FF1A 2GJMA 1IQFL 1B9WA 2K2TA 4BTIA 2YGOA 1NPEB 2P16L 4BDWA 3DEMA 2EFBA 1XDTR 2QPKA 2MHPA 1QFKL 3SXVA 1UZPA 2EHAA 2Q1JB 2NPRA 5CKMA 2M74A 4Z6AL 4M10A 2K2SB 2Y82B 2EI7B 2W2PE 1EMOA 1W7XL 3FBYA 5IKRA 1D2VC 1YO8A 3F6UL 3SOVA 4QJQA 1NQLB 3F1SB 2VVUL 5L2YL 5B72A 4N7AA 2UWPB 2RNLA 5F19A 5F1AA 2W2ME 4BTUA 5GH0A 4ZH8B 1APOA 3QCWA 3EGFA 2XC4L 1PFXL 2Y5HL 4X8UL 4Y55A 5IKQA 3GISX 1ZAQA 2JKHL 1HJ7A 1K37A 3ERHA 4MMYB 4RS0A 1FAKL 1EPJA 2W26B 1CEJA 1Q4GA 4E1GA 1PTHA 3SW2A 3NJPC 1HX2A 1TLEA 4Y7AB 5KN5C 3PY4A 3GCJA 1FAXL 3RR3A 1IVOC 3I6NA 2BOUA 3QMOA 4ZHAB 1FE2A 1LPZA 1MOXC 2E9EA 1KLOA 2F9BL 3F9PC 3LC3B 1F7EA 2W86A 1HAFA 2P95L 1JBUL 1FJSL 1KLJL 1ATDA 1WU1B 2DDUA 1DNUC 3UBAA 2P93L 4YZUB 2WPJE 1G1SA 2BOKL 1D7WC 4D0FA 4XL1A 2O86A 1PRHA 2G00L 2WG3C 1FF7A 2WG4B 1JV2B 3NYHA 5JVYA 1NT0A 2PUMA 1EQGA 3LN1A 2J95B 3BT1A 4NGAL 4Y6DB 1L3YA 1COUA 2WPME 1HT5A 3V64C 3LTFB 4CSYA 3N8WA 2J38B 4ISIL 2EI8B 2Y5FL 2KL7A 1LPKA 2ADXA 5FIWC 4JZDL 2PR3B 4RRZA 1ATAA 3GCKA 4NG9L 2IPSA 3HO3A 4RUTA 1ATBA 2WFTA 1DNWC 4JZFL 2RA0L 2Y38A 1CCFA 3BXIA 5JBAE 3S4FA 1OB1C 4M11A 3MQEA 3NTBA 4C1MC 2BQ6A 5E8DA 2J34B 3KQEL 4D90A 4KVLA 3ERIA 4KVKA 4QYQA 1P9JA 5JBCE 2VWLL 3RKEA 3V65B 2W2QE 2Y5GL 4LJJA 1K36A 4OTJA 3SOBB 3TGYA 4RRYA 2FZZL 2BOHA 1URKA 1YUKB 3Q9KA 4KSZA 1BF9A 4Y7BB 2WFXB 1HREA 3KQCL 2MGRA 2P3FN 3TH3L 2VWMK 2NQXA 4C16A 5GLSA 1F0SB 1IP0A 4CUFA 1HZ8A 1G1RA 3KK6A 2KV4A 1IQGL 3CENL 3FFGL 4RRWA 1MQ6L 1NFXB 1G2LB 2P3TA 4O02B 1KSNB 4NJBA 3H5CB 1IGZA 4BXSA 3N8VA 3GCWE 5I46L 1KLIL 2XBVL 1YGCL 2WPLE 3GCXE 3ZYJB 1IQHL 3SOQA 2FLBL 1DX5I 2QRBA 4A7IA 1XKAL 2PHBB 4JYVL 1CCVA 1HT8A 2CJIB 2P26A 4Z0LA 3LTGD 1Z6CA 3HS5A 1PGEA 1DIYA 4BTTA 4XBMA 4AQTA 5IKTA 5L2ZL 3CA7A 2FLGA 4YT7L 1I0UA 4DL1C 3R55A 2KB9A 4X8SL 3FAQA 1CXPC 4OTYA 1IQJL 4IG5A 3TGFA 4NT3A 5JBBE 2B7DL 3ZS0C 4LORA 1LQDA 1DDXA 2BMGA 3N8FA 1UZQA 3R05A 4ISHL 1IQNL 3IJEB 2P3FL 3KRQA 1MQ5L 3C9AC 4O1ZA 2RHPA 4YT6L 1EMNA 2VH0B 3CS7L 3TZIA 2I9AA 2VJ3A 4MMZB 4X8VL 4RRXA 1WHFA 5COXA 2W2NE 3N8WB 2VVCK 1MYPC 1X7AL 3KCGL 3P5BL 4GM7A 5K0HB 2BOXA 2VH6B 1G1QA 3OGWA 3ZYIB 1C5MF 2XC0L 1CVWL 4NA9L 1LPGA 1D5LC 3ASIA 3N8XA 4BDXA 1IOEL 2UWLB 1JL9A 4XLWA 1IQKL 3POYA 1EPGA 1EAIC 2Y7ZB 1F0RB 2VWOL 2BQ7A 3KRKA 1UZKA 3LAQA 4LMFA 3CFWA 2Y7XB 1V3XB 1N7DA 1O5DL 3LC5B 2P94L 4COXA 1NFUB 3HPTA 3ZS1C 2XBYL 1TPGA 3N8YB 3R5OA 1G1TA 1LMJA 2WPKE 4Y76B 1WHEA
chains in the Genus database with same CATH superfamily
1GK5A 1CX2A 2QQTA 1YUGA 3HO4A 3NT1A 4G1MB 3M37L 3NIUA 2PT3A 1XFEA 2H9EL 2AYLA 5JB8E 2GD4A 1XKBA 4HHRA 2BZ6L 1QIUA 5FDQA 1EGFA 3M36L 1LMMA 1HAEA 2Y81B 3LN0A 2OYEP 2WYJB 2J4IB 5L30L 2XBXL 1N1IA 2WPIE 1NZIA 2D1JB 4ZAEB 2MGPA 3KQBL 4BXWA 1HCGB 3ELAL 3LIWB 1IQIL 3HO5A 3R5QA 2I9BA 5JB9E 3KQDL 4ZXYL 3U7UG 3HS7A 1MHLC 4CUEA 3KL6B 1ATEA 5KIRA 1IQEL 1IOXA 5IKVA 1M1XB 2TGFA 3Q3KB 2YGPA 3IITB 1PXXA 3QL6A 1L5GB 1Z6EL 5CKNA 2WPHE 2XBWL 2R5LA 1LK9A 3V6QA 1UZJA 3TK5B 3PGHA 4JZEL 3QF1A 2OYUP 3GCLA 1IGXA 4D0EA 2UWOB 4TGFA 5HPWA 4JYUL 6COXA 2W3KB 5JVZA 4FM5A 3NAKA 2BQWA 3U73A 2J2UB 4MSFA 3ZYGA 1EBVA 3BPSE 3QH0A 1U8CB 1RFNB 4CUDA 1TOZA 3N8YA 2IKCA 1J9CL 3MDLA 3FNLA 1KIGL 1NFWB 1NFYB 1EQHA 1SZBA 4Y71B 4PNXA 2P28B 1P0SL 5EGMB 4Y79B 1AUTL 3BT2A 1FSBA 3N8ZA 3OLUA 2PUQL 3OLTA 4OEKA 3GC1A 2XC5L 1CVUA 4KVJA 1YUFA 3Q7DA 3NTGA 2W3IB 4GN6A 2BO2A 1IJQA 2VRSA 3ENSA 1G2MB 4PH9A 1EZQB 1HRFA 1DVAL 1A3PA 2J94B 3R4XA 2WYGB 3K9XA 1FFMA 3TK6B 1APQA 2OJVA 1IQLL 1U67A 1F7MA 5JW1A 1ADXA 5CKQA 2FLRL 5CISA 2Z5ZA 2P3UA 4Z0KB 2W2OE 2VVVL 1IQML 2Y80B 4ZXXL 1W8BL 1EPIA 1DQBA 2VWNL 2FD6A 4HHSA 1EPHA 4MMXB 3FCSB 3HS6A 2EI6B 3TBDA 4X8TL 1CQEA 5FF1A 2YGQA 2GJMA 1IQFL 1B9WA 2K2TA 4BTIA 2YGOA 1NPEB 2P16L 4BDWA 3DEMA 2EFBA 1XDTR 2QPKA 2MHPA 1QFKL 3SXVA 1UZPA 2EHAA 2NPRA 2Q1JB 5CKMA 2M74A 4Z6AL 4M10A 2K2SB 2Y82B 2EI7B 2W2PE 1EMOA 1W7XL 3FBYA 5IKRA 1D2VC 1YO8A 3F6UL 3SOVA 4QJQA 4A94C 1NQLB 3F1SB 2VVUL 5L2YL 5B72A 4N7AA 2UWPB 2RNLA 5F19A 5F1AA 2W2ME 4BTUA 5GH0A 4ZH8B 1APOA 3QCWA 3EGFA 2XC4L 1PFXL 2Y5HL 4X8UL 4Y55A 5IKQA 3GISX 1ZAQA 2JKHL 1HJ7A 1K37A 2BT7A 3ERHA 4MMYB 4RS0A 1FAKL 1EPJA 2W26B 1CEJA 1Q4GA 4E1GA 1PTHA 3SW2A 3NJPC 1HX2A 1TLEA 4Y7AB 5KN5C 3PY4A 3GCJA 1FAXL 3RR3A 1IVOC 3I6NA 2BOUA 3QMOA 2WZPP 4ZHAB 1FE2A 1LPZA 1MOXC 2E9EA 1KLOA 2F9BL 3F9PC 3LC3B 1F7EA 2W86A 1HAFA 2P95L 1JBUL 1FJSL 1KLJL 1ATDA 1WU1B 2DDUA 1DNUC 3UBAA 2P93L 4YZUB 2WPJE 1G1SA 2BOKL 1D7WC 2BT8A 4D0FA 2JJLA 4XL1A 2O86A 1PRHA 2G00L 2WG3C 1FF7A 2WG4B 1JV2B 3NYHA 5JVYA 1NT0A 2PUMA 1EQGA 3LN1A 2BSFA 2J95B 3BT1A 4NGAL 4Y6DB 1L3YA 1COUA 2WPME 1HT5A 3V64C 3LTFB 4CSYA 3N8WA 2J38B 4ISIL 2EI8B 2Y5FL 2KL7A 1LPKA 2ADXA 5FIWC 1V1HA 4JZDL 2PR3B 4RRZA 1ATAA 3GCKA 4NG9L 2IPSA 3HO3A 4RUTA 1ATBA 2WFTA 1DNWC 4JZFL 2RA0L 2Y38A 1CCFA 3BXIA 4GU3A 5JBAE 3S4FA 1OB1C 4M11A 3MQEA 3NTBA 4C1MC 2BQ6A 5E8DA 2J34B 3KQEL 4D90A 4KVLA 3ERIA 4KVKA 4QYQA 1P9JA 5JBCE 2VWLL 3RKEA 3V65B 2W2QE 2Y5GL 4LJJA 1K36A 4OTJA 3SOBB 3TGYA 4RRYA 2FZZL 2BOHA 1URKA 1YUKB 3Q9KA 4KSZA 1BF9A 4Y7BB 2WFXB 1HREA 3KQCL 2MGRA 2P3FN 3TH3L 2VWMK 2NQXA 4C16A 5GLSA 1F0SB 1IP0A 4CUFA 1HZ8A 1G1RA 3KK6A 2KV4A 1IQGL 3CENL 3FFGL 4RRWA 1MQ6L 1NFXB 1G2LB 2P3TA 4O02B 1KSNB 4NJBA 2H9EC 3H5CB 1IGZA 4BXSA 3N8VA 3GCWE 5I46L 1KLIL 2XBVL 1YGCL 2WPLE 3GCXE 3ZYJB 1IQHL 3SOQA 2FLBL 1DX5I 2QRBA 4A7IA 1XKAL 2HORA 2PHBB 4JYVL 1CCVA 1HT8A 2CJIB 2P26A 4Z0LA 3LTGD 1Z6CA 3HS5A 1PGEA 1DIYA 4BTTA 4XBMA 4AQTA 5IKTA 5L2ZL 3CA7A 2FLGA 4YT7L 1I0UA 4DL1C 3R55A 2KB9A 4X8SL 3FAQA 1CXPC 4OTYA 1IQJL 4IG5A 3TGFA 4NT3A 5JBBE 2B7DL 3ZS0C 4LORA 2KNIA 1LQDA 1DDXA 2BMGA 3N8FA 1UZQA 3R05A 4ISHL 1IQNL 3IJEB 2P3FL 3KRQA 1MQ5L 3C9AC 4O1ZA 2RHPA 4YT6L 1V1IA 1EMNA 2VH0B 3CS7L 3TZIA 2I9AA 2VJ3A 4MMZB 4X8VL 4RRXA 1WHFA 3S6XA 5COXA 2W2NE 3N8WB 1KKEA 2VVCK 1MYPC 1X7AL 3KCGL 3P5BL 4GM7A 5K0HB 2BOXA 2VH6B 1G1QA 3OGWA 3ZYIB 1C5MF 2XC0L 1CVWL 4NA9L 1LPGA 1D5LC 3ASIA 3N8XA 4BDXA 1IOEL 2UWLB 1JL9A 4XLWA 1IQKL 3POYA 1EPGA 1EAIC 2Y7ZB 1F0RB 2VWOL 2BQ7A 3KRKA 1UZKA 3LAQA 4LMFA 3CFWA 2Y7XB 1V3XB 2HOXA 1N7DA 1O5DL 3LC5B 2P94L 4COXA 1NFUB 3HPTA 3ZS1C 2XBYL 1TPGA 3N8YB 3R5OA 1G1TA 1LMJA 2WPKE 4Y76B 4GU4A 1WHEA
chains in the Genus database with same CATH topology
1GK5A 1CX2A 2QQTA 1YUGA 3HO4A 3NT1A 4G1MB 3M37L 3NIUA 2PT3A 1XFEA 2H9EL 2AYLA 5JB8E 2GD4A 1XKBA 4HHRA 2BZ6L 5FDQA 1EGFA 3M36L 1LMMA 1HAEA 2Y81B 3LN0A 2OYEP 2WYJB 2J4IB 5L30L 2XBXL 1N1IA 2WPIE 1NZIA 2D1JB 4ZAEB 2MGPA 3KQBL 4BXWA 1HCGB 3ELAL 3LIWB 1IQIL 3HO5A 3R5QA 2I9BA 5JB9E 3KQDL 4ZXYL 3U7UG 3HS7A 1MHLC 4CUEA 3KL6B 1ATEA 5KIRA 1IQEL 1IOXA 5IKVA 1M1XB 2TGFA 3Q3KB 2YGPA 3IITB 1PXXA 3QL6A 1L5GB 1Z6EL 5CKNA 2WPHE 2XBWL 2R5LA 3V6QA 1UZJA 3TK5B 3PGHA 4JZEL 3QF1A 2OYUP 3GCLA 1IGXA 4D0EA 2UWOB 4TGFA 5HPWA 4JYUL 6COXA 2W3KB 5JVZA 4FM5A 3NAKA 2BQWA 3U73A 2J2UB 4MSFA 3ZYGA 1EBVA 3BPSE 3QH0A 1U8CB 1RFNB 4CUDA 1TOZA 3N8YA 2IKCA 1J9CL 3MDLA 3FNLA 1KIGL 1NFWB 1NFYB 1EQHA 1SZBA 4Y71B 4PNXA 2P28B 1P0SL 5EGMB 4Y79B 1AUTL 3BT2A 1FSBA 3N8ZA 3OLUA 2PUQL 3OLTA 4OEKA 3GC1A 2XC5L 1CVUA 4KVJA 1YUFA 3Q7DA 3NTGA 2W3IB 4GN6A 2BO2A 1IJQA 3ENSA 1G2MB 4PH9A 1EZQB 1HRFA 1DVAL 1A3PA 2J94B 3R4XA 2WYGB 3K9XA 1FFMA 3TK6B 1APQA 2OJVA 1IQLL 1U67A 1F7MA 5JW1A 1ADXA 5CKQA 2FLRL 5CISA 2Z5ZA 2P3UA 4Z0KB 2W2OE 2VVVL 1IQML 2Y80B 4ZXXL 1W8BL 1EPIA 1DQBA 2VWNL 2FD6A 4HHSA 1EPHA 4MMXB 3FCSB 3HS6A 2EI6B 3TBDA 4X8TL 1CQEA 5FF1A 2YGQA 2GJMA 1IQFL 1B9WA 2K2TA 4BTIA 2YGOA 1NPEB 2P16L 4BDWA 3DEMA 2EFBA 1XDTR 2QPKA 2MHPA 1QFKL 3SXVA 1UZPA 2EHAA 2Q1JB 2NPRA 5CKMA 2M74A 4Z6AL 4M10A 2K2SB 2Y82B 2EI7B 2W2PE 1EMOA 1W7XL 3FBYA 5IKRA 1D2VC 1YO8A 3F6UL 3SOVA 4QJQA 4A94C 1NQLB 3F1SB 2VVUL 5L2YL 5B72A 4N7AA 2UWPB 2RNLA 5F19A 5F1AA 2W2ME 4BTUA 5GH0A 4ZH8B 1APOA 3QCWA 3EGFA 2XC4L 1PFXL 2Y5HL 4X8UL 4Y55A 5IKQA 3GISX 1ZAQA 2JKHL 1HJ7A 1K37A 3ERHA 4MMYB 4RS0A 1FAKL 1EPJA 2W26B 1CEJA 1Q4GA 4E1GA 1PTHA 3SW2A 3NJPC 1HX2A 1TLEA 4Y7AB 5KN5C 3PY4A 3GCJA 1FAXL 3RR3A 1IVOC 3I6NA 2BOUA 3QMOA 2WZPP 4ZHAB 1FE2A 1LPZA 1MOXC 2E9EA 1KLOA 2F9BL 3F9PC 3LC3B 1F7EA 2W86A 1HAFA 2P95L 1JBUL 1FJSL 1KLJL 1ATDA 1WU1B 2DDUA 1DNUC 3UBAA 2P93L 4YZUB 2WPJE 1G1SA 2BOKL 1D7WC 4D0FA 4XL1A 2O86A 1PRHA 2G00L 2WG3C 1FF7A 2WG4B 1JV2B 3NYHA 5JVYA 1NT0A 2PUMA 1EQGA 3LN1A 2J95B 3BT1A 4NGAL 4Y6DB 1L3YA 1COUA 2WPME 1HT5A 3V64C 3LTFB 4CSYA 3N8WA 2J38B 4ISIL 2EI8B 2Y5FL 2KL7A 1LPKA 2ADXA 5FIWC 4JZDL 2PR3B 4RRZA 1ATAA 3GCKA 4NG9L 2IPSA 3HO3A 4RUTA 1ATBA 2WFTA 1DNWC 4JZFL 2RA0L 2Y38A 1CCFA 3BXIA 5JBAE 3S4FA 1OB1C 4M11A 3MQEA 3NTBA 4C1MC 2BQ6A 5E8DA 2J34B 3KQEL 4D90A 4KVLA 3ERIA 4KVKA 4QYQA 1P9JA 5JBCE 2VWLL 3RKEA 3V65B 2W2QE 2Y5GL 4LJJA 1K36A 4OTJA 3SOBB 3TGYA 4RRYA 2FZZL 2BOHA 1URKA 1YUKB 3Q9KA 4KSZA 1BF9A 4Y7BB 2WFXB 1HREA 3KQCL 2MGRA 2P3FN 3TH3L 2VWMK 2NQXA 4C16A 5GLSA 1F0SB 1IP0A 4CUFA 1HZ8A 1G1RA 3KK6A 2KV4A 1IQGL 3CENL 3FFGL 4RRWA 1MQ6L 1NFXB 1G2LB 2P3TA 4O02B 1KSNB 4NJBA 2H9EC 3H5CB 1IGZA 4BXSA 3N8VA 3GCWE 5I46L 1KLIL 2XBVL 1YGCL 2WPLE 3GCXE 3ZYJB 1IQHL 3SOQA 2FLBL 1DX5I 2QRBA 4A7IA 1XKAL 2PHBB 4JYVL 1CCVA 1HT8A 2CJIB 2P26A 4Z0LA 3LTGD 1Z6CA 3HS5A 1PGEA 1DIYA 4BTTA 4XBMA 4AQTA 5IKTA 5L2ZL 3CA7A 2FLGA 4YT7L 1I0UA 4DL1C 3R55A 2KB9A 4X8SL 3FAQA 1CXPC 4OTYA 1IQJL 4IG5A 3TGFA 4NT3A 5JBBE 2B7DL 3ZS0C 4LORA 2KNIA 1LQDA 1DDXA 2BMGA 3N8FA 1UZQA 3R05A 4ISHL 1IQNL 3IJEB 2P3FL 3KRQA 1MQ5L 3C9AC 4O1ZA 2RHPA 4YT6L 1EMNA 2VH0B 3CS7L 3TZIA 2I9AA 2VJ3A 4MMZB 4X8VL 4RRXA 1WHFA 3S6XA 5COXA 2W2NE 3N8WB 2VVCK 1MYPC 1X7AL 3KCGL 3P5BL 4GM7A 5K0HB 2BOXA 2VH6B 1G1QA 3OGWA 3ZYIB 1C5MF 2XC0L 1CVWL 4NA9L 1LPGA 1D5LC 3ASIA 3N8XA 4BDXA 1IOEL 2UWLB 1JL9A 4XLWA 1IQKL 3POYA 1EPGA 1EAIC 2Y7ZB 1F0RB 2VWOL 2BQ7A 3KRKA 1UZKA 3LAQA 4LMFA 3CFWA 2Y7XB 1V3XB 1N7DA 1O5DL 3LC5B 2P94L 4COXA 1NFUB 3HPTA 3ZS1C 2XBYL 1TPGA 3N8YB 3R5OA 1G1TA 1LMJA 2WPKE 4Y76B 1WHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK5 A;  1CX2 A;  2QQT A;  1YUG A;  3HO4 A;  3NT1 A;  4G1M B;  3M37 L;  3NIU A;  2PT3 A;  1XFE A;  2H9E L;  2AYL A;  5JB8 E;  2GD4 A;  1XKB A;  4HHR A;  2BZ6 L;  5FDQ A;  1EGF A;  3M36 L;  1HAE A;  2Y81 B;  3LN0 A;  2OYE P;  2WYJ B;  2J4I B;  5L30 L;  2XBX L;  1N1I A;  2WPI E;  1NZI A;  2D1J B;  4ZAE B;  2MGP A;  3KQB L;  4BXW A;  1HCG B;  3ELA L;  3LIW B;  1IQI L;  3HO5 A;  3R5Q A;  2I9B A;  5JB9 E;  3KQD L;  4ZXY L;  3U7U G;  3HS7 A;  1MHL C;  4CUE A;  3KL6 B;  1ATE A;  5KIR A;  1IQE L;  1IOX A;  5IKV A;  1M1X B;  2TGF A;  3Q3K B;  2YGP A;  3IIT B;  1PXX A;  3QL6 A;  1L5G B;  1Z6E L;  5CKN A;  2WPH E;  2XBW L;  2R5L A;  3V6Q A;  1UZJ A;  3TK5 B;  3PGH A;  4JZE L;  3QF1 A;  2OYU P;  3GCL A;  1IGX A;  4D0E A;  2UWO B;  4TGF A;  5HPW A;  4JYU L;  6COX A;  2W3K B;  5JVZ A;  4FM5 A;  3NAK A;  2BQW A;  3U73 A;  2J2U B;  4MSF A;  3ZYG A;  1EBV A;  3BPS E;  3QH0 A;  1U8C B;  1RFN B;  4CUD A;  1TOZ A;  3N8Y A;  2IKC A;  1J9C L;  3MDL A;  3FNL A;  1KIG L;  1NFW B;  1NFY B;  1EQH A;  1SZB A;  4Y71 B;  4PNX A;  2P28 B;  1P0S L;  5EGM B;  4Y79 B;  1AUT L;  3BT2 A;  1FSB A;  3N8Z A;  3OLU A;  2PUQ L;  3OLT A;  4OEK A;  3GC1 A;  2XC5 L;  1CVU A;  4KVJ A;  1YUF A;  3Q7D A;  3NTG A;  2W3I B;  4GN6 A;  2BO2 A;  1IJQ A;  3ENS A;  1G2M B;  4PH9 A;  1EZQ B;  1HRF A;  1DVA L;  1A3P A;  2J94 B;  3R4X A;  2WYG B;  3K9X A;  1FFM A;  3TK6 B;  1APQ A;  2OJV A;  1IQL L;  1U67 A;  1F7M A;  5JW1 A;  1ADX A;  5CKQ A;  2FLR L;  5CIS A;  2Z5Z A;  2P3U A;  4Z0K B;  2W2O E;  2VVV L;  1IQM L;  2Y80 B;  4ZXX L;  1W8B L;  1EPI A;  1DQB A;  2VWN L;  2FD6 A;  4HHS A;  1EPH A;  4MMX B;  3FCS B;  3HS6 A;  2EI6 B;  3TBD A;  4X8T L;  1CQE A;  5FF1 A;  2GJM A;  1IQF L;  1B9W A;  2K2T A;  4BTI A;  2YGO A;  1NPE B;  2P16 L;  4BDW A;  3DEM A;  2EFB A;  1XDT R;  2QPK A;  2MHP A;  1QFK L;  3SXV A;  1UZP A;  2EHA A;  2Q1J B;  2NPR A;  5CKM A;  2M74 A;  4Z6A L;  4M10 A;  2K2S B;  2Y82 B;  2EI7 B;  2W2P E;  1EMO A;  1W7X L;  3FBY A;  5IKR A;  1D2V C;  1YO8 A;  3F6U L;  3SOV A;  4QJQ A;  1NQL B;  3F1S B;  2VVU L;  5L2Y L;  5B72 A;  4N7A A;  2UWP B;  2RNL A;  5F19 A;  5F1A A;  2W2M E;  4BTU A;  5GH0 A;  4ZH8 B;  1APO A;  3QCW A;  3EGF A;  2XC4 L;  1PFX L;  2Y5H L;  4X8U L;  4Y55 A;  5IKQ A;  3GIS X;  1ZAQ A;  2JKH L;  1HJ7 A;  1K37 A;  3ERH A;  4MMY B;  4RS0 A;  1FAK L;  1EPJ A;  2W26 B;  1CEJ A;  1Q4G A;  4E1G A;  1PTH A;  3SW2 A;  3NJP C;  1HX2 A;  1TLE A;  4Y7A B;  5KN5 C;  3PY4 A;  3GCJ A;  1FAX L;  3RR3 A;  1IVO C;  3I6N A;  2BOU A;  3QMO A;  4ZHA B;  1FE2 A;  1LPZ A;  1MOX C;  2E9E A;  1KLO A;  2F9B L;  3F9P C;  3LC3 B;  1F7E A;  2W86 A;  1HAF A;  2P95 L;  1JBU L;  1FJS L;  1KLJ L;  1ATD A;  1WU1 B;  2DDU A;  1DNU C;  3UBA A;  2P93 L;  4YZU B;  2WPJ E;  1G1S A;  2BOK L;  1D7W C;  4D0F A;  4XL1 A;  2O86 A;  1PRH A;  2G00 L;  2WG3 C;  1FF7 A;  2WG4 B;  1JV2 B;  3NYH A;  5JVY A;  1NT0 A;  2PUM A;  1EQG A;  3LN1 A;  2J95 B;  3BT1 A;  4NGA L;  4Y6D B;  1L3Y A;  1COU A;  2WPM E;  1HT5 A;  3V64 C;  3LTF B;  4CSY A;  3N8W A;  2J38 B;  4ISI L;  2EI8 B;  2Y5F L;  2KL7 A;  1LPK A;  2ADX A;  5FIW C;  4JZD L;  2PR3 B;  4RRZ A;  1ATA A;  3GCK A;  4NG9 L;  2IPS A;  3HO3 A;  4RUT A;  1ATB A;  2WFT A;  1DNW C;  4JZF L;  2RA0 L;  2Y38 A;  1CCF A;  3BXI A;  5JBA E;  3S4F A;  1OB1 C;  4M11 A;  3MQE A;  3NTB A;  4C1M C;  2BQ6 A;  5E8D A;  2J34 B;  3KQE L;  4D90 A;  4KVL A;  3ERI A;  4KVK A;  4QYQ A;  1P9J A;  5JBC E;  2VWL L;  3RKE A;  3V65 B;  2W2Q E;  2Y5G L;  4LJJ A;  1K36 A;  4OTJ A;  3SOB B;  3TGY A;  4RRY A;  2FZZ L;  2BOH A;  1URK A;  1YUK B;  3Q9K A;  4KSZ A;  1BF9 A;  4Y7B B;  2WFX B;  1HRE A;  3KQC L;  2MGR A;  2P3F N;  3TH3 L;  2VWM K;  2NQX A;  4C16 A;  5GLS A;  1F0S B;  1IP0 A;  4CUF A;  1HZ8 A;  1G1R A;  3KK6 A;  2KV4 A;  1IQG L;  3CEN L;  3FFG L;  4RRW A;  1MQ6 L;  1NFX B;  1G2L B;  2P3T A;  4O02 B;  1KSN B;  4NJB A;  3H5C B;  1IGZ A;  4BXS A;  3N8V A;  3GCW E;  5I46 L;  1KLI L;  2XBV L;  1YGC L;  2WPL E;  3GCX E;  3ZYJ B;  1IQH L;  3SOQ A;  2FLB L;  1DX5 I;  2QRB A;  4A7I A;  1XKA L;  2PHB B;  4JYV L;  1CCV A;  1HT8 A;  2CJI B;  2P26 A;  4Z0L A;  3LTG D;  1Z6C A;  3HS5 A;  1PGE A;  1DIY A;  4BTT A;  4XBM A;  4AQT A;  5IKT A;  5L2Z L;  3CA7 A;  2FLG A;  4YT7 L;  1I0U A;  4DL1 C;  3R55 A;  2KB9 A;  4X8S L;  3FAQ A;  1CXP C;  4OTY A;  1IQJ L;  4IG5 A;  3TGF A;  4NT3 A;  5JBB E;  2B7D L;  3ZS0 C;  4LOR A;  1LQD A;  1DDX A;  2BMG A;  3N8F A;  1UZQ A;  3R05 A;  4ISH L;  1IQN L;  3IJE B;  2P3F L;  3KRQ A;  1MQ5 L;  3C9A C;  4O1Z A;  2RHP A;  4YT6 L;  1EMN A;  2VH0 B;  3CS7 L;  3TZI A;  2I9A A;  2VJ3 A;  4MMZ B;  4X8V L;  4RRX A;  1WHF A;  5COX A;  2W2N E;  3N8W B;  2VVC K;  1MYP C;  1X7A L;  3KCG L;  3P5B L;  4GM7 A;  5K0H B;  2BOX A;  2VH6 B;  1G1Q A;  3OGW A;  3ZYI B;  1C5M F;  2XC0 L;  1CVW L;  4NA9 L;  1LPG A;  1D5L C;  3ASI A;  3N8X A;  4BDX A;  1IOE L;  2UWL B;  1JL9 A;  4XLW A;  1IQK L;  3POY A;  1EPG A;  1EAI C;  2Y7Z B;  1F0R B;  2VWO L;  2BQ7 A;  3KRK A;  1UZK A;  3LAQ A;  4LMF A;  3CFW A;  2Y7X B;  1V3X B;  1N7D A;  1O5D L;  3LC5 B;  2P94 L;  4COX A;  1NFU B;  3HPT A;  3ZS1 C;  2XBY L;  1TPG A;  3N8Y B;  3R5O A;  1G1T A;  1LMJ A;  2WPK E;  4Y76 B;  1WHE A; 
#chains in the Genus database with same CATH topology
 1GK5 A;  1CX2 A;  2QQT A;  1YUG A;  3HO4 A;  3NT1 A;  4G1M B;  3M37 L;  3NIU A;  2PT3 A;  1XFE A;  2H9E L;  2AYL A;  5JB8 E;  2GD4 A;  1XKB A;  4HHR A;  2BZ6 L;  1QIU A;  5FDQ A;  1EGF A;  3M36 L;  1LMM A;  1HAE A;  2Y81 B;  3LN0 A;  2OYE P;  2WYJ B;  2J4I B;  5L30 L;  2XBX L;  1N1I A;  2WPI E;  1NZI A;  2D1J B;  4ZAE B;  2MGP A;  3KQB L;  4BXW A;  1HCG B;  3ELA L;  3LIW B;  1IQI L;  3HO5 A;  3R5Q A;  2I9B A;  5JB9 E;  3KQD L;  4ZXY L;  3U7U G;  3HS7 A;  1MHL C;  4CUE A;  3KL6 B;  1ATE A;  5KIR A;  1IQE L;  1IOX A;  5IKV A;  1M1X B;  2TGF A;  3Q3K B;  2YGP A;  3IIT B;  1PXX A;  3QL6 A;  1L5G B;  1Z6E L;  5CKN A;  2WPH E;  2XBW L;  2R5L A;  1LK9 A;  3V6Q A;  1UZJ A;  3TK5 B;  3PGH A;  4JZE L;  3QF1 A;  2OYU P;  3GCL A;  1IGX A;  4D0E A;  2UWO B;  4TGF A;  5HPW A;  4JYU L;  6COX A;  2W3K B;  5JVZ A;  4FM5 A;  3NAK A;  2BQW A;  3U73 A;  2J2U B;  4MSF A;  3ZYG A;  1EBV A;  3BPS E;  3QH0 A;  1U8C B;  1RFN B;  4CUD A;  1TOZ A;  3N8Y A;  2IKC A;  1J9C L;  3MDL A;  3FNL A;  1KIG L;  1NFW B;  1NFY B;  1EQH A;  1SZB A;  4Y71 B;  4PNX A;  2P28 B;  1P0S L;  5EGM B;  4Y79 B;  1AUT L;  3BT2 A;  1FSB A;  3N8Z A;  3OLU A;  2PUQ L;  3OLT A;  4OEK A;  3GC1 A;  2XC5 L;  1CVU A;  4KVJ A;  1YUF A;  3Q7D A;  3NTG A;  2W3I B;  4GN6 A;  2BO2 A;  1IJQ A;  2VRS A;  3ENS A;  1G2M B;  4PH9 A;  1EZQ B;  1HRF A;  1DVA L;  1A3P A;  2J94 B;  3R4X A;  2WYG B;  3K9X A;  1FFM A;  3TK6 B;  1APQ A;  2OJV A;  1IQL L;  1U67 A;  1F7M A;  5JW1 A;  1ADX A;  5CKQ A;  2FLR L;  5CIS A;  2Z5Z A;  2P3U A;  4Z0K B;  2W2O E;  2VVV L;  1IQM L;  2Y80 B;  4ZXX L;  1W8B L;  1EPI A;  1DQB A;  2VWN L;  2FD6 A;  4HHS A;  1EPH A;  4MMX B;  3FCS B;  3HS6 A;  2EI6 B;  3TBD A;  4X8T L;  1CQE A;  5FF1 A;  2YGQ A;  2GJM A;  1IQF L;  1B9W A;  2K2T A;  4BTI A;  2YGO A;  1NPE B;  2P16 L;  4BDW A;  3DEM A;  2EFB A;  1XDT R;  2QPK A;  2MHP A;  1QFK L;  3SXV A;  1UZP A;  2EHA A;  2NPR A;  2Q1J B;  5CKM A;  2M74 A;  4Z6A L;  4M10 A;  2K2S B;  2Y82 B;  2EI7 B;  2W2P E;  1EMO A;  1W7X L;  3FBY A;  5IKR A;  1D2V C;  1YO8 A;  3F6U L;  3SOV A;  4QJQ A;  4A94 C;  1NQL B;  3F1S B;  2VVU L;  5L2Y L;  5B72 A;  4N7A A;  2UWP B;  2RNL A;  5F19 A;  5F1A A;  2W2M E;  4BTU A;  5GH0 A;  4ZH8 B;  1APO A;  3QCW A;  3EGF A;  2XC4 L;  1PFX L;  2Y5H L;  4X8U L;  4Y55 A;  5IKQ A;  3GIS X;  1ZAQ A;  2JKH L;  1HJ7 A;  1K37 A;  2BT7 A;  3ERH A;  4MMY B;  4RS0 A;  1FAK L;  1EPJ A;  2W26 B;  1CEJ A;  1Q4G A;  4E1G A;  1PTH A;  3SW2 A;  3NJP C;  1HX2 A;  1TLE A;  4Y7A B;  5KN5 C;  3PY4 A;  3GCJ A;  1FAX L;  3RR3 A;  1IVO C;  3I6N A;  2BOU A;  3QMO A;  2WZP P;  4ZHA B;  1FE2 A;  1LPZ A;  1MOX C;  2E9E A;  1KLO A;  2F9B L;  3F9P C;  3LC3 B;  1F7E A;  2W86 A;  1HAF A;  2P95 L;  1JBU L;  1FJS L;  1KLJ L;  1ATD A;  1WU1 B;  2DDU A;  1DNU C;  3UBA A;  2P93 L;  4YZU B;  2WPJ E;  1G1S A;  2BOK L;  1D7W C;  2BT8 A;  4D0F A;  2JJL A;  4XL1 A;  2O86 A;  1PRH A;  2G00 L;  2WG3 C;  1FF7 A;  2WG4 B;  1JV2 B;  3NYH A;  5JVY A;  1NT0 A;  2PUM A;  1EQG A;  3LN1 A;  2BSF A;  2J95 B;  3BT1 A;  4NGA L;  4Y6D B;  1L3Y A;  1COU A;  2WPM E;  1HT5 A;  3V64 C;  3LTF B;  4CSY A;  3N8W A;  2J38 B;  4ISI L;  2EI8 B;  2Y5F L;  2KL7 A;  1LPK A;  2ADX A;  5FIW C;  1V1H A;  4JZD L;  2PR3 B;  4RRZ A;  1ATA A;  3GCK A;  4NG9 L;  2IPS A;  3HO3 A;  4RUT A;  1ATB A;  2WFT A;  1DNW C;  4JZF L;  2RA0 L;  2Y38 A;  1CCF A;  3BXI A;  4GU3 A;  5JBA E;  3S4F A;  1OB1 C;  4M11 A;  3MQE A;  3NTB A;  4C1M C;  2BQ6 A;  5E8D A;  2J34 B;  3KQE L;  4D90 A;  4KVL A;  3ERI A;  4KVK A;  4QYQ A;  1P9J A;  5JBC E;  2VWL L;  3RKE A;  3V65 B;  2W2Q E;  2Y5G L;  4LJJ A;  1K36 A;  4OTJ A;  3SOB B;  3TGY A;  4RRY A;  2FZZ L;  2BOH A;  1URK A;  1YUK B;  3Q9K A;  4KSZ A;  1BF9 A;  4Y7B B;  2WFX B;  1HRE A;  3KQC L;  2MGR A;  2P3F N;  3TH3 L;  2VWM K;  2NQX A;  4C16 A;  5GLS A;  1F0S B;  1IP0 A;  4CUF A;  1HZ8 A;  1G1R A;  3KK6 A;  2KV4 A;  1IQG L;  3CEN L;  3FFG L;  4RRW A;  1MQ6 L;  1NFX B;  1G2L B;  2P3T A;  4O02 B;  1KSN B;  4NJB A;  2H9E C;  3H5C B;  1IGZ A;  4BXS A;  3N8V A;  3GCW E;  5I46 L;  1KLI L;  2XBV L;  1YGC L;  2WPL E;  3GCX E;  3ZYJ B;  1IQH L;  3SOQ A;  2FLB L;  1DX5 I;  2QRB A;  4A7I A;  1XKA L;  2HOR A;  2PHB B;  4JYV L;  1CCV A;  1HT8 A;  2CJI B;  2P26 A;  4Z0L A;  3LTG D;  1Z6C A;  3HS5 A;  1PGE A;  1DIY A;  4BTT A;  4XBM A;  4AQT A;  5IKT A;  5L2Z L;  3CA7 A;  2FLG A;  4YT7 L;  1I0U A;  4DL1 C;  3R55 A;  2KB9 A;  4X8S L;  3FAQ A;  1CXP C;  4OTY A;  1IQJ L;  4IG5 A;  3TGF A;  4NT3 A;  5JBB E;  2B7D L;  3ZS0 C;  4LOR A;  2KNI A;  1LQD A;  1DDX A;  2BMG A;  3N8F A;  1UZQ A;  3R05 A;  4ISH L;  1IQN L;  3IJE B;  2P3F L;  3KRQ A;  1MQ5 L;  3C9A C;  4O1Z A;  2RHP A;  4YT6 L;  1V1I A;  1EMN A;  2VH0 B;  3CS7 L;  3TZI A;  2I9A A;  2VJ3 A;  4MMZ B;  4X8V L;  4RRX A;  1WHF A;  3S6X A;  5COX A;  2W2N E;  3N8W B;  1KKE A;  2VVC K;  1MYP C;  1X7A L;  3KCG L;  3P5B L;  4GM7 A;  5K0H B;  2BOX A;  2VH6 B;  1G1Q A;  3OGW A;  3ZYI B;  1C5M F;  2XC0 L;  1CVW L;  4NA9 L;  1LPG A;  1D5L C;  3ASI A;  3N8X A;  4BDX A;  1IOE L;  2UWL B;  1JL9 A;  4XLW A;  1IQK L;  3POY A;  1EPG A;  1EAI C;  2Y7Z B;  1F0R B;  2VWO L;  2BQ7 A;  3KRK A;  1UZK A;  3LAQ A;  4LMF A;  3CFW A;  2Y7X B;  1V3X B;  2HOX A;  1N7D A;  1O5D L;  3LC5 B;  2P94 L;  4COX A;  1NFU B;  3HPT A;  3ZS1 C;  2XBY L;  1TPG A;  3N8Y B;  3R5O A;  1G1T A;  1LMJ A;  2WPK E;  4Y76 B;  4GU4 A;  1WHE A; 
#chains in the Genus database with same CATH homology
 1GK5 A;  1CX2 A;  2QQT A;  1YUG A;  3HO4 A;  3NT1 A;  4G1M B;  3M37 L;  3NIU A;  2PT3 A;  1XFE A;  2H9E L;  2AYL A;  5JB8 E;  2GD4 A;  1XKB A;  4HHR A;  2BZ6 L;  5FDQ A;  1EGF A;  3M36 L;  1LMM A;  1HAE A;  2Y81 B;  3LN0 A;  2OYE P;  2WYJ B;  2J4I B;  5L30 L;  2XBX L;  1N1I A;  2WPI E;  1NZI A;  2D1J B;  4ZAE B;  2MGP A;  3KQB L;  4BXW A;  1HCG B;  3ELA L;  3LIW B;  1IQI L;  3HO5 A;  3R5Q A;  2I9B A;  5JB9 E;  3KQD L;  4ZXY L;  3U7U G;  3HS7 A;  1MHL C;  4CUE A;  3KL6 B;  1ATE A;  5KIR A;  1IQE L;  1IOX A;  5IKV A;  1M1X B;  2TGF A;  3Q3K B;  2YGP A;  3IIT B;  1PXX A;  3QL6 A;  1L5G B;  1Z6E L;  5CKN A;  2WPH E;  2XBW L;  2R5L A;  3V6Q A;  1UZJ A;  3TK5 B;  3PGH A;  4JZE L;  3QF1 A;  2OYU P;  3GCL A;  1IGX A;  4D0E A;  2UWO B;  4TGF A;  5HPW A;  4JYU L;  6COX A;  2W3K B;  5JVZ A;  4FM5 A;  3NAK A;  2BQW A;  3U73 A;  2J2U B;  4MSF A;  3ZYG A;  1EBV A;  3BPS E;  3QH0 A;  1U8C B;  1RFN B;  4CUD A;  1TOZ A;  3N8Y A;  2IKC A;  1J9C L;  3MDL A;  3FNL A;  1KIG L;  1NFW B;  1NFY B;  1EQH A;  1SZB A;  4Y71 B;  4PNX A;  2P28 B;  1P0S L;  5EGM B;  4Y79 B;  1AUT L;  3BT2 A;  1FSB A;  3N8Z A;  3OLU A;  2PUQ L;  3OLT A;  4OEK A;  3GC1 A;  2XC5 L;  1CVU A;  4KVJ A;  1YUF A;  3Q7D A;  3NTG A;  2W3I B;  4GN6 A;  2BO2 A;  1IJQ A;  3ENS A;  1G2M B;  4PH9 A;  1EZQ B;  1HRF A;  1DVA L;  1A3P A;  2J94 B;  3R4X A;  2WYG B;  3K9X A;  1FFM A;  3TK6 B;  1APQ A;  2OJV A;  1IQL L;  1U67 A;  1F7M A;  5JW1 A;  1ADX A;  5CKQ A;  2FLR L;  5CIS A;  2Z5Z A;  2P3U A;  4Z0K B;  2W2O E;  2VVV L;  1IQM L;  2Y80 B;  4ZXX L;  1W8B L;  1EPI A;  1DQB A;  2VWN L;  2FD6 A;  4HHS A;  1EPH A;  4MMX B;  3FCS B;  3HS6 A;  2EI6 B;  3TBD A;  4X8T L;  1CQE A;  5FF1 A;  2YGQ A;  2GJM A;  1IQF L;  1B9W A;  2K2T A;  4BTI A;  2YGO A;  1NPE B;  2P16 L;  4BDW A;  3DEM A;  2EFB A;  1XDT R;  2QPK A;  2MHP A;  1QFK L;  3SXV A;  1UZP A;  2EHA A;  2Q1J B;  2NPR A;  5CKM A;  2M74 A;  4Z6A L;  4M10 A;  2K2S B;  2Y82 B;  2EI7 B;  2W2P E;  1EMO A;  1W7X L;  3FBY A;  5IKR A;  1D2V C;  1YO8 A;  3F6U L;  3SOV A;  4QJQ A;  4A94 C;  1NQL B;  3F1S B;  2VVU L;  5L2Y L;  5B72 A;  4N7A A;  2UWP B;  2RNL A;  5F19 A;  5F1A A;  2W2M E;  4BTU A;  5GH0 A;  4ZH8 B;  1APO A;  3QCW A;  3EGF A;  2XC4 L;  1PFX L;  2Y5H L;  4X8U L;  4Y55 A;  5IKQ A;  3GIS X;  1ZAQ A;  2JKH L;  1HJ7 A;  1K37 A;  3ERH A;  4MMY B;  4RS0 A;  1FAK L;  1EPJ A;  2W26 B;  1CEJ A;  1Q4G A;  4E1G A;  1PTH A;  3SW2 A;  3NJP C;  1HX2 A;  1TLE A;  4Y7A B;  5KN5 C;  3PY4 A;  3GCJ A;  1FAX L;  3RR3 A;  1IVO C;  3I6N A;  2BOU A;  3QMO A;  2WZP P;  4ZHA B;  1FE2 A;  1LPZ A;  1MOX C;  2E9E A;  1KLO A;  2F9B L;  3F9P C;  3LC3 B;  1F7E A;  2W86 A;  1HAF A;  2P95 L;  1JBU L;  1FJS L;  1KLJ L;  1ATD A;  1WU1 B;  2DDU A;  1DNU C;  3UBA A;  2P93 L;  4YZU B;  2WPJ E;  1G1S A;  2BOK L;  1D7W C;  4D0F A;  4XL1 A;  2O86 A;  1PRH A;  2G00 L;  2WG3 C;  1FF7 A;  2WG4 B;  1JV2 B;  3NYH A;  5JVY A;  1NT0 A;  2PUM A;  1EQG A;  3LN1 A;  2J95 B;  3BT1 A;  4NGA L;  4Y6D B;  1L3Y A;  1COU A;  2WPM E;  1HT5 A;  3V64 C;  3LTF B;  4CSY A;  3N8W A;  2J38 B;  4ISI L;  2EI8 B;  2Y5F L;  2KL7 A;  1LPK A;  2ADX A;  5FIW C;  4JZD L;  2PR3 B;  4RRZ A;  1ATA A;  3GCK A;  4NG9 L;  2IPS A;  3HO3 A;  4RUT A;  1ATB A;  2WFT A;  1DNW C;  4JZF L;  2RA0 L;  2Y38 A;  1CCF A;  3BXI A;  5JBA E;  3S4F A;  1OB1 C;  4M11 A;  3MQE A;  3NTB A;  4C1M C;  2BQ6 A;  5E8D A;  2J34 B;  3KQE L;  4D90 A;  4KVL A;  3ERI A;  4KVK A;  4QYQ A;  1P9J A;  5JBC E;  2VWL L;  3RKE A;  3V65 B;  2W2Q E;  2Y5G L;  4LJJ A;  1K36 A;  4OTJ A;  3SOB B;  3TGY A;  4RRY A;  2FZZ L;  2BOH A;  1URK A;  1YUK B;  3Q9K A;  4KSZ A;  1BF9 A;  4Y7B B;  2WFX B;  1HRE A;  3KQC L;  2MGR A;  2P3F N;  3TH3 L;  2VWM K;  2NQX A;  4C16 A;  5GLS A;  1F0S B;  1IP0 A;  4CUF A;  1HZ8 A;  1G1R A;  3KK6 A;  2KV4 A;  1IQG L;  3CEN L;  3FFG L;  4RRW A;  1MQ6 L;  1NFX B;  1G2L B;  2P3T A;  4O02 B;  1KSN B;  4NJB A;  2H9E C;  3H5C B;  1IGZ A;  4BXS A;  3N8V A;  3GCW E;  5I46 L;  1KLI L;  2XBV L;  1YGC L;  2WPL E;  3GCX E;  3ZYJ B;  1IQH L;  3SOQ A;  2FLB L;  1DX5 I;  2QRB A;  4A7I A;  1XKA L;  2PHB B;  4JYV L;  1CCV A;  1HT8 A;  2CJI B;  2P26 A;  4Z0L A;  3LTG D;  1Z6C A;  3HS5 A;  1PGE A;  1DIY A;  4BTT A;  4XBM A;  4AQT A;  5IKT A;  5L2Z L;  3CA7 A;  2FLG A;  4YT7 L;  1I0U A;  4DL1 C;  3R55 A;  2KB9 A;  4X8S L;  3FAQ A;  1CXP C;  4OTY A;  1IQJ L;  4IG5 A;  3TGF A;  4NT3 A;  5JBB E;  2B7D L;  3ZS0 C;  4LOR A;  2KNI A;  1LQD A;  1DDX A;  2BMG A;  3N8F A;  1UZQ A;  3R05 A;  4ISH L;  1IQN L;  3IJE B;  2P3F L;  3KRQ A;  1MQ5 L;  3C9A C;  4O1Z A;  2RHP A;  4YT6 L;  1EMN A;  2VH0 B;  3CS7 L;  3TZI A;  2I9A A;  2VJ3 A;  4MMZ B;  4X8V L;  4RRX A;  1WHF A;  3S6X A;  5COX A;  2W2N E;  3N8W B;  2VVC K;  1MYP C;  1X7A L;  3KCG L;  3P5B L;  4GM7 A;  5K0H B;  2BOX A;  2VH6 B;  1G1Q A;  3OGW A;  3ZYI B;  1C5M F;  2XC0 L;  1CVW L;  4NA9 L;  1LPG A;  1D5L C;  3ASI A;  3N8X A;  4BDX A;  1IOE L;  2UWL B;  1JL9 A;  4XLW A;  1IQK L;  3POY A;  1EPG A;  1EAI C;  2Y7Z B;  1F0R B;  2VWO L;  2BQ7 A;  3KRK A;  1UZK A;  3LAQ A;  4LMF A;  3CFW A;  2Y7X B;  1V3X B;  1N7D A;  1O5D L;  3LC5 B;  2P94 L;  4COX A;  1NFU B;  3HPT A;  3ZS1 C;  2XBY L;  1TPG A;  3N8Y B;  3R5O A;  1G1T A;  1LMJ A;  2WPK E;  4Y76 B;  1WHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...