1CQEA

Prostaglandin h2 synthase-1 complex with flurbiprofen
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
552
structure length
552
Chain Sequence
PVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The X-ray crystal structure of the membrane protein prostaglandin H2 synthase-1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (PROSTAGLANDIN H2 SYNTHASE-1)
total genus 198
structure length 552
sequence length 552
chains with identical sequence B
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 1cqeA02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1cqeA01
2RNLA 3SOQA 1IQFL 3GCKA 3LC5B 4C1MC 1APOA 1IQJL 3GCWE 1L5GB 2WPLE 1K37A 3POYA 2EI6B 3LN0A 1NT0A 1W7XL 3ERIA 4TGFA 3TZIA 3RR3A 1DIYA 2JKHL 4PH9A 1EPIA 4KVJA 2Y5FL 4G1MB 5I46L 3KRQA 1ADXA 1TPGA 1ATDA 4ZXYL 2Z5ZA 4BDXA 4X8TL 3CFWA 3F6UL 4NGAL 4PNXA 2WFXB 4GN6A 4XL1A 4AQTA 2FLGA 1SZBA 3Q9KA 1HCGB 4CUDA 3R5QA 2WPME 2BQWA 3ZS1C 4X8VL 4CUEA 2VWLL 3V6QA 2Y5HL 2Y5GL 1EQHA 3I6NA 3GCJA 2Q1JB 3QMOA 4BDWA 4ZAEB 2OYEP 3OGWA 1NPEB 2VH0B 1KIGL 3ZYIB 2Y82B 2WPHE 1FAKL 1XKAL 4KSZA 3NT1A 3H5CB 5JW1A 2W2PE 2XBXL 3ZYJB 4BTTA 1NFXB 1I0UA 2BZ6L 2IPSA 4XLWA 2UWOB 1IOEL 1JV2B 4OTJA 1AUTL 4BXWA 2Y7XB 2P16L 1G2LB 5FF1A 3F9PC 5B72A 5IKTA 4X8SL 3SOVA 1IGXA 1PRHA 3MQEA 5KN5C 1F7MA 2GD4A 4YZUB 5GH0A 1G1RA 1F7EA 3PGHA 4Y7BB 3NTGA 3TH3L 2EI7B 2CJIB 2W2ME 3V65B 3NYHA 1G1TA 5CKMA 5JBAE 1Z6EL 2VH6B 1IQEL 3KQDL 1F0SB 2Y81B 2PUMA 3R4XA 2ADXA 2W86A 4ZXXL 2PT3A 4RRZA 2TGFA 1DQBA 2W2NE 5JVYA 1CCFA 4XBMA 4LORA 1WHEA 2KL7A 2BMGA 4D0EA 5FDQA 4ISIL 5L2ZL 3GC1A 1NFWB 2Y38A 2K2TA 1CVUA 1CVWL 2PUQL 5COXA 4ZH8B 3KL6B 1HT5A 3FBYA 1HJ7A 5JBBE 3QH0A 2WPIE 3N8WA 1QFKL 1UZJA 2QRBA 3N8WB 1N1IA 1Q4GA 2XBVL 2QQTA 2VVUL 3LTFB 2KB9A 3LAQA 1KSNB 2MGRA 1FAXL 1LPZA 1RFNB 5L2YL 3ENSA 1ZAQA 3KK6A 4D90A 1D2VC 4ISHL 4JZFL 4MSFA 1X7AL 4BTIA 2H9EL 1MOXC 1IOXA 2P28B 1B9WA 1COUA 2WYJB 1PFXL 1EPHA 4X8UL 1F0RB 3N8FA 1FJSL 1PXXA 3NTBA 1IP0A 1WU1B 2W26B 2DDUA 1LPGA 3KQCL 1IGZA 1DX5I 3HO4A 1EBVA 2O86A 3N8XA 4ZHAB 2VVCK 3CS7L 4RUTA 4JYVL 5JB9E 3Q7DA 4HHRA 2WG3C 2P3FL 2VVVL 5FIWC 4M11A 3R55A 2YGPA 2J38B 4BTUA 2K2SB 5HPWA 4MMZB 3SOBB 3C9AC 2P93L 3Q3KB 5CKNA 2XBYL 3NJPC 4LJJA 4NA9L 3HS7A 3N8YB 1NQLB 2VWNL 2J34B 1XFEA 2J4IB 3OLTA 3GCXE 3M36L 4YT7L 2EI8B 1CXPC 1YO8A 3S4FA 5F1AA 3TBDA 1A3PA 2D1JB 1IVOC 1PGEA 2I9AA 2OJVA 3KCGL 5GLSA 4Z0LA 4NJBA 2UWPB 1U8CB 2BQ6A 3FFGL 2NQXA 1HZ8A 1U67A 1WHFA 1URKA 5CKQA 1DDXA 3LN1A 1LMJA 1NZIA 3BPSE 1CEJA 3QF1A 3TK5B 3N8YA 3QL6A 2P3FN 3K9XA 2P26A 3F1SB 1IJQA 5IKRA 1YUFA 3PY4A 1MQ6L 4Y7AB 1KLJL 1UZQA 3HPTA 4DL1C 1BF9A 4Y76B 2E9EA 1D5LC 2MGPA 3BXIA 3QCWA 3N8VA 1IQML 2BO2A 2G00L 4RRWA 1W8BL 3LC3B 4C16A 1HT8A 4IG5A 1TOZA 3KQEL 3ASIA 1IQGL 4COXA 4M10A 1EMOA 1D7WC 3UBAA 3IITB 5CISA 2VWOL 1FFMA 1MQ5L 2BOXA 4BXSA 1J9CL 2Y7ZB 3U7UG 2W3KB 1M1XB 2OYUP 2KV4A 2GJMA 1YGCL 5EGMB 1HAFA 4N7AA 3MDLA 1N7DA 1Z6CA 3OLUA 2P3UA 1XDTR 2FLRL 1FF7A 1HAEA 1GK5A 2J2UB 1YUKB 3BT1A 1HX2A 2AYLA 3HS5A 2IKCA 2EHAA 2XC4L 2VJ3A 2W2OE 1NFYB 1HREA 1EMNA 1DVAL 4KVLA 1YUGA 2Y80B 4NG9L 4CSYA 1NFUB 4RRYA 3GCLA 3HO3A 3ELAL 4OTYA 3CA7A 3IJEB 5L30L 2WG4B 4Y55A 1C5MF 2WPKE 3N8ZA 3U73A 3NIUA 3R05A 2BQ7A 4LMFA 3FCSB 2BOKL 2QPKA 2XBWL 1IQHL 1EGFA 4QJQA 1P0SL 4Y79B 3P5BL 3RKEA 1JBUL 1FE2A 2I9BA 4KVKA 1ATAA 1IQNL 1LQDA 4RRXA 1DNWC 5IKVA 3TK6B 4MMXB 2VWMK 1EQGA 3FAQA 4HHSA 2W2QE 1K36A 1CX2A 3V64C 2J94B 1ATBA 1IQKL 2NPRA 2RHPA 1V3XB 1UZKA 1G1SA 1P9JA 4QYQA 1PTHA 4JZEL 3TGFA 2P3TA 1KLIL 4Z6AL 2YGOA 4Z0KB 5JBCE 2EFBA 1CCVA 2BOHA 1CQEA 4A7IA 1XKBA 1HRFA 1MYPC 2RA0L 2M74A 2BOUA 1G2MB 2W3IB 3EGFA 3DEMA 6COXA 1EPGA 1IQIL 3LIWB 3M37L 5JVZA 4CUFA 4GM7A 3ZYGA 1KLOA 1O5DL 4Y6DB 2MHPA 2WFTA 3FNLA 1EPJA 1LPKA 1IQLL 4JYUL 3CENL 1L3YA 4YT6L 3NAKA 2UWLB 1DNUC 5KIRA 4E1GA 2FD6A 1EAIC 2J95B 4O02B 3ZS0C 2R5LA 3TGYA 5IKQA 2B7DL 4RS0A 3BT2A 2F9BL 4O1ZA 2WPJE 2P94L 4MMYB 3GISX 1JL9A 3HS6A 3KRKA 2FZZL 2XC5L 1MHLC 2XC0L 1FSBA 1TLEA 2PHBB 1G1QA 4Y71B 3KQBL 2FLBL 2WYGB 3ERHA 1OB1C 4OEKA 3R5OA 5JB8E 1UZPA 1EZQB 3SW2A 2P95L 3HO5A 4JZDL 5F19A 5K0HB 2PR3B 5E8DA 4D0FA 1ATEA 4FM5A 3SXVA 4NT3A 1APQA 3LTGD
chains in the Genus database with same CATH superfamily
2RNLA 3SOQA 1IQFL 3GCKA 3LC5B 4C1MC 1APOA 1IQJL 3GCWE 2VRSA 1L5GB 2WPLE 1K37A 3POYA 2EI6B 3LN0A 1NT0A 1W7XL 3ERIA 4TGFA 3TZIA 3RR3A 1DIYA 2JKHL 4PH9A 1EPIA 4KVJA 2Y5FL 4G1MB 5I46L 3KRQA 1ADXA 1TPGA 1ATDA 4ZXYL 2Z5ZA 4BDXA 4X8TL 3CFWA 3F6UL 4NGAL 4PNXA 2WFXB 4GN6A 4XL1A 4AQTA 2FLGA 1SZBA 3Q9KA 1HCGB 4CUDA 3R5QA 2WPME 2BQWA 3ZS1C 4X8VL 4CUEA 2VWLL 3V6QA 2Y5HL 2Y5GL 1EQHA 3I6NA 3GCJA 2Q1JB 3QMOA 4BDWA 4ZAEB 2OYEP 3OGWA 1NPEB 2VH0B 1KIGL 3ZYIB 2Y82B 2WPHE 1FAKL 1XKAL 4KSZA 3NT1A 3H5CB 5JW1A 2W2PE 2XBXL 3ZYJB 4BTTA 1NFXB 1I0UA 2BZ6L 2IPSA 4XLWA 2UWOB 1IOEL 1JV2B 4OTJA 1AUTL 4BXWA 2BT8A 4A94C 2Y7XB 2P16L 1G2LB 5FF1A 3F9PC 5B72A 5IKTA 4X8SL 3SOVA 1IGXA 1PRHA 4GU4A 3MQEA 5KN5C 1F7MA 2GD4A 4YZUB 5GH0A 1G1RA 1F7EA 3PGHA 4Y7BB 3NTGA 3TH3L 2EI7B 2CJIB 2W2ME 3V65B 3NYHA 1G1TA 5CKMA 5JBAE 1Z6EL 2VH6B 1IQEL 3KQDL 1F0SB 2Y81B 2PUMA 3R4XA 2ADXA 2W86A 4ZXXL 2PT3A 4RRZA 2TGFA 1DQBA 2W2NE 5JVYA 1CCFA 4XBMA 4LORA 1WHEA 2KL7A 2BMGA 4D0EA 5FDQA 4ISIL 5L2ZL 3GC1A 1NFWB 2Y38A 2K2TA 1CVUA 1CVWL 2PUQL 5COXA 4ZH8B 3KL6B 1HT5A 3FBYA 1HJ7A 5JBBE 1KKEA 3QH0A 2WPIE 3N8WA 1QFKL 1UZJA 2QRBA 3N8WB 1N1IA 1Q4GA 2XBVL 2QQTA 2VVUL 3LTFB 2KB9A 3LAQA 1KSNB 2MGRA 1FAXL 1LPZA 1RFNB 2YGQA 5L2YL 3ENSA 2BSFA 1ZAQA 3KK6A 4D90A 1D2VC 4ISHL 4JZFL 4MSFA 1X7AL 4BTIA 2H9EL 1MOXC 1IOXA 2P28B 1B9WA 1COUA 2WYJB 1PFXL 1EPHA 4X8UL 1F0RB 3N8FA 1FJSL 1PXXA 3NTBA 1IP0A 1WU1B 2W26B 2DDUA 1LPGA 3KQCL 1IGZA 1DX5I 3HO4A 1EBVA 2O86A 3N8XA 4ZHAB 2VVCK 3CS7L 4RUTA 4JYVL 5JB9E 3Q7DA 4HHRA 2WG3C 2P3FL 2VVVL 5FIWC 4M11A 3R55A 2YGPA 2J38B 4BTUA 2K2SB 5HPWA 4MMZB 3SOBB 3C9AC 2P93L 3Q3KB 5CKNA 2XBYL 3NJPC 4LJJA 4NA9L 3HS7A 3N8YB 1NQLB 2VWNL 2J34B 1XFEA 2J4IB 3OLTA 3GCXE 3M36L 4YT7L 2EI8B 1CXPC 1YO8A 3S4FA 5F1AA 3TBDA 1A3PA 2D1JB 2JJLA 1IVOC 1PGEA 2I9AA 2OJVA 3KCGL 5GLSA 4Z0LA 4NJBA 2UWPB 1U8CB 2BQ6A 3FFGL 2NQXA 1HZ8A 1U67A 1WHFA 1URKA 5CKQA 1DDXA 3LN1A 1LMJA 1NZIA 3BPSE 1CEJA 3QF1A 3TK5B 3N8YA 3QL6A 2P3FN 3K9XA 2P26A 3F1SB 1IJQA 5IKRA 1YUFA 3PY4A 1MQ6L 4Y7AB 1KLJL 1UZQA 3HPTA 4DL1C 1BF9A 4Y76B 2E9EA 1D5LC 2MGPA 3BXIA 3QCWA 3N8VA 2KNIA 1IQML 2BO2A 2G00L 4RRWA 1W8BL 3LC3B 4C16A 1HT8A 4IG5A 2BT7A 1TOZA 3KQEL 3ASIA 1IQGL 4COXA 4M10A 1EMOA 1D7WC 3UBAA 3IITB 1V1IA 1QIUA 5CISA 2VWOL 1FFMA 1MQ5L 2BOXA 4BXSA 1J9CL 2Y7ZB 3U7UG 2W3KB 1M1XB 2OYUP 2KV4A 2GJMA 1YGCL 5EGMB 1HAFA 4N7AA 3MDLA 1N7DA 1Z6CA 3OLUA 2P3UA 1XDTR 2FLRL 1FF7A 1HAEA 1GK5A 2J2UB 1YUKB 3BT1A 1HX2A 2AYLA 3HS5A 2IKCA 2EHAA 2XC4L 2VJ3A 2W2OE 1NFYB 1HREA 1EMNA 1DVAL 4KVLA 1YUGA 2Y80B 4NG9L 4CSYA 1NFUB 4RRYA 3GCLA 3HO3A 3ELAL 4OTYA 3CA7A 3IJEB 5L30L 2H9EC 2WG4B 4Y55A 1C5MF 2WPKE 3N8ZA 3U73A 3NIUA 1V1HA 3R05A 2BQ7A 2HOXA 4LMFA 3FCSB 2BOKL 2QPKA 2XBWL 1IQHL 1EGFA 4QJQA 1P0SL 4Y79B 3P5BL 1LK9A 3RKEA 1JBUL 1FE2A 2I9BA 4KVKA 1ATAA 1IQNL 1LQDA 4RRXA 1DNWC 5IKVA 3TK6B 4MMXB 2VWMK 1EQGA 3FAQA 4HHSA 2WZPP 2HORA 2W2QE 1K36A 1CX2A 3V64C 2J94B 1ATBA 1IQKL 2NPRA 2RHPA 1V3XB 1UZKA 1G1SA 1P9JA 4QYQA 1PTHA 4JZEL 3TGFA 2P3TA 1KLIL 4Z6AL 2YGOA 4Z0KB 4GU3A 5JBCE 2EFBA 1CCVA 2BOHA 1CQEA 4A7IA 1XKBA 1HRFA 1MYPC 2RA0L 2M74A 2BOUA 1G2MB 2W3IB 3EGFA 3DEMA 6COXA 1EPGA 1IQIL 3LIWB 3M37L 5JVZA 3S6XA 4CUFA 4GM7A 3ZYGA 1KLOA 1O5DL 4Y6DB 2MHPA 2WFTA 3FNLA 1EPJA 1LPKA 1IQLL 4JYUL 3CENL 1L3YA 4YT6L 3NAKA 2UWLB 1DNUC 1LMMA 5KIRA 4E1GA 2FD6A 1EAIC 2J95B 4O02B 3ZS0C 2R5LA 3TGYA 5IKQA 2B7DL 4RS0A 3BT2A 2F9BL 4O1ZA 2WPJE 2P94L 4MMYB 3GISX 1JL9A 3HS6A 3KRKA 2FZZL 2XC5L 1MHLC 2XC0L 1FSBA 1TLEA 2PHBB 1G1QA 4Y71B 3KQBL 2FLBL 2WYGB 3ERHA 1OB1C 4OEKA 3R5OA 5JB8E 1UZPA 1EZQB 3SW2A 2P95L 3HO5A 4JZDL 5F19A 5K0HB 2PR3B 5E8DA 4D0FA 1ATEA 4FM5A 3SXVA 4NT3A 1APQA 3LTGD
chains in the Genus database with same CATH topology
2RNLA 3SOQA 1IQFL 3GCKA 3LC5B 4C1MC 1APOA 1IQJL 3GCWE 1L5GB 2WPLE 1K37A 3POYA 2EI6B 3LN0A 1NT0A 1W7XL 3ERIA 4TGFA 3TZIA 3RR3A 1DIYA 2JKHL 4PH9A 1EPIA 4KVJA 2Y5FL 4G1MB 5I46L 3KRQA 1ADXA 1TPGA 1ATDA 4ZXYL 2Z5ZA 4BDXA 4X8TL 3CFWA 3F6UL 4NGAL 4PNXA 2WFXB 4GN6A 4XL1A 4AQTA 2FLGA 1SZBA 3Q9KA 1HCGB 4CUDA 3R5QA 2WPME 2BQWA 3ZS1C 4X8VL 4CUEA 2VWLL 3V6QA 2Y5HL 2Y5GL 1EQHA 3I6NA 3GCJA 2Q1JB 3QMOA 4BDWA 4ZAEB 2OYEP 3OGWA 1NPEB 2VH0B 1KIGL 3ZYIB 2Y82B 2WPHE 1FAKL 1XKAL 4KSZA 3NT1A 3H5CB 5JW1A 2W2PE 2XBXL 3ZYJB 4BTTA 1NFXB 1I0UA 2BZ6L 2IPSA 4XLWA 2UWOB 1IOEL 1JV2B 4OTJA 1AUTL 4BXWA 4A94C 2Y7XB 2P16L 1G2LB 5FF1A 3F9PC 5B72A 5IKTA 4X8SL 3SOVA 1IGXA 1PRHA 3MQEA 5KN5C 1F7MA 2GD4A 4YZUB 5GH0A 1G1RA 1F7EA 3PGHA 4Y7BB 3NTGA 3TH3L 2EI7B 2CJIB 2W2ME 3V65B 3NYHA 1G1TA 5CKMA 5JBAE 1Z6EL 2VH6B 1IQEL 3KQDL 1F0SB 2Y81B 2PUMA 3R4XA 2ADXA 2W86A 4ZXXL 2PT3A 4RRZA 2TGFA 1DQBA 2W2NE 5JVYA 1CCFA 4XBMA 4LORA 1WHEA 2KL7A 2BMGA 4D0EA 5FDQA 4ISIL 5L2ZL 3GC1A 1NFWB 2Y38A 2K2TA 1CVUA 1CVWL 2PUQL 5COXA 4ZH8B 3KL6B 1HT5A 3FBYA 1HJ7A 5JBBE 3QH0A 2WPIE 3N8WA 1QFKL 1UZJA 2QRBA 3N8WB 1N1IA 1Q4GA 2XBVL 2QQTA 2VVUL 3LTFB 2KB9A 3LAQA 1KSNB 2MGRA 1FAXL 1LPZA 1RFNB 2YGQA 5L2YL 3ENSA 1ZAQA 3KK6A 4D90A 1D2VC 4ISHL 4JZFL 4MSFA 1X7AL 4BTIA 2H9EL 1MOXC 1IOXA 2P28B 1B9WA 1COUA 2WYJB 1PFXL 1EPHA 4X8UL 1F0RB 3N8FA 1FJSL 1PXXA 3NTBA 1IP0A 1WU1B 2W26B 2DDUA 1LPGA 3KQCL 1IGZA 1DX5I 3HO4A 1EBVA 2O86A 3N8XA 4ZHAB 2VVCK 3CS7L 4RUTA 4JYVL 5JB9E 3Q7DA 4HHRA 2WG3C 2P3FL 2VVVL 5FIWC 4M11A 3R55A 2YGPA 2J38B 4BTUA 2K2SB 5HPWA 4MMZB 3SOBB 3C9AC 2P93L 3Q3KB 5CKNA 2XBYL 3NJPC 4LJJA 4NA9L 3HS7A 3N8YB 1NQLB 2VWNL 2J34B 1XFEA 2J4IB 3OLTA 3GCXE 3M36L 4YT7L 2EI8B 1CXPC 1YO8A 3S4FA 5F1AA 3TBDA 1A3PA 2D1JB 1IVOC 1PGEA 2I9AA 2OJVA 3KCGL 5GLSA 4Z0LA 4NJBA 2UWPB 1U8CB 2BQ6A 3FFGL 2NQXA 1HZ8A 1U67A 1WHFA 1URKA 5CKQA 1DDXA 3LN1A 1LMJA 1NZIA 3BPSE 1CEJA 3QF1A 3TK5B 3N8YA 3QL6A 2P3FN 3K9XA 2P26A 3F1SB 1IJQA 5IKRA 1YUFA 3PY4A 1MQ6L 4Y7AB 1KLJL 1UZQA 3HPTA 4DL1C 1BF9A 4Y76B 2E9EA 1D5LC 2MGPA 3BXIA 3QCWA 3N8VA 2KNIA 1IQML 2BO2A 2G00L 4RRWA 1W8BL 3LC3B 4C16A 1HT8A 4IG5A 1TOZA 3KQEL 3ASIA 1IQGL 4COXA 4M10A 1EMOA 1D7WC 3UBAA 3IITB 5CISA 2VWOL 1FFMA 1MQ5L 2BOXA 4BXSA 1J9CL 2Y7ZB 3U7UG 2W3KB 1M1XB 2OYUP 2KV4A 2GJMA 1YGCL 5EGMB 1HAFA 4N7AA 3MDLA 1N7DA 1Z6CA 3OLUA 2P3UA 1XDTR 2FLRL 1FF7A 1HAEA 1GK5A 2J2UB 1YUKB 3BT1A 1HX2A 2AYLA 3HS5A 2IKCA 2EHAA 2XC4L 2VJ3A 2W2OE 1NFYB 1HREA 1EMNA 1DVAL 4KVLA 1YUGA 2Y80B 4NG9L 4CSYA 1NFUB 4RRYA 3GCLA 3HO3A 3ELAL 4OTYA 3CA7A 3IJEB 5L30L 2H9EC 2WG4B 4Y55A 1C5MF 2WPKE 3N8ZA 3U73A 3NIUA 3R05A 2BQ7A 4LMFA 3FCSB 2BOKL 2QPKA 2XBWL 1IQHL 1EGFA 4QJQA 1P0SL 4Y79B 3P5BL 3RKEA 1JBUL 1FE2A 2I9BA 4KVKA 1ATAA 1IQNL 1LQDA 4RRXA 1DNWC 5IKVA 3TK6B 4MMXB 2VWMK 1EQGA 3FAQA 4HHSA 2WZPP 2W2QE 1K36A 1CX2A 3V64C 2J94B 1ATBA 1IQKL 2NPRA 2RHPA 1V3XB 1UZKA 1G1SA 1P9JA 4QYQA 1PTHA 4JZEL 3TGFA 2P3TA 1KLIL 4Z6AL 2YGOA 4Z0KB 5JBCE 2EFBA 1CCVA 2BOHA 1CQEA 4A7IA 1XKBA 1HRFA 1MYPC 2RA0L 2M74A 2BOUA 1G2MB 2W3IB 3EGFA 3DEMA 6COXA 1EPGA 1IQIL 3LIWB 3M37L 5JVZA 3S6XA 4CUFA 4GM7A 3ZYGA 1KLOA 1O5DL 4Y6DB 2MHPA 2WFTA 3FNLA 1EPJA 1LPKA 1IQLL 4JYUL 3CENL 1L3YA 4YT6L 3NAKA 2UWLB 1DNUC 1LMMA 5KIRA 4E1GA 2FD6A 1EAIC 2J95B 4O02B 3ZS0C 2R5LA 3TGYA 5IKQA 2B7DL 4RS0A 3BT2A 2F9BL 4O1ZA 2WPJE 2P94L 4MMYB 3GISX 1JL9A 3HS6A 3KRKA 2FZZL 2XC5L 1MHLC 2XC0L 1FSBA 1TLEA 2PHBB 1G1QA 4Y71B 3KQBL 2FLBL 2WYGB 3ERHA 1OB1C 4OEKA 3R5OA 5JB8E 1UZPA 1EZQB 3SW2A 2P95L 3HO5A 4JZDL 5F19A 5K0HB 2PR3B 5E8DA 4D0FA 1ATEA 4FM5A 3SXVA 4NT3A 1APQA 3LTGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNL A;  3SOQ A;  1IQF L;  3GCK A;  3LC5 B;  4C1M C;  1APO A;  1IQJ L;  3GCW E;  1L5G B;  2WPL E;  1K37 A;  3POY A;  2EI6 B;  3LN0 A;  1NT0 A;  1W7X L;  3ERI A;  4TGF A;  3TZI A;  3RR3 A;  1DIY A;  2JKH L;  4PH9 A;  1EPI A;  4KVJ A;  2Y5F L;  4G1M B;  5I46 L;  3KRQ A;  1ADX A;  1TPG A;  1ATD A;  4ZXY L;  2Z5Z A;  4BDX A;  4X8T L;  3CFW A;  3F6U L;  4NGA L;  4PNX A;  2WFX B;  4GN6 A;  4XL1 A;  4AQT A;  2FLG A;  1SZB A;  3Q9K A;  1HCG B;  4CUD A;  3R5Q A;  2WPM E;  2BQW A;  3ZS1 C;  4X8V L;  4CUE A;  2VWL L;  3V6Q A;  2Y5H L;  2Y5G L;  1EQH A;  3I6N A;  3GCJ A;  2Q1J B;  3QMO A;  4BDW A;  4ZAE B;  2OYE P;  3OGW A;  1NPE B;  2VH0 B;  1KIG L;  3ZYI B;  2Y82 B;  2WPH E;  1FAK L;  1XKA L;  4KSZ A;  3NT1 A;  3H5C B;  5JW1 A;  2W2P E;  2XBX L;  3ZYJ B;  4BTT A;  1NFX B;  1I0U A;  2BZ6 L;  2IPS A;  4XLW A;  2UWO B;  1IOE L;  1JV2 B;  4OTJ A;  1AUT L;  4BXW A;  2Y7X B;  2P16 L;  1G2L B;  5FF1 A;  3F9P C;  5B72 A;  5IKT A;  4X8S L;  3SOV A;  1IGX A;  1PRH A;  3MQE A;  5KN5 C;  1F7M A;  2GD4 A;  4YZU B;  5GH0 A;  1G1R A;  1F7E A;  3PGH A;  4Y7B B;  3NTG A;  3TH3 L;  2EI7 B;  2CJI B;  2W2M E;  3V65 B;  3NYH A;  1G1T A;  5CKM A;  5JBA E;  1Z6E L;  2VH6 B;  1IQE L;  3KQD L;  1F0S B;  2Y81 B;  2PUM A;  3R4X A;  2ADX A;  2W86 A;  4ZXX L;  2PT3 A;  4RRZ A;  2TGF A;  1DQB A;  2W2N E;  5JVY A;  1CCF A;  4XBM A;  4LOR A;  1WHE A;  2KL7 A;  2BMG A;  4D0E A;  5FDQ A;  4ISI L;  5L2Z L;  3GC1 A;  1NFW B;  2Y38 A;  2K2T A;  1CVU A;  1CVW L;  2PUQ L;  5COX A;  4ZH8 B;  3KL6 B;  1HT5 A;  3FBY A;  1HJ7 A;  5JBB E;  3QH0 A;  2WPI E;  3N8W A;  1QFK L;  1UZJ A;  2QRB A;  3N8W B;  1N1I A;  1Q4G A;  2XBV L;  2QQT A;  2VVU L;  3LTF B;  2KB9 A;  3LAQ A;  1KSN B;  2MGR A;  1FAX L;  1LPZ A;  1RFN B;  5L2Y L;  3ENS A;  1ZAQ A;  3KK6 A;  4D90 A;  1D2V C;  4ISH L;  4JZF L;  4MSF A;  1X7A L;  4BTI A;  2H9E L;  1MOX C;  1IOX A;  2P28 B;  1B9W A;  1COU A;  2WYJ B;  1PFX L;  1EPH A;  4X8U L;  1F0R B;  3N8F A;  1FJS L;  1PXX A;  3NTB A;  1IP0 A;  1WU1 B;  2W26 B;  2DDU A;  1LPG A;  3KQC L;  1IGZ A;  1DX5 I;  3HO4 A;  1EBV A;  2O86 A;  3N8X A;  4ZHA B;  2VVC K;  3CS7 L;  4RUT A;  4JYV L;  5JB9 E;  3Q7D A;  4HHR A;  2WG3 C;  2P3F L;  2VVV L;  5FIW C;  4M11 A;  3R55 A;  2YGP A;  2J38 B;  4BTU A;  2K2S B;  5HPW A;  4MMZ B;  3SOB B;  3C9A C;  2P93 L;  3Q3K B;  5CKN A;  2XBY L;  3NJP C;  4LJJ A;  4NA9 L;  3HS7 A;  3N8Y B;  1NQL B;  2VWN L;  2J34 B;  1XFE A;  2J4I B;  3OLT A;  3GCX E;  3M36 L;  4YT7 L;  2EI8 B;  1CXP C;  1YO8 A;  3S4F A;  5F1A A;  3TBD A;  1A3P A;  2D1J B;  1IVO C;  1PGE A;  2I9A A;  2OJV A;  3KCG L;  5GLS A;  4Z0L A;  4NJB A;  2UWP B;  1U8C B;  2BQ6 A;  3FFG L;  2NQX A;  1HZ8 A;  1U67 A;  1WHF A;  1URK A;  5CKQ A;  1DDX A;  3LN1 A;  1LMJ A;  1NZI A;  3BPS E;  1CEJ A;  3QF1 A;  3TK5 B;  3N8Y A;  3QL6 A;  2P3F N;  3K9X A;  2P26 A;  3F1S B;  1IJQ A;  5IKR A;  1YUF A;  3PY4 A;  1MQ6 L;  4Y7A B;  1KLJ L;  1UZQ A;  3HPT A;  4DL1 C;  1BF9 A;  4Y76 B;  2E9E A;  1D5L C;  2MGP A;  3BXI A;  3QCW A;  3N8V A;  1IQM L;  2BO2 A;  2G00 L;  4RRW A;  1W8B L;  3LC3 B;  4C16 A;  1HT8 A;  4IG5 A;  1TOZ A;  3KQE L;  3ASI A;  1IQG L;  4COX A;  4M10 A;  1EMO A;  1D7W C;  3UBA A;  3IIT B;  5CIS A;  2VWO L;  1FFM A;  1MQ5 L;  2BOX A;  4BXS A;  1J9C L;  2Y7Z B;  3U7U G;  2W3K B;  1M1X B;  2OYU P;  2KV4 A;  2GJM A;  1YGC L;  5EGM B;  1HAF A;  4N7A A;  3MDL A;  1N7D A;  1Z6C A;  3OLU A;  2P3U A;  1XDT R;  2FLR L;  1FF7 A;  1HAE A;  1GK5 A;  2J2U B;  1YUK B;  3BT1 A;  1HX2 A;  2AYL A;  3HS5 A;  2IKC A;  2EHA A;  2XC4 L;  2VJ3 A;  2W2O E;  1NFY B;  1HRE A;  1EMN A;  1DVA L;  4KVL A;  1YUG A;  2Y80 B;  4NG9 L;  4CSY A;  1NFU B;  4RRY A;  3GCL A;  3HO3 A;  3ELA L;  4OTY A;  3CA7 A;  3IJE B;  5L30 L;  2WG4 B;  4Y55 A;  1C5M F;  2WPK E;  3N8Z A;  3U73 A;  3NIU A;  3R05 A;  2BQ7 A;  4LMF A;  3FCS B;  2BOK L;  2QPK A;  2XBW L;  1IQH L;  1EGF A;  4QJQ A;  1P0S L;  4Y79 B;  3P5B L;  3RKE A;  1JBU L;  1FE2 A;  2I9B A;  4KVK A;  1ATA A;  1IQN L;  1LQD A;  4RRX A;  1DNW C;  5IKV A;  3TK6 B;  4MMX B;  2VWM K;  1EQG A;  3FAQ A;  4HHS A;  2W2Q E;  1K36 A;  1CX2 A;  3V64 C;  2J94 B;  1ATB A;  1IQK L;  2NPR A;  2RHP A;  1V3X B;  1UZK A;  1G1S A;  1P9J A;  4QYQ A;  1PTH A;  4JZE L;  3TGF A;  2P3T A;  1KLI L;  4Z6A L;  2YGO A;  4Z0K B;  5JBC E;  2EFB A;  1CCV A;  2BOH A;  1CQE A;  4A7I A;  1XKB A;  1HRF A;  1MYP C;  2RA0 L;  2M74 A;  2BOU A;  1G2M B;  2W3I B;  3EGF A;  3DEM A;  6COX A;  1EPG A;  1IQI L;  3LIW B;  3M37 L;  5JVZ A;  4CUF A;  4GM7 A;  3ZYG A;  1KLO A;  1O5D L;  4Y6D B;  2MHP A;  2WFT A;  3FNL A;  1EPJ A;  1LPK A;  1IQL L;  4JYU L;  3CEN L;  1L3Y A;  4YT6 L;  3NAK A;  2UWL B;  1DNU C;  5KIR A;  4E1G A;  2FD6 A;  1EAI C;  2J95 B;  4O02 B;  3ZS0 C;  2R5L A;  3TGY A;  5IKQ A;  2B7D L;  4RS0 A;  3BT2 A;  2F9B L;  4O1Z A;  2WPJ E;  2P94 L;  4MMY B;  3GIS X;  1JL9 A;  3HS6 A;  3KRK A;  2FZZ L;  2XC5 L;  1MHL C;  2XC0 L;  1FSB A;  1TLE A;  2PHB B;  1G1Q A;  4Y71 B;  3KQB L;  2FLB L;  2WYG B;  3ERH A;  1OB1 C;  4OEK A;  3R5O A;  5JB8 E;  1UZP A;  1EZQ B;  3SW2 A;  2P95 L;  3HO5 A;  4JZD L;  5F19 A;  5K0H B;  2PR3 B;  5E8D A;  4D0F A;  1ATE A;  4FM5 A;  3SXV A;  4NT3 A;  1APQ A;  3LTG D; 
#chains in the Genus database with same CATH topology
 2RNL A;  3SOQ A;  1IQF L;  3GCK A;  3LC5 B;  4C1M C;  1APO A;  1IQJ L;  3GCW E;  2VRS A;  1L5G B;  2WPL E;  1K37 A;  3POY A;  2EI6 B;  3LN0 A;  1NT0 A;  1W7X L;  3ERI A;  4TGF A;  3TZI A;  3RR3 A;  1DIY A;  2JKH L;  4PH9 A;  1EPI A;  4KVJ A;  2Y5F L;  4G1M B;  5I46 L;  3KRQ A;  1ADX A;  1TPG A;  1ATD A;  4ZXY L;  2Z5Z A;  4BDX A;  4X8T L;  3CFW A;  3F6U L;  4NGA L;  4PNX A;  2WFX B;  4GN6 A;  4XL1 A;  4AQT A;  2FLG A;  1SZB A;  3Q9K A;  1HCG B;  4CUD A;  3R5Q A;  2WPM E;  2BQW A;  3ZS1 C;  4X8V L;  4CUE A;  2VWL L;  3V6Q A;  2Y5H L;  2Y5G L;  1EQH A;  3I6N A;  3GCJ A;  2Q1J B;  3QMO A;  4BDW A;  4ZAE B;  2OYE P;  3OGW A;  1NPE B;  2VH0 B;  1KIG L;  3ZYI B;  2Y82 B;  2WPH E;  1FAK L;  1XKA L;  4KSZ A;  3NT1 A;  3H5C B;  5JW1 A;  2W2P E;  2XBX L;  3ZYJ B;  4BTT A;  1NFX B;  1I0U A;  2BZ6 L;  2IPS A;  4XLW A;  2UWO B;  1IOE L;  1JV2 B;  4OTJ A;  1AUT L;  4BXW A;  2BT8 A;  4A94 C;  2Y7X B;  2P16 L;  1G2L B;  5FF1 A;  3F9P C;  5B72 A;  5IKT A;  4X8S L;  3SOV A;  1IGX A;  1PRH A;  4GU4 A;  3MQE A;  5KN5 C;  1F7M A;  2GD4 A;  4YZU B;  5GH0 A;  1G1R A;  1F7E A;  3PGH A;  4Y7B B;  3NTG A;  3TH3 L;  2EI7 B;  2CJI B;  2W2M E;  3V65 B;  3NYH A;  1G1T A;  5CKM A;  5JBA E;  1Z6E L;  2VH6 B;  1IQE L;  3KQD L;  1F0S B;  2Y81 B;  2PUM A;  3R4X A;  2ADX A;  2W86 A;  4ZXX L;  2PT3 A;  4RRZ A;  2TGF A;  1DQB A;  2W2N E;  5JVY A;  1CCF A;  4XBM A;  4LOR A;  1WHE A;  2KL7 A;  2BMG A;  4D0E A;  5FDQ A;  4ISI L;  5L2Z L;  3GC1 A;  1NFW B;  2Y38 A;  2K2T A;  1CVU A;  1CVW L;  2PUQ L;  5COX A;  4ZH8 B;  3KL6 B;  1HT5 A;  3FBY A;  1HJ7 A;  5JBB E;  1KKE A;  3QH0 A;  2WPI E;  3N8W A;  1QFK L;  1UZJ A;  2QRB A;  3N8W B;  1N1I A;  1Q4G A;  2XBV L;  2QQT A;  2VVU L;  3LTF B;  2KB9 A;  3LAQ A;  1KSN B;  2MGR A;  1FAX L;  1LPZ A;  1RFN B;  2YGQ A;  5L2Y L;  3ENS A;  2BSF A;  1ZAQ A;  3KK6 A;  4D90 A;  1D2V C;  4ISH L;  4JZF L;  4MSF A;  1X7A L;  4BTI A;  2H9E L;  1MOX C;  1IOX A;  2P28 B;  1B9W A;  1COU A;  2WYJ B;  1PFX L;  1EPH A;  4X8U L;  1F0R B;  3N8F A;  1FJS L;  1PXX A;  3NTB A;  1IP0 A;  1WU1 B;  2W26 B;  2DDU A;  1LPG A;  3KQC L;  1IGZ A;  1DX5 I;  3HO4 A;  1EBV A;  2O86 A;  3N8X A;  4ZHA B;  2VVC K;  3CS7 L;  4RUT A;  4JYV L;  5JB9 E;  3Q7D A;  4HHR A;  2WG3 C;  2P3F L;  2VVV L;  5FIW C;  4M11 A;  3R55 A;  2YGP A;  2J38 B;  4BTU A;  2K2S B;  5HPW A;  4MMZ B;  3SOB B;  3C9A C;  2P93 L;  3Q3K B;  5CKN A;  2XBY L;  3NJP C;  4LJJ A;  4NA9 L;  3HS7 A;  3N8Y B;  1NQL B;  2VWN L;  2J34 B;  1XFE A;  2J4I B;  3OLT A;  3GCX E;  3M36 L;  4YT7 L;  2EI8 B;  1CXP C;  1YO8 A;  3S4F A;  5F1A A;  3TBD A;  1A3P A;  2D1J B;  2JJL A;  1IVO C;  1PGE A;  2I9A A;  2OJV A;  3KCG L;  5GLS A;  4Z0L A;  4NJB A;  2UWP B;  1U8C B;  2BQ6 A;  3FFG L;  2NQX A;  1HZ8 A;  1U67 A;  1WHF A;  1URK A;  5CKQ A;  1DDX A;  3LN1 A;  1LMJ A;  1NZI A;  3BPS E;  1CEJ A;  3QF1 A;  3TK5 B;  3N8Y A;  3QL6 A;  2P3F N;  3K9X A;  2P26 A;  3F1S B;  1IJQ A;  5IKR A;  1YUF A;  3PY4 A;  1MQ6 L;  4Y7A B;  1KLJ L;  1UZQ A;  3HPT A;  4DL1 C;  1BF9 A;  4Y76 B;  2E9E A;  1D5L C;  2MGP A;  3BXI A;  3QCW A;  3N8V A;  2KNI A;  1IQM L;  2BO2 A;  2G00 L;  4RRW A;  1W8B L;  3LC3 B;  4C16 A;  1HT8 A;  4IG5 A;  2BT7 A;  1TOZ A;  3KQE L;  3ASI A;  1IQG L;  4COX A;  4M10 A;  1EMO A;  1D7W C;  3UBA A;  3IIT B;  1V1I A;  1QIU A;  5CIS A;  2VWO L;  1FFM A;  1MQ5 L;  2BOX A;  4BXS A;  1J9C L;  2Y7Z B;  3U7U G;  2W3K B;  1M1X B;  2OYU P;  2KV4 A;  2GJM A;  1YGC L;  5EGM B;  1HAF A;  4N7A A;  3MDL A;  1N7D A;  1Z6C A;  3OLU A;  2P3U A;  1XDT R;  2FLR L;  1FF7 A;  1HAE A;  1GK5 A;  2J2U B;  1YUK B;  3BT1 A;  1HX2 A;  2AYL A;  3HS5 A;  2IKC A;  2EHA A;  2XC4 L;  2VJ3 A;  2W2O E;  1NFY B;  1HRE A;  1EMN A;  1DVA L;  4KVL A;  1YUG A;  2Y80 B;  4NG9 L;  4CSY A;  1NFU B;  4RRY A;  3GCL A;  3HO3 A;  3ELA L;  4OTY A;  3CA7 A;  3IJE B;  5L30 L;  2H9E C;  2WG4 B;  4Y55 A;  1C5M F;  2WPK E;  3N8Z A;  3U73 A;  3NIU A;  1V1H A;  3R05 A;  2BQ7 A;  2HOX A;  4LMF A;  3FCS B;  2BOK L;  2QPK A;  2XBW L;  1IQH L;  1EGF A;  4QJQ A;  1P0S L;  4Y79 B;  3P5B L;  1LK9 A;  3RKE A;  1JBU L;  1FE2 A;  2I9B A;  4KVK A;  1ATA A;  1IQN L;  1LQD A;  4RRX A;  1DNW C;  5IKV A;  3TK6 B;  4MMX B;  2VWM K;  1EQG A;  3FAQ A;  4HHS A;  2WZP P;  2HOR A;  2W2Q E;  1K36 A;  1CX2 A;  3V64 C;  2J94 B;  1ATB A;  1IQK L;  2NPR A;  2RHP A;  1V3X B;  1UZK A;  1G1S A;  1P9J A;  4QYQ A;  1PTH A;  4JZE L;  3TGF A;  2P3T A;  1KLI L;  4Z6A L;  2YGO A;  4Z0K B;  4GU3 A;  5JBC E;  2EFB A;  1CCV A;  2BOH A;  1CQE A;  4A7I A;  1XKB A;  1HRF A;  1MYP C;  2RA0 L;  2M74 A;  2BOU A;  1G2M B;  2W3I B;  3EGF A;  3DEM A;  6COX A;  1EPG A;  1IQI L;  3LIW B;  3M37 L;  5JVZ A;  3S6X A;  4CUF A;  4GM7 A;  3ZYG A;  1KLO A;  1O5D L;  4Y6D B;  2MHP A;  2WFT A;  3FNL A;  1EPJ A;  1LPK A;  1IQL L;  4JYU L;  3CEN L;  1L3Y A;  4YT6 L;  3NAK A;  2UWL B;  1DNU C;  1LMM A;  5KIR A;  4E1G A;  2FD6 A;  1EAI C;  2J95 B;  4O02 B;  3ZS0 C;  2R5L A;  3TGY A;  5IKQ A;  2B7D L;  4RS0 A;  3BT2 A;  2F9B L;  4O1Z A;  2WPJ E;  2P94 L;  4MMY B;  3GIS X;  1JL9 A;  3HS6 A;  3KRK A;  2FZZ L;  2XC5 L;  1MHL C;  2XC0 L;  1FSB A;  1TLE A;  2PHB B;  1G1Q A;  4Y71 B;  3KQB L;  2FLB L;  2WYG B;  3ERH A;  1OB1 C;  4OEK A;  3R5O A;  5JB8 E;  1UZP A;  1EZQ B;  3SW2 A;  2P95 L;  3HO5 A;  4JZD L;  5F19 A;  5K0H B;  2PR3 B;  5E8D A;  4D0F A;  1ATE A;  4FM5 A;  3SXV A;  4NT3 A;  1APQ A;  3LTG D; 
#chains in the Genus database with same CATH homology
 2RNL A;  3SOQ A;  1IQF L;  3GCK A;  3LC5 B;  4C1M C;  1APO A;  1IQJ L;  3GCW E;  1L5G B;  2WPL E;  1K37 A;  3POY A;  2EI6 B;  3LN0 A;  1NT0 A;  1W7X L;  3ERI A;  4TGF A;  3TZI A;  3RR3 A;  1DIY A;  2JKH L;  4PH9 A;  1EPI A;  4KVJ A;  2Y5F L;  4G1M B;  5I46 L;  3KRQ A;  1ADX A;  1TPG A;  1ATD A;  4ZXY L;  2Z5Z A;  4BDX A;  4X8T L;  3CFW A;  3F6U L;  4NGA L;  4PNX A;  2WFX B;  4GN6 A;  4XL1 A;  4AQT A;  2FLG A;  1SZB A;  3Q9K A;  1HCG B;  4CUD A;  3R5Q A;  2WPM E;  2BQW A;  3ZS1 C;  4X8V L;  4CUE A;  2VWL L;  3V6Q A;  2Y5H L;  2Y5G L;  1EQH A;  3I6N A;  3GCJ A;  2Q1J B;  3QMO A;  4BDW A;  4ZAE B;  2OYE P;  3OGW A;  1NPE B;  2VH0 B;  1KIG L;  3ZYI B;  2Y82 B;  2WPH E;  1FAK L;  1XKA L;  4KSZ A;  3NT1 A;  3H5C B;  5JW1 A;  2W2P E;  2XBX L;  3ZYJ B;  4BTT A;  1NFX B;  1I0U A;  2BZ6 L;  2IPS A;  4XLW A;  2UWO B;  1IOE L;  1JV2 B;  4OTJ A;  1AUT L;  4BXW A;  4A94 C;  2Y7X B;  2P16 L;  1G2L B;  5FF1 A;  3F9P C;  5B72 A;  5IKT A;  4X8S L;  3SOV A;  1IGX A;  1PRH A;  3MQE A;  5KN5 C;  1F7M A;  2GD4 A;  4YZU B;  5GH0 A;  1G1R A;  1F7E A;  3PGH A;  4Y7B B;  3NTG A;  3TH3 L;  2EI7 B;  2CJI B;  2W2M E;  3V65 B;  3NYH A;  1G1T A;  5CKM A;  5JBA E;  1Z6E L;  2VH6 B;  1IQE L;  3KQD L;  1F0S B;  2Y81 B;  2PUM A;  3R4X A;  2ADX A;  2W86 A;  4ZXX L;  2PT3 A;  4RRZ A;  2TGF A;  1DQB A;  2W2N E;  5JVY A;  1CCF A;  4XBM A;  4LOR A;  1WHE A;  2KL7 A;  2BMG A;  4D0E A;  5FDQ A;  4ISI L;  5L2Z L;  3GC1 A;  1NFW B;  2Y38 A;  2K2T A;  1CVU A;  1CVW L;  2PUQ L;  5COX A;  4ZH8 B;  3KL6 B;  1HT5 A;  3FBY A;  1HJ7 A;  5JBB E;  3QH0 A;  2WPI E;  3N8W A;  1QFK L;  1UZJ A;  2QRB A;  3N8W B;  1N1I A;  1Q4G A;  2XBV L;  2QQT A;  2VVU L;  3LTF B;  2KB9 A;  3LAQ A;  1KSN B;  2MGR A;  1FAX L;  1LPZ A;  1RFN B;  2YGQ A;  5L2Y L;  3ENS A;  1ZAQ A;  3KK6 A;  4D90 A;  1D2V C;  4ISH L;  4JZF L;  4MSF A;  1X7A L;  4BTI A;  2H9E L;  1MOX C;  1IOX A;  2P28 B;  1B9W A;  1COU A;  2WYJ B;  1PFX L;  1EPH A;  4X8U L;  1F0R B;  3N8F A;  1FJS L;  1PXX A;  3NTB A;  1IP0 A;  1WU1 B;  2W26 B;  2DDU A;  1LPG A;  3KQC L;  1IGZ A;  1DX5 I;  3HO4 A;  1EBV A;  2O86 A;  3N8X A;  4ZHA B;  2VVC K;  3CS7 L;  4RUT A;  4JYV L;  5JB9 E;  3Q7D A;  4HHR A;  2WG3 C;  2P3F L;  2VVV L;  5FIW C;  4M11 A;  3R55 A;  2YGP A;  2J38 B;  4BTU A;  2K2S B;  5HPW A;  4MMZ B;  3SOB B;  3C9A C;  2P93 L;  3Q3K B;  5CKN A;  2XBY L;  3NJP C;  4LJJ A;  4NA9 L;  3HS7 A;  3N8Y B;  1NQL B;  2VWN L;  2J34 B;  1XFE A;  2J4I B;  3OLT A;  3GCX E;  3M36 L;  4YT7 L;  2EI8 B;  1CXP C;  1YO8 A;  3S4F A;  5F1A A;  3TBD A;  1A3P A;  2D1J B;  1IVO C;  1PGE A;  2I9A A;  2OJV A;  3KCG L;  5GLS A;  4Z0L A;  4NJB A;  2UWP B;  1U8C B;  2BQ6 A;  3FFG L;  2NQX A;  1HZ8 A;  1U67 A;  1WHF A;  1URK A;  5CKQ A;  1DDX A;  3LN1 A;  1LMJ A;  1NZI A;  3BPS E;  1CEJ A;  3QF1 A;  3TK5 B;  3N8Y A;  3QL6 A;  2P3F N;  3K9X A;  2P26 A;  3F1S B;  1IJQ A;  5IKR A;  1YUF A;  3PY4 A;  1MQ6 L;  4Y7A B;  1KLJ L;  1UZQ A;  3HPT A;  4DL1 C;  1BF9 A;  4Y76 B;  2E9E A;  1D5L C;  2MGP A;  3BXI A;  3QCW A;  3N8V A;  2KNI A;  1IQM L;  2BO2 A;  2G00 L;  4RRW A;  1W8B L;  3LC3 B;  4C16 A;  1HT8 A;  4IG5 A;  1TOZ A;  3KQE L;  3ASI A;  1IQG L;  4COX A;  4M10 A;  1EMO A;  1D7W C;  3UBA A;  3IIT B;  5CIS A;  2VWO L;  1FFM A;  1MQ5 L;  2BOX A;  4BXS A;  1J9C L;  2Y7Z B;  3U7U G;  2W3K B;  1M1X B;  2OYU P;  2KV4 A;  2GJM A;  1YGC L;  5EGM B;  1HAF A;  4N7A A;  3MDL A;  1N7D A;  1Z6C A;  3OLU A;  2P3U A;  1XDT R;  2FLR L;  1FF7 A;  1HAE A;  1GK5 A;  2J2U B;  1YUK B;  3BT1 A;  1HX2 A;  2AYL A;  3HS5 A;  2IKC A;  2EHA A;  2XC4 L;  2VJ3 A;  2W2O E;  1NFY B;  1HRE A;  1EMN A;  1DVA L;  4KVL A;  1YUG A;  2Y80 B;  4NG9 L;  4CSY A;  1NFU B;  4RRY A;  3GCL A;  3HO3 A;  3ELA L;  4OTY A;  3CA7 A;  3IJE B;  5L30 L;  2H9E C;  2WG4 B;  4Y55 A;  1C5M F;  2WPK E;  3N8Z A;  3U73 A;  3NIU A;  3R05 A;  2BQ7 A;  4LMF A;  3FCS B;  2BOK L;  2QPK A;  2XBW L;  1IQH L;  1EGF A;  4QJQ A;  1P0S L;  4Y79 B;  3P5B L;  3RKE A;  1JBU L;  1FE2 A;  2I9B A;  4KVK A;  1ATA A;  1IQN L;  1LQD A;  4RRX A;  1DNW C;  5IKV A;  3TK6 B;  4MMX B;  2VWM K;  1EQG A;  3FAQ A;  4HHS A;  2WZP P;  2W2Q E;  1K36 A;  1CX2 A;  3V64 C;  2J94 B;  1ATB A;  1IQK L;  2NPR A;  2RHP A;  1V3X B;  1UZK A;  1G1S A;  1P9J A;  4QYQ A;  1PTH A;  4JZE L;  3TGF A;  2P3T A;  1KLI L;  4Z6A L;  2YGO A;  4Z0K B;  5JBC E;  2EFB A;  1CCV A;  2BOH A;  1CQE A;  4A7I A;  1XKB A;  1HRF A;  1MYP C;  2RA0 L;  2M74 A;  2BOU A;  1G2M B;  2W3I B;  3EGF A;  3DEM A;  6COX A;  1EPG A;  1IQI L;  3LIW B;  3M37 L;  5JVZ A;  3S6X A;  4CUF A;  4GM7 A;  3ZYG A;  1KLO A;  1O5D L;  4Y6D B;  2MHP A;  2WFT A;  3FNL A;  1EPJ A;  1LPK A;  1IQL L;  4JYU L;  3CEN L;  1L3Y A;  4YT6 L;  3NAK A;  2UWL B;  1DNU C;  1LMM A;  5KIR A;  4E1G A;  2FD6 A;  1EAI C;  2J95 B;  4O02 B;  3ZS0 C;  2R5L A;  3TGY A;  5IKQ A;  2B7D L;  4RS0 A;  3BT2 A;  2F9B L;  4O1Z A;  2WPJ E;  2P94 L;  4MMY B;  3GIS X;  1JL9 A;  3HS6 A;  3KRK A;  2FZZ L;  2XC5 L;  1MHL C;  2XC0 L;  1FSB A;  1TLE A;  2PHB B;  1G1Q A;  4Y71 B;  3KQB L;  2FLB L;  2WYG B;  3ERH A;  1OB1 C;  4OEK A;  3R5O A;  5JB8 E;  1UZP A;  1EZQ B;  3SW2 A;  2P95 L;  3HO5 A;  4JZD L;  5F19 A;  5K0H B;  2PR3 B;  5E8D A;  4D0F A;  1ATE A;  4FM5 A;  3SXV A;  4NT3 A;  1APQ A;  3LTG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...