2YGOA

Wif domain-egf-like domain 1 of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
180
structure length
174
Chain Sequence
TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WNT INHIBITORY FACTOR 1
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 31
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygoA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygoA01
1BF9A 3GISX 4OTJA 2VWOL 2W2PE 2H9EL 1CX2A 4CUFA 1UZKA 4RUTA 4BTTA 1F7EA 5KN5C 3K9XA 2Y38A 2WFXB 3U7UG 5IKQA 1FSBA 2W3IB 1IQML 3KCGL 4Y71B 2P94L 4D0EA 2P93L 3NTGA 3EGFA 1IQNL 3HO5A 4BDXA 4G1MB 1TPGA 2FLRL 2J95B 2Y80B 5FDQA 4ZAEB 1G1QA 3IJEB 4NA9L 3N8XA 2G00L 4MMXB 4BTIA 5EGMB 2KL7A 1X7AL 5IKRA 1W7XL 4ZHAB 3Q7DA 3CA7A 2W2NE 2UWLB 1L3YA 2XBWL 1IOEL 1NT0A 1KLOA 3NT1A 2YGPA 2M74A 4TGFA 2BOXA 1NZIA 3ZYIB 1IQGL 2P3UA 5CKQA 1IQHL 2VH0B 1UZJA 2Y5GL 1NFUB 1LPKA 1QFKL 2W26B 3H5CB 1F0SB 1HZ8A 4RRYA 2BQWA 2VH6B 1MQ5L 4Y7BB 1PXXA 4X8TL 2WYJB 1HT5A 2Y7ZB 2Y7XB 3M36L 2W2OE 1TOZA 3KQEL 1YO8A 1J9CL 1OB1C 3SOQA 1IQJL 1FAKL 4ZXYL 1EMOA 5F19A 4X8SL 2UWOB 4RRWA 3QMOA 2J2UB 4MMYB 1EPHA 2BO2A 1CCFA 1DDXA 2FLBL 2XC4L 3N8VA 4YT6L 5JBAE 4JYVL 3SOBB 5L2YL 2I9BA 4C16A 1GK5A 1MOXC 1A3PA 1PRHA 3C9AC 3LTFB 1PTHA 1ADXA 1PGEA 1TLEA 1W8BL 1FE2A 3LIWB 2YGOA 4Z0KB 3TBDA 1HAEA 2Y5HL 5I46L 1APQA 5KIRA 3IITB 4YT7L 6COXA 2VJ3A 3TZIA 2OYEP 2RA0L 2VVVL 3R05A 2UWPB 2VVUL 1NFYB 1DX5I 1HX2A 3HS6A 5JVYA 2W2QE 4O1ZA 4JZEL 2I9AA 3LC3B 1JV2B 3LN1A 2RNLA 3KQBL 1UZPA 2VWNL 4COXA 4BDWA 1P9JA 3N8WB 4A7IA 1LMJA 1UZQA 1SZBA 2BQ7A 1NQLB 1O5DL 1WHEA 1MQ6L 2K2TA 1FAXL 2D3JA 3FCSB 3LTGD 3GCXE 1LPZA 1LPGA 2EI8B 2FZZL 1IQKL 4Y6DB 3OLUA 1Z6EL 1KLIL 3TH3L 2B7DL 2W3KB 5COXA 4Y76B 4X8UL 2OYUP 3F6UL 2RHPA 5JW1A 2KV4A 4ZH8B 4ZXXL 3QCWA 1IGXA 3HPTA 2WYGB 1HCGB 3N8YB 5JBBE 1CVUA 4M10A 3P5BL 2FD6A 4YZUB 2XBYL 1RFNB 3LAQA 1XKAL 5K0HB 2Y82B 2DDUA 1NFWB 1G1SA 4NG9L 1JL9A 4JYUL 1IQFL 2W86A 3PGHA 1K37A 3NJPC 1B9WA 1EPGA 4RRZA 1CEJA 2CJIB 3HS5A 4PH9A 2WG3C 5IKVA 1EZQB 3TGFA 1JBUL 2AYLA 1DIYA 2XBVL 1EQHA 3U73A 1IGZA 2EI6B 3HS7A 3HO3A 5JB8E 5JVZA 1G1TA 4JZFL 2PHBB 1LQDA 1COUA 2BZ6L 2BQ6A 4BXWA 3ELAL 4MMZB 1U67A 1Z6CA 2J34B 3QH0A 1Q4GA 2K2SB 3N8ZA 3V65B 4ISHL 2WPHE 2BOUA 3Q3KB 1IVOC 3KL6B 4OTYA 2WPME 3V64C 1IQEL 3ZYGA 1G2MB 5CKNA 1CCVA 4Z6AL 1YGCL 1HJ7A 2J4IB 1ATEA 1FJSL 2P3FL 2J94B 1F0RB 1C5MF 3MQEA 2P95L 1ATAA 4E1GA 1IOXA 1EPIA 2ADXA 4M11A 3DEMA 3KQDL 4Y79B 1M1XB 3CS7L 3MDLA 1IQLL 1ATBA 2F9BL 1WU1B 2VWLL 3N8WA 1IQIL 5IKTA 1YUFA 2WG4B 1V3XB 1FF7A 3ZYJB 3RR3A 5CISA 5L30L 1XFEA 1KSNB 3NTBA 2KB9A 4AQTA 2NPRA 2D1JB 3CENL 3KK6A 4BXSA 3BT1A 2MHPA 1EAIC 4Z0LA 1EGFA 1CQEA 1URKA 1APOA 4JZDL 4BTUA 1P0SL 1IJQA 1KIGL 4Y7AB 3F1SB 2GD4A 4XBMA 2VVCK 2PR3B 4LMFA 3FBYA 4LORA 1G2LB 1WHFA 2WPIE 3LC5B 4CSYA 4D0FA 1N7DA 4XL1A 2Y5FL 5F1AA 1I0UA 3GCWE 3HO4A 2Y81B 3N8YA 2YGNA 1AUTL 1U8CB 1G1RA 2MGRA 1XDTR 1EQGA 2P3TA 5CKMA 1DQBA 1N1IA 1NFXB 3SOVA 4CUDA 4CUEA 3M37L 4O02B 2P16L 3BPSE 5E8DA 2PUQL 3KQCL 4FM5A 1ATDA 2MGPA 4NGAL 2W2ME 1CVWL 3ASIA 4D90A 1EBVA 5JBCE 3POYA 2TGFA 5L2ZL 1HAFA 4XLWA 3ENSA 1HRFA 2YGQA 3LN0A 2EI7B 3CFWA 2WFTA 2VWMK 3FFGL 2JKHL 1ZAQA 1K36A 4ISIL 2BOKL 2J38B 4RRXA 2BOHA 1L5GB 3TK6B 1NPEB 3OLTA 1HREA 1YUKB 1IP0A 2Q1JB 2XC0L 2P3FN 2P28B 1EMNA 2XC5L 5JB9E 1HT8A 1YUGA 1F7MA 1XKBA 2BMGA 2P26A 4X8VL 3KRKA 3TK5B 1KLJL 1EPJA 1DVAL 2WPKE 3BT2A 1PFXL 3SW2A 2WPLE 2XBXL 1FFMA 2WPJE 4RS0A 2FLGA
chains in the Genus database with same CATH superfamily
4ZYKA 2KKQA 4K3DL 5I15L 2Z1PA 1VGEH 4HIQA 4R7DA 4Z7WE 3UGXA 3AT9A 5LN4A 3DOSB 5IFHH 1CX2A 4KRLB 4HGWA 3FU7A 2OAAA 2ED9A 4LQFH 2EDXA 1WP6A 3EYVB 2YLKA 3GZPA 3HC0B 3RL1A 5HJBA 2IDQA 2VLJA 5E08H 3DSNA 3C09C 1RLWA 5J06A 3RFZB 3HPLB 4X6DA 2CRYA 3V5HA 3W2DL 1JZJA 4AQ8A 2O5NA 2DDQL 4PJBF 4KKPA 5GZOA 5JZ7D 1M71B 3NP3A 5KVDH 2QHRL 4AJVA 2Y2TA 2QKIB 5IMOA 3UTSD 4PJEF 4NCDA 1N5AA 2NOYA 4LGPB 2FLRL 2A4CA 2NTSP 4ZXBD 4EIUA 2FB4H 4DW2H 2CBTA 3EBIA 1BHGA 3MRHB 1F2QA 1NIAA 1KJVB 1ZT4B 5CLZA 4NA9L 3LQAL 3ME0A 4I77L 1A2YB 1KC5L 4O5LH 2WZAA 5D7IF 1MRDL 1MCCA 3MLPA 2NX5B 1MJ7H 4U1MB 1PY4A 1XH0A 2I26N 5L0QC 1A3QA 3D30A 3FH8A 4U6XA 4MRBA 5IY5B 2CBPA 1ZPLA 4LVHB 1QSFE 1A6VL 2YXWA 2VH5H 5E95B 4TVPE 3V0IA 2C7UA 1KCBA 4DKDC 4X4XA 1DBKL 5M95B 1F4YL 4X42A 3PJSA 1E9PB 3VFNA 1SQ2N 5FYKU 1RZIA 2PWFA 1ZLVK 2KPNA 2J56A 4OU3A 4P0DA 1LP9A 3BUYA 3BGMB 3PL6C 3T3MB 1RKRA 3FOMA 4M61B 2MCG1 1UH4A 3PAUA 5FO9A 3RGVA 2Y07H 4UQDA 3I6LE 4WEUD 1ZT1B 3SGEH 2DMHA 2NY5L 3V5KB 3QFJA 4UT9A 2C9VA 1IKFH 3L3DA 3L7EA 3FJTA 1IIIA 3FKUS 4PGDA 2Q86B 1AHWC 2QSCL 2AVFA 4PJ7F 2AEWA 4ANVA 4J8RA 5BZDB 2XKNA 1EQWA 3PABB 3T4YA 2GITA 1D9KC 4TULH 2N7SA 4FP8L 1VADA 4NZRL 5KBLA 1M56B 3WG7B 3MV9D 4AE0A 3NCXA 1D6EA 3CHOA 5EO9A 1UM5L 4QXVA 1BZOA 4DP1X 5LN8A 1ID5I 1T7ZA 5EG6C 4GKOA 1QEWA 2UUDK 4MXQD 2OMXA 3DX4A 1IL1A 5DQJB 4UT7L 5E9DE 1RAMA 1CLOH 5EC2B 1G7LB 3Q06A 1V54B 4OUUB 2X4PA 2EXYD 1XGUB 3UP6A 5TE7L 1LO5A 4ZUUA 2I9BA 1IGYB 2W65A 3KPLB 4HC1L 5DRXA 2ZXDA 3GHEL 3ZK0A 3EFOA 5DZLA 3MV11 1C1EL 3H6AA 3M8OH 2D03H 3VM5A 4C55A 1XF2B 1XSJA 4WSKA 1FYTA 4HULB 1X9UA 1XT5A 2KBGA 5KYXA 3PWJB 4Q6KA 4UTBL 3BQUC 5C0RH 1NUGA 5E8NA 2VR4A 5L4JA 5L8JB 3OXRB 2Y5HL 2X88A 4TVPH 4L1HA 2VSMB 2F6AA 4PJEA 1APQA 4BRJA 5F89A 6COXA 2W38A 2C3GA 4LESA 4PUBL 1DLFH 4ZD3H 1ZLEA 2B0SH 1OTUC 2NY7H 1MRFL 1NEZB 2OJZL 5DHDA 4TSAH 2H26B 5D7IA 3HE7B 1DFBL 5B1AB 2UVFA 2VVUL 1J0IA 3QCVH 2GJZB 3KPSD 4GO8A 4OCSH 3D6GA 3WBDA 2JJSC 4GAJH 3CSYB 1JGIA 1R47A 4Q4IA 1QR1B 1JPST 2CHZA 4LVNC 4DO5A 3S3SA 2EDDA 1CYXA 4AOFA 4OZFB 1J1XH 3T4AB 3G08B 3JWNC 5IIEA 2ZX5A 5DC0A 5H37A 1ZTXE 5I75B 4HFUL 5I0YA 2D7TH 3EYOA 3TBVA 5A16B 4S0SD 4L29A 1PZ3A 3AG4B 4I3RH 4WW2C 2J88H 3HHSB 3L4WA 3U0WL 4Y2OA 5ANME 2VDRB 2YAFA 3KYNA 3LRKA 5HSFA 3ABKB 4XMXA 4KTEL 2BQ7A 5DO2D 1OIOA 2W9EL 3L3HA 4EQ3A 2Q7NA 2K2TA 3CHQA 3QP3A 5G5DA 3VRIB 3SD5A 1BZ7B 1U2HA 3KVDD 1HKLL 1YN6A 4P2QB 4WTZA 4FTDA 5I73C 3QDMD 1H3TA 3MRRA 2ZPKL 5JIPA 5I0VA 2X4NB 4A7QA 3TEXA 3CSTA 1TCRB 1NLDH 4HOMA 1WEJH 5ISZA 4I8DA 3RFRA 4IKJA 4XVTH 3HEIB 4DGIH 4NNXB 1FFRA 5C0CA 5H94B 2BLFA 2OYUP 2OXGB 2A83A 1EFXD 4X5PA 1NUDA 2RHPA 3PHOA 1FO0L 1O7VA 1F3JB 4R2GC 2J8UA 4NHUB 3QZBA 2XV6B 2EE0A 4P3CH 4B6ZA 3BHBA 3UTQB 3NCBB 4PRNB 3WOVA 4DIXA 1DQVA 1V5JA 4PJXA 5C6TL 5KJ4A 5D93C 3U30B 3ULUL 4L4VB 2BWQA 4XP5L 4P59H 3ARTA 2O5YL 3I2CL 3S5LA 5I8CA 1WWWX 2XBYL 4XNZC 2D7PA 4JDZA 4EUPA 2Y82B 1I53A 3T5WA 2VC2H 3HG4A 2VJ8A 1UJ3A 1J05B 5JPMB 2JB6B 4G9FE 4LOEA 5HDOA 3LH2H 3KCPB 2DQIH 4BSWA 2RQEA 2ZUWA 1DN0A 2NY4B 4W9LC 4DUVA 1MLCB 4ZAKC 1OO2A 1B9WA 3IYLW 1BBDL 2HKHL 3JWNH 5A2KH 3DI3B 4JO4L 3AJ7A 5DGRA 1OLZA 1AGCB 3TWCL 5CILH 5D7SH 1SXAA 4L1TA 5AVRB 5CCJA 3UYPB 2HTLD 2WZPP 3DK0A 3WNNA 5B38A 5J13C 1ZTXH 3BKYL 4XPBL 2WNWA 4UQ2B 4KROD 1YECL 3E8VA 1N9PA 2EDOA 1SMDA 2GTWB 5E6ZA 1L6ZA 1XH3A 2PHBB 3T65B 4LCCC 3FO2B 4MJID 3VQ1C 2PO6B 2W5PA 3S2CA 2IOIA 2MJWA 1BXXA 4PJDB 1AP2A 3PGCA 4V1DE 3O41A 3FQRA 2PPDA 3ARWA 3OGCB 4OGAC 4TSCH 3E3QE 1AO7A 1R33A 5ICUA 3VXMA 3GSOB 2AQRA 4ISHL 1OGAA 1MEXL 4WV1A 1DVFA 2ICWA 3O3AA 2QFRA 3E3QC 3EO0A 4KY2A 1PZUB 1S9VB 1VCBC 1A65A 1OPGH 2B1HL 3BAEL 3PS6A 5DUPL 3QQ3B 4S1DD 2DLHA 3CPLA 5C07E 2Y69B 2JXMA 3QQ4B 2WBXA 4DP8X 2K6WA 4PRBA 2P5EB 5MP6H 3BH4A 5TQ0H 3Q2NA 1KTBA 3VO0A 5GS3A 1MCPL 4XCCL 1X5YA 2VABA 2P3FL 4ODVH 2VXQL 5HHME 2A77H 4ZX6A 5HHPB 5AVWB 3SGEI 1NBCA 5FK9A 4KHTL 4P5MB 2XWEA 4KH2A 5I76A 5L8LB 3HG1A 2VLRB 3FFDB 2ERJC 2Y6TE 1CLVA 2H1XA 4JRYB 3AXLB 2YIHA 3GLAA 3WI9A 3NGBC 5JHDB 5BQ7A 1WS8A 2HJFA 1ATBA 3QS2A 5IM7B 3KPRD 5SWZD 3RWCA 2EEAA 5GQBA 5JR1H 5CCKH 3ARGC 1LYQA 1YUFA 1JF1B 3QO0B 3V52L 3HNSL 4IMLB 3M7FB 4UOJA 2B20A 4ZO7A 3NIGF 4XGZB 3SO5A 4HAGA 3MUGB 4J3TA 5KSUB 4AZ8B 1KBWA 2NXZB 3QI9C 3NH7H 1FZKB 4PWFA 1XFEA 1IT9L 5E1HB 4P5KA 4YZWA 1K4CB 4BXSA 2R8SH 1CE1L 3TA3C 1U9KA 3M45A 2Y1YA 3MA9H 4V33A 3EH4B 3HI5H 4BBWA 2LLLA 1DQQA 2C5DC 2F18A 3HE6A 2SODB 3NQKA 5AKTA 4J6RH 4A2MA 5ACZA 5I8OH 5GRVK 5HHVL 5GGUB 5KSBE 5IJKA 2G60L 3PWPA 5D5ME 3OKKB 1TTFA 1WBYA 1KBGL 1YNTB 3TCXA 3LS4H 2P80D 4UIMB 2J2ZA 5LQBL 1Z9OA 5FKAB 1BWMA 4EZKA 1E3FA 2ZWNA 3WFCL 4QKTA 1A7PL 1CT8A 5DUML 4I5BB 1FDLL 4QRQB 3V4LA 1DQBA 5DMGD 5ETUB 4ODSL 1XGYH 2R2CA 3BESR 1VENA 3OWEA 2VKWA 5IROC 4C56D 1KEGL 1I8IA 5HYJD 1TEFA 1QTSA 1KG0A 1MW2A 4MA1B 4BA8A 1IGML 2UYLB 4OLUL 3BEVA 2L7JA 5CEZD 2IH1B 4UTCA 5EOCJ 1XEDA 2OTUB 4OTXL 3EGXB 4ACTA 2VAAB 2V2TA 5KS9E 2DEYX 1YMMA 4NGAL 1QNZL 3BMWA 1HILB 2W2ME 2DIEA 1JPSH 3WKML 1C5DB 1R3LA 4DEPC 1PBYA 1IGIH 1G7MA 2D3NA 1PKQB 1A7NH 3O6ML 3ENSA 1F58L 1UB6A 4PRHA 4XMLH 1MFUA 3II1A 2N0MA 4MQ7B 3IMWA 4NZTL 1KBBA 4QAWA 3TZVA 4CC0A 5D72L 2ZWLT 4ISIL 3D33A 4QF1B 3W81A 2VNCA 4U1LB 1MQKL 3K6SB 5EF3A 3P2BA 3GHBL 2VW4A 2ESVB 3W0WD 4FXKC 1GSKA 4HUVB 5BVJB 4MMZA 4M7JL 1KCVL 1I9RH 2E6PA 5E8DL 4EBQH 1MNUH 3B2VH 1MXGA 3TFBA 4QRUA 3F00A 3LNDA 3EYUH 2BP8B 4MLSA 1B0GB 2L7QA 3FT3A 1VFBB 4XPTH 1LL1A 3TBWB 4HPYH 5FB8B 3TEWA 3BH9B 2W60A 4H26A 2DQFB 4ZFOL 2WO3B 4NKIH 5D7HA 1UATA 2HTKC 4HKBA 1G7IA 4NSKA 1KYDA 4KJWC 1RZ8A 4GPVA 4UQAA 3Q9PA 3UO1L 1IBFA 3DKHA 3U1SL 3FB7A 4QTHB 2EVIA 1KLJL 1G6RL 2NY3C 2YPVL 2PXYA 3EGSA 1A7OH 3PXHA 4FFZA 4PJ8A 3VU1A 4HBCH 3HZMA 4L4TA 3RAJH 2NX5D 2JQMA 3B7SA 1DO6A 5CZXC 4H5SB 2FX9L 2KLTA 4I85A 2H1LM 4WGWB 4LPXA 1DEEB 5GGRY 4L1LA 4HALA 1ZV9A 1E4WH 3L5WB 4K71C 5FM8A 4OTJA 3VSTA 4PREB 3V8CA 3QRGH 2OX5B 1F3DJ 4KI1A 3ZOAA 4ZT1A 6TAAA 1U8JB 3L1OH 1BEYL 4RIRA 3EJTA 4M7KL 1ZVHA 4FLOA 4EI5C 2D31B 5E2VH 1E65A 1TDQA 4X80L 1RPQA 2QZ5A 4MBOA 3GZOA 4NXSA 1KCUL 1UENA 4H0IA 3MLYL 3ORJA 3VXTB 4ZPTA 3KPOA 4NBZB 4B9KC 1T6WA 1TSHA 5KG9B 2XKUA 4WO4A 5CP7B 3O6FA 4L9DA 3P3UA 2V3FA 1RK0B 2X9XA 2ZOUA 3BZDA 4DP4X 4WK4B 1XDTT 4XNUH 4FDWA 1WT5C 2VDPL 1GGUA 4LCUA 1CICC 1MZYA 3DETC 1N7MH 5IKRA 5HHOA 2XN0A 4HIIA 2MOGA 3UPCA 4X6BB 2SEBA 5FYKE 5F7NC 4FNUA 2DJUA 1W0WA 2FQEA 3B7TA 1AH1A 3J7HA 4M1GL 2CR0A 5DU7A 1ECZA 1I1CA 3RY6C 1BLNB 5KBKA 5F7DB 4LCYA 5DTFA 2WLJA 2EE9A 3H4HA 4FG0A 3LN5B 4F20A 4RMRA 3E6FB 3WD5H 1NFDF 5E4EB 1NZIA 2DD8H 1DVQA 1BM7A 1TQSA 1HWWA 1UXSA 1T83A 1QBAA 3CV5A 3E80A 5IV2A 4FTVE 1D5ZB 5KW9H 3EDKA 3GKWL 4K8RD 2HX7A 2X9WA 1ADQL 4BYHA 4LPUA 1RZKL 3DOHA 1QYGL 3FFCE 2MNUA 3G5VA 4JQVA 3LIZH 3T8XB 3HLKA 3DX8A 4QDGA 1EHKB 1AZZC 1DVXA 3GMRB 4RDQG 5L9DL 4MDRA 4FQLL 1PU0A 4W6XB 4M3KB 5TF1L 3S98A 4AQ1A 3X3GL 5EUOE 4PR5A 2A73B 2BFVL 3QPKA 1RZGB 3LNGA 5E9AA 5LNDA 1EUTA 2B16A 2WXRA 2ZOKB 4YHNB 5GPRA 1N5YH 4JRXA 2CUMA 3UROR 3GBLA 4CW1A 1J9CL 2PWDA 3T3PF 2NZ9C 3NZHH 4GG6F 4MJ4A 3QHFH 4KQ3L 3PAZA 3LVTA 3HE7D 1KBVA 2ZCLH 4JGNA 3HMWH 1KCWA 4JREC 2FLBL 1JDCA 2YKLL 1N59A 1OSEA 4PWJA 1BCIA 3ARBD 5JBAE 2AJZB 2E8ZA 3GBNH 2IANA 4YIQB 4B9PA 1BFTA 1DJHA 1XCQA 2BO0A 2F15A 1IC4H 3O4OB 1KYOJ 1MOXC 5GIRB 2VSCA 2JSFA 1S9YA 3RWIA 1N64L 5ALCH 1Q72H 3MBEA 4U1NA 3EYFB 5KSAC 1PGEA 5E6IB 2NY6C 1TLEA 2VN3A 4H0HB 4L3CB 5TE4H 3LIWB 3PDGA 5FYKH 4UZUA 5CD3A 4ENEC 4R90H 1AAJA 1BMGA 3OR7B 5KN5B 1HHJA 4H8UA 5E8OB 1JZ3A 2W91A 1AC6A 4POUB 4RAHA 2LU4A 3FTVA 5F44A 4X6CF 3D18B 1T04B 3MXVH 4OD3H 5EIVA 4P2QD 5I1KL 5BUPA 3PP4H 3EIFA 1ZSHA 43CAB 4YVNA 3TM6A 2Q7YA 5EDSA 3C8KB 3EFFB 1HAUA 4H1LH 4O4YH 5B39G 5C09D 3E0GA 3VI3E 3N40P 4A7UA 3PIQB 3C75A 1FVCB 1Q38A 2DTSA 3HS6A 3S8WA 3UJTH 2ZAHA 3LRSA 1S5IL 2ZOLB 4GEJA 3DJZA 3P2DA 4OLXH 5EBGA 3EOTH 4ONGL 2B2XL 3WNPA 3IGUA 1P2CB 1NFDA 5EZOH 2ZUQB 2BMKA 5A1AA 3VQLA 3TVMB 2AK1H 1XB3A 3NIDF 3JBG7 3VAEA 5FHAH 1JZ2A 2WWKT 5EULV 1SQMA 1D5BA 4HEPG 3D0VB 3DV4A 1UZQA 4J3UA 4V2BA 4LQ1A 5F9AC 4KTGA 2XZCL 1FZJB 4I13B 4JRLA 1K5WA 1P6AB 4JFHD 2D3JA 3D3VE 4XODA 4ODWA 1S9WA 4N2DA 3LMJH 2GUOB 1XFPA 1CFVL 2GI7A 3KPNA 3MMEB 1J7VR 3GCXE 4K3JL 4CSSA 2OL3B 4U1JA 3F3HA 3DVFA 2OR9H 4NCC1 4FMVA 1GIGL 4MMXA 4JO1H 3SJVD 5DD5H 3D85B 1UHVA 4HOXA 4MX7A 3TH3L 1E3XA 1SM3L 3HUJE 1BECA 1WDAA 3Q9QA 4KO7A 4OB5H 1A5FH 3KE0A 2WB1A 4M48H 4FADA 4FLQA 5I66A 4X98A 3CZUB 4L3EA 4F27A 3VFTB 4M7ZB 4X9GA 5HYJA 4XVSH 3FU5A 1IGXA 4NWUH 2V2XB 1HCVA 1DQJB 3RY5A 2PO6D 1T21B 1E2WA 2NY1D 3MOBH 3QZWA 3HMXA 4PN6A 5EZIL 3TA4D 1F86A 4PCKA 4NJAL 3MRFA 3ZE0E 4UM8A 1FNGB 4QRPE 1PS3A 3ROOA 5E7BA 1JZ7A 4GBXD 2FH6A 1RI8A 3AU1A 5HYEA 1HJCA 5EU5B 1QWHA 4PJFE 3HS0A 5IOPB 1TJMA 4XO3A 4CJ0A 4N0UE 5D2NB 4XBPA 1GOHA 3NIFE 5GISL 4F91B 1ZTMA 2X2HA 3F8UB 4XC3H 3IU4L 1SEBA 2QFPA 4FLSA 4MJ5B 4RWYH 4WCYH 1CBVH 4RRZA 1XF5A 4LNVA 5HD8C 4Q97A 2FWOB 1T5XA 2OCJA 2YPKA 1JYWA 3F7YB 3QUZA 1U93A 4PRPA 4ZFOB 4F58H 4X6CA 1WZKA 1EQHA 4Y2DB 1KV7A 3I9IA 5DVNA 1Q9OB 3GS7A 2Q5BA 3OHMB 4MMYA 3BWUC 4WI0A 5DZVA 5I6PA 2V7HA 2NXYB 3ZDWA 5KZCD 3SIKA 2H0JA 3UEQA 4Q9RH 3Q3GA 1U92A 3IRPX 3UO8B 2VIRA 5FHBH 3KMDA 4MAUH 4KKBC 4JVWA 2N59A 5FYJL 3UTSE 4LPWA 4XXDB 5ESVA 3U9PH 2R4RH 3F65A 4A6YB 3R8BB 4IJTA 5JA9A 4YSDA 3MOQA 4WFED 1EFQA 3BFWA 1OLLA 3GXTA 3RWJA 3SDAA 3WN6A 3HB3C 2GW5A 4JDTL 3JUZA 3QDGA 2P7TB 4ZXBC 2MWCA 5D6CB 1OP9A 3D2UB 3RJQB 1MIEL 4YC2C 2FL5A 4NFDA 1X5IA 2HT4D 2Y1VA 2V17L 5E99H 5F6IC 4PWEA 4HWEL 2NXZD 1H5BA 1I7RB 3GIVA 3IS0X 5I6LA 5L2KA 4GEIA 3CHXA 4OTYA 4OR1A 4MGXA 4PM1A 1NBVL 3WFBH 3V64C 3QIWB 4AENB 4Z77B 1C16A 1FV1A 4L37A 4O9HH 4ZNCD 3NEXA 1KB5A 5I6MA 1SEQH 2NW2B 4Q6YA 2Z31A 5CWSA 3UPAA 4E5XA 4PJXB 1RHFA 4JPKH 4AT6A 2C26A 3S6CA 3V55A 1JNNL 2YC1A 3P1VA 4HKZA 4XMUA 1QFUH 4R7DB 2V4LA 1QAWA 1FVDA 5H35B 3WV0A 1CDBA 1KLGA 3O6KL 3O0RL 4HGWB 4DVBB 2UY6A 3U48A 1JGLH 2BSBA 2VLJB 1JRHL 3DSNB 1SVBA 1DSWA 2WP3T 5D1XA 3VFGH 5CCGE 3P9MA 4W9JC 1QLRB 4X6DB 5G55A 3V5HB 2F9BL 2VLKA 4LFHG 1XV8A 3MUHL 3MV9E 5INCA 2VWLL 4KNTA 1WFNA 2QLVB 2WG4B 1AQMA 2C3VA 4P3DA 4NIKB 1BJMA 5IMOB 1SYSB 3ECQA 5TQ2L 1N5AB 2CO2A 3VD0A 4PY8J 5IJVB 1ZOXA 4DUXA 1WF5A 1E42A 3U6RA 4U4BA 3ME0B 1KLFA 1UT2A 1CE6A 3TN0A 4Z0LA 3ULVF 2WYIA 1RV6X 1G7QB 1FSKC 4BTUA 3ZMNA 4U6XB 1AI1L 4LSUH 1T4KA 1P0SL 1IJQA 1KIGL 4PWKA 4DVRH 2HLFD 1OTTD 2GD4A 1MOEA 4QYOA 4QRFA 4ZX3A 2EXYC 2AJYH 2F8IA 4K9JA 4LORA 2C7UB 2Y22A 3CVCA 5T5FA 2C1PA 5SV4A 4JZJA 1J0YA 2YD9A 5IFJA 4X4XB 1AS7A 1WAAE 3PJSB 4TL5A 3LRMA 1CDUA 2A9CA 3VFNB 4NN6C 4BE6A 1RZIB 2AJVH 3MLSL 3GCWE 4IRZH 4PGBA 4ZUWA 1LP9B 2PN5A 3BUYB 2CPCA 3IBOA 3TBBA 3FOMB 3EDDA 5GSVA 2ESVD 3RGVB 2BH0A 1DBAL 4UQCA 1QPKA 3DO3A 1NMCB 1PG7W 4OJFL 4OI7A 2XZQL 3F84A 5HHNA 1UVQA 4OGXH 3QFJB 5F1KC 4HFWA 2BNRA 2DWDA 1Z5HA 1NWPA 3BAKA 3L3DB 3L7EB 4CUEA 4PGDB 4BZ1L 1P1ZA 4GW4A 1IJ9A 3FDWA 1I9JH 1PLCA 2XKNB 3O8XD 3T4YB 4YK4B 3FH7A 1UFUA 2GITB 2GJRA 2FVNA 3KPSE 3TV3L 4AGOA 1VADB 2GSIA 5DFAA 4FKEA 2EDHA 2J5LB 5JHLA 2HKFH 1TTCA 3NFSL 2PYED 4OFIA 3UTTE 1GRWA 1LE5A 3VTTA 1TEYA 4HXBH 1LO2L 1FCGA 2IF7A 3GHPA 1ZGLP 1GGTA 3GFUA 1D6EB 1WRFA 4JG5A 3SBWC 1ASPA 4MNQD 5EO9B 5T3XD 3U9WA 2V9TA 1OY3B 2DQEL 2OSLA 3LN0A 3EJCA 5TD4A 1QEWB 3L3JA 2OMXB 3NRQA 1IL1B 1BXUA 2ZXAA 4RBPH 4ANKA 3PQYD 3I3DA 2X4PB 4FERA 5TGBB 4KVCH 3P69A 3RU8L 4PJAF 1ROCA 5TPWL 4ZUUB 2E56A 3QIBA 2HRLA 2BS9A 2W65B 4JQXA 1A3LL 2DM2A 2WXMA 3BVUA 5HDLA 4PCSA 2N56A 5DRXB 1NH6A 4HJTA 1VPOH 4RFNC 1GZPB 3UZQA 3EFOB 1G43A 4K7FA 1CI5A 1PZDA 2YBGA 3PNRB 4U0RC 5T5NG 3QDME 1RCYA 1E5BA 1FYTB 4NPKA 2UZPA 4P2YA 1CK0L 3L3GA 5KYXB 4QRTA 3UFIA 2RQ8A 3ZDXE 1HT8A 2DMCA 3PDOA 4KMTH 4YXHH 5E8NB 4H20H 2N01B 4PJBB 4D0CA 2Z4TA 1U4FA 4JO2L 3RWHA 2P26A 1ACYL 1RUMH 3VXSE 4PJEB 5F89B 1UZ8A 3G9VA 2Y06L 4LSTL 4G6FB 2VL5A 1IAII 5D7IB 1URLA 5E4AA 3ASWA 4FQXB 1T03H 2QTVA 1M7DA 2PTVA 3CE1A 3CSFA 4MXVF 1YEEH 3WMPA 1RP9A 2X41A 4Y19D 3DPDA 3THMH 3CXHK 2H8PA 1EZSA 1GHFH 5A2BA 4YZFE 2APBA 3EYOB 3TBVB 1A14H 4L29B 1ZPUA 5T1KD 2IH9A 1SXSA 1WZAA 2E7LC 4Y2OB 1QQDA 1M7UA 3KYNB 3QDJA 4J3WA 1J10A 5AB9A 5AAPA 3X1GA 1OWWA 2RFXA 5GJTL 3MLZH 2AW2A 4GXVL 3EGFA 3L3HB 1P6WA 4AK1A 5G5DB 4HHGA 5SX4H 1OP3H 3AGVA 5B1CA 3MODH 2YAHA 4NO5A 1BVLA 1CGWA 1YN6B 3D9AH 5FUOH 2WUCL 2XG4A 3OSKA 3MRRB 3VFRA 4IBUA 3P11L 3PUUA 4H0GA 5EU4B 4FXGA 5B8CA 1GH7A 4PGCA 1JGUH 2XIIA 4MJIE 3MBXL 1TJHH 4B9CA 4ELME 5AFAA 5ISZB 2G4EA 5KTEH 1SMOA 1U3HC 3EF7A 3QO1A 4M6NH 4DN3L 5D8JH 4OIIH 4EDWL 2XCMC 2OBGA 3FRUA 5C0CB 5CO1A 3NT1A 2A83B 1WICA 3PHOB 1UKQA 1OAKL 1MHCA 3U4BH 5BS0E 1DN2A 2P8PA 2XJKA 3T09A 1IQGL 2DL9A 1KCSL 2GBTA 3AQZA 5G4NA 1EHAA 1XL4A 3A6CL 1TJXA 4NGHH 3BHBB 3ZL2A 1A6UH 1UGNA 2VH0B 4FNPA 4YWGL 4D94A 2JH2A 2O30A 4PJAA 4JR9H 2K78A 1RIHL 1U3YA 4AH2A 2DS4A 4PRAA 5D2LF 4QY8B 3S5LB 5I8CB 2JCCE 5D1ZC 2DM3A 3CDYA 3MOAL 2ADFL 4JDZB 4EUPB 4FQCH 4IDJL 2PP7A 1UJ3B 4TVSa 2QDVA 1NAKL 5FCUH 5FM4A 4S1DC 4C58B 4HH9B 4BSWB 3ZHFA 4NUGH 1DN0B 5EIIA 1HNFA 1BZEA 1GW6A 1CDGA 3B56A 1PXXA 1T2JA 1L0YA 1XBDA 2J6EH 4YFDB 3CVHA 3DC0A 4E36A 5JIDA 3NJXA 4U3XA 5HGHA 2E7BA 5B38B 4ZMWA 2KZBA 3QNZA 1NGYA 5SWSA 5B7MA 4M62H 1T0OA 3KPRE 4LZKA 2X1XR 3SBRA 1XH3B 3CBKB 1GJWA 2R27A 2EKSA 2YJLA 2G0KA 4K3EH 2FD6L 2E46A 5B1BB 3QA3A 4LEXH 1L4IA 4JFZH 5C0EA 4DGUA 1R9FA 3C9NB 3BH8B 3RVTC 3MUY1 1G1YA 3PGCB 4KK5D 1U8PA 3T8MA 3FQRB 3MRNA 2YOAA 2HFGL 5DHMC 1YNKL 1OKEA 5GS1C 1AO7B 3VXMB 2AQ1A 3K46A 3NVQA 5CINH 3K71A 1O9WA 1QFOA 2BZ7A 3CLWA 4PJHA 4ZO9A 3U0PA 2X2IA 1OGAB 4R5VA 4YO0A 1DJGA 1XF3A 3O3BA 1DVFB 2ICWB 3O3AB 3QJZA 4WV1B 4EN3A 3BRDA 3EO0B 3GSVA 2RCSH 3VRJA 3CHRA 3LS5L 1KEML 4M7LT 1H8SA 3IITB 3KR3L 3X1BA 2X40A 2WQSA 3CPLB 4WFFD 3VA6A 3U9UB 4B50A 3BKCH 1IGTA 2JXMB 5AUMA 3V79C 5FM5O 1YEDA 3WLBA 4PRBB 2DKMA 2X7LA 1M9WA 3WY1A 4WFGD 1KTDA 4ONOA 4BFFA 2A9MH 5F9OH 1INDL 1AZRA 4DQOL 1WZ1L 1ZIAA 2GAZA 3ALWA 4JZEL 2H9EC 2NCMA 1F8TH 2PPCA 1I3RA 3FQ1A 4MTMA 3MXWH 5E4IA 4C56E 4EKXA 5FK9B 2AS5M 5HYJE 2J1KA 3FO0H 3HG1B 4ODTH 1WS7A 2OP4H 5IB2A 1TPXC 4MAYA 5CEZE 2CNYA 4GUQA 3BLBA 5BQ7B 2HJFB 4UIKL 1HS6A 3A6OA 1YA5A 3RWCB 4AZUA 1WSST 1AHMA 4DJMA 4Z7WF 1M3IA 3DYMA 1LMJA 3DBXA 2VMFA 1E27A 5D2LA 3RX5A 1JBJA 2WTPA 1QRKA 3ILEA 5AB2A 1W9XA 2ITFA 3WTXA 3LTGD 2G75A 1UA3A 2KL6A 1QBLH 4XAWL 3GXMA 4EOWL 4DT2A 2HVKB 3FF8A 1TQBC 3IDXL 4RX4A 4AIEA 1RUQH 1DQQB 1SN2A 3HE6B 4JPQA 4HD9A 3W0WE 3UEZA 4B27A 5J7CC 3P0YL 2B7DL 1DQIA 3KYOA 3PWPB 4IRJD 4NZFA 2EECA 2W3KB 1A7BA 4Y5YC 1L0PA 4LSQH 1TYEB 4XBGA 2H0PA 4B9IA 1L7TH 2CJUL 2J2ZB 1TJIL 4Y5VC 1N70A 4K5OA 3AXHA 4M5ZH 1Y0LA 1OAYL 3C8DA 5AYTA 4ERSH 3RURA 3GK8H 5CJXC 1CT8B 4YBQD 5LBGA 1S5HA 3N41F 4RGNB 2WQWA 4O58L 2LTQC 1K6QH 3AQXA 2TSBA 4CL7A 1BM3L 3DV6A 4F7PA 4WI9A 1I8IB 3K6OA 3MREA 1V55B 4XTRD 1KG0B 1XH2A 2AI0L 3BEVB 2VLLA 1BF2A 5IHUH 3OG4B 2Y36L 3RTLA 3HVNA 4X4MA 3MJ6A 5DHEA 5E2WL 1YMMB 1EJOL 1KYFA 4FZ8H 5E2TH 3CCHA 1R3LB 2OZ4L 2VWEE 4QCIA 1G7MB 1GZQA 1R34A 2VDNL 2CO3A 3E9UA 1UB6B 4PRHB 5EEUA 5CEZH 5AYUL 2VWEC 3TZVB 1DHKA 1OVZA 3TC9A 2VCOA 2ITDA 2Z1KA 2J5WA 4Y4HA 4I0PD 2EE2A 3QORA 2KDYA 5L4FA 4A04A 2DBLL 2ZOTA 5MENA 1B88A 3BVXA 2CZNA 5CSBA 1HQ4A 1J1PL 1BSIA 2HWZH 2C1OA 4MMZB 2W94A 4NZ8A 1H3GA 3RNKA 4NP4L 4UNVA 2OR7A 4J2XA 3GEFA 2O26U 1IIKA 2FEJA 4QRUB 2J72A 3P4LA 3NFNA 4TXVB 1BP3B 1HZHL 4ODUB 4OM0H 5DZNA 3HAEG 5F9WB 4Z7WA 2VKXA 2W60B 4H26B 1RPUA 5JIIA 2WPHE 2BOUA 3NIGB 4NSKB 1RZ8B 2J43A 4Z6AT 1CXHA 1IVOC 2Z92A 1CLYL 3EBAA 1I82A 3FB7B 1XMWA 3VG0H 2CLVA 4JG9A 3T0EE 3V0EA 2PXYB 2PNDA 3EGSB 4PJ8B 3ZN6A 4FLRA 3HZMB 3V9CA 1SLXA 4TNGA 2NSQA 3T0EC 5F7WC 2A1WH 4M6ML 5HI4C 1IM9A 3MLXH 3TPUA 3DXAD 1BVOA 5DJYA 4IMKC 4QAMB 1GVIA 1OF0A 2WXIA 2YAMA 4A7SA 4QI3A 5FGBC 1KBPA 3JV6A 4RIRB 1VZIA 1Z9PA 4Z3GA 4HWBL 3RGVD 5LBSL 4Y79B 4OFYD 5EWIL 3Q8BA 4N4YB 5ESQA 4JHAL 1QSFA 1IQIL 1NC2A 3KPOB 3RRQA 4YHLL 3WS6C 4WO4B 3EHBC 2VR8A 4DH2A 5J3HD 1Z9MA 3O6FB 3FL7A 3Q5TA 4WW2F 4XVJL 1C5CH 2VM4A 3PL6A 5D7JD 2CRMA 1CUOA 5ERWA 1YEFL 2UX7A 5DRNA 4Z7AA 1NAML 1CS6A 1MIML 2E5EA 3VGBA 4LCUB 1DLHB 1VHPA 5FW6A 3WFDH 1LTXA 4MJHA 1FGVL 5LCVH 4OCMC 1KGXA 3OBAA 3VSUA 5HHOB 1PD6A 4F5CE 2SEBB 4R4FH 1WCQA 1AHWA 2WANA 4LHUA 1FL5B 4E9LA 5EEWA 3TBSB 1JGVL 1W0WB 2XWBA 1Q90A 5GRVL 2C3HA 3ARBC 2XC8A 3IDIA 1D9KA 4LCYB 3QPXH 1YJDC 4NI3A 2ROXA 3D39D 1GYCA 3JQOB 3CN2A 1TQVA 4NRYA 3GMLA 1UXSB 5A3ID 5IV2B 1D6VL 2Y81B 4H2CA 4DP7X 1FNLA 3NCEB 3QW9A 5K93A 5BMFL 1HHHA 1OARH 2QV2A 3NUKA 3WE6A 4P2AA 1T0MA 3G5VB 3IMUA 2OJ1A 1EQGA 1OD9A 4M7LH 5CR8A 5HJ3A 5EEVA 3DX8B 1UADC 4PQXA 2FJHA 3TYFA 5I71B 4KJPC 2F58H 1Q1JL 5E9DA 4YX2L 5IREA 2J20A 1YY9D 1FFQA 4H0LC 4AQ1B 2FATH 4PR5B 3MNZB 5C09E 5K59E 4XO9A 1ZJBA 4QGYA 3K2KA 5I1GH 1WTLA 1AG0A 4G5AA 1JZ6A 4LKXA 2EUZA 4G6ML 1RJYB 4AEEA 2CKBL 4JRXB 4OQTH 2WW8A 4CW1B 1FORL 4U3HA 2AMUA 3BQUA 4G6FD 2Y5TA 3UIZA 3C5JA 4LSPH 1YVLA 4U7MA 3A67L 2ORBH 2DYSB 3DO4A 2WLZA 5KBDA 1N59B 2BERA 4BH8A 1X5XA 1KCLA 2IANB 2CCVA 5H8DA 1XCQB 5JW3L 2XXGA 3DBSA 4RWHA 5AZ2L 1KXVC 3OHXC 1F11B 4F3FA 1S9YB 2GSGA 3QUXC 5EH1A 5FYLD 1B0WA 4JKLA 1SVZA 3G5XA 4DZ8B 1I1AD 1HH9A 3MBEB 3N44F 4O02L 3SZ6A 5C0AB 5ICXA 1EMNA 1RH8A 4UTAH 4N2MA 1A4CA 3P0GB 2I32A 3FPXA 5CD3B 4LCWD 3INOA 4DN4H 2CO7A 1U30A 3H53A 1YJDH 1HHJB 2XXFA 5DEZA 4AQAA 4CKVX 4U6VH 5KVMC 5I18H 4WW2A 1Z6JT 5IESH 3GMMA 5K39A 3VACA 4ICXA 1ZHLA 2EZ0D 3L95A 5I74B 2HLAA 2CK0H 3L9BA 5ANMA 4TMPA 1MCKA 2AQPA 4G70B 5C0CD 2XBTA 3MCYA 2NY1C 3LRSB 4XO8A 4LP8A 2X6MA 4KY1H 3AWFA 1RUKL 5BQDA 2GYSA 4RUTA 1CU4H 1NFDB 4QLRA 4GBXC 4N6QA 2BMKB 2MPAH 5JIHA 5L7XH 5LLIC 4WJ5A 4ANXA 5KEZA 1R6VA 2VYRE 4QD2E 4RRPA 2E0PA 1D5BB 4W9FC 2YEVB 1MHPL 5FUZL 3DV4B 4K9EL 3SHSA 1KT2A 2Y9RT 1ESOA 5IW6A 2R69H 3EZJB 3Q1SL 3DHPA 2ZTBA 3ZYJA 1IQNL 1TPGA 2O1AA 1LDSA 3MLWH 4ODWB 4P2OD 3ZT6A 1CF8L 1SBSL 1TJGH 1CD8A 5FGRA 5AG8A 2FWLB 3KPNB 3ULVL 3ZHDA 2WC7A 1JP5A 4S1RL 3IJEB 3L5XL 2W81C 5HYSA 2I9TA 3N8XA 2QADB 3H3PL 1QI5A 4MMXB 1KIRA 2DB8A 2CR3A 3F7PC 4MX7B 2W2NE 4LEOA 3L4CA 1T7VA 1KELH 1Z1WA 3LEYL 4HXAH 4GUCA 3T3PB 4WFEE 5I66B 4X98B 4X8JA 1B3JA 4J3BA 4ZAKA 4BWUA 3OKNA 4L3EB 1OAQH 3CDZA 4G9FA 3IDNA 2VDNB 1AGDA 1B0RA 1EEQA 4PV9B 3VFPA 4LARH 5CJOL 2PUQT 5KSBF 1AS6A 3QEQD 5D5MF 4KNQA 1NFUB 3BN3B 3MRFB 4CU8A 1OP4A 1YUHA 2X0VA 4UM8B 3ROOB 2RJMA 3EDEA 4BFNA 2VDML 2EDEA 1HZ8A 1S7RA 3QWOA 4GJTB 2HT2C 3GSNH 4XBPB 3VXMD 3JWOC 3N50A 3BUQA 5MEPA 3ETBJ 1DVFD 3IXTA 3VXPA 4LPVA 4D7BA 4R7LA 3ZDZF 3CQFA 3TXAA 2LU5A 1XF5B 1R5IA 1T5XB 4YAQA 2QQKL 1ILUA 2ARJA 1U93B 3K5SA 3QUZB 4FQ2L 4PRPB 4CVWA 2PCFA 1RZFL 1G94A 4IK7A 4X6CB 3UBHA 4KGJA 4V1DA 3CVIL 4JPIA 4K23H 1OAZH 2X4RB 2YD3A 4LLYA 1XXFC 3K8KA 2IH3B 4XNYH 1EA9C 5TTRA 4PB9L 4WI0B 4MMYB 4WAFA 2EIDA 3EH1A 2V7HB 5KS9F 3CGTA 1KFGA 3Q3GB 1U92B 3F7VA 4K55A 3ABLB 1RP8A 1VGKB 4KVNL 5ESVB 3HI6H 5MEOA 4P5SA 1I7TA 3RNQA 5C07A 3VSVA 2VW7A 4IIQC 1CDIA 3ARDD 3RWJB 2I5YL 4FHBD 4KV5E 3G04A 5DVKA 3SDAB 1FIGL 4FFYH 2OMUA 3QDGB 2WO2B 3IFOA 3CTTA 2WOYA 3KBEA 1NEZG 4S0TD 5IFAL 4OAWA 2FL5B 2JKTM 3IS1X 2H0FA 1PIGA 4LVOB 1BYNA 3W5MA 3GM0A 4HIEA 4PRDA 3DNKA 1DJZA 2R23B 3VCLA 2HLFC 3ARGA 2GG1A 1C16B 1FV1B 4GI9A 4L37B 5IEKA 1NMAH 1KB5B 4OZFG 3UJJL 3LOWA 3T08A 3MRLA 2Z31B 4LASH 1KGJA 5CWSB 5F70A 4E5XB 1E28A 1OK8A 1NAMB 2W0FA 2UWPB 1AD0A 2YC1B 1UCBL 1JNLH 3EJZC 4G6KH 4AY0A 3PWPD 4HKZB 3TA3A 2D7NA 2Z6FA 1FVDB 3JWOH 1KLGB 4MA8H 3W56A 3HC3H 2WZPD 4YXLL 4Y5XC 4OZIE 2UY6B 4BFBD 2GI0A 4OV5A 2YR3A 4RSVA 2W92A 4KJYA 5D1XB 3OJDA 2BSEA 3P9MB 4JGMA 3F58H 2VLKB 2PYEE 1S8DA 2WLHA 5INCB 3O8XC 3S34L 5KSBA 2WLMA 4U1KA 3ZTNH 5DMIH 1WFUA 2C3VB 4P3DB 5D5MA 3NJIA 4M8QA 1B90A 3EDJA 4BWTA 5AZEL 4A2GA 7FABL 1JNJA 4RBPK 4MNQE 4OUOA 4Z5RA 2ISDA 3HN5A 1MNNA 3U6RB 1N0LA 3HTLX 4M9PA 4TTDD 4F7CA 2F0CA 1E6JH 2J8HA 2X4UA 4G6JH 4IKNA 5GRUL 1KLFB 4A38A 1TXKA 1YMMD 3PQYE 5FPIA 1CE6B 5IROA 3TN0B 3WIIL 3IU3B 5C3IA 5E2JA 1R3JA 2VZTA 2JJTC 4XP1H 5C70A 4QYOB 4UMSA 1LK3L 4D0BA 3V0GA 1CGSH 2Z8VC 4KMQA 4PRHD 2LR4A 4U7SA 3V0WH 4F57L 4Y76B 2C1PB 2CKBB 3TZVD 3ZMRA 4JZJB 3WKPA 5IFJB 1NGQH 4LAJH 1U4EA 2FT8A 4Z0BH 1KUMA 2VDOB 4ZUWB 5KS9A 4LGSB 4BZ2A 5SX5K 3OPZL 5GSVB 1AIFA 2LU3A 3ALXA 1R24A 3WO4B 5J11C 4MD4A 1FI8C 4JM2C 4HJGA 5HHNB 4Y9FA 3HZYA 1UVQB 1HHKB 4HFWB 4LSRL 2BNRB 2DWDB 5J89A 2R1WA 3FQ2A 15C8L 1P1ZB 1FAKT 3GLEA 3FQUA 4GW4B 1RD6A 3B9KB 2LFGA 2YUZA 4FXKA 5E24E 1VGEL 3S4SG 3ZKSD 2GSIB 1IBBA 1NZRA 2BIIA 1T7XA 1M4KA 3ERXA 4GMTH 5EV7A 3ECVA 4DGVH 4Y19E 3DOIA 1LE5B 3VW3H 3ET9F 4FFVD 1EZQB 1FL6A 3DDGA 1EK3A 2PXYD 2BIOA 1BIHA 1LM8V 2CO6A 4L4TD 2OSLB 2KDGA 4UINL 4R4ND 3JT0A 1X3DA 5DJ6A 5AVQB 1UC6A 5EUOF 1FAIH 3L3JB 3NJMA 2RB8A 4XXWC 2UXTA 2EADA 4YE4H 1DSFL 1FGNH 3BFOA 2H9GA 2HN7A 5KVDL 1OP3K 4XRCA 1S7QA 2ZCHH 4NZUL 2WHVA 1IEBA 2VUYA 2FB4L 3QIBB 2H5UA 4MNGE 4AKPA 1SJMA 4P2RD 5T3XH 4N2OA 2FT7A 2QEJA 3AWGA 3LIZA 3UZQB 4O5LL 3ZKQD 1T5KA 3QJFA 4K7FB 1PG7L 1JN6A 3BLPX 5DR5L 4AV4A 3TJEH 5CS7A 5BOPA 4GU3A 3GZQA 4JY6A 2NNRA 4Y8DC 3L3GB 4QRTB 4MBRA 3INUL 4N24A 4P05A 4PLOB 3PDOB 1E43A 5I30L 2VH5L 4K07A 3K7UA 4A7TA 4D0CB 4AVHA 3O6FD 3V65B 4EI5A 2RGSA 3RWHB 3H55A 5J57B 1OWRM 5HDQH 5FO8A 3ATDA 1A6WH 2XY2A 3CFCH 3IDGA 3MV8E 4ALAC 4CN1A 1UZ8B 3CD4A 3TNMB 1KB9J 3LEXA 3LB6C 5HGBA 1IQEL 5DI8A 2VL5B 5HHOD 1OCCB 3D2TA 2K3TA 3NCWA 1M7DB 3B34A 1ZEAL 1HJ7A 2CO1A 2G4GA 2R0LH 2R4SL 3IJHA 4QOKD 4WO0A 3QVAA 5BZZA 3NJVA 1WT5A 1CFNA 1FLTX 2PTUA 3DROA 5I1IH 5GRYA 2VN7A 1KGUA 1U2YA 1KDJA 3LQZA 2H8PB 1QTPA 4TULL 2G3MA 5ITFA 2WLKA 4YJZL 3UABA 1O6VA 1QSVA 1TO4A 1PVHA 5DWUH 3VI3F 4QNPE 3RY6A 1DO5A 1TEGA 1SFHA 1QQDB 4O51A 4X8GA 3UADA 4IYKA 3QDJB 4X99A 2ZUVA 2K9FB 1Z32X 1RIVH 5IGXH 2YO3A 5AD0A 1FF7A 2EYRA 2RACA 5HVWA 1CURA 4YNYA 1D5XA 1GC1L 2KYIA 4KK8D 5J12B 2X70A 4NO5B 1BVLB 1KJ2L 8FABA 1B9ZA 2XG4B 4FTVA 3KPTA 4ZTOH 3VFRB 4H1LA 1HXYB 2BIHA 4KZEH 1EAIC 5B8CB 5T5NF 4FXGB 4JMXA 4PGCB 3VXRD 3FQYA 3GO1H 4YSSA 3DRQA 3FFCA 1URKA 5K1JA 1XB6A 2VQTA 3B7YA 4TQHA 4Y9BA 3QO1B 1D7CA 5T33L 1JERA 4YSUA 3N9GH 2BY0A 3M8OL 1JXFA 3FRUB 3GSUA 3QAQA 5AVZB 3ZL4H 3VG9B 3ZKXB 1MHCB 5EBMA 4XVUD 4Z78A 1MPAH 25C8L 2P8PB 4GT7A 2R2BA 4N2GA 5CN1A 1WK0A 5EUOA 2UX6A 2I27N 3LX9A 4E9XA 2IAND 4ALAH 1QLEH 4P57B 3HBZA 4S0HA 1MN4A 2AJUH 2XOTA 4JG1H 4Z7QF 4PJAB 3ECUA 2Y24A 1DLFL 1IBYA 1UWEH 5F6HI 4PRAB 4KHXH 4ZD3L 4YHOH 4FI7A 1XDTR 1M1SA 4K94C 1X5ZA 1OAXH 3BAWA 3GDBA 2XV0A 5BNXD 4L23A 4MB5A 5F3FA 1DYZA 1MWOA 5F2FA 5IB1A 1FBIH 4DAGL 4JRWA 3QCVL 2BSSB 2FK9A 3ZRFC 3L4TA 1B3IA 2NCEA 5F7KC 5IVXE 4WFGE 5EIIB 3JWDC 1ES0A 3NTCH 1QSED 2L0DA 3A22A 3ZE0F 2PWEA 5A2JH 1J1OH 1UB5A 4FJZA 5AB0A 5KSAA 3BIKA 3V6BR 4DPCX 3RDTC 5HGHB 4PJFF 3ELAT 1BFOA 3QNZB 1H9VA 1HAFA 1NGYB 2H3KA 2J88L 3AADB 3NIFF 4I3RL 5SWSB 2Y6SD 1ZANL 1WFMA 1FWXA 2HT3D 4RMVA 5DFVD 5ITBL 1JF6A 2EKSB 3QULA 5FC9A 4L1DA 4OJYA 3V0HA 3QA3B 3BWUF 4FHJA 3ZBMA 1KIQA 5C0EB 2PR4H 1NPEB 4CRPA 4M5YL 4PS3A 1USZA 5C0GA 2GB2A 1UYWH 1SBBA 1U8PB 3UMNA 1RMFH 3MRNB 2J1YA 1ND0A 1BQLH 1TETH 1UURA 3QCTL 3VI3A 1CR9H 2XC5L 4U1SA 3BPNB 3IETA 1S7UA 2Q9OA 3N1FC 4GS7B 2K6ZA 4QYAA 3ZUCA 3K71B 3PV7A 2WGNB 4JHUA 4PJHB 4DGIL 1XF3B 3O3BB 4EN3B 1AQDA 4MZRA 2GEQA 3GSVB 3VRJB 2PPAA 5C2BH 3S88H 4PV1C 3CXFA 4IBYA 1ADWA 5DZPA 4P3CL 1IGTB 1F42A 2W9DH 4IRJC 4OLWH 5AUMB 3S96A 2LV4A 3QNYB 3ZVVA 1L9PA 3WLBB 3MACL 4L8CA 3IMVA 3ARPA 4DTGL 4QT5B 1NA8A 1XIWD 2X7LB 4K94H 3GRWL 3LEVH 4WU5A 2VITB 1NDGA 3GM8A 3WE1A 5C0JA 3LXCA 3FT0A 2GAZB 3CFBA 5JO5A 4UYQA 1RZ7L 3D3VA 1CI3M 1I3RB 4L3ED 3WNOA 4AM0A 3JWDH 1HZLA 1J0HA 3LH2L 2DQIL 5I28A 1O6SA 5IB2B 4MAYB 3O11A 2IDTA 3U46A 3QIUD 1SYVA 1L9OA 1CO1A 5C9KA 1MH5A 2FYYA 2F7PA 2O5XH 1ODUA 5IKQA 2VN6A 4PEEA 2UZXA 3HUJA 2NY2D 3DBXB 4ZMXA 4A67A 2C4XA 1E27B 4N8UA 5D2LB 4C54A 3FCSA 1S3KL 3NZ8A 4JNXA 5JW4Q 5PCYA 2DYRB 2NY0C 3BSZL 3VA2C 5CEYA 2G75B 5K9KA 4EEEA 4RZCA 4NAJA 1EZLA 4YR6A 2J12B 2XWZA 3FQTA 4OW6A 4X50A 5F1NA 4NOFA 4N0YL 3I9AA 1W7XL 1AS8A 2BJMH 3LJ3A 3HG2A 2ICES 3HBPA 3QUZD 4JLRA 4PRPD 3CA7A 4QRPA 2OMZA 4I0PC 4AL8C 2WJ7A 3BDYH 3KYOB 3WSQH 2BS71 3BT0A 2ZP0T 4PJFA 4UDTA 4XBGB 5ESAA 1R3IH 2EUVA 1CFTA 3B1TA 5HI3D 4N0UA 4TSCL 3P3TA 3ZRCC 1SOQA 4M4RA 2WNXA 2KC0A 1IVTA 1BXVA 1MJUL 1Y0LB 4FAAB 3ZZLA 4UNTA 1ZV2A 2ZCKH 1H6TA 1A7RH 4AXWA 4AQ8C 1S5HB 1QMUA 3VWJD 1T89C 2HFTA 4MZIA 1N19A 1AGBA 5DJ2B 2L8AA 1LPKA 5C0ND 4DKAA 4FQ1L 3DV6B 4F7PB 1WAAF 4ZQTA 1FHGA 2BRRL 3QDGD 1JYXA 1W0VA 1U8OA 3APMA 3BJLA 2R2EA 3D34A 2DI8A 2VLLB 3GMPA 4G5ZH 3NJHA 1W6WA 2CM5A 3DPBA 1IC7L 5L2KD 4W9GC 3DXAE 3UTSA 1UD3A 1PX4A 4HPOL 3E8UH 3CCHB 4HIXH 2H2SD 3LXBA 2R29H 4QCIB 1TZAA 1GZQB 2DLFL 4FS0A 2V9QA 3B5TA 2X4OA 4MKTA 1TLMA 5JR1L 5GS0D 3O9WA 4KTDH 5CCKL 2J55A 4Y88A 3LTVA 4Y4HB 3QORB 5MENB 3DO7A 1NMCC 3KYKH 5A6MA 1HQ4B 2JNZA 5EEZA 1DBJL 4EXKA 2R8SL 1OT2A 3EFDL 2JKSA 3QEHA 4C16A 4WW1A 3RNKB 4WRLA 3EYQD 2EDMA 3U0TA 1PRHA 3HI5L 5D1XD 1K3IA 2R0ZH 3P4NA 4TLKA 5E6YA 5D7JC 5C8JA 5JQ6H 3NFNB 4J6RL 1P53A 4KOBA 2GIYA 2ZWZA 4QKXB 4QTIH 4XPFL 3G3LA 4MCYA 4Z7WB 5C0BE 4ZMVA 3SE4C 5AW5B 1JJUA 1UQSB 4JGUA 2YPLE 2HRPL 3TBDA 2XFGB 1BG9A 3C09B 1IBZA 1RJZA 3AGWA 1JK9B 3MA7A 3SGJC 1WBZA 2CLVB 1U8MB 2WY3B 3D39E 3IFPA 2KH2B 2MQ3A 3TN0D 1MCEA 2PR9A 2ZX6A 3FQWB 1XTLA 2YGVA 4XP9H 1TZHA 1FNEA 1YPZE 1NICA 2HB0A 4GQZA 5CSGA 3AROA 3CDFA 2OR8A 3MV9A 4DQAA 1TIUA 5CKGA 3S9DB 1IM9B 1OL0A 5A3IC 3TPUB 1XGYL 5CFAA 1QUPA 5DJYB 1MWAA 3Q8EA 1AFVH 3G6AA 2ZE0A 5L0QB 3JV6B 4J3OG 4WKXA 5B4MD 1CZ8H 1Q4NX 1FG2A 2BINA 4BQCA 3F7LA 2QGCA 4COXA 2VO8A 1YC7A 4NC1E 5E56A 1JPTH 4JX0A 1IGIL 2FRGP 4GINA 3N41B 5ESQB 1QSFB 1NC2B 1A7NL 3UAJD 3PWLA 4MB3A 4XBEL 5I26A 2ENPA 1J5CA 1LQBC 4NC1C 3PL6B 4KUZH 2Y2YA 3DHJA 5D7KD 4YZFF 1Y7VA 3US1A 1WAAA 4G1MA 4LSVH 4BFEA 4XC1L 5I0ZA 5DRNB 1OCRB 4ZQKA 3VE0A 3D06A 1T2XA 2Z4QA 3KGUA 3B43A 2Y7MA 2FO1A 4HMCA 4BQBA 4IIZA 2VXVH 4CC4C 3A5VA 4F33A 1YEKH 4LHUB 1AHWB 4NN7C 3OLUA 1FIEA 1I9RL 1YNLH 3Q8AA 1KLIL 2WSPA 4AYFA 1EZVY 4OM1L 4EBQL 3IDIB 1MNUL 2K4AA 1D9KB 3CZFA 4FG2A 4CADA 1OSPL 2XQBH 3EYUL 2PCYA 3HC4H 5IB4A 1QHQA 5GRJH 4HPYL 4OZHE 3KPSA 3QCWA 3GMLB 1KIUA 4NRYB 4OZGE 3S35X 4A66A 4KRPC 2Q76A 3C12A 4HS8H 4LCWE 3H7BA 3S36L 4ELMF 3SBWA 3UTTA 1I1AC 3ABMB 1CVUA 1IFGA 2XQYK 1A4KA 1HHHB 2OV0A 3PRZA 5H4YA 3WE6B 2Q3XA 3L9EA 4EQ2A 1T0MB 4YHIA 4QRRA 2WYTA 5IMLA 1OE2A 3CFMA 4XMWA 2R56L 3RAJL 1IV8A 2ID5A 5HJ3B 4F7KA 5E2UL 2FJHB 3TYFB 5E9DB 3H6JA 3BWAA 1O0VA 1PKOA 3RX7A 2IFFL 1DQLH 4XN4A 1UOLA 1MZZA 4R5XA 2CLZA 1IGCH 4Q0XL 5F7LB 2EZ0C 4LKXB 4M93C 4L05A 3L1OL 3VI4E 2JCCF 4EE2A 1PDKA 1DE4A 3CX5J 4RFOH 2Y72A 3BQUB 5E2VL 2Y5TB 3KJ4C 1BEXA 5B3NA 3C5JB 1P69B 3QDMA 4YHMH 1DZ0A 2WVTA 1W80A 3OZ9H 4UAHA 4XP6L 5I1HH 5ALBH 3D4YA 4XZUA 2XIDA 3BT2H 2XRAH 2IC2A 5KVFL 4BH8B 3L5IA 3VXSA 2ZUTA 1T6BX 3ILQD 1EFXA 3T04D 3L13A 1AR1D 1XGTA 12E8H 4XNUL 4LOVA 4F3FB 1JMXA 3D1MC 2GSGB 5CLTA 2VC2B 1GGCH 3BDBA 2GTZA 3BX7C 1N7ML 3G5XB 1HH9B 4P2OC 4LVNB 4OCYH 3UC2A 5ICXB 4BKTC 2YD4A 3QDJD 3BSHA 3NCCB 4OJDH 1BF5A 2CO7B 3AUVA 3N8ZA 4JS7A 4AQAB 1BXAA 1PLGH 5AB1A 2YQBA 1JK8A 1Q9KA 1OSYA 5FYLH 4WW2B 3GMMB 4IJ3B 5K39B 3OXSA 2Q87A 1DVYA 5KW9L 1P7QD 3RWEA 1ZHLB 2F61A 1CDYA 3KVPA 2PPEA 3L95B 2HLAB 3CX2A 5ANMB 1GMEA 3TJHC 4E9RA 1OF2A 1BZ9A 3QEQE 1A8JH 1PEZA 5DJDA 4X7DC 5I73B 3T6QC 4JDVA 2J94B 4LEEA 7TAAA 5I1EH 1OV8A 4JVPA 4XX1G 4OD1H 2X1WL 3BUPA 2BNQD 3WXWH 4OCXL 1U3HA 4WJ5B 2OW7A 3MLUH 4NS0A 2DWYA 1N5YL 2V5RA 4ELMA 1DJWA 4MJIA 3MDLA 4G7VH 4I87A 4JFOA 1WA1X 5D4QA 1HL4A 4H40A 4R2GB 1AHKA 1KTLB 1MAJA 1KT2B 2ZYHA 2XZZA 2QL1A 3WY2A 5IW6B 1C9SA 3HPJA 3ZYJB 3WNJA 3OX8B 5BS0A 2C9XA 2Z91A 4IOFD 3NMEA 1A9VA 5D93B 4PV8A 1JE6A 3PFUA 5EOTB 3MJ9L 4LVEA 5HYSB 2I9TB 4XNZB 3GI9H 4PWIA 2CPUA 5D1ZA 1KIRB 2APFA 3NACH 5C7XH 1IC4L 3PUCA 1NGWA 2EAEA 4D9LL 2JCCA 3QS3A 1UA7A 4YL9A 4LEOB 5T1DH 2DQCL 2E9GA 1W8EA 4FKKA 4KKNA 1WFOA 4AMWA 7CGTA 1Q72L 4DETA 1RZQA 2HRHA 4L9LC 4X8JB 4ZAKB 3OKNB 4H8HA 5TE4L 4G9FB 3UG4A 1LGVA 1TR7A 2FECL 2QPUA 2X44D 3IDNB 4HJJH 1AGDB 1B0RB 5FYKL 3ARDC 3VFPB 3SKJL 3WTUA 4X7SH 1I0UA 4UV7H 3T6VA 5J13B 2AXJA 4JJ5A 4JY4A 3MXVL 4OD3L 2XVBA 1YUHB 2AERT 3PP4L 4U1GC 5F7EH 3FUMA 4NNPH 4FNQA 3MRDA 2GT9A 4LCCB 2BSTA 1S7RB 3KPRA 1HJBC 1TKWA 3N44B 3DUUA 2H6PA 3FN9A 4WNSA 5MEPB 3UJTL 4FM5A 4EN3D 1ZV5A 3IXTB 4FG4A 3VXPB 5T3ZD 3KPQA 1F1GA 4HWZA 3EJSA 2MGPA 1R5IB 2FIRT 4KK6D 4YAQB 4BFGA 4L0YA 1OPOA 1L7IH 3ASIA 2ARJB 3S0PA 5JOFB 3D69A 1NCCL 5D96C 5EZOL 3B2UC 5FECB 4KH9A 5JBCE 2AK1L 2Y0SA 4UT6H 4V1DB 4JPIB 2A0LD 5IB5B 4LLYB 2VR6A 4IBTA 5IG7A 1C12A 2JKHL 3VD9A 2VDKL 1QFWM 4KFMA 3X14A 5KOVC 3F7VB 1YEJL 3APNA 3O6LH 4XE5B 4KKQA 3LMJL 3QRBA 5MEOB 2WIIA 1I7TB 2XVGA 3RNQB 1FFPA 1MLBA 4QIRA 4ZFQA 4MAYD 2ICWI 2R0KH 4F80A 4JB9H 3R7QA 2D3LA 3Q6GH 1OZUA 5DD0H 5DD5L 2OMUB 3QQ9C 1E30A 2XC0L 1NBYA 1U8IA 3IFOB 1GOFA 5GZND 2EO7A 4YXKH 5D4IA 4OAWB 4TTDC 2NSMA 1A5FL 4M48L 1ZSDA 3B37A 4C83A 1YEHL 5HHMB 2ERJB 5LO7A 1ZVNA 5DURB 2VSKB 4HLZH 2G5BB 3BE1L 3KXFD 4NCC2 4C56A 1RERA 2BMGA 3NGBB 5D6DC 4H7VA 4HIEB 3H4FA 4JPVH 1UD4A 5ADPH 3BDXA 4X8VL 2ALWA 4XVSL 5DQ9B 3VCLB 3WJJC 5LWYL 3CFUA 4NWUL 3IKKA 1FLRL 3H2QA 4BEIA 5D70H 3ARGB 4BK8A 1FFTB 1Z3GH 2OMYA 2A7BA 2J8OA 4PJ9A 5ADOH 4ECNA 3MOBL 4PLKC 4RX4D 5IEKB 3L45A 1DVAL 1QBMH 1PFXL 3MRLB 2PCPA 1CIUA 3RVWD 1E28B 2XBXL 2DM4A 5H37G 2VUKA 1VKXA 1NANH 2W0FB 1AD0B 1I1FA 1CXKA 2O72A 3TA3B 4KTYA 2MRYA 1X5FA 1NDTA 3OB0H 4OZ4A 3STZB 4OT1H 2E9IA 4I89A 4AJ0A 3QHZL 1NIDA 4WIQA 4D9RD 4HA1A 4OV5B 1VB9A 3WY4A 2EEBA 4RWYL 3LNEA 4KJYB 4WCYL 4L3FA 3OJDB 3C6LC 5B21A 4WTZG 1UA6H 3O3UN 1M1XA 3X13A 1JPEA 1F1DA 1JSYA 4G8FA 4U1KB 3T0AA 3W0WA 5KSBB 4Y5VA 3CK0L 5D5MB 4B9JA 4X0KA 1A8ZA 4M8QB 4K73A 2ZXEB 1TUPA 4Z5RB 4KK9C 1YQVL 5CJXA 4FFVC 4HEME 2ED8A 4QWWC 1IMHC 2J3SA 3AG3B 1E7VA 1N0LB 4F7CB 3WTTA 2X4UB 4ZAEB 4Q9RL 5FHBL 2ZWYA 4MAUL 1SJHA 1Y6KR 4QO1A 3WY3A 4JE4B 3U9PL 1IRAY 1PJ9A 1TZGL 5JOPD 2XYCA 3FTYA 4P2RE 4D0BB 4JEGB 1EH9A 2W9LA 3FSOA 1E6OL 1NCWH 3S5LG 4PS8A 2IPUK 2VT0A 1GGBH 3FO9A 4EUPG 4Y4HD 3ZYIB 4DEPB 5E99L 3AC0A 5KS9B 5MEND 5CKQA 5INDA 1BQHB 1MF2L 1FZMA 1AIFB 2FEDD 4GSDL 3TPKA 1R24B 1T7WA 2BVPA 3PGFL 1GSMA 4MD4B 4HJGB 3WFBL 2P5WD 2BDNL 3HZYB 2WQVA 3RIAF 4MD5A 1NDMA 4OBRA 1QFKL 2R1WB 4OIBA 1BPLB 5T1LD 3SOBH 3UYRH 5HYFA 5HYQA 4X5LA 3FQUB 3H5CB 4JPKL 4Q58C 4BCYA 4L3AA 5EOQH 5B38G 4FXKB 2BQWA 2VH6B 2OM5A 4JPWH 2JKJA 4QOKE 2H2PC 4PJGE 3T2NH 5KVEE 2CHWA 4Z3EA 1OOWA 4UV4L 2WYJB 5CJBA 2Y7ZB 4Z95L 1FL6B 1UEMA 2IBBA 3FSZA 2CO6B 2QVMA 3QUMH 1BQRA 1MAMH 1CJYA 3BP7A 4E9WA 5DJ6B 3NA9H 4UQEA 2XBZA 4MFHA 2H9GB 2HN7B 2J4WH 5GHWH 2A38A 2JB5H 4XRCB 1S7QB 3SE9L 2Q20A 2WLLA 2I7SA 3S6XA 2NY3B 4NC2B 1R75A 1IEBB 4JFFE 1D2OA 1R5VA 1E4XH 3CH1A 4N3UA 5MERA 3T0EA 3OLEA 3QJFB 1JN6B 2AFNA 1A3PA 3JTBA 3J8F7 4LO9A 3VMNA 4IMKA 4K71B 1MFAH 4JY6B 2AEPH 3CFTA 4KK8C 1QKZH 4QXUH 5FGBA 3VXRE 1LILA 4TVPD 4JKPL 2ZKHH 2X1QA 5E9NA 4EI5B 2DEXX 4OQTA 1OEZW 2WBWB 4ADGA 5FO8B 3NK4A 4FX5A 3IDGB 5CU9A 1WE5A 3RPBA 5JQIB 5JXEA 2O6FA 2JJUA 5FGCE 3G6DL 4IRZL 5KIRA 2AJVL 2P49B 5HGBB 1TQTA 4RGMC 5DI8B 4ZTPH 2YD1A 3KDMA 3I6LD 3WS6A 2OYEP 1KSRA 3NPSC 4FNRA 4LHUD 4XVUC 4QHNA 3EOYG 3IJHB 3UAFA 1BQSA 1ERNA 4HWNA 5IQLA 1CFNB 3DROB 4AQEA 1U42A 4F1ZA 5JVYA 3SQOH 1CICB 5AW7B 1NBQA 2P52A 3W82A 5HI5C 1I9JL 3NABL 1ZGLM 5JHAA 5IJCC 1QZNA 5ITFB 2F2HA 1I8MA 1N18A 1USQA 2FLRT 4XMPH 2HKFL 4GKSA 3ARBA 4UTAA 1Y1UA 4F5CA 1QSEE 2XFXA 3REVA 1VZGA 5JZ7C 4L18A 1EPFA 2MNJB 4PJDF 4X99B 1XO8A 1A64A 5EC1B 5AD0B 5BV7C 2DKUA 2EYRB 5L88L 1HE7A 4YNYB 5B3JF 2XQYA 3IVKA 3IAQA 4OF7A 4PJ6A 4LCIH 3QRFM 8FABB 4FTVB 2VQUA 3RB5A 3RJOA 3O4LD 4H1LB 1AMXA 3BISA 3K2UL 1LPGA 4LOUD 3DRQB 3FFCB 5C0FA 2XTLA 2HT3C 3UTZA 5HPOA 2CDGA 3RUGE 1CGYA 3GSUB 2AEIT 2WKLA 3GXNA 3BKMH 5EBMB 2FJUB 3ECWA 4Z78B 5EUOB 2R2BB 5C09A 3P4OA 1REIA 4TUOA 1ZLSL 3MBWA 1L6PA 4L1BA 5IT2L 4X7FC 1RUML 4W93A 4JK0D 3T1WA 4GKZA 1WV7T 3ZW3A 2YSTA 2A6JA 4AGMA 2NNAB 3CNKA 2R69A 4LEBA 3AMKA 4JREB 4YH6A 2G2PA 2UZIL 1XGRA 2APTA 2XWXA 1FNFA 3IXAA 5IB1B 4QHKI 2E4TA 2JIXA 3P2TA 3TT3H 5CJ8A 1YEEL 1M57B 4HK3J 3ZDYE 4NERA 1W8NA 3QQDA 3KGSA 1C7SA 4UAOC 1KXVA 3OHXA 1ES0B 3BWZA 1MREH 2R51A 3QUXA 4AYMC 4OKDA 2DWEA 3CG8A 1WFJA 2P42B 1XIWC 1CLCA 3THML 4Z7OE 1UB5B 2Z3FA 4A2FA 5KSAB 1IGJA 3BIKB 2NY6B 5F71A 1C08A 3TGFA 1MRCH 1M6OA 2B4CC 4PGEA 1A14L 3H42H 1XCWA 1BFOB 2WOBA 4ZUTA 3VM7A 1SHXA 2G5RA 5GGSY 3N3EA 2EC9U 2EI6B 5DYOA 4PH8A 3SYCA 5BV7H 4J3VA 3BI9X 2ZXWB 1A47A 3MLZL 3QIUC 3LKPA 3QULB 1VCAA 4KRMB 4FD0A 4Y16C 2NUTA 1VIWA 4N1CA 4AMXA 1QTYT 3P0VL 3CLFH 3CAFA 5FFOA 1KIQB 1ILSA 3D9AL 4TRPH 3B7RL 5FUOL 2GC4C 3K74B 1T22A 2NY2C 3U2SA 1UJTA 5C0GB 2Q6WB 2FDBP 3HS0C 4TUKL 2J34B 3GSNA 1E40A 1ND0B 1MFDL 3DX6A 4WLCA 1TJHL 2DMKA 3VI3B 3P02A 3ENEA 4R2GD 5KTEL 3IETB 1S7UB 5D8JL 3FAXA 4OIIL 2EKJA 1YO4A 4K0OA 3TNNA 2V5SA 5F96L 4PS4H 4Y7OC 3QG7H 1URZA 4K2UH 4MD0A 1TTUA 1AQDB 2YXMA 3VUAA 2F5BH 2EVHA 2Q8AL 4TNVK 4NUQA 1SN5A 3TIEA 4AQZA 3AW5A 3NJGA 4WUUD 5F7YC 1OANA 2C34A 2E7DA 1YN7A 3WKNA 2MCPH 3BCDA 5GSRA 3MRQA 1A6UL 5CEXA 2B8OT 4L8CB 1QW9A 1PF3A 1E9OA 1PYWA 4TLTA 3OC8A 5HI3C 5E8EA 3EH5B 1CCVA 1FPTL 2I60H 4OFKA 4WU5B 1NDGB 4P49A 5C0JB 2WXNA 1EVTC 2E9JA 2V0AA 3CFBB 1EGJL 2MIZA 2X38A 5JO5B 1HZKA 3D3VB 3R0NA 5DRWA 3T1FA 4GG8A 5FCUL 4AM0B 3VWJC 3GNMH 3W11C 2BT8A 1O6SB 1TU2A 4NUGL 2CNZA 4HS6A 3V4VH 3V4PL 5C0NC 3AACA 4FFYA 3O11B 3U46B 1JI1A 2EDYA 3TYGL 2ADXA 1SYVB 3MUZ1 3SPVA 5B7EA 1YCSA 1MH5B 3A47A 2FYYB 2J6EL 2XWRA 2B4CH 4N3TA 4PVNA 4ZSOE 5L2KE 2UZXB 3MRCA 3HUJB 4Z7QB 2NUPA 2IWKA 4H44C 4NZDA 2DQDL 3WGUB 4P8QA 5HXMA 1O7SA 1H5BC 3NN8A 2YA2A 2OLDA 2HKAA 2XN1A 4OZIF 4GLRI 1Z2KA 2BP3A 1QWNA 3NZ8B 3LPOA 1MFBL 3MPCA 1HINH 2H2SC 4TNEA 3HMXH 5CEYB 5K9KB 1OGSA 1WG3A 1AACA 1LEGA 5DYFA 4RZCB 3FQTB 1DCEA 1W15A 5AWNH 4K3EL 4UUJA 3DX2A 3NA4A 1Q9WA 3NCYP 5F1NB 4LEXL 4JFXA 4JFZL 5I2IA 3ZE0B 4JLRB 1K8DB 3VRLE 1P4LA 4N9GB 4QRPB 2OMZB 4NAMA 4OCRL 5KYYA 4V1DD 4PD4K 3B2MA 3P9WB 2DICA 4LF3A 1SLUA 1G4MA 1LO3H 4PJFB 4UDTB 5ESAB 4FQPA 1CFTB 3UBXI 2ZX9A 3L2LA 4N0UB 4MQXC 4M4RB 3NIFB 4J5VA 2F19H 1XF4A 3VB9A 2YD0A 3SDCA 2CGZA 2NY5C 1BOGA 1GGIL 3EYQC 4PYHA 4TOYL 5JORA 5CJQH 5JUEH 5HDBE 4AXWB 2WKGA 2R59A 3QXWA 3N8YA 1BZ8A 3K3QA 3PLYA 5C07D 2YGNA 1AGBB 2KERA 1XBRA 1OHZA 5CKMA 4NQVA 1N1IA 1W0VB 1MY7A 1U8OB 1G9EA 4JGJA 3OC5A 4E9SA 4DESA 2R2EB 5E5LA 2A9ML 5F9OL 5DS8B 1G7PA 3DPBB 3BPSE 5HHMD 4IIQA 4AV0A 2WGXA 2NQDA 3MXWL 4G42B 3UTSB 3JVFC 3HB3B 2WWMD 4IDLA 3U7YL 1X4XA 4ODTL 2Q2EB 1XAKA 3FO0L 4ZXBB 5ILTH 2HMIC 5IWLC 2FBOJ 3OJVC 4RAUA 3POYA 4YC2B 1V3LA 1OAUH 2CLRB 2X4OB 5F6IB 4XLWA 4RESB 1A0QL 3AVEA 2FNBA 3MU3A 2VE6A 4N1EA 4ZDHA 3TA3D 5GS2D 4WHYH 4LL1A 1CDCA 1G0YR 4JQIA 1QEXA 3DO7B 4LLVA 1Q94A 2DV6A 4TLSA 2AC0A 5D7KE 3QEHB 1QBLL 5FOBA 1CL7I 4WW1B 1A6VH 3UAJC 3U0TB 5C8JB 3P4NB 1QFWH 4NZJA 32C2A 2UXVA 2BHUA 4X4ZA 4QXGL 4UQIM 4Y5XA 4MCYB 4EIZC 3QAZC 1LNUA 1IX2A 2WWKO 3I50L 4LSQL 4B5EA 5AOLA 2JI2A 2ZSWA 3C2AH 2NY5H 1NQBA 1RJZB 4PGJA 3FFOA 4OZIA 2IPTH 3MA7B 1WBZB 4F8QA 1MCHA 3TK5B 3O8XA 3IFPB 5BOJA 1ANUA 4S1SH 4ERSL 2WNKA 5IROD 3GK8L 1TZHB 1FNEB 2PYEA 3CN1A 3MRPA 3MV9B 4MNHB 1K6QL 3L9YA 4HJ0D 4IGBA 4YHPA 2CXGA 1KGCD 4FP8H 4JO8A 4NZRH 4MNQA 3G6AB 1WC7A 4BCXA 4JQXC 4ZW8A 5IHUL 2X3BA 2H9EL 1FSKB 5B39A 1EMTL 1H8LA 1RXLA 2JJTA 4R7NA 1FG2B 3PQYA 3CPUA 2ZCZA 4FZ8L 1G1OA 5T1MB 5E2TL 2RA1A 3KBFA 1A9EA 4UT7H 5KJRL 4OSUL 4K3HA 3PWUA 4P07A 1FSBA 3ZQ9A 4R97C 5DD6B 3CSGA 3G5WA 3EYSL 3PWLB 4GXUM 1E0OB 4NN6B 4MJJA 1AY1L 1DDHA 4NHCL 3CU1A 3HO5A 4G1MB 2J1WA 4ZQKB 5AOIA 1UGKA 3GHEH 3VE0B 4QNPF 3OZLA 3OZKA 2Z4QB 3IGAA 4JM2A 2KZ1B 5JTWA 4Q9QL 1PZAA 5F1SA 4MCNA 4FXTA 4WWKD 3IM1A 4HV8A 2CH8A 5EGMB 3UTPE 1JCVA 2HWZL 4F33B 4UTBH 2UV3A 5DZ9A 4AYFB 2VDQL 4KQ4L 4H8WL 3ZKMD 3CZFB 3PHQA 4CADB 4G72B 1NIFA 2XVLA 3ILQC 5F21B 4KJWD 1AR1C 1TTAA 5IB4B 2JV6A 4WZ9A 4E0RA 1FP5A 1WUNT 3MDJA 4KI5E 4QEGA 3KPSB 1KIUB 4FMKA 2OJZH 3H7BB 4ZS7H 3UTTB 4AYBA 1IQHL 2PTTA 4Y19A 3U83A 4KI5C 5CZXD 1A4KB 1T1YA 1IILE 4YHIB 5TH2A 2DQGH 5IMLB 5HHXL 2OMTA 2KZWA 3PE9A 3SO3C 1KULA 1QBBA 1MFMA 3O3EA 1JXGA 4LT7A 4D8PA 5T1KA 3BWAB 3MLXL 1WLHA 4KKCD 4RRYA 4Y9EA 4Q9CA 4RH4A 1MQ5L 4RFNB 2CLZB 3JYCA 3OSVA 2K45A 3ZSTA 2HG0A 3V6ZA 1X6NA 2Z8SA 3GTTA 4U0RB 4MNGA 4Y7BB 5HJGA 4AIZA 1PDKB 1R17A 1DE4B 4GMSH 3VX1A 4YDNA 3BGAA 4HLEA 4KTEH 4HBQA 2BNQE 3QDMB 3WUZA 1OB1C 1OM3L 1BQKA 3BUDA 4ISVA 3WHXA 3OKMA 1HKLH 4JHWL 4XZUB 4ETYA 1X5GA 2FJSA 4GAFB 1CCFA 2XC4L 1AR2A 3VXSB 1ACCA 4GQRA 5KAQG 5M7QA 1EFXB 3MV8A 1XGTB 4MSWA 3TBTA 4OFQA 4JYVL 1UXWB 1PQZA 2JLPA 5L2YL 3OGOE 2Y1ZA 1F3DH 4M3HA 3WFDL 4NI6A 3EUUA 5LCVL 2GTZB 1RY7B 3V0AC 3W9DA 1FO0H 4X9BA 4X4YA 5F88A 4IOFC 1PTHA 3QEGL 4R8WH 4FNSA 1XL6A 2WP3O 1U3JA 3GSWA 3IDUA 3SOTA 3MR9A 1IO4C 3K6NA 4E5XG 5I1AA 2XUWA 2IIJA 4JCLA 1Q9KB 4XP5H 1DFXA 2BZDA 4TUUA 3SSGA 2OSXA 2O5YH 1HEJC 3OXSB 2NDGA 4TL4A 5FO7A 2F7RA 4TNVF 3RWEB 3NP4A 1OARL 3FFCD 3R05A 1MCOL 4MDIA 4MWFA 1CN4A 1EO7A 1BZ9B 1OF2B 1T20A 4JFEE 3PPSA 1A7QH 5DJDB 3AXIA 4M29A 4GP4B 2F1EA 2DQ6A 2HKHH 3H9SE 4JDVB 4JO4H 2FATL 3FNKA 4PTUA 3VFUA 1CTMA 3WIHL 5F7HA 2NT1A 4K8RL 4XNMA 4QTFA 1M7IB 1U3HB 2NZ9D 3QBTB 4WGKA 5FFLA 3EJYD 3HR5A 3IMSA 4ELMB 4MJIB 2FGWH 1EX0A 3DGDA 4XPBH 4JFOB 1LXMA 5T3ZE 2A4EA 5I8KH 4LDCA 1UASA 5DXWA 2D3VA 5BRZD 3MRJA 2VZVA 3MLRH 3HPJB 1V1IA 2CSPA 3BPLC 2BNUA 5BS0B 1FNSH 2JELL 4DZBA 2Z91B 3T6WA 1FAXL 3II3A 4PV8B 1BVKA 3DYPA 3U1PA 3T2OA 1VFAA 4LMQI 2A0LC 5D1ZB 1IZJA 2PWHA 2X4SA 2E27H 1NGWB 5KSAD 5J6SA 1JD9A 2NY6D 2JCCB 4ONHB 4N2IA 4RNRA 4JKMA 4AUUA 1L0XA 5AOZA 3OPUA 4N6RA 2ADIA 1P1VA 4XI5D 4IU3A 4PJXF 4B9YA 1EIBA 3QZMA 2B1HH 3BAEH 5DUPH 5IVXA 2J1XA 4BJLA 4NPYA 4MAYC 4ZXXL 2CJTA 5JIMA 1HL9A 3RDTA 3CVHH 4XH2A 5KSVA 5I18L 2WYHA 4GO9A 1HCGB 4B41A 4JJ5B 4JY4B 2NYYC 2W8CA 3KXFE 5GZNC