2YGOA

Wif domain-egf-like domain 1 of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
180
structure length
174
Chain Sequence
TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords WNT INHIBITORY FACTOR 1
total genus 31
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygoA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygoA01
1JV2B 3TH3L 1EBVA 2Q1JB 1EPJA 2J94B 3U7UG 4XBMA 2K2SB 3KL6B 1G2LB 3P5BL 1KIGL 1YGCL 2J34B 4D0EA 4XLWA 3ZYGA 4LORA 2WPIE 2MGRA 3LTFB 1WHEA 3LC5B 3N8WA 2BQ7A 4BTTA 1IOEL 2W3IB 2Y5GL 3ZYIB 1IQJL 1EZQB 2M74A 2J2UB 4RUTA 3K9XA 2XC0L 1XFEA 2WPLE 1F0RB 1TPGA 3ENSA 1HT5A 4JYVL 4Z6AL 4ISHL 3LIWB 2D1JB 2Y5HL 1HCGB 2UWOB 2BQWA 1EMNA 5L30L 2Y7ZB 2EI8B 1F7EA 1IQEL 1UZJA 4YT7L 3SW2A 2EI7B 1ADXA 5COXA 2XC5L 2P3UA 1RFNB 1G1SA 3SOVA 2EI6B 2J95B 2YGNA 1IQIL 5CISA 1IVOC 3NJPC 3EGFA 1ATBA 5IKTA 1F0SB 5JVYA 2W2PE 1COUA 3F6UL 1HRFA 3BT1A 1URKA 2VVUL 4X8SL 2D3JA 1LMJA 1L3YA 5CKMA 3BT2A 1L5GB 2BOHA 1C5MF 2KV4A 3M37L 1EPHA 2TGFA 1P0SL 2OYEP 4MMYB 2WG3C 1PXXA 1A3PA 1G1QA 4E1GA 3IJEB 2P95L 2J38B 5EGMB 3NTBA 4NGAL 5I46L 2RNLA 1KLJL 1DQBA 4CSYA 2FD6A 1HAEA 2VWNL 1J9CL 2UWLB 2RHPA 3POYA 2FLBL 4BDWA 3CA7A 4TGFA 3CENL 3TGFA 2BO2A 5E8DA 3SOBB 3FCSB 4Y79B 1GK5A 3OLUA 3N8YB 2YGOA 4BTIA 5L2ZL 2KL7A 3QCWA 1IGXA 2BMGA 1YUFA 1N7DA 4CUFA 4M10A 4MMZB 2H9EL 1SZBA 1LPGA 1LPZA 4CUDA 1NFXB 1XDTR 4Y7BB 1CX2A 1ZAQA 2P3TA 3N8XA 4AQTA 3LAQA 3HS7A 1V3XB 1EMOA 2FLGA 2BQ6A 1EQHA 1Z6CA 1EAIC 1PRHA 1ATAA 4YZUB 1CQEA 5IKVA 6COXA 3KQDL 3C9AC 3NT1A 4M11A 3R05A 2VH6B 2XBYL 2VWMK 4O02B 4X8TL 4O1ZA 3KQBL 4NA9L 3KK6A 4OTJA 1EGFA 1O5DL 1X7AL 3TBDA 2BOXA 1N1IA 2Y38A 4LMFA 2XBWL 2MHPA 3Q7DA 1EQGA 2JKHL 3KCGL 4X8UL 1OB1C 2VVCK 1CVUA 4C16A 4RS0A 3F1SB 5IKRA 3ASIA 1P9JA 1CVWL 1AUTL 1WHFA 1IJQA 5K0HB 2XC4L 3Q3KB 2P28B 3H5CB 5F1AA 2YGPA 5JW1A 3SOQA 5KN5C 4JZDL 1WU1B 3N8WB 4Y76B 2PR3B 1BF9A 2FZZL 3HS5A 2WYJB 2W2ME 3KRKA 2WYGB 1YUGA 4RRWA 4BTUA 2RA0L 1JL9A 1FAXL 2W3KB 2BZ6L 2WFXB 5JBAE 2PHBB 2PUQL 2BOKL 1G1RA 1IQFL 1TLEA 4RRXA 4Y71B 1YO8A 2XBXL 4ZHAB 1G2MB 2F9BL 1IQNL 2VWLL 3QMOA 1CEJA 1FE2A 4MMXB 2KB9A 3N8YA 2GD4A 1YUKB 5F19A 3FFGL 2Y5FL 1IOXA 1UZPA 1HAFA 1LQDA 3M36L 1UZQA 1IQGL 5CKQA 4BXSA 3LN1A 4A7IA 2AYLA 4CUEA 2W2QE 4JYUL 3PGHA 1NQLB 3QH0A 3LC3B 2NPRA 1XKAL 3V64C 4JZFL 2W86A 1NZIA 1IP0A 4RRZA 4COXA 2G00L 4D90A 1IQHL 2VH0B 3MQEA 1FAKL 3MDLA 3HO4A 2MGPA 2XBVL 2Y81B 2WPJE 3FBYA 4Z0LA 1ATDA 1IQKL 4ZXYL 3OLTA 2P93L 3LN0A 2K2TA 4G1MB 4RRYA 5JB8E 3V65B 2Y80B 1NT0A 3N8ZA 2VVVL 3HPTA 3KQEL 4Y6DB 1DX5I 1PTHA 4ZXXL 3IITB 1W8BL 1Q4GA 3LTGD 2J4IB 3ELAL 5FDQA 1KLIL 1HREA 1TOZA 4OTYA 3TZIA 4Z0KB 1KSNB 2I9BA 5JBCE 3KQCL 1DIYA 1LPKA 2P26A 5KIRA 4ZH8B 1PFXL 3NTGA 2I9AA 1UZKA 1W7XL 1Z6EL 4ZAEB 4FM5A 5CKNA 1KLOA 1MOXC 2BOUA 1HT8A 3DEMA 3GCXE 1APOA 1G1TA 1I0UA 1NFYB 1MQ5L 1FJSL 4YT6L 1QFKL 1IGZA 3HS6A 1PGEA 1FSBA 3CFWA 1K36A 5JB9E 2WFTA 1FFMA 4NG9L 2FLRL 2VJ3A 2B7DL 1FF7A 1F7MA 2VWOL 3TK6B 3CS7L 4X8VL 1JBUL 2P3FN 2P3FL 1U8CB 4D0FA 4BDXA 1XKBA 2Y82B 2WPME 3BPSE 5JVZA 1IQML 1CCFA 2DDUA 2UWPB 2WPKE 3HO3A 2CJIB 1CCVA 4JZEL 2WG4B 1ATEA 3U73A 1HJ7A 2W26B 1EPGA 2P94L 2YGQA 2P16L 1IQLL 3GISX 4BXWA 1EPIA 1APQA 2W2NE 3HO5A 2WPHE 1NFWB 3TK5B 3GCWE 1HX2A 1NFUB 1M1XB 5JBBE 1B9WA 2ADXA 2W2OE 3ZYJB 5IKQA 2Y7XB 4PH9A 4XL1A 1U67A 3N8VA 1HZ8A 5L2YL 3RR3A 2OYUP 1K37A 1NPEB 1MQ6L 4Y7AB 1DVAL 1DDXA 4ISIL
chains in the Genus database with same CATH superfamily
1LLAA 2Y2TA 4PLJD 5DJXB 4NKOA 4O58H 3Q05A 4TUOB 2V7NA 2EDYA 1UKSA 2EYTA 3MNWB 1BJ1J 1M2OA 1KBPA 1L0XA 2UWEB 3W81A 1F42A 2RFXA 3DX6A 4OZGE 4B9IA 1RURL 1G2LB 5E7FA 2DQHL 4YDVA 2DL2A 1Q9KA 2H0FA 4N85A 5I30L 5A16A 1IGCH 3C6LB 3EFDL 2QKIB 3ILPB 4FXGC 1U8QB 4TUJB 1LNUA 1UWXH 4JRXB 3S88L 2FEJA 4LOEA 3GGWA 4BUHA 4K5NA 4I9XA 5ALBH 3AGWA 3FB6A 1WHEA 3HI6H 4UQAA 2QSQA 1J10A 1PKQE 1LEGA 2M26A 3L9BA 3P4MA 4P5RA 3RVWC 3WUWB 4NQSA 1DL7H 2F1BA 1QNZH 3ASOB 5DC0A 3V9FA 3CHPA 2J2UB 3DJTA 3TEZA 1EHAA 2E4FA 4BQ8A 3U7YH 4XMPL 1VPOH 1KIUA 3ABLB 3SYOA 4HIEA 4WO4A 3X11B 3FSOA 3S35H 1TU2A 3IJHB 3EYFA 3F6LA 4V1DA 4BWTA 3O3DB 1CFTB 2VL5B 1G1YA 2JJTC 5HYJD 4GAJL 4I4WB 4LLYA 1YVLA 2AC0A 1YECH 1FO0A 4L29A 1INQA 3FHQA 1OB0A 2F8XC 2F54A 2C3XA 4LLVB 1IQEL 3WS3B 1UWXK 2KS0A 3G04B 2IOIA 1FN4B 5J4MA 1ADXA 1X5YA 4JFYA 3KCPB 1MJ7H 2XC5L 2EXYC 1S5IH 4M3KB 4ZFOL 1HS6A 1VIWA 1NFIB 2AJVH 1EJ6A 3UTTB 1JHLL 5F97E 3QFGA 4KI5F 5T1DL 5EF2A 1CU4L 2CIIB 2Q9OA 1NIDA 2JB5H 3ILQD 2ZPKH 5I1JH 3BT2L 4QOKA 1TENA 2AEPL 1V3LA 5C0GA 1ML0A 3O3BB 4NNYA 1X7QA 2D31A 2X12A 5H35B 4YHYB 3WD5H 3UTQB 2YOCA 4M6MH 1D9KB 3HIZA 3KPLA 3L4TA 3VFUA 3QQ3A 1LK2B 2DWTA 3QYNA 1VZHA 1ASPA 1J12A 3ECVA 2NZIA 4OZIE 1N0LB 1O5PA 1MF2H 3V9CA 5E56A 4P2YA 2QKIA 1NEZA 3ILPA 5D1ZD 1ZGLP 1LO4L 1K4CB 3P77A 2VMDA 3Q43A 4OFYD 2QKIC 3RIFF 4BQBA 4I0KA 3MDJA 1J0ZA 2QSCH 4JM2B 5FKPA 3G5WA 3GXNA 4MKMA 1J05A 5G5DA 3D18A 4OZHE 1HQ4B 1A7QL 5D2LB 3QUKA 2FD6A 4FQLH 1QACA 2DL9A 2VWNL 2ZD0A 4OF0A 1S7TB 4JJ5A 2PCPB 2C9SA 2DWDB 1C5DB 2VZOA 3WIIL 4CJ1A 5D1XB 5SWSB 3FF7A 2X7LA 1TYJA 5DQ9A 1KPVB 2TAAA 5AVZB 2A6KA 3IDIB 1YN7B 2K3TA 5A2IH 2H26B 4LLAA 3WDHA 3N8YB 2CBQA 4DKTA 4L0ZA 2KL7A 4KMTH 2YS4A 3MNVA 4GW5B 1YUFA 2A73A 2JLLA 3C8DA 4CUFA 3CBKB 4M10A 1MZYA 4I0PA 4K2UL 4WTQA 5EA0H 3WTSA 4XNBA 4R7NA 2EAEA 2ITFA 4UQ3B 3QUGA 1UQSA 4KJQD 5ID0B 1MCJA 2QV2A 3HB3B 1R33A 2G0KA 4YGAB 5I1EL 3QRFM 3QJQB 4RZCA 3IFOA 1AS8A 5K39B 5D93C 2Y5QA 5GS0D 3N1MC 2P3TA 3L3KB 4Y4KB 4ODUA 3N41B 2VXVH 2X38A 3QA3B 4FULA 4XP9H 2VLMD 2R15A 1WIOA 1G9HA 2X3AA 2CJTA 1HZHL 3VXRD 2VB5A 3UBGA 1RU9H 5JPNC 1MCWM 5EEXA 1EA9C 3MLUH 3SJVD 3QO1B 4YDNA 1NDMA 5I18L 5C2BL 4KZ0A 5JA8B 1AHWA 4YDLC 2HTLD 3QQ3B 3OXSA 1MFEL 4ENED 5CGYC 2DQDH 4WTWA 5F3BA 2XBYL 4M7LT 1XAUA 2G5BB 4HCRL 4JKKA 5JPMB 3HR5A 1BZ7B 1UASA 3VB8A 4NA9L 2ZX7A 5GS0C 1N5AA 3AB0C 2VO5A 5BV7L 4X6CB 3EJYD 3T65A 3LRLA 3S37X 1NANI 1BVZA 5K9KB 2WXRA 1DVXA 2FLBT 3ROOA 1XF3A 3UG5A 2YUWA 5ANHA 4HKZA 3TFBA 3VFGL 3ZE2F 3VMPA 2FECI 4CMHC 1BA9A 5D2LA 1I1YB 2WUCL 3MUY1 1I9RH 5F9JA 4AEEA 5K33A 1S8DA 4R4FH 3UMNA 5A2JH 5FO9B 3ASIA 1GS6X 5GGRB 3KW8A 1SLWA 2QR0B 1XF4A 3FU8A 2ED7A 2WQSA 4NUGH 2VYRE 3DURA 2R69A 1JF1A 3IAPA 4KMLB 4YSEA 2TRYA 5KYUB 4OF7A 1J1PH 2V2XA 5T1LB 4LOFA 4UOJA 4JN2B 1NIAA 3ZE2E 3HPJA 1CCZA 3EHBD 2GB2A 4OW6A 3BGFB 1M57B 3PCYA 3NQIA 4UQ3A 2OLDA 2Y24A 3TT3L 5FF6A 5DA0B 1IBBA 1W0VB 1ZPLA 1CLVA 2WMPB 1GCYA 4IKLA 5C0IA 3UJTH 1BPVA 3O2WL 3MOBL 4JY6A 4GXFA 4YSTA 2NW2A 3OKKB 2HT4D 3CLEL 2HJLA 3NBNA 4KXBA 2VN6A 1A1NA 3MREA 1A6WH 3IFNH 4LIQL 2E47A 4RNRB 3IGAA 4D9RE 2IGFL 3GGWB 4KQ4L 5LAPA 5HXMA 1CR9H 1I7ZB 2F0CA 3VQLA 1MJ7L 4FFVD 2WBXA 1JL9A 1YYCA 1NJ9A 1AGDB 4PJHF 4UI2A 4MCNA 4Y2DB 3ARVA 5KSBA 1TZIA 2BNRA 3S5ZA 3IKCA 4TVSa 3OVUB 3E6FB 2VDOB 4KKBD 3CAFA 3C6SA 4Y1AB 1IAOA 5D7LE 1TLEA 4UUJA 4YDLB 3MCYA 2DQMA 3NG5A 3O6KL 2CK2A 1F58H 3O81A 4ZHAB 4MRCA 2YSSA 2F9BL 2ZJSL 4P2OC 1FL5B 1IGIL 2JK5B 5HBBA 4ZX5A 3EAKA 4XCCH 4CNIA 2NUPA 5TDOA 2I7SA 2ENQA 4GG8A 3D51A 3PAUA 1TZ8A 4ODVH 3HFMH 1FVEA 5SWSE 1XX9C 2WLIB 1UCBL 1IBZA 2EABA 4IMKA 4K71C 2AAVA 5DMGD 4AEHH 1CD9B 5JOPD 4UTAH 3ARBB 1UZQA 3KWXA 4BXSA 5DEJA 5ACLA 3PIQA 4HJGB 3HRPA 1RJYB 4PJGE 5FECB 4RESB 3JWNH 4R8WH 4PRHD 1JTPA 1ECZA 3UPRA 3FCUB 3S48A 5I73C 3AG1B 1DDTA 2K78A 2PR4L 1NCBL 1OE1A 2V7HB 1ROCA 1LO0H 4U1IB 1HOCA 3ZX1A 1E43A 3IAQA 1E0OB 2NW3B 1FPTL 4IK7A 4P5KA 1FL3B 1UT9A 1U8HB 3CFJB 2P45B 1GL4B 4NWTL 1TJGH 5DVLA 1ZA3B 3BGMA 1F90L 2B39A 5LAXB 5KYYB 3BP5B 1KV7A 4ONGL 1KBKA 2WPJE 2XYBA 4BE6A 5MI0C 1ACZA 5IBLC 1JI1A 3AY2A 5EC1B 3EJQA 4PJIA 3WIAA 4HDIB 2NMSA 5CLWA 2ARJB 1YY9D 2NLJA 4QY8A 4DPCX 5E2WH 4JM2A 4B5EA 3KQEL 2UXTA 3UTTE 4NZRH 1T2QH 4NBXB 1EAQA 1KLFB 3EO0B 5ACMA 2J4IB 1X5ZA 1H3XA 1E4XL 5CN2A 4NQED 1QSVA 3ILQC 1JZ8A 1RZ7H 5ICZB 1WSST 3SBWC 2ZG1A 3GI9H 4JQVC 4X6DF 1IAKA 3OHXA 1FNLA 1W72H 5AW5B 1LPKA 2EDHA 5DDHB 1BHGA 1O75A 1CMOA 3CFKB 4M8QA 4NQUA 4JCLA 2VMJA 3OZ9L 5CKNA 2XTJB 3HZVA 1XL6A 5FA3A 1N10A 1RK0B 1U3NA 4KHTH 5EU3A 2HRHA 2JIXA 3HLKA 1JBJA 1MH5A 1RLBA 4P3DB 1MDAA 5E0FA 3W5NA 1G0XA 4UT9A 3RI5F 3HMWH 1QUNA 3RP1A 5I6LA 5FKAA 5HHVH 1P69B 5HVHB 2P5EE 1CQYA 1IAIM 1XGZA 4JN1H 4LHQB 4OLZL 2UZIL 1EVTC 3S35X 3WKQA 5E24E 4NZDA 5L0QB 12E8L 3HZ3A 2IDCA 1QZ1A 4GAFB 1ZKAA 1I9RL 1WICA 2WUCH 5E70A 5GRYA 1AHKA 1FFMA 5JIKA 3VE0A 2GSGA 2XV2A 5AZ2L 2IH9A 2YK1L 3PL6D 4P4KB 2DBLL 1FUNA 5DRWA 1WGOA 4LCWE 2ENYA 3LXAA 2ZWZA 3HMXA 2X41A 4NEHB 2XBZA 2VZUA 4W9HC 3L95A 1H6TA 3N1QC 5DSCB 2D7NA 3FBKA 1MY7A 1J0HA 3KPNA 1BZ9A 4PJIB 5FA4A 2A9AA 2VXTL 2XTSA 1UACL 3D08A 3HG1B 3NFSH 4NYLA 3LKRB 5AOLA 2DLTA 5C9JB 4HKZB 1BJ8A 1UATA 4QCIA 5I66A 4NJ9L 2AJSH 5EUOB 4MTMA 4PLKC 3R06A 4POZC 2F58H 4G6AC 3FRUB 5HYQA 4F7TB 5J3HD 3E1F1 4JO1L 2RH0A 3L3IA 4NN5C 4QOKD 3JWDC 4Y5XB 1AO7A 5C08E 3REVB 1GY2A 2AITA 1XCQA 2JJSA 3B9EA 2VNCA 2AJZA 4PWGA 2OMZA 2FX7L 2P1YA 3H3PL 5I6KA 2Y69B 1EAJA 4E9VA 1APQA 2BJMH 2P8MB 2R0WH 4F9LC 1FORH 1U8OB 1GPOL 4NZJA 1EZLA 3WJMA 4WIQA 1AG0A 2X10A 3FFCB 3CMOL 3HTLX 1JNLH 2R39A 1Z0MA 4UQEA 2DKMA 1ES0B 4JREC 4L5FE 5DJXA 5I1DA 1XXFC 4NBYB 3MJ8B 2OZ4H 1XQ4A 4AYFB 2C9QA 2XWJB 5BUPA 2DMBA 3L3GB 3MROA 4LASL 5C0BA 1SJEA 4PGDB 2ALAA 1XFPA 2COVD 1U0QA 1TVHB 4OCRL 5C07E 2OYUP 3VB9A 3QXDA 4X9FA 2WQAA 3NSCA 3L7EB 4N5ED 5D9SB 3JWOL 1DR9A 2CH8A 4K7PX 4R8WL 5C0RH 3EDJA 3TH3L 1OAJA 3BFWA 2AKRA 1NFDE 2J94B 4L4TB 5F3FA 5KSBE 3ZOAA 5DHVB 1QW9A 4GRLD 4PJ8C 2BWQA 2XU9A 2IFFL 4W9LC 4HALA 5LBVA 1UCBH 3DTUB 3OLDA 5F7FA 2GCYA 2BVQA 1YGCL 3X1FA 3VNZA 1M7UA 3LD8C 3N1FC 4J1UA 1XGPA 1S9VA 2PWHA 1R6VA 1UEYA 4MMXA 4WZ9A 4JM0A 4EZKA 1IGIH 1TTGA 1XCTB 3IMSA 4EXPX 2X6UA 3N8WA 2HX9A 4N6RB 2W3IB 1SOSA 1QEXA 3ZU8A 4HEPG 3HLAA 3GI8H 1YMMB 1PG7H 1I85A 3DUSA 5T1MB 3V0IA 1S9WA 2IBBA 2IIJA 3MRHB 1ADWA 2XIBA 4H25B 1EH9A 4ZFZA 2XJKA 3RGBA 4IBSA 1TPGA 4HKXA 4MNQD 2PYED 1MWAA 5DC4B 2W9DL 2JSFA 3LIWB 5FFOA 2GT9B 1TR7A 1KJ2B 2JCCA 4OTXH 1G7JA 3L81A 4MSWA 4GSQA 4XO5A 5I8EA 4DP7X 1YUHB 2LLGA 5JPNA 3AT9A 3AT0A 2L7JA 4DESA 1TMQA 3MRFA 4NLAA 2ZYIA 3I9AA 4JO3L 5FO9A 3HVDA 3K1KC 1GJWA 4QHKJ 4QO1A 4W9DC 4EF3A 2ESVE 1P2CB 4W9CC 3UTSA 5A6IA 2BCMA 3BWAA 4KKLD 3GMNA 2KLSA 1U3HA 1ZY9A 3WHE1 2CJ3A 1SJEB 2MEJB 2PR9A 2YPLE 1TF4A 4DUVA 1MFCH 2WLNA 3AZUA 4NN6B 4TUUA 5CISA 3QORB 3V4PH 1I1RA 3FPXA 1KDIA 2WXJA 5CILL 5AL0A 3QUZA 3C60A 3BRGC 4ZUSB 4P46B 4X5XB 3KHQA 1CDHA 4OQTL 2RD0A 3SBRA 1IMHC 3EFOA 3W9DA 2H6PB 4J3BA 4NKQB 5IB4B 1T21A 1YN6B 2IAAC 4PCKA 4P23D 5DHDA 3UYPA 2Y0SA 1P1ZA 1RUML 5CN3A 2PETA 4K7PL 1IL1A 1JGUL 3ARXA 2D9QB 4PJ8B 5GRUL 3UC2A 2NY4C 1P0SL 1I9IL 3L1EA 3PFUA 2PPFA 3MRJA 1CYXA 5DMIL 2Z9TA 4U6YA 4HWEL 4UZGA 5D1XC 4HSQA 2RR3A 2KDYA 5IKCB 4KTEH 1KCBA 1NCWL 5IIEA 1NC4D 1F00I 4WWNA 4PS7A 5FM5O 5DLLA 4UANA 3RLSA 5DZPA 2QQLL 4TYUA 1ZLVH 3CSGA 4RMTA 2KLRA 4ZS7H 3LKSA 2A73B 2FJFB 3BAXA 3CDZA 4Y79B 3ZQWA 5TGBB 5ESQA 4NZ8A 3MRMA 1FRGL 3MLPA 2XIDA 5D93B 4ZO9A 1CD0A 1NFDA 3QUHA 1H8LA 5F3BB 3GJFA 4JJHA 2LFEA 4KVPA 4JS7A 5AZ2H 1C7SA 5C09A 4ENEC 1IM3A 2KBGA 2WKGA 1BD2B 3TBBA 1BMGA 5DZJA 4DP2X 3NIDE 2F53E 4MQXD 4NB7A 5ABAA 4CUDA 4EOWH 3CZFA 5BO1H 3SDCD 4CL7A 1XDTR 3AVEA 1E9OB 1CDUA 1UB5A 5T1KB 4ACPA 4X5LA 2FD6H 3HZYA 4XGZB 4Z0BH 4KKQA 4YBQD 3P9MB 1MEXL 2OX5B 3SOBL 1UA7A 1I8IB 2VXQL 4UILL 5JOFA 2DY2A 3OKEA 4N1EA 3K6DA 4MXVE 5AW2B 4JDEA 4YDJA 4Z8FL 1ET7A 1Z9LA 2ZUYA 3EYVA 4X8GA 4ZPVB 3TA3D 2JJWA 2IC2A 3QUMA 1HFUA 5AD0B 1JZ6A 1A9VA 5ICXB 4LZKA 4PJAE 4PJHA 4C56D 4HHAB 4FQJL 4TVPL 3VXSE 3WLBB 1WRFA 2M2DA 3BPLB 4HWUA 5L2JA 1NUNB 1OB1B 5LGKA 1HK6A 4M11A 2KZBA 35C8L 3CSYA 1J8SA 3FAWA 1CD1B 3CVIH 3KWVA 3TH4T 4NLHA 5DJDB 4FLQA 1I1YA 5C2UB 1FVDA 3NQKA 2ZX9A 3B7UX 4K3DH 4JGUA 2Z8RA 3FFOA 4FA8A 5F8QC 2ICEC 3OMAB 2BOXA 5DD5H 2EKJA 1U8MB 3D0LA 1CLZH 2XBWL 1J0IA 1E4XI 2H0EA 3EOYG 3EJCA 3IN0A 4GOSA 4AM0A 2BNUA 3ZDXB 4KO6A 4YSSA 1OKEA 4P9MH 4F9LA 4X8UL 1PQZB 3RZCD 3TBCA 4UT7L 4P5TC 4KROD 4PJXF 4L1HA 4LRNH 3C5ZD 4P2RD 3H8NA 3IPFA 4HP5A 3PDDA 4IRJD 5DGQA 2HYMA 4FTVD 4LRIA 3KPRA 1J9RA 2IOOA 3QXDB 4XWGH 1Q0XL 3C8KB 1WZ1L 3N43F 4TQEH 2A6IA 3QIUB 4DSYA 4Z23A 2XWBB 5BQDA 4A2HA 3VXSB 4KKRA 1Z9SA 4UZUA 3US1A 5GXBB 1AXSA 4JQVA 2GI7A 3UP6A 4F9PC 5IVNA 2VSDA 4RAHA 1NCBH 3QXAA 2PR4H 3A4AA 5BUGA 1CT8B 5BJTB 2OYLA 1EXUA 3IBOA 5HYEA 2WYJB 3B2DC 1OE2A 3OJMB 3M8OL 2VE6B 3U6XA 1MCEA 1XH1A 3O9WB 1V05A 1H9VA 4AJYV 4ZW8A 4HWEH 3VJ6A 5C6PB 3DDGA 1Q9WB 5IESH 1NGZB 1JPTL 3B7TA 4PG9A 3S34H 2GUYA 3BYTA 2XN9E 1ZJAA 4GINA 2WFXB 1E8WA 1XBDA 3QQNA 1IARB 4YFLF 4DZ8A 4WV1B 3FN0H 5MEOB 1RLWA 5HHQA 2EICA 1R3KB 4MXWL 4KVNL 1J1OL 4KY2A 3D18B 3GZPA 3O4OC 3QR1A 5IEHB 3ARBC 2JKXA 5D8JL 3L1GA 3PL6A 2HFGH 1FC1A 3WELA 3VTAA 1XH0A 3ARBA 5CJQH 2DF3A 3S88H 1IILE 4G6KH 5HHPA 2DIEA 5DD6A 2EVJA 1JGUH 4IU2A 4KK8D 2AFNA 2KPNA 2OXGA 4QLWA 1KB3A 1ZSDA 5F1NA 2DQHH 3HC0B 5CZKA 3HAEB 3MLSH 1VFBA 4EEEA 1OANA 3W9EA 4D3CL 5DI8A 3TBWA 1I3GH 5C86A 3MBEC 3PAZA 4HKJB 5EULV 2O6EA 1V27A 3MFFB 2JCWA 1KTJA 5DJAB 3CU1A 2EH7H 3T0AA 4ETYA 1QR1B 4H0LC 2E7CA 1TTBA 1GGIH 2MTAA 2ITDA 2UZXB 1UKTA 3VVWA 2FRGP 2X4UB 5DQJA 3BFQG 1P5VB 3MDLA 5JQ6H 4I5BA 4F7CA 3QJHB 2VGLM 2XSKA 1A8JH 2HKHH 2XN9B 3EGDA 3AQYA 4UBDC 3ARRA 5KSAD 5ITBL 4Z0LA 2BP5M 4ZXYL 4WJG3 4S1QL 2GY5A 1KCUH 4IRZA 2PPCA 5IG7A 1JHKL 4NXSA 2QADB 1UXSA 1IAMA 5ICZA 3GSWA 5FOBB 3MNDA 2XQYK 1DN0A 4M7JL 4LSPH 4NKMB 3NZSA 1LWJA 1YNTF 2PP7A 3O9WC 2YEZB 1S3KH 2EDJA 1P9MC 3NRQA 5D2NE 5EB9A 1A9BA 1OM9A 3ZDZF 3D3VA 2BNQB 3SDAA 3H7BA 2NY5C 1LMIA 4NNPH 4XC3H 1YAZA 5EBWA 1NGPH 2DQEL 4IKNA 3BHBA 4WHTA 4ZS6D 3OPZH 4LSVL 5AW1B 3KPMB 4WCYH 3CVIL 1KSNB 4DGUA 3DSFL 4L9LA 1RK1B 2XCMC 1URZA 4TVPH 3VFNB 4GSXA 3U0TB 3CFQA 2JIXB 2UVFA 3GMQB 4ODSL 4HEME 1WBZA 1P4BL 3QDJA 3BH4A 5DD6B 2J88H 2Y5EA 5L0QC 2CLRB 2V33A 3CVDA 3T0BA 1SJHB 2IPKB 1QO3B 3GRBA 4BM7A 1I0UA 3SOBH 3RWCB 1O6TA 5DFWH 3RNKA 2NZ9D 3ESUF 4I1PA 4YPGA 1T5XB 1U8PA 1U8NA 1CQKA 4QCIB 5KVGL 3ARGB 3LN4B 1SF5A 5L7XH 2EECA 5F6HJ 3BLBA 3MBEB 3OHMB 1LWHA 1K36A 3WFDH 2CDFA 5I1LB 1IV8A 5EIQA 5IBTL 1M6OA 4XZUA 3CIAA 1L6PA 1MCFA 4FLRA 2OJEA 5C70A 3FH5A 3CVHL 3GUFA 4XO9A 3ZL4L 4PRPA 2A9BA 1L9QA 1F56A 2D03H 1TVBA 2AZUA 2BP0A 2VN4A 4OB5L 3IGLA 4JG9A 3HBPA 4KQ3H 4PY7A 2P3FL 3MNMA 5JUEH 1TJHL 2HT3D 4AE1A 3L9RA 3V4VA 4D0FA 4XNQB 3MR9B 1E4JA 3FB8A 4K94C 3ZDXF 3DO4A 5K59E 2OAAA 3W11D 3DECA 3OXRB 1NGXA 2XA3A 4HPHA 5LAXA 2WB1A 3EBHA 3WMQA 1OSEA 4CC4C 3QJFA 3DARA 3REWB 1E67A 2HVJB 4P06A 3HO3A 1LP9F 4WNQA 2EYRB 2A1WH 4UMGA 5CIPA 5F3HB 3RKPA 2VABA 3JYBA 3VU1A 5B8CB 5EEUA 3EYVB 5DMIH 2JKIS 1U3HC 1HJ7A 4HJSA 5CKGA 4ZOBA 3G7TA 3N44F 3WL9A 4W9FC 1ZRUA 4PB0H 3A4FA 1CK0H 2VKXA 4J2XA 2R1YB 2DAVA 1DANU 2XWJA 3I9GL 1B0IA 3MLRL 4IOIA 4J6RL 1NQBA 4JQIH 4LPXA 5BOZG 3T0EA 3TURA 1M7IB 1ND0B 3CFUA 3DUUB 4Y4HB 5F0LB 2ZYSA 2R56L 4MD0A 1RJLB 4R3SB 2V6HA 4AJWA 3L5JA 1PAZA 4XP1H 1PZ5A 1P53A 4ZFGH 1XGPB 1CTNA 2PXYB 2XA8L 5EUOE 4F58L 1UWYA 3V9EA 1SHMA 3E6HB 4U05A 5LHDA 2BS8A 3WKPA 3NIFF 1CICD 1I9EA 1MCRA 2Q7NA 5IKQA 2OCJA 1JRHH 3MOQA 4HJEA 3ZKSD 2FB4H 2KZKA 3QWQB 4HPOL 5I0XA 1F3RB 3E3QC 4DGYL 1IGJB 5AFAA 1CGYA 5F2FA 3HC3L 2RJMA 1KIQB 4LMQI 3QHTC 3QNFA 4JVUA 3RKDC 3LZPA 3MV7B 1NWOA 3WFBH 4LAQH 1Z3RA 4WHCA 1E4KC 2GJPA 4UZSA 3QCUL 3X12A 1T7XA 2E3VA 2LGNA 3W1ZA 2OCFD 2Y2WA 3VD4A 2NY2C 2Z35A 4LVHB 1OAZL 4PGDA 5LGHH 3OKEB 3GJEA 3KPRD 4HS6B 1QIUA 2J34B 1YNTA 2Z3FA 4PW3A 4LORA 4OIIH 5EIIB 3VFMA 3RNQA 5HHOB 5LXGL 1HN1A 4NRYA 3FB7B 1TQWA 1M1SA 4PGBB 2XVGA 1FGNL 4M3HA 2PO6A 3HI1A 4XH2A 1FNGB 2CGRL 5FGCB 3PL6C 5T3XD 3IGKA 5AWNL 4L3EB 2BZ7A 1BBJA 1UJTA 3MRRB 4L4VD 3I75B 2WWKO 2VC2B 3MLXH 2JKJA 1MN4A 4UOW1 1XEUA 3BT0A 3APMA 5I1IL 4LPVA 3DC0A 5DD3H 4I85A 1SN0A 2VQ1A 4QEGA 4JYVL 3II2A 4GUPA 4G42B 4HS3B 5JW4R 3TOPA 1W80A 5CP3H 2EYRA 5F3HA 4JVWA 2LR4A 2JI1A 3DX8B 3U30B 5I6MA 4F37K 1I7RB 5DD1H 1IKFH 1KIRA 4Q2ZB 4W6YB 1X5JA 3BWAB 1DLHB 4JO5A 5L4JA 3CPUA 5BVPL 3GMNB 2GBAA 2P5PA 3HE6B 4GLRH 4I0PD 4TNWK 1N59B 3TN0D 1T83C 4ONGH 5FYKH 3NH7L 3SKOA 1QUPA 3NEXA 4L8BB 3BW9B 5IW6A 1CXLA 2ZWKA 1B9KA 2VRKA 3CZNA 4PAZA 4HVBA 5I1HL 5KVEE 4JG0L 2EI7B 32C2B 3EJSA 4O58L 4P46C 2A77L 5DJ6A 4RFOH 3HNVH 4JDZA 4Y1TA 3DTDA 1HL5A 1LWRA 1UUNA 2NY5H 5AAMA 2VXQA 4X4MA 5TH2B 2EI6B 2J95B 2GSGB 2K45A 2C9VA 3C12A 4R2GB 1DBAL 1KTDB 5EBLB 5F21B 2OXHA 1NEPA 1F11A 3HI5H 1NUFA 2CGYA 4X8JA 3B4NA 4U33A 5A2CA 1IM3D 4HOZA 4KBPA 1ADQH 1JNNL 2LV4A 1MHEB 5EF1A 4FTVA 4LKCA 3FRPB 4WUUA 3ZKXC 2XBDA 3WDJA 2CCLA 5FR3A 4NQDB 4XPAL 3WU1A 2Q8AL 4XP5L 2JLPA 1S7QA 1T0PB 4PJCE 2CLZB 1CI3M 3GJFB 5AZEH 4HUCA 1LP9A 1VACB 4O2EB 3QUYA 4OR1A 2BY3A 3E0GA 4MMYB 1CE1H 2AMUA 4GP8B 3QDGB 4UV7L 5E8DL 5ESAA 3UIYA 4U1GB 5GSRA 3QZBA 4DHLA 2IGFH 4IMLA 4KQ4H 3RB5A 3VFNA 3CDZB 3K72A 1IGYA 4FJYA 4LBAA 5T3XH 3TO2B 4NGAL 2RNLA 2BS71 1NBCA 3HE7A 4MVBD 1P1VA 1L9OA 3P3RA 4N26A 4XN1A 3VRIA 5I1AA 2WLLA 4Y1AA 3U9UB 2UWLB 3SKJH 2ICWI 2BM3A 4BDWA 2ZP9A 1XGRB 4M5YL 2YXFA 2VERA 5D55A 3TA3C 2R0LH 5IHWA 3RB7A 3ZYOA 5EDSA 4PYGA 3GLEA 3F7KA 3GLZA 2YK1H 3L7FB 3OLUA 1ZT1A 3DTXB 3ZE1B 4OV5B 4GB9A 3KYKH 1E9OA 2NQ3A 3PHOA 4N8PA 3EDDA 3MLVH 4P23C 3TBVB 4F2FA 1T1ZB 2Z93A 3IJYA 4JFTA 1EXGA 4AVKA 1C5BH 1BMWA 2WQ8A 3P30H 2J43A 3DO7A 4JN1L 1MXGA 5J9PA 5BRZB 3HC4H 4OJAA 4CN1A 2B5IB 7FABL 1QA9B 2JKRM 4HMDA 2X40A 4DVBB 3QHZH 1CUOA 2EUZA 5C09D 1V3XB 1ZDSA 3F58H 1T7YA 3F04A 3K5SA 4ZFQA 1J11A 1A1OB 1ZHKA 1HKLH 4R2GC 1JZJA 3D9AH 3PPEA 2AV1B 4A2DA 3STLB 1F86A 4I18C 4KVCH 4DP4X 1ATAA 1ZT4B 3IFLL 4N24A 3HNSL 5D71H 4BXSV 5IF0B 5JHLH 5E9DE 1J1XL 4AIXA 1GKOA 1O7DE 3VFGH 1G7MB 1QW8A 4JQIL 1HESA 3GSNH 3VXUA 1H3PH 3ZTCC 2DJ4A 3MC0A 3VXSA 5EF3A 4UDUB 4BFRA 2IPTL 2CJUH 3H1ZA 1BG9A 1KXVC 1X4ZA 4FS0A 1T20B 4TQIA 3BD4A 3AAZB 4LPYA 1HH6B 5A1AA 3WMSA 3POHA 1QI5A 4ELMF 3GS0A 5I1EH 5FUZL 3PWPE 1DDHA 1AQKL 1FFOB 4JVPA 4FMFA 4XBEH 2UYLA 5E99L 3T2LA 4BXVA 2E5EA 5IJVA 1DE4B 1R5VA 3QFJA 4OV6F 3KWUA 4V1DB 1A7PL 3VXME 2XNAA 3ZRSA 1HTYA 1G7LA 4APQC 1ACCA 5K0HB 2H0JA 2B1AL 1JVLA 2Z8VC 3ARDB 4KOBA 3O9WA 1MAML 3CFKA 5F1AA 4M8QB 4TUKL 5KOMC 3NP3A 4HF5L 1JZ4A 1WAAE 4PJ9B 3VQ2C 2XWDA 3I3DA 1F3DJ 2L7QA 3G9AB 3HUJB 3DGGA 1MFDH 3EYOA 3MV9A 3CFBB 2RALA 1U3HD 5EA0L 4L3CA 2BSTB 5ID1B 3WJJA 1S7SB 4KMTL 4EI5D 2AABL 1PG7W 4PV8A 4WW2F 3MCKA 4GKSA 1U8QA 1GZQB 1YAIA 2Z1KA 4TUJA 2W92A 5JO5B 3V0GA 5KBNC 4I9WD 3QRBA 4N2CA 4H8VA 3S8GB 1NM4A 3GBEA 4HZ1A 25C8H 3UJJH 1JF1B 2X0VA 5KYUA 3KWWB 3GXUB 1ZEAL 2W81C 4KU1A 3N44B 3OMIB 3P9MA 3D4ZA 5AW8B 4E9YA 5C0AD 2LQRA 4BHUI 4TNVF 3L5HA 4TLUA 3NFPA 3TBSA 2BOKL 5KVFL 2GK2A 2OMXA 4OCXH 4ZX4A 5DVNA 3PPSA 2XN9D 3BQUA 4JFQA 2XBXL 5GSVA 1CG9B 1G94A 3V6OC 4WFFD 4KJYB 5BRQA 3P0YL 5HGAB 3ZT7A 3K46A 3MLYH 3LNHA 3CH1A 3EO1B 2V9UA 2ROXA 4N86A 3S2AA 2I5YH 2NY4D 4AMKH 2CKBH 4BFKA 9PCYA 4YR6B 1P7BA 5SWZE 1XO8A 1S3RA 4XNZC 1HNGA 4XVUC 3QARA 1NCGA 3HZKA 4E9XA 4IHOA 2QLYA 3F7QA 5DUBB 3CHSA 1D9KA 2PUQT 4NC2B 1YG9A 5IJBC 1BWMA 3NCFB 1WT5A 4KTGA 3KDMB 1DVFD 4OZIF 2RTTA 4KQ0A 3PE9A 5TDPB 1E5AA 3TBYB 2W86A 5FW7A 2B14A 4EN3D 4Q89A 1NZIA 1ZMYA 5CNHA 1G43A 1NCAH 2JKWA 3IDYC 3LIZA 1XF1A 3P2TA 4Y1AE 1GRWA 2HG5B 1RJCA 1PYWA 1GXEA 4LCCC 1GJUA 4MJ5B 4Z7NF 4IJ3C 2DJSA 1AFVH 4KKPA 1MLCA 4R5TA 1AZUA 3CUPA 3BVUA 4OBRA 3LKOB 2OV0A 4O02A 4L4TE 1IQKL 4GG6B 5EFIB 1GOHA 3GKZA 5EBWB 4CAGA 1S9YB 3C6SB 1R1CA 15C8H 1ETJA 2BNQA 4MX7B 3HUJE 2P7TB 2Y80B 4GAYA 3KPRE 4WVRA 3S35L 1DEDA 3HEIB 3VFOA 3BD5A 4MJJA 1J86A 5FUCC 1L3WA 4RGMB 3TPKA 1NAKL 4U1MB 1X9LA 4S0HA 4QXGL 5JIQA 4A04A 2GCYB 1HINL 4V2CB 4ZW7A 3F7VA 1YEDA 3VXMB 3B43A 4KVNH 1KLIL 2TSBA 3Q1EA 2X9ZA 2I85A 4TNFA 1GKEA 4C56E 4IW4C 4PS4L 4LLQB 4MAUL 2J1WA 4M03A 1WAPA 5MHSE 4OZFG 4MA3A 1IGCL 4P57B 1U8KB 2BRQA 1UZKA 2DM3A 1KIPB 2D3LA 4GS7C 4ODWA 3KD4A 1CFBA 1WCBB 1FL5A 2JK5A 3C8KA 4Y5VA 2KI6A 4LARH 1G6RL 4L48A 4P8QA 5EF0A 1IIIA 2H45A 1G1TA 3B9DA 1KIUB 4PBVC 5AYUL 5CEYA 1YY9C 1TJIH 2P5ED 3GS4A 3AU1B 3FFDA 2H8PB 3GDBA 2XWEA 4R0LA 1PGEA 1FNEB 2P8LB 4X6CE 5C0EA 3V4VB 4ZNEA 3M1OA 3CFWA 4AYID 2VLLA 3RHWF 4D8PA 4OLVH 5J1SC 4WO4C 1T0MB 5H4YA 2NY1C 4NM8H 4X8VL 1EGJA 5I23A 3KCPA 1KZYA 1T1XA 5C08A 1B4RA 1AGFB 1MRDH 4R26H 2IDTA 3N50A 3S3CB 4CADA 3W57A 1U8CB 5F93C 4HH9B 4F3FA 3WTXA 1H3PL 4H88L 1MPAH 4GG6A 4N22A 4Z7WB 1RJZA 2CDGB 4FQLL 4JFED 4PREA 3U9PL 5JNYB 3MLTB 1XIWA 2YC1A 3HZMB 1ILUA 1DJSA 4NRZB 5IHZA 3DPBA 3G6AB 1VKXA 1CLZL 3KYOA 1TCMA 5DRXB 3NAAH 4LNVA 2HJFB 4ZFOB 1SXZA 5TK4A 1HKLL 1K85A 1MFAL 5HDOA 1N0XL 1K8IB 1U8IA 3BVDB 3C09B 4FNTA 1C16A 5CWSB 4PIBA 1MF2L 4QWWC 4QXWA 3VXTA 3I6LE 5F96L 2ZWLT 2E75C 4I2XA 2V3EA 4X5WB 3D25B 3GBMH 2PTTA 1P7HL 5HJDA 4BKLB 2Z31D 4N2NA 3BO8A 5CGTA 1BVLB 2EDLA 2H0PA 4PTUB 3UDWA 4LLQA 5GS2D 4HXBL 1F1AA 1MCOH 1G7PB 3MLWH 4Y4FB 2C8NA 3ULUH 5IQNA 1JDDA 3P0VL 1GGUA 4P5TD 3ZYJB 1M4KA 3QDGE 5I1CH 2IAMC 3P0GB 5GS0H 1JHTA 5F6IC 4KH9A 4XT1C 2VUOA 3EW3B 2LHAA 2YUXA 3L2LA 5FECA 5DS8A 1CFNA 5KANI 4FQXB 2DI7A 2PWEA 5GRJH 2BZCA 1YJDL 2DRUA 4LQFH 2O61B 2CNZA 3HS9A 2JQMA 2IGLA 3FJTA 3FQUA 4U1HB 1DBBH 2IQ9H 2O72A 3FMGL 1BQRA 3CCHA 5AKVA 1KIQA 4AUJA 3TN0A 2AJXL 3D39D 3HS0A 4GG8B 3AREC 4AYFA 5LVEA 4MMXC 1FSKC 2OTUB 3PQYA 4NGHL 3WTUA 4OGAC 1NBQA 4APQD 4LK4A 1YC8A 4N2HA 2EVIA 4NHUB 3S4SG 2ZSWB 5BMFH 1RMFH 2CCVA 1PFCA 1JVKA 1C08B 2BOBB 2QPEB 1KGXA 5F7BA 1QNZL 5IQLA 3U1PA 3BQUC 1GHFL 1JPGA 3R7RA 5D96C 1QG3A 4G1EA 1JNHB 3I74A 4P5MA 2A83B 1ID5I 1UZGA 4QRRB 3GZQA 3LSOA 3LN9A 3F7YA 3L2NA 1XFEA 3U4KA 2CIIA 4N8CH 4IBUA 3D12B 1KTLA 2Y7OA 1F4YH 4K9EL 1KN2L 5KYYA 4OZFA 3FO0L 4JG1L 4YSUA 4IKIA 4G6FD 4EZJA 2MQGA 3BPOB 4FP8H 4UOW0 5DMKA 3EOTH 4HHWA 1NMBH 3SZKC 2C1OA 4PTTA 3FU3A 2NNFA 3QXVA 4KDVA 5E94B 1LHZA 3C87A 1JUFB 2YD4A 1MIML 3HKFA 4BE5A 2RA1A 4Q56A 5GZND 5I1HH 3Q9QA 5D4IA 4U2ZA 1E9QB 3KE0A 3SPJA 3Q7JA 4URTB 1TLMA 2Y06H 4BKLA 1L7TH 4FNLL 3RX9A 4BFJA 1F11B 2MCAA 1KLFA 1ZS8A 3CGTA 2X5PA 2C3VB 1S78D 3KM1A 2MCMA 2RACA 1TVHA 3T0EC 3QCVH 3WFEL 2QR0A 1WZLA 3EGFA 1QAWA 3DX3A 2I25N 3GSVA 4M8UA 4HX1B 4H8UA 3QS2A 2W2PE 4HDIA 4ALAC 1HNYA 4FJ6A 3O6FD 4HUUB 4N2FA 3VI4F 3BW9A 3TZVC 4OJEH 1IJNA 4E9SA 1URKA 1BF5A 4MJIB 1G7IA 1TQUA 3BP7B 1KC5H 1CFNB 3D3VE 4PV8B 1BOGB 5BW7C 1N26A 2Y7QA 4J3XA 4NQXA 3CZUB 3GIVB 1JPSL 1YYML 1ZHLA 3FCTB 4KV5E 4DTGH 1E28A 2WGXA 2Y6TE 5GISH 4YXKH 3WUWG 3MJGX 2E7LA 4OJFL 3UAJA 2FT8A 2AQ2A 3ARFA 2PNDA 1RIHL 5KUMA 1TZOA 4HV8B 3TZVD 4DOHB 4RX4D 1AYRA 4J27A 1MRCH 2Z7YA 1A6PA 3FCSA 2O5YL 4X7SH 1DVFB 3VI4B 2XRAL 5FAAA 5JW4M 5MERA 3MBXL 4NQDA 4M4RA 1N12A 4XVOA 1KLJL 1OQXA 4AVHA 5D96B 4DP8X 3KLDA 4IRZH 4PGBA 3MRLA 1J9CL 4UNIA 4FZEL 5A7EA 1SVZA 4MMZA 3NFNB 4QF1B 1IKNC 3QT2A 3TGFA 4NO0A 5E8DA 2ICWJ 2RBLA 5IZ7A 4H7VA 1N64H 1HE7A 3ESOA 4HH8A 4GQPH 2YLHA 3LQAH 3HRZC 5TTRA 3FS9A 1E6JL 4CNIB 5KSUA 2JKSA 2WZ5A 4JPKH 3V5HA 2AXJA 2MIZA 3Q5YA 3NN8A 1DO5A 3W38A 1DVTA 1E9QA 4NZTH 4N0UA 4PGEB 1KUMA 3UC0H 5ETUB 2EEAA 2OQJB 4YDZA 4OLWH 2JJLA 1CL7L 2IDFA 4Y2NA 4XBGA 3P9LB 4GQ9H 2DH2A 3PWLB 3UL4A 4AIEA 3AFLA 3QAZC 4PJXE 3HS7A 3V6OA 1EMOA 1YEEH 2VWEE 4YHPA 5GGVL 1CC3A 5EPMB 1QLFB 3QIWB 2A1WL 1GSKA 3LKRA 1FNEA 4GKOA 2VR4A 2P24B 1DE4A 3QFJB 1FNHA 4B9KC 4QAMB 4GMSL 1QRKA 1S9KC 1MCPH 4UQ9A 2LE9A 4XTRC 3R05A 3FU7A 2Q2LA 4XWOD 5LN8A 4JPSA 3VQ1C 2X1PA 3B6SB 5EC2B 1XCQB 3KQBL 5C0JA 3HPJB 1WFOA 1ZVNA 4KQ3L 1H8NA 1DQDL 5JHAA 4LMFA 1DEEB 1E28B 4GY4A 5FYJE 4XXDA 1R24B 2D73A 4OFYA 4OAWB 2QEJA 3D69A 5D1ZA 5IMMA 2BP8B 1WUNT 4FOMA 1IGFL 2R7EB 2WUBH 4WW2C 4TTGA 2D7TL 2Y06L 4YL9A 1K8DB 2X2JA 1VKXB 3I3BA 2K70A 4OGXL 3SY6A 3GBLA 3MRLB 3V52L 1BQLH 4WO0A 1SLUA 5L7XL 4GSUA 1AGBA 1PDKA 4BQCA 5JHDB 2IAND 3DMMA 1SM3H 4Y2DA 3BVVA 2X0WA 1RZFH 3NGBC 1WIUA 3BVNB 4ZMWA 1LE9A 2C9PA 4FQ2L 2XZCL 2BNQE 4I1NB 1CVRA 3Q3KB 4U6HB 5FFGA 4QT5B 5L4FA 2J88L 4P2RA 4FE9A 1RZ8A 4LCIH 4OZIB 3NDYE 1FZJA 2A2QT 3QPKA 5HHVL 1V7ML 1MG3C 2VLLB 3LS4H 1G9EA 1YMMA 1U8NB 4W68A 3TN0C 4JPWL 3FTSA 2R23A 2XRAH 2ADIA 1I82A 2VLRA 1MCDA 2X4QB 3BP6A 4YZFF 3WY2A 4HYTB 4NN7C 4XPTH 1J9SA 2F1AA 1MRCL 5I2IB 2Y4SA 3RVVD 2J1ZA 3EYUH 2OS7A 2WN2A 4WSGA 2I69A 2A6IB 4MCZA 4Y4KA 1KT2A 4OJFH 4IRSD 5CZVL 3OB8A 4WJKB 1D2PA 3KDMA 1OK8A 3R8BB 5JHLA 1YYMH 3LIUA 3VWKB 3WKMH 5FPIA 1KENH 4AX3A 4UM9D 4HZLA 4NRZA 2YPLB 1NGQH 4PS8A 3FNKA 5L2KD 3HZKB 1PS3A 4IBTA 2X0UA 4G7SB 4UT9L 4R0LC 3CZSA 5INCA 2X4TA 1SFHA 2ESVB 2PW1A 1PCXA 4Z0XB 3D52A 5E23A 4QYOA 5BO0D 3KLHC 2GTQA 5EBGA 5GRZA 2YA2A 1E8XA 1RUKL 4NUJA 4AQ8A 3FQTB 1SFDA 2UWEA 5GSVB 2XBTA 3G5YA 4HIHB 3T4YA 4WI9A 1BAFH 1OP9A 2QSVA 3MODL 4QLRA 1UWGL 2AHIA 2BWDA 3KYNA 3OJVC 3F7YB 4RMSA 5KS9B 3KMDA 3D39B 3P3UA 1CWVA 1MAKA 1PKQB 5CP7B 3HUJF 5AKRA 3Q1SH 4FKKA 2F54E 4OCWL 4M61A 5E6ZA 4WK4B 5CHNA 4AJ0A 2XVKA 1CFSA 4PRDB 2E27H 2P52A 2ADFL 1ZA6A 3ZSTA 4AYBA 2WVVB 1IQHL 2W0KA 4MQ7A 4D0BA 1XMEB 1S7RA 4YHZL 2FHFA 5IMKB 1OT2A 4F8LA 4UTBH 5EUKB 3NACH 5KS9F 3PS6A 4IKJA 5BNXD 2YFOA 4KUZH 5EEZA 3BXNA 3GIZH 1AD0A 3UDWC 1Y0LA 5KVMC 4FXGB 1A8ZA 1XSJA 4PSPA 1MCQA 1MPAL 3PUUA 1JGEA 4J3VA 3I02B 1A3RL 3FW6A 4CA4A 4FG2A 4XPGH 3V65B 2Z34A 1JPEA 3VXMA 3N8ZA 1NFDB 3LIZL 4NN7B 4HX1A 3ZQXA 3B5TA 3V0VA 3MRMB 2G4GA 3C2SA 3SE9L 2ZAIA 2NPLX 3U2IA 3VM7A 4KO7A 1CN4A 1D7DA 4JFHE 1MWAL 4XMLH 3ELAL 5HJGA 1KCVL 1KWGA 3RDTC 2MH4A 1OF2A 4LSTL 1HREA 1LQBC 3GEWB 4F8TA 4M7LL 1RHHA 2NY1D 2WBJC 3C8HA 4I3GA 5ILTL 1RIVL 2GEQA 4WV1A 3ZUCA 2CU9A 1WWCA 2F5BL 2WZAA 3OKOB 4HCGA 2DQFB 1NC2A 2OMXB 2ED6A 3PHQA 1Z6JT 4YHMH 2P26A 2YRPA 2FAUA 1NCCL 3FFCE 3WO4C 1OD9A 5GZNA 4F2MB 1LXMA 5L88H 1RZGB 2IH1A 2XWTB 3CZJA 2G9KA 3MGOA 3EGSB 4WY7L 1TPXC 3OPUA 1A7RL 3QEQE 4WO4B 3X11A 2HN7A 1HCZA 5FDWA 1DVZA 1IC7H 4LU5H 4UB0H 3HG1A 1VEOA 4F20A 2J5WA 2AVGA 2JMRA 5I28A 5J56B 1NICA 4ZAKD 4TULL 4E0RA 2VOTA 5A2AA 3OB0K 2ADYA 5C6TL 4PV9B 2BSBA 1G7HB 1FO0L 2WFTA 2Q86A 3M1CA 4W9IC 3BIKA 3LEVL 2BVOB 1J1PL 2YJQA 3TCLB 4OVVA 3FT4B 1AACA 1U8CA 4F3FB 2BVTA 4I2XB 4N9GA 1L0QA 5KWYC 5KSUB 1F7MA 1R3JA 4QJ4B 4M5SA 5DS2A 3MCLH 2JNZA 1D5BB 4JZNB 4Y8DC 4JANA 4ERSH 4YLQT 4W9JC 5DQ9B 1T0MA 1IGML 3AWFA 4NFBA 3QZWA 5GPRA 4J6IA 2ZWSA 2GYSA 3HBZA 2AW2A 2XQBL 5A6MA 3BPSE 2VUKA 3IMWA 2EDDA 4J3OH 1CCFA 4XMKL 2F53B 1KCSL 5B22A 1FDLL 4N2GA 1L7IH 2HFFB 2FECL 4G7RB 3TC9A 4D94A 4G71B 2N01B 5B3JF 1ZV5A 1EGJL 2CLVB 4OFDA 3GZKA 3LRSB 1HYSC 1D5IH 4X6EB 5CLZA 4NDMB 3RGVD 2P94L 2GK0A 5F9OH 3RYMA 4WI0A 1VEPA 4IU3A 1NEZB 5AVVB 2OTWA 1F18A 3P3YA 1E2VA 1SMOA 1CD1A 1NM9A 4MKTA 5E2UL 2FO8A 4PN6A 5LBSH 1EPIA 1AGEA 3OSKA 3BP4A 2W2NE 4APXB 2GIXA 3TO2A 4AV5A 3U0TA 3QCTH 4U1KB 4Q7DA 1NGXB 2NY7H 1S9XA 4XCNB 4ZSOB 4J5VA 1OAKL 3SDYH 2CA4A 4N68A 3T2OA 2OK0L 2VDQH 1ZDQA 2HT3C 3QNXA 5AOJA 5CWSA 4UAHA 1EANA 1PNCA 1Q9KB 2NYKA 1FRGH 3ABGA 4JEGB 5HHXL 2EDWA 2CKBB 5EBMA 2J6EA 5D7JD 1Y6NR 3ZIYA 2C1PB 3L6FB 1V3JA 4EZLA 5AVQB 5IM7A 3TU6A 2EH8L 1BX2B 2ENPA 5TFSH 3JYCA 4ZUUB 3DETC 1SXBA 4MCYA 4ELMB 4DQAA 2DS4A 4ISIL 3RL1A 1F6AB 3DJSA 4K2UH 4NQCE 2VM4A 4JHZA 5BVJB 1W8EA 3IMRA 4OCXL 1CJYA 1FWXA 2D7QA 1EPJA 1S6NA 3LN4A 1R3HB 2X4OA 1FIGL 2YPVL 3CLFL 3F83A 2EVGA 1JUFA 5JZ7C 1KTBA 4F7CB 3P5BL 1ZTXH 2E9IA 3O6LL 4XMTA 4OZ4A 3WS6A 4QRPD 3FO9A 1S2EA 3LRMA 1DANT 3QUMH 4IBYA 4U1MA 1WPCA 4AZ8B 3S3JA 3ASWA 1A3LL 4KXCA 3HN5A 4NXKA 3UO8B 1CT8A 2GTWA 2VZTA 4TRPH 3IPEA 5C0AE 2PXYD 4TN9A 1WBXA 5FDYA 4YNYA 5IVOA 2QSCL 3QO1A 5KYWA 3LPWA 4AXWA 2EDBA 1IE5A 3ULSA 2NQCA 1DBKL 4QHUA 4JHVA 1F0RB 3P77B 1DFBL 2A74B 3BISA 4X6BB 2IO5A 3H7BB 3C9NA 4NPKA 5HVGB 1QHQA 2XJLA 1F4XL 5IB1A 2YZ1A 4HT1L 5A16B 3RVVC 1DBJH 3X1BA 4FYTA 4X5RA 4HC1L 3C6EA 1F1DA 1VSCA 3NJFA 1MJ8L 5A40E 3JZYA 3ATEA 2Y7ZB 1ODUA 2XKNB 2YWZA 1NDGA 2YMOA 3P1VA 2EI8B 4U6XB 1C1EL 5CM1A 1R3IL 4GYBA 5DR5H 3IM1A 5C0FB 5KAQG 1U8LA 5HJ3A 5EO9A 4AGOA 2YMXH 1S8DB 4YMPA 4R7VA 4P2OD 2FJGA 3WFCH 4DEUA 1UH4A 5KVDH 5C0CD 2I5YL 1TEYA 2VLKB 1CXFA 4XNYH 2LTQB 2XNAB 4LVNB 3X3FH 1YYLH 5IT2H 1UOKA 2NNCA 3ZMEA 3NJPC 3IMVA 4ZUVA 4CSZA 1JERA 4Y16A 3LB6C 5SX4H 4TNWF 4L4VB 3CZGA 3TH3T 1J05B 3SDCC 3V4VH 3BWUC 3LH2H 5HDLA 4Y2DC 1MUJB 2I24N 4L3CB 5T3ZH 1CLOL 3RVXD 4BA0A 4TLTA 3K6NA 5C3TA 2OJ1A 4Z7QB 1XF2B 4XP4L 1AJ7L 1U91B 2HTLC 1FGVL 2F7RA 3I84A 4PRAA 4JM4H 3UX9B 3WOVA 4NO5B 1SYSA 2NY0C 5FM5M 1WH0A 5F7YC 4E1GA 4YDKL 5JR1H 2NY3B 5K9JH 3LEVH 1B90A 2JCCF 2Z8WC 1FFNB 3K4AA 2B08A 3OAUH 4XZUB 4JUSA 4EVNA 4YPJA 1L9TA 4X7TB 3UYRL 3O3BA 2CK0L 4JBSA 4RBPH 1MNNA 4K9JA 5D7SH 5CZXD 2A38A 1BFVH 2XG5A 2FWSA 4B3VA 2JXMA 4EKXA 3HS0C 3HB3C 1WF5A 4OLXH 5D1QD 4F2EA 1QSED 3LPFA 4GT0A 4HV8A 2P48B 4OCRH 3TGXA 4LLWB 5HY9B 1ZWIB 2J57A 2OMUA 4BZ1A 4XBGB 2QFPA 2Q20A 5I73B 3RTQB 4QHPA 3FOLB 3KW7A 3ZN6A 5CUSL 2H6UA 4MFHA 4KX7A 4CVUA 4UNUA 2BMGA 4GBXB 1EAPA 3GRWH 3W2DH 4HWBA 4OD1H 2WD0A 1BM3H 3SY0A 2W07B 4E41E 3SGJC 4J4PA 1VGEL 4PB9H 4RFNB 5IW6B 3H53A 3K2KA 4PJIE 2WVSA 1ZLDA 1T66D 5FHAH 2ZUQC 1RH8A 4UV4L 1KYAA 5BPPA 1N59A 2ERJC 2WAHA 4A7GF 3MJ7B 4Z7WF 4R96B 3F7LA 5I74B 3HB3D 5D7IE 4QTIL 5DJ2B 5I6XB 5IW3A 1Q1PA 3UROR 1OAXL 5IMKA 1KB5A 2AEIT 2F7IA 1EO8H 5C0AA 4Z77B 3H0TA 2FLRT 4Y7OC 4L2LA 4BINA 1A5FL 4PS3A 5EO0A 3GTTA 5LWYL 3MBEA 5I8CB 2AQ3A 1ZTMA 2D4FA 5IKVA 2GJ6B 1MHEA 3NFSL 5M94B 3NIFE 3N2JA 1DSFH 2AQTA 4H2AA 4HA1A 4PVNA 4YDIH 5I1GH 3GIZL 1AE6L 3WI9A 3GD1C 2EIZA 4WW2B 2E8ZA 1MQ8A 3RBGA 1MCLA 3QR2A 3T8XB 4IU3B 2F7PA 4UTBL 2VDKL 4OTJA 1KXVA 3QUYB 1A21A 3NPZB 3SODB 3LNFA 3GYRA 3C2AL 4M8RA 4LLDB 2DBLH 3MZTA 5G4OA 1GYWA 3U7AA 4OZFB 5KG9A 3DI2B 5SWSA 5EZOH 2E27L 4WK2B 2FBJL 3HNVL 2CMRH 4YHIA 3PHSA 2NY3C 3A67L 4QO1B 5ANME 2YQGA 3KCGL 4PJ7A 2B2XH 1X9QA 3EF7A 2PPDA 4V11A 3O8XA 1HZKA 3ULUD 4AQAA 2B77A 2HRPH 4GP4B 2WN3A 3QQ4B 1UWGH 3UPCA 1P7QD 1CFQB 4IDJH 3TYGH 1WITA 5D1ZB 5IMMB 4K94H 2E7LC 4XHQA 1XIWD 5LXVA 1XH3A 3DX8A 3ARFC 5I75B 3T3MB 1KGUA 1X9UA 2MPAH 3PHAA 2GITA 3WIHH 5LGYA 2AF2A 4OZHB 2V2TB 3DK2A 1NJ9B 1QWHA 2TRHA 2N7SA 4N2LA 3PP4L 3QQDB 1UFUA 1RUAH 3O3UN 5T5NG 1H19A 4U1SA 1UZ6E 4EDWL 3RZCB 3WNJA 4JFUA 1PZ5B 1UJ3C 2EE0A 2NDFA 1FNGA 4BRJA 3D0AA 5T5FL 2OFQA 2PW2B 3LHPL 4PR5A 3RDTA 1WAAF 2VIRB 3NCXA 1OARL 3FULA 1XGYH 2W2ME 1BD2A 5E1GA 4JO2H 3ARGA 1N70A 3B7RL 2UY7B 1A7OH 1S5HA 1UCTA 1Z32X 1P5UB 4ODHL 3N40F 1DVQA 4I48B 1GZPA 5LDUA 1N18A 2V2XB 3P4NA 2ZAGA 3FRUA 5HYQB 5SWZA 3TM6A 5CSGA 3V4LA 4K71B 3KR3H 3VGAB 4QI3A 3K2IA 1JV5B 2OSLB 2APWA 2YQ3A 2DQIH 4Q9CA 3CVBA 3KPQA 3VFRA 5JW3H 3BPCB 1FFPA 2VQ4A 4XNQA 1GGCL 3S5LG 4ABQA 5DT1L 4HPOH 3MV8A 3QSKB 3AU0A 4AUYA 1HEZA 4AZ8A 4A66A 1JN6B 3TH2T 4ENZA 3H42L 5J3HC 3FFGL 5EBLA 2FTAA 4NQCB 4LLDA 2NTSP 1BWWA 1JPFA 2R1XB 1XR9A 4ZMYA 1I9JH 4P48A 3BN3B 3UADA 1LDPH 1CF1A 3N0PB 1WZKA 3HNTL 4OLEA 1IQGL 1THCA 4PEEA 3EZ8A 5HTSA 1Y1DA 4BZYA 5B4MC 4WWKC 3QQ4A 3G5XA 2BSEA 5KVGE 5KZCB 4D9QE 4P99A 1KCRH 4XB3A 3RWJA 4FG6D 3SDXF 5I71B 4E2OA 4UQCA 4PVLA 2HG0A 5EU6E 4EAEA 4O9HL 2Q5BA 3K7UA 5B1CA 3K72B 5CAYB 1QD0A 1RD6A 1MH5B 3INOA 3FQRA 1UD3A 5GSRB 5B21A 4MVBC 3MO1A 1XHHA 4F7MB 5I0DA 4JHWH 3PXLA 1G5AA 2WANA 2XBVL 1L6ZA 3HG3A 2E9BA 4UNVA 2BFGA 1EO7A 4JY4A 3SPVB 4G43A 1XEDA 3L3HA 3RIAF 5F7DB 1AXSB 3LN0A 5PAZA 3D3VD 3G6JB 3SDAD 3VI3A 1P7KA 4TNEA 1LP9E 1VHPA 2W9LA 3DTXA 4U6VH 3L08A 3VG9C 1VENA 1REIA 2ZX5A 5MP6L 4RMUA 2WBJB 5ABDE 1SN2A 2GJZA 1YMHA 5KTEH 2H26A 4YSOA 1GYVA 4Y9GA 4MA8L 3M7FB 1Q4GA 3LTGD 4R4BB 2D8KA 3ULAB 4KJPC 1QBML 2XIIA 4LIQH 3GJEB 4HS6A 2R69L 5FDQA 4KXZI 3WO4B 5IMOB 2J8HA 1ACXA 2F6AA 1CURA 4XCEB 3WGUB 4N2EA 2I9BA 3BPCA 2J7LA 4GIAA 1H0DA 3H9ZA 3BAYA 2EDKA 3VXUE 1PKOA 1NMAL 4HBCH 4IBLT 2MSPA 4F91B 4MA1C 4GBXA 5CINH 1DVSA 4QD2E 1ZT4A 3UTOA 1CYGA 4TOYH 2YEVB 3F65A 2WLJA 3RG1C 4GMTL 3QUXA 5KYXA 4G42A 2WQXA 4JW3A 3ZTJG 4GXVH 4JO4L 3WS6C 3D05A 3GXIA 1SBSL 3BIKB 4W6XB 4IRZL 1BAGA 4XP4H 3SCMD 4M43H 3B1UA 2H3NA 2O5ZH 4Y8AA 3PWUB 2F08A 2Q3ZA 3NIGF 4WWKB 3RGVC 4ZTPL 2R2CA 4FKEA 4P2CG 1DO6A 4LNRB 5I71C 1OSYA 4GKNB 5L2KA 3AAZA 4LP4A 1TZGL 4PJDF 5CR1A 2ODHA 1TKWA 2W8CA 3CG8A 5CSZA 4B9FA 1A6VL 2BS9A 4OT1H 4H20L 3W82A 1QZNA 4G70B 5DJ6B 3HPLB 3RU8L 3WNMA 1T7ZA 3D0VB 4UIMA 5E08H 3TCTA 1OAUH 3FONB 1ZIBA 1KELL 3GXPA 3V79C 3VXUB 2IG2L 1QKZL 4FEIA 2B1HL 4G6JL 5DO2C 1UOVA 3PGDA 4Z7UB 2XXFA 5DK3A 1WA1X 2DQTL 4ATTA 5AOZA 2HKFL 2Y82B 3V5KB 5DA4A 5JVZA 1LEIA 5CXPA 1D5BA 4JZNA 3KEHA 5ERWA 3K74B 1OTTD 5LUMA 1C1EH 3SYCA 1R3JB 2GHZA 3M17B 1ZHKB 4OZGA 1DJZA 1IGJA 2NY2D 5GGUB 4AKOA 2AJYL 1TZIB 1ATEA 4XPHL 5C0DA 4QKTA 1ZVSA 2L0DA 4HC1H 2X53A 3SGEI 2YGQA 2VR3A 4ZAKC 4PH8A 3KDPB 3OB0H 3WSQH 4POZD 5CCKL 2CKBA 4I89A 5EBMB 3HC2A 3LZOA 1RJYA 3ASNB 2N3JA 3T2NH 1XVSA 3BGAA 2IH3B 4CBPA 2P8PB 3TXAA 3T8XA 1DBKH 1BBDH 4KKBC 3IU4H 5E9NA 4XXCC 3ZHDA 1AR1D 4G7VL 1BZQK 1RQ5A 3BH8A 4MNQB 5J5EA 2VW7A 5ECJE 4EIZC 5EIIA 1OAQH 3QQDA 1NFWB 4HHAA 3VD1A 1IB5A 1FV1A 4H2CA 3F3HA 1KKEA 3BE1H 3M86A 4U1SB 4X9YA 3T1FB 4D9LL 1S46A 4FLSA 2X4PA 4RAUA 1WFNA 4K8RH 2W2OE 1HHGB 3OR7A 4H8WH 3FO0H 4JG1H 3TJEH 1HWGB 1LK3L 4PGCB 4PLOB 3MCKB 4EQ3A 3ALWA 4YHLL 3UGXA 3SYQA 1MQ6L 1B2WL 5IB5A 1OTUC 1DDXA 4ONFL 1VB9A 3DJ9A 4QDGA 4A7QA 1BZ8A 1FIGH 5D72H 4FQCL 1EBVA 1HQRB 2ADJA 4A94C 1FE8H 2AJUL 1CDYA 2EO7A 3EHBC 2WM0A 4XBMA 2DWYA 3B83A 4MCYB 1WHPA 4OZFH 1E30A 5IFHL 1BVKB 4P9HH 3AS0A 1RUQH 5AW6B 3KBEA 2H1XA 3ZYJA 3UAEA 3QPQD 3IXTB 3HMXH 2ADGA 3CK0L 4JKNA 3CDGB 1WGVA 5GS1C 2A74C 2BSED 3BAWA 4OKVA 2WQVA 3VD5A 5FUOH 4NQTA 1CXIA 2D7PA 1H15A 1OK0A 4M7KL 3V6OE 2BQ7A 5TQ2L 1BGXL 3IB4A 4KRLB 1NAMH 3AQZA 4YSPA 1DLFL 2WSPA 4HJTA 3VSUA 1EZQB 1UOLA 4OUUB 3V5KA 2XC0L 4NUMA 4XVTH 4GO9A 1I1FB 4QHMB 1H5BB 4GFXA 3O45A 4FQQA 1NCIA 4JFFB 2HAZA 3VJ6B 1VFUA 4DP9X 3FDWA 4Z6AT 2AV7B 1PYWB 2FYVA 1Y1UA 4FFVC 3ULUL 3N85L 4UDUA 3JWDH 4F7PA 3MX0A 3FCGA 5AOMA 2GSIA 2UX6A 4UAOB 4AXWB 1OL0A 2IXQB 4AQAB 3TBYA 1MLBA 2DB8A 3V0AC 3MACH 4XHJC 1WE5A 4R5VA 2EDOA 1E90A 1NPUA 2QGEA 3GMOA 4PJGA 2F19L 2EUXA 2FQEA 3B2VH 4ZMXA 4KMQA 5MEOA 2CHXA 2BSSB 1R19A 4XB7A 2WINA 4CGTA 3PDOA 1UHVA 3CFCL 1K5NA 5JHDE 3SOVA 4GEJA 3DSNB 5EEYA 1H3VA 3HKZA 1VADB 2ZOLB 4H1LG 5TE6L 3THMH 1YPZB 2SEBA 1N19A 2FH6A 4DZBA 4H8QA 4KY1H 1AS7A 2JXMB 3FXIC 4OM1H 3LQZB 2LAGB 4FABH 2GAZA 3QH3A 4LOUC 5JIDA 5C07A 5FYLD 3OBAA 4U31A 5IB5B 1LMJA 4Z18A 2MFNA 4H88H 3MOAH 5B4MD 2ISDA 4AV4A 2DICA 2OA9A 5T3ZD 3PXJA 1ORQB 4FG0A 1C9SA 1EPHA 1BYOA 2FX9L 2HG5A 4ABVA 2FWUA 3FT9A 1IC7L 4PRIE 1GS8A 2VXQH 4UILH 3TEYA 1IC4H 3GMRB 2HORA 2H1PL 3FO1B 5FHBH 1FZOA 1UJ3A 2J38B 3K8MA 3QYCA 4FQPA 1AQDA 4G7VH 1TEGA 4N6QA 5J06A 3KGUA 1FBIH 3GSOB 4IS6B 4OIAA 2G2RB 7PCYA 1S78C 3K91A 3LS5L 3UGUA 1JFQH 1EAPB 2VDML 2NR6C 3F7RA 1OD7A 2GJ6E 3ETBF 3IBEA 4XE5B 5C0GB 1WBXB 3RIKA 4I77L 3CENL 4WHDA 3DRQA 3S5LA 3OMZA 5EORL 1O9WA 3MUGA 4IK6A 2BNUB 5DHEA 3C5ZC 2QPFA 1BQSA 2J4WH 3AADB 3DHJA 4NO3A 4A6YL 3WJLA 4KJYA 4XOCA 4BTIA 4NUJB 4QRUB 2X89D 5DVOA 4LPCA 3ML9A 2EYTB 2QL1A 3KPNB 3NCCB 4WFFE 1KSRA 3FH8A 43C9A 1Q8MA 1BD2D 4N0FA 4UT7H 2XKNA 3RZWA 1NDGB 4BSJA 5EU5A 3G6JF 1WC7B 1AR2A 1XCWA 4ZUTA 3TO4C 3TEXA 1MCWW 1OAUL 3FTZA 2PYFA 1P4LA 2H1PH 4PSRA 2ZOOA 5C6WH 3UTTD 4G82A 4FL4B 1Q1JH 3U9WA 3QHFL 5K93A 5IBUG 2WINB 5IOKA 4QRTB 4PW4A 3BZFB 1K5WA 4LSSL 1MG2C 1HIML 4YX2L 1AQMA 1DBMH 3QEQA 4PTUA 4WWKA 2HUHA 5I5RA 4OLYH 2BVPA 1FAIL 3L3HB 3MJ8A 2J6WA 4R96A 4JFDB 5KVFE 3TNMA 2H3KA 4BIKA 3FFCA 1GW0A 4AL8C 3U46A 4KX9A 1AD0B 1SBBA 1IZJA 5GHWL 4K8RC 1QATA 3UCQA 4O1ZA 2OP4L 3P54A 4PJ9A 4PGJA 1I7RA 1KYOJ 4BWUA 4J1UB 4F7EA 5F8RC 2MRYA 3PWNB 1RVFL 1DQQA 1N1IA 2YAFA 3S2CA 4MASA 5C71A 4NOFA 1MREH 5D1ZC 3TV8A 3CC5A 3C5JB 4LHUB 5HSFA 3O6FC 4RH4A 1MHCB 2XX0A 5F9AC 4PGZA 3GXDA 5CJOH 4XCEA 5D6CB 5DHVA 3DROB 2UY7A 5J13B 4GG6E 3ARSA 2WZPA 2YXVA 2AKRB 4FLHA 4TNGA 4AH2A 2YRLA 4MQSB 5GGVY 3SE6A 1AXTL 4GQRA 4P3WA 4XI5C 2BFVH 2EXTA 1BGXH 1CDBA 3SB3A 3B2UC 3NA4A 2G30A 3E8VA 2XC8A 3RZCA 2OJZH 1IJQA 3QNZA 3SJVA 2NR6D 2FYYB 5D4JA 3ZDZB 1JGLL 3FSWA 4KROC 4PBWD 3V8OA 1HJBC 5AG8A 3UBXA 2O5XL 2DM7A 4NT6B 3HLAB 1X7SA 1BQHA 5MI0B 4W1TA 3MBWA 3L2MA 3N8WB 4FFTA 4PVMA 4WI5A 4K3GA 4Z7NE 1DP0A 2IADA 5I8OL 4PLJC 1P4IL 3MJ9H 1D5MA 4PJHB 5ADOH 2FZZL 2VT0A 3H85A 5FUOL 5AZUA 4DP1X 5HHME 2WNGA 5SWZB 2OMWA 4MNQE 2X2IA 5HHMD 5EUOF 1T6VN 4MNGE 4JHWL 2K8MA 5D7JB 3VI3F 1KN4L 3I9PA 3KJ4B 1IGYB 1CICC 4EN3A 4NZFA 3RFZB 2ZF8A 2RA0L 3P2BA 4AGNA 5F1NB 4L23A 2E6PA 4ZO7A 4JHUA 5DFTA 3RY6A 2QVFB 4KK5D 1FNSL 1TQBB 2J8OA 2P5WA 3LEXB 3QI9A 4IQHA 4FKHA 1U3HB 3QDMD 5KSVA 4EE2A 3FOMA 5KJ4A 1SEBA 1TJXA 1KLUB 2X3BA 1V54B 3T0ED 2QGCA 3QZWB 5DWUL 3UTSB 1ED3B 3JWOH 1V1HA 3L95B 2I7OA 4Y71B 1BG1A 2WP3O 4MWFA 3ESPA 1C12B 2PCFA 3BKYH 1M05A 3QDHA 4NHUA 1N4XL 1EHLH 4XXDB 4QRPB 1XZWA 2P5EA 4GW1A 5GRVL 3WHXB 2VABB 4WTXA 4Y19A 1NCDH 2CO2A 3U6RA 2D9CA 4PG9B 5FO7B 1T89C 1MFMA 3MUHL 3JTTA 3VTMA 5E5RB 3M36L 1DQDH 4PCYA 2VDOL 3GPEA 4PHZA 1Z5YD 5EU7C 3V10A 2Z4QB 1AGBB 2QGBA 1A7NL 3BLKA 5DUMH 4XXWC 2EVFA 1O0VA 5F1IA 5IHBA 4FA7B 1OEZW 3H3PH 3ZZQA 2XPGA 3VDAA 1AY1L 4U6YB 5CLXA 3NJGA 4HPYL 3LTVA 5AEAA 4OCSH 2AV1A 1HYRC 1U93A 4PBDA 1RULL 2Z31C 1GYCA 3BP6B 5LLIC 2DEXX 1ERNA 5CFAA 2I9LB 1QLEB 2V17H 3ECBA 4ODBD 1WBYB 2IH8A 4V1DE 1Z66A 3VX1A 1A6VH 4OT1L 3VRJA 3KBPA 5ANMB 4YH6A 3FBYA 3T4AA 1KJVB 4FXKB 3NK4A 2AXFA 3GUTB 2XI9A 4CU6A 5IQOA 3A6OA 4BYHA 1AG6A 2P93L 4DAGH 1TIUA 4FJZA 4ABUA 2IADB 4I13B 4PJ5A 5FC9A 4EDWH 1RIUH 1F3JA 4NZTL 4ZX3A 1MQKL 3RU8H 2IAMA 4NN5B 5E08L 4L37A 3QORD 1ZAGA 3IXTA 4J8QA 3LNEA 4HIEB 4KTDL 4U3XA 4HMEA 1INDL 4JQIA 1SNRA 1QBAA 2UXVA 2VSMB 3OV6A 3CBJB 1Z1WA 3BXNB 3T0VA 1EHXA 1YSOA 3ARYA 4NP9A 3VMOA 1IZKA 4DKEL 3A3YB 2YPLA 4CC0A 1R5IB 1MDTA 2X4RB 3GSUA 3V5HB 1H9DA 2I9AA 2DIAA 4GMTH 4KK6C 3AWEA 5F1OB 5J57B 3B9KC 2R69H 4GRWE 2AS5M 1HYSD 5GS1A 3KYMA 1MOXC 2AJ3A 2Y36H 5D7EA 3L4ZA 4MMYA 1L5GA 5DJ8A 3RIAK 5TDNB 4XX1E 4E41B 4Z3IA 3V0FA 1T2JA 5ICYA 3P40A 4AL8H 4L8CB 1EERB 3QJXA 1ROWA 3H6JA 5F1SA 5FIEA 1OF2B 5B39G 3NEEA 4R4NC 3HS6A 1H6EA 1DSFL 2XTJD 3VFTA 4YX2H 5DF0A 3QB7C 4NKOB 3SGJA 3FTWA 5JB9E 5EPMA 1QABA 3RKDD 3FQWA 1QVOB 1A9EA 2D7MA 1A6UH 3QEQB 3K5RA 1RAMA 4N0UE 4Y9FA 3TK6B 3SGDH 3PWVB 1JBUL 2DLIA 2OL3H 4FQ1H 2Z31B 5FYLE 2ED9A 1TFHA 4JZJC 3D4YA 3QCVL 5KJRH 4HSCX 5C0DB 2HVKB 4KJWC 5IR1A 2ZYRA 4Q4EA 3ET9F 4M5ZH 3CXHJ 3LQAC 5FHAL 4F8OA 2ZICA 4QGTA 1YEJH 2EUVA 5J11C 4XAKE 2VDRB 4GU4A 1NAMA 3GKWH 2WKOA 4PGCA 3D85D 4WO4D 2NCEA 1KOAA 4Z7UA 4NWTH 5ISZD 1M71B 3HJEA 1A4BA 1F8TH 4HLZG 2VDPH 3BKML 3AG4B 3U0PB 2UY6A 4ADGA 4BK4A 1TVBB 3SCMC 1LO0L 5HDBF 1FZKB 3T77B 3TIEB 3EGSA 4RRPA 2P16L 4A2GA 3SCMA 4P3CH 5B1KA 5E6ID 5IHHA 4J3OF 3B6SA 5EC2A 2ZQKA 2DLEA 3GMLB 2DQFA 4A7VA 2WXLA 4JL2A 4AVIA 1WFJA 5C0BE 3OAUL 4KDTA 1E5UI 5I0VA 4BQ9A 3FUIA 5F0MB 2XZAH 3D2TA 1EK3A 2R0ZH 2NXYD 4OZIA 1MNUL 4FNSA 1HI6A 3HFML 1CFTA 3QORC 1ZSHA 3IU3B 4HUXA 2AQPA 3ULVD 1H6UA 4PRHE 3TCLA 1G9NL 4PYHA 3DX4A 1T3FA 1JYNA 2ZJSH 5FFLA 2B5IC 1GC1L 2W88A 4JRFA 1UM4L 3JWOC 3O6KH 1TO4A 4AYGA 1THAA 1UD4A 2VM9A 3SPHA 4PD4K 1K4DB 3BEVA 1SEQH 1JWSB 2MKWA 3F85A 5AOKA 1ZSDB 3KXFD 2Y72A 4YDMA 2W9EH 3LHPH 2NZ9C 1JDCA 3KL6B 3MTRA 5HHPB 1OXYA 2N7AA 5DHYB 4NSKB 4EPSA 5E9DA 1T2QL 1RZKL 4Z7UF 2FHBA 2YSSB 3T3PF 2G75A 2ZUXA 4OCSL 4IBZA 5I1DB 2HJLB 2HPTA 4H26B 4HPYH 3PF2A 4OUUA 4JREB 2MGRA 1XGYL 2K4AA 4GRWH 3NIGB 4GRLB 4KX8A 4F80A 4L29B 1RZJL 2HKAA 2Q8BL 4Q97A 2ZKYA 2BK8A 2PABA 3RL1B 4K94L 3J7HA 3V95A 5HHNA 1J8KA 1F4WH 1YQVH 2VDOH 3UJIL 2E46A 4NIKB 3WFHA 3P11H 5F88A 2GSIB 1HT5A 1IEAA 2EIMB 4OU3A 1UXMA 2AQQA 2ZP0T 5E8EB 5GGTL 2IWGA 4KC3B 5F7KC 4W93A 2Z0BA 3WIHL 3KWWA 5CD3B 1DFBH 2AI0H 3S5YA 2UWOB 4OQ1A 3UO1H 2NW3A 2FR4B 3F5WA 4Y5YC 3TT1H 5CEZH 4KWUA 2C4FT 1NA8A 4G6ML 5I17A 5DK0A 4M00A 2N1TE 2VLJB 5LG6A 2F68X 2BP8A 3QP3A 4PBXA 4XNMA 5ID0A 4QR7A 4UUJB 1AGEB 4LP5A 1FLRH 5COXA 1UH2A 5DEGA 3I85A 3AXLA 3INUL 3ILEA 4WF7A 3MV8D 4ZSOE 1J9QA 3CH8A 3LCYA 2N59A 3OQ3B 1TCRA 3FQXB 2X87A 1FV1B 4Y9BA 3U25A 4U1GC 3MMEA 3L9YA 1XWVA 3Q6FA 5JVYA 4G2AA 4NM8L 5DK2B 3K81A 5D72L 2NUPB 3F6UL 1IGTA 4AQOA 3NFNA 1AAJA 2E76C 2IANB 4QF1A 4X7CC 4XCFH 4R7XA 1HQ4A 1UXWB 2FR4A 3ZTNL 3RAJL 4ZUUA 5I8OH 2I9TB 3NCWA 5C0FA 4ZTOH 3AY4A 3FAXA 4UMSA 5FGBA 4GXUN 3FSAA 1G9MC 4F92B 2FSDA 5LO7A 3ES6B 3SDXE 3UZEC 4D7PA 5IB3A 3RWCA 1INEH 1BQUA 1QWUA 1N5AB 2VDLB 4AQ1B 1PXXA 4J28A 2R4SH 5E9DB 1HVXA 3GO1H 1TTFA 1A47A 3AUVA 2HB0A 1YEGH 4X99A 3GSUB 5E1AB 3TWYA 3CLEH 2FATL 5TE4H 3QCTL 4UTCA 2GBUA 2KL6A 4XWOC 5BCAA 2WZPP 3MGAA 4E0RB 1U4EA 2V37A 5LBSL 5A3ID 3TT3H 4Z7QE 5DUBA 3FT3B 1JPGB 5FDWB 4PS4H 1JZFA 4HWBL 3GMRA 5E8EA 3QA3A 1E27A 2Q2EB 2J73A 1D6VL 1CBVH 5F88B 1HINH 1BVNT 4NKDB 4YHNB 3SQOL 2NLJB 5TF1L 1IL1B 3CMGA 3FRPG 3QCWA 4NENB 2A9DA 4G5ZL 4AG4H 2IV9A 2UYLB 1KJMA 4ANUA 3RY6C 4FL4C 5IB2B 2ODIA 4GSDH 4OCLC 3CCHB 1RP9A 4L18A 3IVKB 1A6ZB 3SE8H 3BP5A 3IXAA 4F57H 4Y7BB 3OPZL 4LSVH 2QV4A 2YUZA 3C6LC 3OZLA 4YXHL 1Y6KR 3CC5B 4LHUA 5DUPL 3FO2B 4XVJH 3ZRFC 4RISH 2WCSA 4L1TA 3QNYA 5HGDA 3VWJB 5IUSA 1XBRA 5EUOA 1MCSA 1AJ7H 2WXPA 3DHUA 5FA3B 1WWBX 5IT2L 4ZTPH 1T80A 1ZANH 4P5MB 4JY6B 2QZQA 1FLTX 2DQDL 2Q1EA 2HLAA 3QNXB 5GJTL 5CF3A 1GZQA 4URKA 3WBDA 5FEBA 2EZ0C 4GI6A 4HUNB 4O51B 2Q87A 3N9GH 5CZRA 3ULVE 5FYKU 2X4SA 5EUKA 4F7KA 1ZT7B 1NLDL 1LMKA 3AGVA 1OY3B 3ABMB 3IMBA 3FO9B 3ERXA 3KPSE 3V6FA 3VGHA 4DN4L 4DVBA 3EH5B 3O45B 2VISB 4OM0L 2APBA 2OW6A 4WFGE 1EAOA 3DETD 3WNNA 1NCOA 1MHHA 3DPDA 3RPIB 3SJVB 4JL1A 3VD3A 2F5BH 3F12B 1AC6A 4XX1G 2BX5A 5DR5L 2HFFA 5IFAH 1YEGL