2YGOA

Wif domain-egf-like domain 1 of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
180
structure length
174
Chain Sequence
TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords WNT INHIBITORY FACTOR 1
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygoA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygoA01
2GD4A 2VH6B 1NFWB 5COXA 1ATAA 1IGZA 4NA9L 3V64C 3N8WB 4RRXA 1U67A 4ISIL 2K2TA 2Y5FL 1EAIC 3LN0A 1APQA 4BDXA 1L3YA 4PH9A 2OYEP 3N8ZA 5KIRA 1JL9A 1KIGL 3FCSB 2RA0L 5CKNA 1Z6EL 4ISHL 1SZBA 4Y6DB 1CVUA 1J9CL 2W2QE 1IP0A 2PHBB 5FDQA 1HAEA 2XC0L 1B9WA 2P94L 2XBYL 2WPLE 4X8TL 4Y7BB 3LC5B 1IQNL 1ZAQA 5JBCE 2BOKL 3DEMA 1AUTL 4Y79B 2WFTA 2D3JA 1N1IA 2WYGB 1F7EA 3N8XA 2RHPA 4D0FA 3FBYA 1HT5A 1EPIA 3Q7DA 3NTGA 4A7IA 3RR3A 4XLWA 2TGFA 1O5DL 3Q3KB 4YZUB 1PRHA 1PFXL 1JBUL 1HT8A 1HRFA 2XC5L 4X8UL 1CQEA 1TPGA 3H5CB 3TH3L 2WFXB 4JYVL 3PGHA 2P26A 1K36A 1COUA 1IQIL 2UWLB 1G2LB 2M74A 2Y5GL 1PGEA 3N8WA 1BF9A 3HO3A 2EI8B 4ZXXL 1F0SB 1RFNB 3IJEB 1FE2A 3V65B 5F19A 2WPHE 5JVYA 5JBAE 2XBWL 3CENL 5JW1A 1G1QA 2CJIB 1WU1B 2W86A 2VWNL 1EQHA 1DVAL 6COXA 4BDWA 4M10A 1KSNB 1NFUB 3HS5A 1XKBA 3N8YA 2J34B 1IOXA 2Q1JB 3NJPC 1KLOA 1IQEL 2WPJE 2W26B 1FAKL 2AYLA 3LC3B 3LIWB 3KQCL 4Z0LA 2BO2A 2WPIE 4BTUA 1HZ8A 3U7UG 2VVUL 3TBDA 1FSBA 1IQJL 3QH0A 3BT2A 2Y7XB 3ASIA 3ZYIB 1IQHL 2VWMK 1IQLL 2BOUA 4Z0KB 3FFGL 4D0EA 3KQDL 1EPJA 2J95B 1JV2B 1MOXC 3ZYJB 2WPKE 3P5BL 1FF7A 4MMYB 1ADXA 1C5MF 2VJ3A 4Y76B 2VWLL 2W2ME 2JKHL 1LPZA 1M1XB 3TGFA 1NFYB 2BQWA 2W3IB 2W2NE 1NT0A 4E1GA 1FAXL 3KCGL 3OLUA 2WYJB 1TLEA 1K37A 3KRKA 1NPEB 4C16A 4BXWA 1EMOA 3HO4A 1A3PA 2FD6A 2BOHA 3SOBB 4ZH8B 1CX2A 1TOZA 1PXXA 2BQ7A 1CEJA 3BPSE 3HS6A 5IKVA 3R05A 3U73A 1LQDA 4ZAEB 4Z6AL 4LORA 3KQEL 2MGRA 2G00L 2J2UB 3CFWA 2WG4B 1L5GB 1DQBA 5L30L 1UZKA 1IQGL 2KB9A 2PUQL 3HO5A 4G1MB 1CCFA 4BXSA 2WPME 2I9BA 2XBXL 1FFMA 1W7XL 2P3FN 1FJSL 2EI7B 2VVVL 1IQKL 1QFKL 2Y82B 1G1TA 3TK5B 1CCVA 1Z6CA 2W3KB 3CS7L 5CKQA 3MDLA 3HS7A 3BT1A 1UZPA 4O1ZA 1GK5A 2Y7ZB 2MGPA 1PTHA 1KLJL 2D1JB 2W2PE 2VH0B 4Y71B 2KL7A 2MHPA 1IVOC 2VVCK 2WG3C 1NZIA 3LTFB 1DX5I 4LMFA 1YGCL 2NPRA 3N8VA 2B7DL 2J4IB 2P93L 3SOVA 1W8BL 1F7MA 4CUDA 2XC4L 3EGFA 1HCGB 3MQEA 1DDXA 1LMJA 2PR3B 1XDTR 3KK6A 2P28B 2Y81B 4RRYA 1P0SL 4JZFL 4YT7L 1P9JA 1IQML 1ATDA 3F1SB 5E8DA 1LPGA 1IQFL 3TZIA 3F6UL 4CSYA 2F9BL 5JB8E 2VWOL 1OB1C 2FLGA 4CUFA 2BMGA 4AQTA 1I0UA 4BTTA 1MQ6L 3ENSA 3GISX 5F1AA 1ATBA 3SOQA 1EPGA 1EGFA 3NTBA 4XL1A 4JZEL 4JZDL 4ZXYL 4D90A 5L2YL 2DDUA 4JYUL 4MMZB 5IKTA 2H9EL 2UWPB 5IKRA 4FM5A 3GCWE 3QCWA 4RRWA 3TK6B 5CISA 1G1SA 1IOEL 2P16L 3LTGD 4BTIA 1WHFA 3POYA 4OTYA 5K0HB 1URKA 2ADXA 1X7AL 5I46L 3OLTA 4NGAL 3SW2A 3N8YB 1HJ7A 1U8CB 3GCXE 3M36L 4M11A 1CVWL 1ATEA 4Y7AB 1Q4GA 3ELAL 2Y5HL 5IKQA 1EBVA 2YGQA 2BOXA 2YGNA 2RNLA 5EGMB 3LN1A 5JVZA 1APOA 3KQBL 1NQLB 2FZZL 4CUEA 1UZQA 4O02B 3CA7A 1IGXA 2P3UA 5CKMA 2I9AA 4ZHAB 1NFXB 3C9AC 4YT6L 1XKAL 1DIYA 3M37L 1IJQA 1HREA 1EZQB 2OYUP 2BQ6A 4X8VL 2FLBL 4TGFA 1F0RB 1UZJA 3KL6B 1HAFA 1EQGA 1YUGA 3QMOA 2J38B 2YGPA 3ZYGA 4RUTA 2J94B 4OTJA 1MQ5L 1XFEA 4RS0A 1EMNA 1YUKB 4NG9L 3NT1A 2XBVL 1N7DA 2P95L 2YGOA 4MMXB 2Y80B 4RRZA 1HX2A 4X8SL 2UWOB 5JBBE 1YUFA 5KN5C 1G1RA 1G2MB 1KLIL 2KV4A 2P3TA 2Y38A 3IITB 5JB9E 3K9XA 1LPKA 5L2ZL 3LAQA 2FLRL 1V3XB 2P3FL 1WHEA 3HPTA 1EPHA 2BZ6L 2W2OE 4COXA 2EI6B 1YO8A 2K2SB 4XBMA
chains in the Genus database with same CATH superfamily
2G4GA 3MNVA 3PDDA 4J7RA 3HR5B 1U3JA 4KC3B 4IU3B 1IC0A 1E6OL 2VL4A 5A7EA 4URKA 2X4TA 4P2RB 2QGEA 4GKZB 1IGZA 1LE5A 4UINL 1E9QA 3OAYK 1U67A 2YXFA 4G2AA 1QPXA 5E4EC 3SCMD 2HFTA 5ACZA 5BVPL 3W11D 4NXKA 4YSCA 4LHUD 4U33A 1I8MB 3FUNA 1MRDH 3SQOH 1A7PH 3FO1B 4PJAA 2JLLA 2X4UA 3CH8A 5GZOA 4MNQB 4NNPH 1MFEL 4HIJB 2EUXA 4RISH 4AQ8A 2NY6B 1TJMA 3Q05A 4QRRE 1F8TL 1WYJA 2NX5A 3CFJA 3PWLA 2X4NB 3HZKA 2K6WA 5HI5C 3WIFA 2HT3C 4PP2A 1CT8B 1TQSA 4FN0A 1GMIA 4P4RA 3OR7B 2R0WL 3D3VD 5FDQA 3KWWB 4FLSA 4QHMA 4OZFG 2VW4A 3IXTB 1KYOK 4RZCB 1YEDB 1DE4B 1BQHA 3SDAC 1G7HB 1MHCA 1QI5A 4BSVB 2GQHA 3MV8A 3QWOA 4KH9A 4WU7A 5AQ0A 5GJTH 5DZJA 4APXB 1WUNT 5LGKA 4NZFA 2EDXA 4G59C 2V17H 2ZD0A 2UY6B 3WLBA 1F3RB 4BFGA 4GI9A 2WXLA 1DQQB 1JV5A 2XN9B 3IB4A 4MCMA 5FO2A 1DJIA 1RUAH 2NSMA 5GGUA 5ADOH 3LKPB 4ZPTA 1FL3B 1HT5A 4B5ZA 4U0RC 1F4AA 1AG0A 1A9EB 5KBKA 2BCMA 2R9HD 2FEDD 4LU5L 2ENQA 1LEKA 3X3GL 1BMWA 2TSBA 4Z76B 1P7BA 3HRZB 3Q3KB 5DD6A 3WFHA 2V5YA 2ZOTA 3FN3A 1A5FH 3LCYA 5C0AD 2XC5L 3NN8A 3QEHB 1SVCP 3RY4A 3F5WA 4YSAA 1XF3B 1ZVSB 3IGAA 1MF2L 2YN5A 3T8VA 4YSSA 3VD4A 4KVCL 1YO4A 3HAEG 4JHWL 2IWKA 3QB7C 4QIRA 1NCNA 1R3HB 1A65A 1TZOA 1Z1WA 5DJXB 2BOBA 2HJLA 5J7CC 1HCYA 1NCDL 2X42A 1N5YL 1C8QA 5AFAA 1QABA 2E6QA 2VGLM 4G7YH 1HHGB 3T1FA 4PVNA 1EXUB 2BIHA 5JBAE 4X6FA 3MMEA 4EDXB 4LDOB 4FQHA 4NC1C 3HB3D 1M3IA 5ANHA 3L9RB 2F5AL 1ET7A 3EHBC 3BD4A 2W86A 2MSPA 5D6CB 1JPST 3CN4A 3A67L 2GTZB 1AKJD 2IBGA 1QSFB 4X9IA 5CN1A 1NAMA 1YUHB 1J88A 2PCXA 1NDGB 4PJXA 3VFVB 3WJJC 4B95C 5LWYH 2OSLB 3I6SA 3S98A 4HPYH 3MRQB 4UBDD 1PNCA 1NFUB 2W0LA 1MDAA 1XKBA 4F57L 3QI9A 4GSUA 4JDVB 5IFJA 2J34B 4LAQL 1Z3RA 1PZCA 4XNUH 2DTMH 5DJ0A 5E6YA 4OJCA 1WEJH 3NIFE 5SV4A 3O8XC 5ILTH 1JI1A 3U7YL 3DPBA 2DI8A 2W07A 2N7BA 3QRGL 2R0LL 1I8KB 5I28A 2WPJE 3U7AA 4TSBL 3RVUD 4CBPA 1H8SA 1C5DB 3DRQA 3HMXH 1ZIBA 4L3EA 4MB1A 1UB5A 4G71B 2EIZA 4JANA 4JFVA 1A6AB 3VXTA 2OK0H 1UOWA 3QAZC 4RMSA 4GB9A 1KCBA 2GFBB 1ASOA 1ESOA 1YQVL 4KUCF 2XXMB 4DKFL 2L3BA 3VI4E 1DQDL 1KJ2L 3AQDA 5GSRB 3NACL 1VGEL 5L4FA 1R3JA 4LFHG 4BXVA 1X5FA 5MERA 2AEIT 3ULVD 5IKCA 1FLRH 4LZKA 1DBAH 2E7HA 3BCFA 2DQJH 4ZO9A 2CAKA 1QSED 3BZ4A 4MMYB 4QXGH 1ADXA 2IH3B 4XMTA 4LPCA 5DJAA 1P6WA 5A3IC 1QFWL 1NCAL 4NQTA 2QADB 4J2QA 3ULUF 4C8XA 1LP9E 2ED7A 4M4PA 3VXME 4HVBA 1ZY9A 2X3AA 3MV7E 5DQJB 5KJRH 2VITA 1NFYB 2Y1AA 4PS3A 1UB6A 3N0PB 4YHMH 4AM0Q 5JHDB 2GITA 2QHRH 4IMKA 1F6AB 2LT9A 3BEVB 2IADB 1BAWA 4LP4A 1KYAA 2C8NA 4XMXA 1S9WA 4RFNC 3R18A 4WCYL 5IBUB 3HE6A 3Q7JA 3NFSH 4PJDA 4N8CH 3CX2A 1CE6A 3NCXA 5FOBB 1THAA 4YUEL 2F61A 1MJ7L 3RBGA 4ODXB 4J1UB 4ADGA 4P0DA 1U41A 1NDMA 4BZYA 1RULL 4H20H 3DA0A 2ZSVA 3WTUA 3BPOB 4CC0A 5EZIL 5EN2A 2WXIA 1U3HD 1AI1H 3K4AA 5SX4H 1GYUA 4AXWA 3V7AG 5HTSA 4XWGH 2C9VA 2GABA 1A9BB 3DPDA 2ENJA 2BVYA 4K3JH 4M7JL 2WTRA 2FH6A 2ZOOA 4ICXA 1G7JA 4NGHL 1B0RB 2PWEA 1KTRL 3H53A 1BLIA 3TBBA 5F9WB 3RX7A 4DP4X 1HYRC 3T6QC 4OZIB 1P7KB 2BX5A 1WFUA 4AI7A 5LXGH 3BRFA 5ITFA 3DJTA 1KJMA 4MDJA 2I9BA 1J5CA 1OANA 3V9CA 2DIAA 5I1EH 1U6AL 3SBWC 5CP3H 5LG1A 1W0WB 2IALB 2AZUA 4YK4C 2DD8H 2YMOA 2Y82B 5DEJA 1CCVA 2Z8WC 1U30A 2VDKB 3Q8FA 4QTHB 2N01B 4OV5A 1XH0A 3DIFA 4JHBA 3H9SA 1P0SE 1Y6MR 3LZPA 1A7BA 4FI7A 2X1WL 4JPKL 2Y7ZB 5KBPA 1XD1A 2GC4C 1SRDA 1G9NC 3QQXA 3VFSA 1JPTH 2OQJA 4NRZA 4P23D 5DRXB 2W2PE 4YHYC 4HU2A 4M29A 2R56L 5D1ZD 1RL1A 4X80H 3R4DA 4OB5H 4N6RA 1IAOA 5I8KL 2C3VB 1H6UA 1GCYA 3T3MF 3QJFA 4HMEA 4G6AC 3UG5A 4RESB 1RJLA 2D7TH 4HF5H 3O6FD 1BMZA 1CU4L 4BH8A 3LTFB 4KK6D 3BH9A 4PLJC 1YGCL 2UY7A 4O00A 4RWYL 1Q9OB 2YPVH 5F7EL 3VFRB 5FYLD 3HG0A 4M5TA 2VAAB 2CA3A 3NZ8B 2V9RA 5JW4N 2OTUB 1C12A 1SBSL 4W9DC 4MJ5B 3RWEB 5B39B 1QKZL 2P1YA 2A6DA 3FB8B 3NIDF 5C86A 1RIHH 3UCQA 3RZCB 2ZUWA 3D25A 4KMTH 4OFYD 1W72B 1CN4A 1KJVA 3EGFA 1V7ML 3MQEA 4KKAC 4XP5L 5CIPH 4UTBA 2OSXA 1PSKH 3HNTL 3EYFA 2ZICA 3QQ9C 3NJFA 1FBIH 4JM2D 3IEAA 2FQEA 4PRBB 2DKSA 3CNKA 2N1KA 1HJBC 5IJKC 2ZIDA 3P02A 3TOPA 2WQUA 4XMPL 1E3XA 1EDQA 4G8GA 2D9CA 2ZWSA 2CK2A 2B7DT 3WIAA 3BWUC 5DUBA 3S37H 5A16A 3UABA 2FZ3A 1A1MB 1GC1H 2C9AA 5HVHB 2EDBA 4XT1C 5EBWA 3PAVA 5TF1L 1RFDL 3GEWB 4AVJA 4AIXA 1NWPA 5KVDH 1C08A 1BX2B 4MDIB 3TT3L 3QWNA 4UILL 2V5MA 1Z7JA 5E1AA 1P7HL 1SY6A 2R4SH 3FQTB 2Y2WA 4JG1H 4LIQH 3VJ6B 5CJXC 3WNIA 2EDTA 4LKCB 3VA6A 1TCRB 1PZ2A 4PP1C 1RIVH 1KC5H 2FLGA 2YAEA 3KPQA 2DBJA 5I8OL 4AQTA 4H8VA 4DCQB 5FA3B 5C71A 1A3RL 4K8RL 4WGWB 5D1XE 3GJEB 4DN3H 1O6SB 1EMTL 3OKLA 1SLVA 4N90E 2F53A 1IV8A 4ZXYL 3JWOL 3UH8A 3D85B 3KS0H 3N91A 5BZDB 3X1EA 1L9PA 2WUBH 1RV6X 1NBCA 3U79A 4FM5A 2R1YB 1MDTA 4LLUA 5JIHA 4GRLC 4K0OA 4BRVA 5B3JF 1INQA 3GMOB 3CCHB 3ZTCC 2YC1B 3IMTA 4HWZA 5DMKA 1AR1D 4G6JL 3SKJH 1QQDB 2XPYA 4ZTOL 5MEQB 4NO2B 2MOGA 1DQLH 4JGNA 5ECGA 3ZX1A 1VIWA 4X8JB 5E7FA 1OF2A 3KPPA 2VOTA 1AYRA 2WXGA 1BD2B 3FFCE 1BM3L 4BBWA 5E8DL 4HX1B 3CWGA 4DN4L 5IKQA 5HPMB 4O51A 5TGBB 4H1LH 5BQ7B 5A2CA 1JD7A 4NZUL 5DZ9A 2JI2A 2R0ZL 3QUMA 4PJ7B 5KYWB 5E8EA 2K8QA 4ZDHB 1BQUA 4NQDD 5AAMC 3WELA 1WT5C 3KW7A 1UWGL 3LV3A 3V4PB 5I0XA 1TYEB 3MSPA 1J86A 3TJEH 5HYJE 1MCOH 3M1CA 4I87A 3BAKA 4XX5A 1RP8A 2P3UA 1XGYL 2I9AA 5LO7A 4B9CA 1B6UA 4NPYB 4AUJA 3FNKA 4JFFE 2EVGA 5DWUL 3L8QA 2KPNA 1MY5A 1NL0L 2XY2A 4JREB 4APQA 4PJEF 5HGDA 3MLYL 2DICA 3BJLA 3CVCA 1SJMA 2OFQA 4TQPA 4XO9A 3QQ4B 5I6XC 3S2AA 1L4IA 3CVHH 2A83A 7FABL 1BMGA 4PJ5E 2P24A 3M7OA 3QIUC 1KENH 4Z95L 3MJGX 3S5YA 3WTYA 2BP0A 3EFDL 5DRZA 5JTWA 3KL6B 2V8LA 2CZNA 2J44A 2YUVA 4XP1H 5B39G 4BQ6A 2ZCLH 1N8OE 2DEXX 4OCXH 4J23A 1FL6B 2XZAH 1V54B 2L7QA 3FYEB 4RUTA 3P9WB 1F18A 1RZGB 4Y5YB 3QFJA 3BRDA 1WLHA 2EJ1A 3MBEB 4DETA 4N5UA 3D51A 1DL7H 2CIKB 4UDUA 5DUPH 4L9LC 5CINH 2BFVH 2N7AA 2WMPA 5JO5B 3CFKA 2B0SH 1WZKA 1QYGH 3OSKA 3LZFH 4M8UA 5E9NA 4UQBA 3PL6A 1B2YA 5KVEL 1Q9LA 5HD8D 2QQLL 3BW9A 3LSOB 2IJ0C 4R96B 2R23B 3SPVB 2ZXGA 3ZL2A 5LNGA 4JQIL 4OTXH 4W9FC 3M1BA 5F89A 4X8SL 4XE0A 3TBYA 4A2FA 1E6JL 2DQEL 3A4EA 1IAIL 1G1RA 4M7LT 5DWPA 1NPNA 1SN0A 1HZKA 4N0CC 1H5BA 4RMBA 2FE0A 2Y38A 3UBXA 5JR1H 4JY4B 5T1DL 1S7SA 3DUHA 1CS6A 4MVBD 1VCBC 2HFGH 4JRXD 3RGBA 5D2NA 3HTLX 5EC2B 4I5BB 1T89A 1A4KA 5EU7E 3T2LA 3VYNA 5I71B 1EPHA 3NDZE 1JZGA 2KQNA 2FBOJ 4ZMOA 3DX7A 3FN0H 5LCVL 4KK5C 3FUJA 5J1AA 5EUKB 1YEIH 3K6SB 1U42A 4I4WB 3PP3H 3WN6A 3BLBA 2VH6B 3U25A 3B9KC 4ZX6A 1LNUA 2WNWA 4GXUN 4F92B 2AJSH 3F3HA 2BS9A 1D5XA 3IYLW 2FATL 1GS6X 1RK0A 2A3TA 2CJSA 3AC0A 3P1VA 2VLRA 4GXVL 2OMTB 3BZ5A 5D5MF 5DVLA 2VZSA 2HVKB 4XHJD 4E41A 4EI5A 3DYMA 1TJHL 1NUDA 1EJOH 4ZUVA 5DTFB 2OYEP 4QEGA 4U6HB 1D5IL 2IVFC 5KIRA 3L7EA 4OJFH 1WGVA 3HZVA 1IARB 1XF2A 2CHZA 1KIRB 5I75B 3Q1SH 3NCJH 5E0FA 3X14B 3VXOB 4M4RB 1YEEH 3O3DA 4A7VA 1E4KA 3HLKA 3NIDE 4OU3A 4JPIB 3RP1A 2EYSA 5IR1A 2LV4A 3W11C 1AQDA 2JI3A 5A6LA 1NANI 1OB0A 2F1BA 5F3HB 3SE3C 3LC5B 2FYYB 1ZAQA 5E5MA 5F7UA 4FDWA 5MHSE 3JZ7A 4FXGA 1LVEA 2WXMA 1FORL 4GKSB 3DEMA 2YBRA 4C55A 4F7PA 2HRPH 2OAAA 1NFIA 2Y0SA 3QIWB 1CXLA 4OKDA 3FBYA 1HNGA 4NQVA 4A68A 3IN0A 1G7MA 2CM5A 1GHFL 2ZUQC 1W16A 2JSFA 3H42H 3RYMA 4GSRA 2VDKL 3E6FA 5H4ZA 5B8CB 3QHTC 4BZ1L 3BSGA 3KPSE 4PBXA 4MNHB 4QRTB 1HDMA 1F1GA 1A14H 1OTUD 2KDYA 1RZJL 1F1DA 1N5AB 1RUKH 3OQRA 1T6WA 4N2NA 1MIMH 5BZXA 2X12A 3Q3GB 4B0MB 4AENB 3H5CB 3S2CA 3QZBA 4JFPB 1OGAA 1IIIA 4ZMLA 2WGNB 5FF6A 4FFWD 1NKGA 4LCUB 3RX5A 3QCTH 1LP9B 3F04A 2FEDC 4G7SB 3ZZLA 4F9PA 4I89A 4TVSa 4OF5A 3EYVA 4GEJA 5SX5K 3OBAA 1RFNB 1T1XB 4UB0L 4RMRA 3B3BA 4P4KA 5EBMA 2EH8H 3P11L 5I1HH 4GPVA 4DGVL 1PDKB 1W72L 1OP4A 4JUSA 3TA3D 2APXA 4KX7A 2AQ3A 5LGJB 2CHXA 2AW2A 4WAFA 2VWNL 3OAUL 1A7OL 2YK1L 2DQGL 4E5XA 2QVIA 5LHDA 4Z0XB 1T2XA 3VVWA 3MLZH 4QRQB 2LOEA 5FKPA 2VIRB 4Z18A 5IW6A 3OB0H 4OM1H 3EDEA 5HHOE 5I18L 4MA1B 3ARGD 3FFOA 5KSAD 1YEKH 1NC4D 3P73A 2B08A 1W0VA 3Q8BA 4HHWA 1MRCL 1HKFA 3P4MA 4BFKA 4F8NA 5AW4B 4GI6A 3RWCA 3QUXA 3EGXA 5TE7H 1P4BL 1XEDA 4LKXA 3TV3H 5E1QA 1TQVA 3MCKB 4QRUB 5E70A 4P46A 1DVFB 3B2MA 5EOTA 5FK9A 3Q43A 3Q6GH 4YLQT 3TBDA 3DROA 4UBDC 2AS5M 1MW1A 3HC2A 3QFDA 2KLRA 4AMWA 4KKCC 4PJEE 4NQCB 2PYEE 3HMWL 2WBJD 4WI9A 3QDJA 3QARA 2WK2A 5DC0A 1IQHL 4Y4HA 3M46A 1IQLL 3STZB 1HVXA 3E2HB 2P47B 4Z0KB 4AQAA 4OJDH 1TQTA 1R5WA 1LO0H 2E9JA 3ETTA 5D7HA 3ARWA 3RVUC 1QHQA 3TCLB 4JGUA 3T4AB 2IAND 4P2OA 4PJFF 5C0IA 3MFFB 1IQDA 3WBDA 3GIZL 2R2BB 3UTPD 2BNQD 3IJSB 4TPRH 2H7WA 3W9DA 5K9JL 4WW1B 1K5WA 2JELL 3FFDA 4YDKH 5ICYA 1UHVA 4E9SA 5TD4A 4I1RA 5T3XL 3CXHK 5DJYB 2R1WA 3F7VA 4ZPVB 1VA9A 1JNHB 1B0GB 4UQIM 4AG4L 2MQ3A 2DV6A 3K0WA 3U2IA 2V3DA 2CLZA 4WNSA 5EZLB 4JDZB 3EAKA 3FRPA 3BPNC 4P9ML 4GAGL 3ULAB 3CSYA 3I02A 5D7SL 4TNVF 2OP4H 3GRWH 3OAWA 4L8SA 4YHZH 2I26N 1MWAL 2ED9A 2CJTA 1H6TA 3VU1A 1UZ8A 3REWA 2XXCB 1FZMB 2GUOB 3X3FH 1SOSA 5IB2A 4FRWA 4AQ1C 4ODTL 4MWFA 1EEQA 5I17B 1ORQA 3V4PL 3IPEA 1U8QA 1JMZA 4XCEA 5TE6L 3R05A 2UXFA 4PIRF 2OL3B 5DMGD 4PJ8D 4P5TB 5F96H 1U91A 3KWTA 3KQEL 4Z5RA 3FO9B 2DTSA 3CFWA 1A7RH 4DUVA 4GBXD 4MXVF 4JFHD 2R0KH 4L8CA 2Z4QB 2A6JA 3CZGA 5DJZA 5I15L 1FUNA 3WEAA 3VX1A 5G2NA 2FNWA 3UTZA 1RUPL 5AB9A 5IVZB 2VXTL 1EXHA 1JHKL 1U3HC 5JPMA 1AO7D 4J3BA 2W60B 1YY8B 2F54A 4XH2B 4QAMB 3QDHA 4TLTA 3O4OB 1YEGH 1S7TA 4O5LH 1Z9MA 3FW6A 3HUJA 5EC1A 1Z6CA 3WJLA 3GIVA 4AYFB 2UUDK 2MTAA 5IBTH 5AZ2L 4B9GA 4KKQA 5KTEL 5FUZH 1MNNA 2YGVA 4A04A 1NCGA 5IF0B 2DQTL 1AMXA 1ZWIB 3FTWA 4IGBB 1A6ZB 3L4CA 4YXKL 4AC4A 5KSBF 2Y36H 1BA9A 2Y06H 3NSJA 4MJID 3LN5B 5ANMB 4A7QA 3NRQA 3LH2H 1DX5I 3ATEA 2ZKHL 3BAXA 3LKNA 3UDWC 4L4VA 2PWGA 2CJUH 4RSYA 4P2QA 1NUGA 4M7LH 4Z7QF 3T3PF 4ZFZB 2B15A 1A2YA 3E8UL 1JL8A 1F90L 2DM2A 3OLGA 4MZ2A 1FJ1B 1VZIA 4MJ6A 4GEIA 4UT9H 4DKEL 1I8UA 1FNSL 1A7QH 2J8UF 2NMSA 1TMCB 4GLRH 4Q6KA 5INDA 4R0LC 5DA4A 2D7MA 4N0UA 1V3KA 1GW0A 2A4EA 5EUOF 3O6FC 4PREA 2EKJA 4KNUA 5E6SB 2AERT 2LE9A 5A2AA 2P28B 4ZMZA 3QXVA 3RU8H 3ARDB 4PRPB 5DHDA 3VAEA 3F7YB 4JZFL 2IPTL 4CBZA 3ARZA 3ZTNH 4NFCA 5E56A 2ESVA 3MRHA 4BQ9A 3KPLB 3G6JA 5FWQA 5MP6H 1U58B 2XA3A 1ATDA 2HLFD 4MFHA 1LPGA 3SDDA 1M71B 4BKLB 4TLUA 1AGFA 2MHAB 3UAAA 1Z9NA 1BBDH 4PJ5B 5L7XH 4W9JC 1C16A 2Q3XA 4JM2C 4RRPM 4HOMA 1XIWD 4JB9H 3CN2A 2VXQH 1DUYB 1T1YA 3FQWB 4OM0L 4JO2L 4HD9A 4NCDA 4GT7A 3QT2A 3U83A 3SDXA 1QUNA 5D7LE 1J48A 2PTTA 3LKQB 4B50A 5JNYA 1H0DB 4NCC2 5F1AA 5LBGA 1WFIA 1UXWB 5EEVA 1GIGL 1SOKA 4FG6C 3W38A 3SD2A 4ZNCD 3WIHH 1OOWA 2YBGA 1U8NB 3OKMB 3JV6A 2J1WA 2LHAA 2VLLA 2I9LB 4W81A 5C09A 1VADB 2O6EA 1D9KD 2G0KA 1C5CL 4PY8I 4ZS7H 5KOMC 1SGKA 4W4NA 1IKNA 5FUCE 1INDH 3VRLE 4NQEB 3PDOA 4F7KA 3OPUA 4P5KA 4R7XA 2A6KA 4M6AA 5D1QD 2Q3AA 3CZSA 3CSTA 2X7LB 5FGRA 3TO2B 4DTGH 3DTXA 3OKKA 4JK0D 4YSOA 5TQ2H 2IWEA 5HYEA 3SW2A 4Z77A 3CHRA 3BDYH 4C54A 3KPTA 1KGCE 1XSKA 3KLSA 4I77H 4GXFA 1FLTX 2FJUB 3MA9L 4QCIA 4Y8AA 5KW9H 43C9B 1S3RA 1MG3C 1PLGL 4AQEB 1RPKA 2HP4A 2PABA 1EEYA 1TDQA 2JCCA 4WWKC 3U30C 2WKGA 4Z7AA 5FUOH 2OTWA 2NY3D 3BSZH 3LXCA 3SPJA 2ZUXA 2NNAB 4PJFE 1FIEA 4O9HH 1LEGA 4ONHA 1IGXA 3WKNA 2BVQA 5C2UB 5CD5D 2QT6A 2B1HH 5C2BH 1P2CA 1ZCRA 1WBZB 4F9LC 3AG4B 3T3MB 3UJJH 1IEHA 1U8OA 1W8EA 2XG4A 3ELAT 3NEOA 4AVHA 1X5XA 4JFDA 3QDGD 5J11B 3RWGB 3WFCL 3GBEA 4WV1B 4A39A 5T1MB 1T5XB 2F18A 2G60L 4P2RD 3TJHC 3I6GB 5TK2A 4YX2H 1PS3A 3NIDB 1YYLL 3TBSB 3O2WH 1I9JH 1XSJA 2YGPA 2BZ7A 1QATA 4GW5B 4KI5D 2X05A 4DHLA 2HFFB 2O5ZL 1EBAA 1N0LB 3DMMA 2XKSA 4MNQD 1LO2H 4LFHD 3DNKA 3FQNB 1MCPH 2XIDA 2NY6D 3GTVA 4KJPD 43CAB 2E75C 1R4XA 3TVMD 1T0MA 4NHUB 5C7XH 2QQNL 3HS0C 1ZA3A 1VLXA 3C6SA 4PJGA 3RG1C 3WKMH 1AHWA 2LLLA 1DZ0A 4H5SB 2FSEA 1QVOB 2OZNA 3F83A 3NCYP 1S3KL 4PI2A 4K8RD 1AH1A 3QNZA 4MXVE 1FNGB 4FQ1H 2JXMB 3PGFH 3WFDH 4Q4IA 4PGEB 1JWMA 4XPAL 3ARPA 3ULSA 4DQOH 4N87A 5DZNA 3TBCA 3OR6B 4Q56A 3KPMA 1PVHA 1R3IH 3K2KA 5JORB 1E28B 2RFXA 2GG1A 1E4XH 1PZ5A 1YHPA 1G7IB 2VQUA 3BHBB 4NN6B 1SLUA 2FLRL 3LIUA 4JFWA 4M61B 1V3XB 3CN0A 4H1LA 4NOFA 4TVPE 3A6BH 1W2KT 5EO0A 5CMAA 1WWAX 3O6MH 4RSVA 3MRLA 3SGKA 3VFMB 3VM7A 1HQ4B 1YO8A 1NGWA 3ZHNA 2ZF9A 4ENED 4F2MB 1YAIA 3G5VA 1RLWA 3RHWK 5KS9F 1Y18A 1BF8A 3EJZC 3NJMA 1E2WA 2V7NB 5DC9B 3UBFA 3LEYL 1N19A 2HOXA 1EUTA 1X44A 3L3IA 1GZHA 2NZIA 3BD5A 4LVNC 5FC9A 4AQOA 3BAYA 3HE7C 2ALWA 5I30L 3WTTA 1LO5A 2V7HA 4FQIL 2GEQA 5DVNA 3LN0A 2A6IB 3GNMH 4IBZA 3AW5A 1EZLA 1DN0B 1NBZA 4NP9A 5D8JL 1KLUA 3CMOH 2AQSA 3CVHA 2YA2A 3G9AB 3V6FB 4KITB 5BXFB 3H3KA 5CKNA 4Y16B 3OPZH 3LS4H 1TJIL 1S9XA 3DVNB 2D4DA 4MYPA 2CCLA 5EZPA 4Z7QE 1PU0A 3T3PE 4IKIA 5F72S 1HOCA 1UJTA 2OL3L 3WHXA 3BO8A 4GFTB 5HHOB 3ZTJG 2C1PB 1LILA 2CGRH 3KLKA 1CD8A 1EAOA 1JZDC 1W91A 4H44C 1LD9A 4XHJC 1JDDA 2J8UE 3S8FB 3NFNA 2AJYL 2Y2YA 3V6OE 1K8DA 3P4NA 4MQ7B 3UJIL 2VXVH 1R75A 2WVUA 2VZ1A 3OMNB 5ICXA 1ETA1 3MYJA 4HPHA 2BOKL 5I8EA 4LL4A 1QSFD 4G6KL 3WSQH 2H45A 1KELH 3MNDA 3O9WA 5AVWB 3RWJA 3BWAB 3JYCA 3L4VA 2HKFL 4PQXA 4JFXA 4ELKA 4IYKA 5B1AB 3N42F 4PLNC 1FN4B 1F4HA 2ITFA 1O9VA 2VO5A 4N2MA 3GZQA 4O02H 4PJEB 2ZUVA 2PYEB 1G7LB 1RZ8B 2ZXQA 4EPSA 3VRJB 5CEYB 4BIKA 1DQIA 2EDDA 3KGUA 2J88L 1DLFL 2XYCA 4HS3B 3ROOA 3UTTB 1WHOA 5E9DB 2V6HA 4LRIC 1KG0A 1BPVA 2C7FA 3DJ9A 2VISA 3W81A 3GJFK 1ILUA 1OAUH 2J4WH 3C2SA 4XO8A 5CCKH 3DVFA 1BREA 1KPVA 5D72H 3BUYB 4IKJA 2VC2L 4NSKB 3STBA 1WD8A 1QTPA 2P26A 2YLKA 5FYKH 3GLZA 2X1XR 3UZVB 4ESKA 2BS71 5DCCA 1E4WL 4M7KL 4UF7C 1YEFH 2C9UA 4ZUUA 3UAJC 3S8GB 2BPBA 3OC5A 3FU8A 2Y7MA 3HI1B 5DD0L 3B2UC 5GRUH 3ZR5A 4UTAH 4ATWA 2JK5A 2OA9A 3UZEC 3PGDB 3FMGH 2MQCA 4RFEA 4HXBH 2XXGA 3V52H 2YD7A 1I8AA 4IRSB 1JTTA 1GPOL 4AVIA 1EVTC 2FUQA 2BSTB 2FGWH 2QADD 4FFWC 4QT5A 3IJHA 3WMSA 3MOQA 4I8DA 4XX1E 1PL3A 1IGML 1PLAA 5SV3A 1DVAL 3U0TB 4CW1A 3FOMB 1XQ4A 4LVOB 2AK4E 4K71C 3ZDYE 3LRGA 4FMVA 5LBSL 2XRAL 3IKCA 4H4NA 2F8XC 3ULUL 2FJHB 3GSNL 2Q1JB 2EDMA 2CGYA 2PR4L 2XWTB 4X0KB 4DQAA 1XBDA 1R6VA 4J3OF 2N0KA 2W1NA 3LDBC 1BVOA 2ADIA 3CK0H 1K5NB 9CGTA 4QRPE 4GU4A 1ET8A 2JJWA 4ZMNA 1NZRA 1UA6L 3LPOA 5D5MB 2DM3A 3TBWB 2VDOB 2X6BA 2H41A 3NT0A 2LU5A 4MX7A 1A6UH 3V4VA 2IPKB 1CBVH 2XPGA 3ASNB 1YN7B 4H8UA 4X99A 5KSAC 4GMSL 4M03A 4X98A 4FAAB 4XNQA 5DYOB 5CBAB 2WLLA 3KGTA 3HG1B 3S5LA 2EH7H 2BOUA 3GMMB 4MGXA 5C3IA 3OGOE 3TFKD 4O2CB 1R0AL 3QUZB 4D9RD 3KBFA 3FYIB 1JNNL 5EFIB 5DRNA 4NRYB 5DQ9B 4CRPA 5I19L 1JRHL 1S7VB 3FB6A 1A3LL 4HC1A 2C1OB 4LSDA 5D7JB 3T6ZA 3U4EB 5I6NA 4U0QB 2V37A 4UMSA 2JJTA 2X3CA 3PWJB 25C8H 1S9YB 2FX7H 4HFUH 3RTQB 4EBQL 1SXAA 5E24E 1KXTB 3QQNA 3GZPA 3C5JA 4Q6IB 4WTWA 1FFNA 3C6LA 3KCGL 1FGNH 2DF3A 1KGJA 2ERJC 5BNXD 3IDGA 5DFTA 1K37A 5FM8A 3WIIL 1SHWA 2EXTA 1JXGA 5K59E 5BS0A 2LABA 4YPGA 2BWDA 4JO3L 2NW2B 2AEWA 2DKUA 1NPEB 4C16A 1MHPH 5GRWA 3HN8A 4ZO7A 3SKMB 5DJCB 1WFTA 5GGTH 1M6OA 1FZJB 1UXLA 4KDTA 3MLVL 5E4AA 2BOHA 1N3NB 4MMXA 5IZ7A 3NJHA 1E9OB 3MRCB 3BGFC 1MVFA 5DS8A 3FB7B 5FLVA 4TNFA 4GP5B 5B7FA 3WY1A 2HN7B 4PHZA 3NTCH 5K69A 2W38A 5EH1A 4G42A 5KANG 2Q8BH 4IBVA 4OLXH 3RZCD 1DFXA 3D9AH 4R26H 4XCNA 5IB5B 4TQEH 2WQXA 5KS9E 2UZIL 4MD4A 5CUSL 3L3KB 5DXWA 4JGMA 1XTLA 3LY6A 3MCLL 1KDIA 3ABLB 3HC0A 3SKNA 3UFIA 2HG0A 3SZKC 3T09A 1CGSL 2VXUL 3CDGA 3N41F 1OALA 5DR5L 2HTLD 4M8QB 4WNQA 4OVUA 3WMPA 3ZYIA 5MENE 2VVVL 3QH3A 2DLFL 2ARJQ 1CK0H 2ATKA 4XAKD 5CZKA 1NBVH 4UQ2B 3DSFL 3CH1A 4OFIA 4RAVA 4XMKH 2Z6FA 4OCWH 2H26A 2WD0A 5F7DB 5CKQA 2WO4A 3OKOA 4DKDC 1J1OL 4ATTA 4GBXC 1JGDB 2XN0A 3MV9E 3B7SA 1KMGA 3C8DA 1XEUA 3GI8L 3PWUA 1FSKC 4Y9BA 2A9MH 3QEQB 4PJ9C 2E86A 2VH0B 4HIXH 3L48A 2FD6L 2H6PA 4PJ6A 2R59A 4PS4H 3RJOA 5HHQA 5DD1H 2APWA 3UO8B 2WG3C 3KHOA 1S8DB 2PW1B 1CZ8L 3L3GA 2C5DC 5PAZA 4BRJA 4PJAF 2BNUB 3JTSB 4BK8A 3N06B 5E00A 1JXFA 1M7DB 1K72A 1P4LB 3D85D 4DO5A 3R7RA 1FFRA 5E1GA 1BZ8A 4OT1L 3FH8A 3IFPB 3NABL 4GFXA 2ZSWB 2GI0A 3RNQA 2WLJA 4L4TD 1JGEA 4AUUA 1ML0A 4XPFH 2E7BA 3NAAL 1LMJA 4X5RA 1E9PB 5B38A 4PTTB 3N40P 2XV6B 2J8HA 1DBBH 2DM4A 1VZGA 2OXHA 3O6KL 1JYXA 1HL5A 4XXDA 4HSAC 3DV4B 3HEIB 4KK9D 5IOPA 1T66C 4LEOA 3WUZA 1MFDL 5D55A 3AM8C 1PX3A 1T3FB 4AT6B 2OSYA 4MMZC 2BNRB 3V5KB 1L5GA 3G08A 1BD2D 5AL0A 1P6FA 4JL1A 4V1DA 5SWZB 2VLMD 1JZHA 3PV6B 1M6UA 3OLEA 4PYHA 4D0BB 4D9LH 3SDAA 1IC5H 3IGUA 1IQFL 3IM1A 4XPTH 4Y1AE 4CSYA 3VDAA 3T77A 2DJMA 3WD5L 4U7MA 2CIIB 3CC5B 2WLNA 2E27L 3Q8CA 3LVTA 3QO1B 4P2AA 2NYYD 1I7TB 2AVFA 2KPWA 1YEHH 3MXWL 3F65A 4X5LA 4YGVB 1ADQH 2HX9A 1HXYB 5CLXA 1WBYB 4N20A 3X12A 2X70A 4H0LC 1LK3L 3B8YA 2FO8A 4CVXB 4W9EC 5EOCH 4NC2B 1UURA 4NI3A 4JZEL 4KFMA 4UOW1 3AAZB 2BZDA 4UOW0 1PX4A 3DTDA 1OHZA 4M5ZH 2Z34A 4FNLL 2ZX8A 1FG9C 12E8L 3OAYH 4PRDA 5DVPA 2YN3A 4RGOL 1XIWC 2Y7NA 1RZFL 4KPHH 4IBQA 3TIDB 4CC4C 4D9QD 3PNWA 1PZ3A 2VLKB 4LHJB 4TV3A 4ZXBC 3I9PA 4MB3A 4L37B 1NJ9A 4LSSH 3VD9A 5KAQG 1WAAA 2AQ1A 1NUNB 3FH5A 2BVPA 1WWBX 3MBED 1TQBB 5E6RB 4OLUH 2MKLC 1SXSA 2ADGA 3FU6A 2H3NA 4PJBA 4WI8A 1U8CB 2P5EB 3ROLA 3CLWA 4PJXF 3FU7B 1D9KC 4KRPC 3ULVH 1EANA 3MROB 2A99A 4ZW8A 3ZGIA 4D7PA 5BV7B 4MA3A 1KTKE 2V0AA 4UIMA 5BRQA 1HWWA 1MI5B 4JJOA 3R1GH 4HS6B 1BIIB 2BJMH 1MQKH 4XP9L 4AOFA 3QCUH 2NLJA 1FF5A 1KCWA 1S6NA 3WS3B 2IOOA 2BO0A 3QDMA 3VXUB 3WJJA 4AE0A 3T0AA 1U95B 1BQKA 1H3TA 2BW5A 3MRKA 1CG9A 5M95B 1I7RA 5FUCC 4F37K 5KSBB 1CGXA 1CTNA 3O8XA 4NN5C 1IFGA 1E8WA 1A4BA 3MJ9A 5AVUB 5ID0B 1T6VN 3U1QA 4QXTA 2JKTM 3LKSB 2WIIA 5E2JA 3L1OH 3WNKA 4PGDB 2Y7QA 3VXRA 1JRHI 2AK1H 3QMOA 1VFMA 5CD5C 2ZJSL 2IH9A 4NJ9H 4XCYB 5AZUA 3WIHA 1ET5A 3HS8A 2J8UB 4M3JA 1KCUH 3QJVB 2IGFL 2X87A 1KT2B 1K2DA 1A47A 5EUOB 2FX8H 1JTPA 5IGXH 1N2RB 1EMNA 1DO5A 1Q9WB 4YGAB 1NC2B 1SN5A 4YEEA 2XQYG 3COOA 4KX9A 3BKMH 1S7WB 1YPZA 2VDOL 2XTJE 5G5DB 4WU5A 5J13B 4PV9A 1TENA 1EJFA 1FAIL 2KHAA 2KL6A 1WZAA 2E9BA 3QVAA 4UNIA 4PJDF 2FO4A 4KI5C 3KNBA 2VB5A 3NSFA 3DWTA 2KV4A 5F7KC 1NCHA 4A6YA 2P3TA 1OQXA 1R34A 4GRWE 4I3SH 4MNGB 3R06B 4JMNA 5E2UH 35C8H 4X5PA 3BZFB 4NKIH 5GRXG 1M2OA 4E0RA 5DJ6A 3ISRA 1HINL 4HGWA 2AC0A 4FFZH 3QIWD 4OQ1A 4XTRD 4EOWH 4NLAA 5FYJE 1I1YB 2CO6B 2Q10A 5FO9B 1UUNA 4FTVB 5HHPB 3AT0A 5T1JA 4QOKA 1C8PA 3CZKA 1JHLL 1SM3H 2IAAC 3FU3A 1FO0H 4I0PC 3EZJB 2EVFA 3JWOC 3MZGB 3SDCC 1ZHNB 5GXBB 3UTSE 3M17A 2NY4C 4ZMTA 3D18A 1DCLA 3HZYA 4TLSA 1A7PL 5FYLH 2OZ4L 1GCFA 1YMHB 2VDQH 3N0AA 3TYGH 4IBWA 1L3YA 1T1ZA 3K4ZA 3P0VH 5FGBC 2OCCB 4U1MA 2B16A 4ELMA 5F1OB 4PRIB 2HZHA 4PJAE 4CN1A 1KJ3H 2OR7A 1MREH 4I0KA 1WISA 1VEMA 3L3HA 2YD4A 4EUPH 1ICTA 2L7JA 3N1GC 4K7PY 4ENEC 1P9MC 3HRZC 2RQEA 3VXNA 4HLJA 3C09B 3CE1A 3BZDA 4HH9A 2GIXA 1MJ8L 1FYTA 1J8HB 1FH5H 3SO3B 1HQRA 4PWKA 2P94L 1OGTA 3FT2A 5DHVH 3OD3A 5IW1B 3MLXL 4KQ3H 2NXYC 4Y9GA 1A4JA 2QSVA 3P9MB 4EKXA 2Z91A 3EUDA 2ADFL 3KXFE 3OKEA 4GAYA 4NM8H 4KZDH 1UFUA 1YNLH 4F7CB 3MV8E 5IK3A 1WO2A 3VDCA 1AY1H 1S5HB 1DQKA 3CBKB 4H26B 1G7PA 1RUAL 5CFAA 1NMAH 5D7IF 5ADOL 1PLBA 2GAZB 4UT6A 4WHCA 2DQUH 3RGVD 2GKIA 2COVD 3K91A 2HCZX 4OGZA 1Q90A 3AG3B 2TGFA 3BVUA 2F58H 4DGIH 5KSUA 1ZT1B 1A5FL 4OLYH 4WFGE 1PD6A 3C5XA 3PIQA 4H0IA 4ZD3H 4U1SB 1MZZA 3CJJA 4QHNB 3W2DH 1HT8A 2YD8A 4ZODA 3MUY1 2X88A 2QJDA 3WAKA 5JIIA 2XIIA 5CWSB 3ZL1A 2OULB 1DVFD 5AW2B 1QW9A 3IE4A 4LCWB 1NFDA 1F41A 4QJ4B 1XCXA 2J1KA 2FNBA 3GMRB 3VYPA 2NCMA 2V5RA 4X7SL 2DWEB 3KPRB 4M02A 1EVUA 4ZUWB 1I3UA 1IGTA 4GQZA 2YMXL 4G7YL 5E9AA 3OF6A 3MRBA 1XGPA 5IJKA 4LSVL 4N2OA 1HNFA 3U7WL 1KB9K 2OMZA 4OCRH 3MN8A 3QA3B 2XACC 5C0FA 4W68A 3QWRA 1OY3B 4ZAKB 2WLYA 4UQDA 2AV1B 2BSEA 1CIDA 1D5ZA 2P4AB 2ZCKH 1PFOA 2Y72A 5TJWK 4AEFA 3KVQA 2PYFA 4KXBA 5DFWH 3ZSTA 4HPYL 5CJXA 3Q6FB 4FE9A 4UUJB 2J6EA 4PJXE 3WLWC 1H19A 3FCGA 4JZJB 2QPDB 2IH1B 3RB7A 5BRZB 3LEXB 3KLDA 5GS3A 3HS5A 4XNUL 4B9ZA 3ZTEA 3WKPA 1OCRB 3LIZL 1CFVH 5AW6B 3B6SA 4R8WH 1AHMA 4NNYB 3D2UA 2XA8L 3K81A 3OG6B 4P99A 3T0DA 1SDDA 2QADC 3V4UH 2DYPB 3UP1A 1YRKA 3OKNA 3P0YH 5KS9B 1RHFA 3HMXL 4HQQH 3Q06A 3HVNA 4P59L 1AZUA 3CFDA 3NGBC 3GLDA 4KROB 4PJIF 5FO8B 2BIIA 5E95B 3Q5YA 2WPIE 3IDXL 1KV7A 4FERA 4L3EE 1T2JA 5JUEL 4JLRA 5CLZA 4DGYL 3K8LA 3P3RA 1RU9L 4P5TD 5HHME 5KUMA 1KPRB 4GRLA 2GTQA 1MFBL 1FVDA 5EU4A 2MCPL 1I3RB 4HJJL 1ZV5A 3U36B 4KO9A 4XMVA 5FO7B 1ZT7B 7PCYA 3EFOA 4JDEB 1QO3B 3BKCL 1FLRL 3GSQB 3HNSH 4GUPB 1DBAL 1K85A 2DQJL 2Y9RT 4RRPG 4QXGL 2QMKA 3P5BL 5DJ2B 5DK2B 1BVLA 3KPNA 5EV7A 2VJ3A 1HX0A 5FHAH 5KJRL 1ED3B 1M1XB 2WANA 4YJZL 4IIZA 2QHRL 3FUEA 3GSXA 2O93L 2CDGA 1T03L 5AAMA 1FAXL 1NAKH 1WT5A 3TFKC 3MR9B 1JGVH 3ZKXC 2EIEA 1SOQA 4LSRH 5D93B 4BGLA 3QZWG 4EXPX 2OX5A 4IGBD 3AXIA 5BV7L 1U8LA 1T04A 4KJYB 2AITA 5TH2A 2YIHA 3N5AA 2W65A 4G9DB 3PYCA 1FC1A 3FQRA 3OHMB 4M62H 1CX2A 2WWKO 3FK3A 1TOZA 4GAAA 1EK3A 2XN1A 3QIUA 1OHQA 1UD4A 1LEIA 5J9PA 2KLTA 2XKUA 4HU8A 3QRFM 1BQSA 2JH2A 4DFHA 3L6FB 2Y6SD 4Z6AL 3P4LA 4UQCA 2WBKA 3GBNL 4X6EB 3SGJC 3K7UA 3VUAA 4OR1A 2TAAA 1J5HA 4PB9H 5K9QG 4KUCD 4YHIA 1DQBA 2APSA 4N22A 5C9JB 5M7QA 3D0AA 2IXQB 2CGZA 3QIBC 5LXGL 4Y1AB 4L9LA 3JV0A 1RH8A 3SY6A 5I1EL 2FR4A 2WPME 1IILE 3SE6A 2AXWA 5DMJB 4RVBA 3O6LL 4PG9A 2DQIH 2H4EA 1CLYH 1IEBA 1SHSA 3ARDD 4PRPD 4JM4H 1JN6A 1KCKA 4PSRA 2R2EB 3EBIA 1ES0B 5HDWA 3ULUD 5E5UB 5JIMA 4XNZB 1PYWA 4MQXC 3APMA 4S2SA 3KYOB 2IAMC 1S9KC 3BPLB 1O5PA 1S7RB 4E2OA 4QHUB 1BP3B 2NNRA 1VZHA 4Z3IA 2OMNA 3H9SE 1EZSA 2BCKA 3ECQA 5SWQA 4KHXL 4PJ5D 1DQML 1SEBA 5CD3A 2WZPA 1SFDA 4X80L 2EDNA 2MHPA 1JF6A 4OB5L 3RDTD 5DVMA 3RLSA 4UOZA 2NUTB 3AXLB 1FP5A 2VDMB 2RD0A 4RQQB 1I3GL 2AXGA 2G2PA 2ZKXA 4UV4L 3B8SA 1F11A 5ENWA 2ADYA 3TWYA 5HVHC 2YPVL 5K9OB 4C83B 3LN4A 1CUOA 5C0BA 5TF0A 3B9KA 1A21A 4MCYA 1PG7L 3EG9A 3OL2A 2NTFB 5FV1L 5EU6A 5E8OB 1B88A 3RI5K 1MFVA 1SJVA 2Z8RA 2OYLA 4KMTL 1P53A 2APBA 1EQWA 1IKFH 4NQED 1VACB 32C2B 3DBSA 2PWHA 3OMAB 5D6DC 2X10A 5TDPA 1FBIL 3ZE1F 2AJ3B 4YNYB 2D7PA 4YE4H 5DZLA 4S1SL 3S37L 4OCLC 1KXVC 5IT2H 1GC1L 1ZGLP 1S7UB 5FGCE 3VXPB 1P4IL 4LP8A 3G04A 1U8MB 5KVDL 2NT1A 4UM9B 1JFQH 1TTCA 1LK9A 3T8MA 15C8L 5JYMA 4DVBB 2W80C 4Z7VB 3S36H 1V7NH 5E94A 3DV6B 4AM0A 3Q1EA 2YWYA 3U2SB 1I0UA 4WSGA 1O9ZA 1MQ6L 1E6OH 3L1FA 2FWOA 1TJGH 5DO8A 2CLVB 1DP0A 8PAZA 3NP4A 1KIPB 3TXAA 1OSEA 3EH3B 2F53E 3B9AA 4HUVA 4ZMYA 4JYUL 4PRHB 5C6PB 3F00A 2H9EL 3UO1H 1MFEH 1RZ7L 1X5KA 3O3BB 4RRWA 1F8TH 2NYYC 3K1KC 1R5VA 1P1ZB 3FQ1A 3BZEA 2H8PA 2F19L 2L04A 3VFOA 4ZFOB 1OLZA 2B59A 2X4RA 3KCPA 2AEPH 3IVKB 4ODHH 5GS0L 2X89D 5KYXA 4EJ1C 5K0HB 3BQUB 5LN4A 3SKJL 1URKA 2R0WH 4JREC 5IEHB 1PF3A 4ZYKB 1ZJAA 4N8UA 1T0OA 2G2NA 3ZIYA 4JE0A 4ZRGA 4D0DA 3BPCA 4Y8DC 1BVKB 3DJZA 4G5ZH 2E46A 3N41B 4JY6A 5F7LB 1DSWA 4CKVX 1A22B 2DJSA 1BW8A 4JFEE 3BEWA 3PAYA 4UQ3B 4UTCA 2NXZB 1E50A 3PG2A 1HEJC 1GJWA 3HI6L 1BZ7B 3OXRB 1NQLB 8FABA 1XGRA 4CUEA 3TJEL 4FG2A 5F1NA 5IP4A 3U46A 1MCOL 3MBEC 3RWHB 4P2CG 4LU5H 3X3GH 2NQ3A 3QZLA 2VRSA 4ZJ9A 4ZHAB 4K3GA 3HNVL 3EXJA 4RMWA 4Z3TA 1ACCA 1N7ML 5H37H 1LDSA 3JTTB 5CM1A 4TXVB 1HREA 3JVGC 4LPTA 1DDHB 3TF7C 2WYHA 3H2WA 2BOCA 3DI3B 3HS9A 4UNUA 1MF2H 2GSIB 2ICWA 4TGFA 4K9JA 4KVCH 1B6DA 2I32A 4XP1L 4QRFA 3VG0H 1ADQA 2NX5B 2ZCLL 4L5FH 5CILH 3FQ2A 3HZKB 3ET9F 4OCXL 4Q97A 1CGVA 1BOGB 1TYRA 3QG6B 3WIFB 3GMPA 2V8MA 2WLIA 4G8FA 1XB6A 2XPZA 3B7UX 5D96C 1R5IA 5CN3A 4P4RB 1DO6A 1CPUA 3U0PB 4HFWA 1QR1B 3L2LA 1U4EA 1DL7L 2AKRB 3LNIA 5DUPL 5JQ6L 3VVVA 5CINL 2BFVL 3QJZA 1W80A 3QFJE 4PWIA 5SX5H 5BVJA 5I71C 1QYGL 4X4MA 1FFPA 1BQHB 5I1IH 1JZ5A 3B1TA 1MHCB 2P5PA 4WU7B 1BHGA 3NT1A 2Y7SA 3BP4A 3O2DH 3A67H 1GGIL 1C7TA 4QKXB 5EDXA 3IKKA 4AMKL 3WLBB 4OTXL 4M3HA 5HHOD 1CQKA 1JV5B 3M8OL 1UJ3B 3U6XS 1AQHA 1QP1A 5DD5L 5GGUB 3S4SB 1GKEA 2AABH 4GO8A 1JDAA 4XN5A 1LEKB 4GG6F 4W70A 4F57H 5I73C 5LNDA 3V6ZA 4YL4A 3VWKC 2VZTA 4LAQH 1Q9KA 4YDVA 4RDQG 3V5HA 4DJMA 5DD6B 3WFHB 3HKZA 4S0SD 2HFGL 1EAPA 4U3HA 3U7YH 2JTYA 3L9EA 1VGKA 3NOIA 1RZKC 2Z0BA 5DFVD 4NRXA 4TSBH 3F5WB 3QJHA 3FN0L 1ODUA 5EU3B 4F93B 1R47A 2PYED 3IGAB 3VE0A 1BZ9A 4ORGA 1IM9B 2WVVB 2AJSL 1SNRA 4F7MB 3UTTD 1YQVH 4L1SA 3PHOA 4AQ1A 5GRZA 4N3UA 4DKFH 1KJ2H 1IEAB 3NACH 1VGEH 4H8HA 3V64C 2HJLB 2RMNA 4LSUL 4AL8H 3K72A 4J2XA 3KYKL 4JRYE 1GVIA 1IBZA 1EJOL 2GIMA 2VLRE 4WEMB 4HOZA 3T1FB 4WI5A 4HG4J 1OAYL 1XMEB 1WTGT 3QIWC 4XTRC 2JE8A 2EKSA 4X6FB 4YHOL 3DRTB 1GGUA 5E1IA 3M6DA 3CPUA 3GSWA 3Q1SL 4Z7UF 3FTZA 3FONB 1QFWH 1NCAH 1YEEL 2JKIS 1QBBA 1J5IA 5B8CC 1J9CL 5IVXB 3ZVVA 4PJXB 1U3HA 2IOIA 4Q14A 1GSMA 1IP0A 5H2BA 3F64A 4OZGB 2X38A 5C07B 1YNKL 3OWEA 4QI3A 1NOAA 4JE4B 4Y2NA 4HEPA 1D5BB 3KVPA 1NGQH 5J89A 1X5LA 2WPLE 2Y5TA 4IRSD 3QYMA 1UD6A 4WCYH 3CLFL 5IFJB 1OAJA 3ZE1E 5DJ0B 1JXKA 1ZKAA 4OD2A 3WN5B 4OZFH 1AUTL 3DPBB 4PGBA 4YUEH 2W07B 3UADA 1MJ7H 1MCIA 4PV8A 3X2QB 5DEFA 3ZXAC 4QYOA 1HHHA 2WYGB 2B39A 2BZCA 3N8XA 1RULH 3DRQB 3GMQA 1BQLL 5J0BA 2XWJA 4GP4B 1H3GA 3H42L 5EZIH 1FZKA 3DX4A 5D7EA 5F70A 1DVSA 3VXTB 2KMWA 2CUMA 4YZUB 1H3WM 5E6ZA 1PRHA 1K3ZA 3GTTA 3UDWA 4DK6A 4M7JH 1WBXA 3CMGA 1NIFA 3L3DA 5IM7B 5E6IC 5FOJA 1I8IA 3QHZH 3RPIA 3OGCA 1QZNA 3TA4D 1Y6KR 4K5MA 3S34L 4F8QA 1IGYB 3QCTL 4MZIA 4HZLA 2BC4A 2GT9A 2VH5H 5A2FA 1IQIL 1OGAE 5DJAB 5T3ZL 2D03H 4LESA 4J5VA 4W4OC 5A7BA 3E1ZA 2IIJA 3G6JF 2OMYA 3HG1D 3EOAA 2NZ1A 3O6FA 4NKMA 1BQHG 2VITB 4XRCB 4G83A 3QUZD 4FLOA 5CJ8A 3RUGF 2EH8L 4FFVD 5I1HL 4PG2C 3MRGB 4ANKA 2VNCA 3DUSA 3WO4B 1DVFC 2WYTA 3WFBL 3KE0A 4JPKH 4BFJA 2E4TA 5D7JD 2WCSA 5J5EA 2UUDH 2Z1KA 3S4SG 2OJZL 4PJDB 3RTQD 4D3CH 1CE6B 2XQYK 4LP5A 1JK9B 3ZR6A 1PCSA 5J56B 4GJTB 4OM1L 4JM2A 3CUPB 2ZSVB 4G5AA 4HISA 1BJ1H 4DPCX 1CU4H 5EN2B 1XAUA 1F2XK 2G3XA 1YSOA 4RWYH 1KTLB 4HZ1A 4RBPK 4AXWB 4PHXA 5ISZA 5DD3H 1QKZH 3T4YB 1G7JB 1VEOA 2OMWA 3ATAA 2FCBA 2VXSL 2AYLA 1O7SA 4TNVK 5D9SA 4DZ8A 3Q6GL 4N2IA 3HNTH 4A7SA 3PWPA 3ARXA 2DWXA 3GPEA 2DQFB 3L81A 4QDGA 4BD4A 2W88A 1KJMB 1ASQA 4XNAA 2M2DA 3GFUA 2EVHA 2ODIA 1AZZC 3FH7A 4GW4A 2ADJB 1QNIA 3J2PA 2PETA 1FIGH 2XG5A 4BKTC 4F3FA 4PMFA 4U49A 2JCCF 5AW8B 4NEHB 2C7UA 1LQSR 4UILH 3BP7A 2FL5A 2I07A 1NIEA 5C7ZA 4HKBA 3LRSA 1U8IA 4YDKL 4ZFOL 5IHUL 1EJ8A 3KLQA 1MCWW 4UIKL 4WKZA 1IBDA 1AGCB 3RVVD 1ZVHA 3I2CL 1D6VL 3FHEA 3UGEA 2J6WA 4K73A 2FT8A 3N44F 3QJFB 4K8RH 4W9ZA 4WWKA 3IDJA 2W2NE 5JW5A 1IBYA 1UASA 3BH9B 3UP6A 3HZMA 3QEQD 5D7IB 3T0EC 5I1AA 2C9SA 3JWOH 3MBWA 2OP4L 4XB3A 4YHZL 3LZQA 1C12B 4F9LA 2ZAIA 3IMRA 3D25B 4K7PL 5DHYA 1RJCA 1KJVB 4XP6H 1ETB1 3C08L 4AJYV 3KW8A 4RGNE 3EYFB 4R7NB 4BH7A 2F15A 1NCIA 4G6JH 2Z8VC 4A7TA 3P3SA 1TZGL 4IBYA 4PTUA 4A66A 2ICWJ 4LLVA 1HHIA 1I7ZA 2XWBA 4G8GB 2MGRA 5FGCB 4PJGF 1NEZA 4X83A 2FZ3B 3IPBA 1D5MB 4YSDA 3FCTA 5FLUA 1DLHA 4A67A 2MWCA 4JO4L 2KB9A 2ZP8A 3TO4C 2VN7A 3IMWA 5KVGH 1C08B 4P05A 1QX1A 2NY5C 2PLTA 5E1AB 1MCJA 2R0ZH 3HS0A 4KGJA 3V9FA 5HYJA 3SDYL 4Y4FC 4M56A 2PW2B 5GIRB 5B1BB 2HWZH 2BNRD 1UWGH 1T7ZA 2ZXCA 3KPQB 2F54E 4JFFA 3X13A 4O2EB 4YR6B 4C59B 1Y7VA 1VHPA 4NQSA 5SWZD 1XGYH 2AMUA 3HUJE 5FUZL 3W9EA 2ZCHL 5FW7A 5AKTA 3OKLB 4DOHB 3T71A 1PKOA 4H0GA 1ZTMA 3O3AA 1M56B 2W9EH 4OH2A 2ZXAA 5K1VA 5L88H 1HHJA 5FKAA 1T83C 4Z95H 2Y06L 4OD1H 1ONQA 3HI5L 3V5DB 1NGYA 2ZG1A 3EFDH 4IJ3B 4NO3A 4BQ8A 1HH9A 5EIIB 1KYOJ 2UWEA 3ALXA 4HZAA 3ULUC 3HBGA 2ZP0T 5GGSA 1INQB 5GHWL 5C6TL 2WSDA 2CJUL 3OV6A 4HWZB 5DMKB 4PW3A 5EF3A 1WCBA 4WW2C 4JZNA 4L4VE 4PJIB 2A77L 4E9WA 3AMKA 2V2XA 3JVFC 1ITBB 3HE7A 1GZQA 4P2QE 3IGKA 2I5YL 2OMUA 4UT9L 2X4SA 2ZOKA 1I85C 4JN2A 5IQOA 2OJEA 2FGZA 3KPPB 1A7QL 3RJDA 2YKLH 4XCCL 5I26A 1EUUA 2VLKD 3BAWA 4D8PA 1PQZA 4HDIA 3KDPB 3EH1A 1L9OA 4O51B 4ZSOA 2J1XA 4N0UE 3ERXA 3QUMB 4UM8B 1INEL 1MJUL 1BFTA 3HN3A 3J27A 2EDOA 5F1IB 5J6GB 4U3XA 1E6JH 2DQEH 3MZTA 3NEXA 3ZDXE 3SE9L 5DSCA 1GY1A 3QEGH 3A4DA 1QWNA 3CHXA 4WI2A 1PIGA 4CSTA 4N1HB 2BIMA 4TVPD 5T1DH 2Q6WA 2IF7A 5E08L 2ESVE 3F1SB 4GKNB 2W9DL 1MI5D 2HT4C 4Z7IA 1BBDL 2F9BL 1MCSA 2H0EA 3KYNB 4APQB 4U6VL 3TEZA 3MRMA 2VWOL 3JZYA 4Y5VC 2VXQL 4WZ9A 1AJ7L 3VXUD 5LCVH 1UD5A 2A83B 1MAKA 3UJTL 2BMGA 2P24B 3ESOA 4JG0L 4KH2A 5TK4A 2BP0B 3OJDA 2I9TB 5BW7C 5DEZA 2B4CL 3V0JA 1RAMA 5IB4B 4NS0A 3VDBA 5BRPA 4YDNA 2FATH 4HAGA 3SDXE 4GXVH 1M42A 3BIAX 4R7VA 3W56A 5AW0B 1MPAH 4XL1A 4OW6A 4NB7A 2HPTA 4HA1A 1NFAA 2DMHA 1HU8A 5FDWA 1CDCA 4LRIA 3KYMB 1IIKA 5D7KE 4UDUB 1D5IH 2HKHH 1INDL 1SBBA 5C09E 2WMPB 3BH4A 3QCWA 3CFKB 4G7RB 4I85A 4BSJA 2XFGB 1GH7A 4JR9L 3E38A 1Q9LB 4TUJB 3BD3A 3H3PH 4DZBB 3ATFA 2Y4SA 3UAJA 3VQMA 5TQ2L 1WAPA 2X1QA 3MGOA 4PEEA 5F89B 1JVLA 4BDVB 3BRGC 3ES6A 4D0CB 3UZEA 2QLVB 2FEJA 1H5BB 3HZ3A 1CVWL 4Y7AB 3BCDA 3UBXB 3LPPA 4WV1C 1UKSA 1S7SB 2Y5HL 5ESQA 4LPVA 4UQ9A 4Z7NF 4HIEB 2YGQA 4U3SA 2YGNA 3CDZA 5D2NB 3MPCA 1A4KB 1APOA 1X6NA 4NZJA 4ODUA 1DEDA 1QBMH 3TONA 5AW1B 5J1AB 5KYYA 1GHFH 1P84K 3O81A 4AY0A 2JCCE 5CLWA 2B1HL 3M07A 5C2BL 1R33A 4NQQA 4OIFA 1LL1A 4U4BA 4BZ1H 5ETUA 1RK0B 2XQ0A 1BVZA 4XODA 1E2VA 2VLRB 5I2IB 3ZLQC 4TSAL 3S96A 1J0ZA 1T7WA 1RZJH 2BSRB 3LQAL 1T4KB 4E41B 1ZVNA 2Q3ZA 3BN9D 5EIIG 5T1LA 1SDAB 4ZUVB 2J21A 4FTVD 4YSTA 4UNTA 5AAPA 3WE6A 4LIQE 5ALBH 4IOSA 2FLMA 3L7EB 4XBGA 5GZND 4JFDE 3GJFH 3HIZA 1G6VK 1IQWL 1CFMA 1D7FA 1PFCA 4XWOD 3O3DB 1ZK9A 2Y1YA 3ECVA 5JZ7D 3TBTB 5C0RL 5KSAA 1LO2L 3HHRB 1DVYA 1IE5A 1MCPL 1QASA 2EYSB 4PRID 5IR1B 3T0VA 3HC3L 3ZE1B 4ANWA 4DGVH 1IC7L 3L3JA 2OBGA 2PPEA 1SYVA 3WKML 3BUQA 4I48A 1EEUA 1FG2B 2Y22A 2YBRB 1JGUH 1KWKA 1A7OH 1BYNA 2YK1H 2DQGH 3VGEA 1C7SA 1J8HD 5INCB 1ND0A 1TEFA 3R19A 3D69A 3ELQA 5A43C 3WAJA 3GM0A 4NQVB 2NSXA 4S0TD 5I18H 1AHKA 3DGGA 4YSUA 1NM9A 2C4XA 2F08A 1JWUA 2EICA 2G2RA 4PH8A 5DJ8A 2RIKA 3E6FB 2WZ5A 3D5OF 4LBAA 4Y16C 2HRLA 3P4OB 3M7FB 5C0AB 3HLAA 4QRPD 1U3YA 1HDMB 4FFYA 5HJBA 3A6BL 4XXCC 3KGSA 3O6ML 4CDHA 2JQAA 1P4BH 4JJ5A 2P3FL 5I1KL 5KVMC 2BNQA 4XXWC 3EH4B 3T0WA 1I82A 5GS0D 4U6XA 4F7EA 4UU9A 2YRBA 2CD0A 2CR6A 1CGUA 5I16A 3CVBA 3BVTA 3VQ1C 2WW8A 3HMWH 2NY1C 4PLKD 1QBAA 1NMCB 4ZMPA 4PWJA 3GNML 2ZWKA 4LNRB 5HYSA 1ZK5A 3TIEA 2PP9A 2HJFA 4H8QA 4LCWD 1KLFB 3SE8H 3FQXA 1TQUA 3CMOL 5EBMB 3TP4A 3V10A 4F8LA 4B9JA 2FLRT 3BIBX 5E8PB 1YMMB 1I8LC 3LS4L 4HT1L 4HMDA 1CMOA 1TZIA 5IBLD 4UTBL 3U0WH 2VAJA 2JELH 4Y6DB 2WOBA 3C87A 1KYFA 3Q5OA 1JTOA 3EF4A 1NGZA 2EP6A 1SDYA 2G3MA 1UZGA 4E5XB 2NY2B 3UBXG 3MODL 4AG4H 5IW6B 1GR7A 3MREA 3VXQA 3KZ8A 3CZEA 4KDWA 3PABA 4N28A 5ERWA 3I9IA 3DOHA 4ISVA 3JWNE 1W0VB 4H40A 1TNMA 4P9MH 3WSQL 2GJRA 4GAGH 1KELL 2V9UA 2WINA 1L7IH 1HKLL 3RWCB 1SY6L 3NSCA 4PJ9A 4PRAB 5BRZD 2X2JA 2A9BA 4HMCA 4P46B 5HPOA 4O02L 3EJRA 1G84A 4ODTH 3QQ3A 4JFZL 3QORB 5J12B 1CFNB 3DROB 1D5RA 2LW3A 3NBNA 2JJSC 3WNMA 4TN9A 1FH2A 4NC0B 1EGJA 1ZTXL 4OBSA 4PRNA 3QDJB 2DYPD 4N9OB 2GJZA 3GXFA 1KFAH 1MH5A 2J4WL 4Y4HB 5CCKL 3UYRH 4TYUA 4AQAB 5D72L 3V9EA 5C9KA 1V27A 1QUPA 1R5WB 3NH7L 4KROD 3NCFB 4AEIL 5I15H 1JMXA 5FYKL 1CDUA 1U8PA 4KV5F 2P9RA 5HHNB 3WUWA 1QSEB 5C0IB 4FKKA 2EECA 4IU2A 2VXTH 5ESVB 2IG2L 2Z31B 5AVVB 2M74A 3W9DB 5FFLA 1M4KA 3BH8B 4HKZA 5I9QC 5FHBL 2EI8B 1S7QA 1BXAA 4NLHA 3FMGL 3TLRA 2AVGA 3VXSE 4LOVA 1Z6JT 5E8NA 2R1WB 3F7VB 3WEMA 2WV3A 3CQPA 4HLZH 3AM8A 3BYYA 4H25A 4MMZA 1A1NA 3HFFA 3WMQA 2BT7A 4I1PA 2CLZB 2FGWL 1UATA 2D31A 4BFIA 1ETZA 4CGTA 4DT2A 2UVEA 4FCHA 2DQTH 2BINA 4GG6B 4L8SB 4YXKH 1UZ8B 6COXA 3LD8B 3QUML 5CS7A 3REWB 2K3HA 4RGNB 3TYFA 3VW3L 4UNVA 5I1JL 2YRPA 4MWFB 3HOGA 4FFVC 4Q89A 4AYMC 2VZ3A 1U8QB 4XCEB 3ZZ1A 3O3UN 3ZDZF 1FL5A 3APCA 4HIHB 1BVNT 4Z5RB 3U9UB 3CK0L 2I69A 4HUWA 4JPSA 5E2VL 4L8CB 1FAKL 1YYCA 3LC3B 2A0LD 4DKEH 1SJHB 5FCUL 1OD7A 4R97B 4Q6IC 4Z0LA 2ZOWA 5GGRA 2QTEA 4HJGA 3UTZB 1IL1B 1XIWA 3P2DA 1FNEB 4CC4A 5DVKA 4PJBF 3QXTA 1ZA6A 4ZXBA 3OC8A 4NKOA 3GGWB 1H3VA 2EH7L 3C6EA 4OGYH 1LHZA 4Z7UB 3UMTA 1XF1A 2IPTH 3LKRB 3C5ZC 4LQ1A 2CNYA 1TVHB 2MNWA 2JB6A 2WQ8A 4Y1AD 2C9PA 1XAKA 3HHSA 4AEEA 2X4QA 2YPLE 1XB3A 2X9WA 1TMQA 3MV01 3BVDB 1Q1JL 2E6JA 1D9KA 3X1FA 2AFNA 2R7EB 4WUUE 3PFQA 4HFUL 4P23B 4GS7B 4C57C 5D7LA 4U1HA 4XGZB 3TTYA 4OM0H 4XC1L 4WSKA 4JO2H 1G1OA 1W15A 3HAEA 3CZJA 5DS2A 3IGLA 5B22A 1URIA 5HI4C 3RNKB 1JBJA 1GGTA 5DFAA 2HVJB 2Z8SA 4PUBH 1H8NA 4LCVA 1PJWA 5GGTL 5SWSE 3ZKMC 5BS0E 4GMTH 4D7BA 3CZNA 1C5CH 4BEIA 4KK8C 4EUPB 2AJUL 4OZ4A 1FYHB 3KJ4B 4FQCH 5T3ZD 2XZCL 5HYIA 1SXCA 1EFXA 2UXTA 5AEAA 3ZE0E 4EEEA 4J3OD 5DRWA 1JWSA 3IT8D 1PIFA 1USQA 3E80A 4PREB 5CSZB 4ZAEB 4OLXL 1Z5LA 1TZHB 1V05A 2CKNA 3QXWA 4R26L 2R2HA 2VZOA 4TQEL 4OKVA 3GXPA 3IETB 4E9QA 5HJGA 4NUJA 4LBEB 2BIOA 1PTZA 2K4AA 1EO5A 3MRHB 1O7VA 3MA9H 1AD0A 3G6JB 1JF5A 3MRDA 1ZXQA 2DYSB 1XCTA 3OAZK 1IQGL 2HT2D 3E3QE 5ELIA 4ACPA 1PLGH 4C4BA 3SDDB 3V0GA 4LDEB 4Q6YA 3RUGB 5KVFH 1CE1H 5E6UB 5MEOB 3NJJA 3LRHA 4IU3A 3OHXB 1C16B 3LPGA 1NBVL 4XMKL 2H1PL 1LDPL 1M7UA 3ECBB 4OCWL 4PYGA 4X6DE 3WDIA 4BHUA 3ILPA 4NN7B 2J1ZA 5IOKA 1KUMA 1QEWA 1I8MA 2PTTB 2BVUA 3QW9A 4UM9D 3W1ZA 5CNHA 2OKMA 3O3EA 5BO1L 3RVTD 3ZUNC 3V0DA 2CHNA 4XCFL 4PS4L 4BSWA 3JV6B 5DD1L 2VLLB 2X0WA 2VWEC 2ISDA 4OI7A 1CT8A 1XZWA 4G8AC 3BQVA 3OR7A 4LLYB 4NT6B 5IUSA 3KWWA 2G60H 4PM1A 3PDOB 5I6PA 1U93A 3IXTA 2V9QA 4P5KB 1U9KA 4RZCA 1YEDA 2A6KB 1DE4A 1A4CA 4L8DA 3TZVB 4NQXA 2QVMA 1JZFA 4JHUA 4I0PA 5JDJA 3CAFA 4PRHD 3OKKB 3SDCA 3GSOA 5KYNA 1MSPA 2A9NL 1F7MA 2UY6A 4Z77B 2X53A 1GY2A 4Y2DC 4ZTEA 2XTJD 1DQQA 2NNCA 2XN9A 3Q13A 5FGBA 4PY7B 4A2EA 2R69H 1L9TA 3NCCB 4QCIB 4LT7A 4RAHA 2QQNH 1FL3A 1HIML 2Y25A 3BQUD 1A9EA 2VKXA 4G43B 3IFOB 4HJSA 3PLYA 1UOLA 4NO0D 4P3WA 4Z76A 1P9MA 3HRZA 5HVFB 1EEYB 4I7ZC 5EEYA 1H6EA 5A6MA 4JHZA 3WTWA 2JCCB 1P5UB 2SODB 2WZAA 4DK5A 1QNZL 2OTWB 4KV5E 2JF1A 3QEHA 3W0WE 4MZ3A 1MAML 3KLAB 2PTVA 2BVQB 1PMYA 1MCHA 4XNYL 4RX4D 1ORSB 3K6FA 1IC5L 1XF3A 2EO7A 2PWDA 2P44B 3PJNA 1P2CB 4JFOA 4PAZA 5E8DA 1ZVSA 2VR7A 4V1DE 4XPTL 5EZOL 5FYJD 3N44B 2IH8A 5BO0D 1CFQA 4JDTH 3A5VA 2XG4B 2GJ6E 3CDFA 1GGCH 3K6NA 4RMVA 3SQBA 1F6FB 1YEHL 4JFDB 1TQBC 2VSCA 1F3JA 5JHAA 4QHLA 4QJ5B 2MNJB 3QJOA 1HHGA 1TFHA 4OLEA 1SFHA 2FBJH 1NFDF 5A2LH 4EUPG 4EDXA 3CHQA 4M5ZL 3F58H 3KLHD 2V5TA 5GZOD 2E7LC 5D8JH 5HDOA 1T5KA 4LPUA 5KG9B 2EDEA 1YUHA 3GCWE 1NDGA 2NX5D 2P8MB 3VFVA 5CISA 1T0MB 2OSLA 4IS6B 3ZE2F 3TC9A 3ZDZE 1ZA3B 1E5AA 2GHZA 1JI2A 3C6SB 3IMSA 4OFQA 4PJGB 3RZWA 1AHWB 5HP5A 4J39A 3BWUF 2WXKA 1OWRM 5EEUA 2OL3H 4MQTB 2P7TA 3QNZB 4NBZB 4OLUL 5L2KB 1ACZA 1WAAE 3AWEA 5C0CB 1QFPA 1YA5A 4N25A 1PZDA 1JWMB 3Q44A 3ULSB 2MRYA 2RCSH 3BT0A 3M36L 2AJYH 3ULVL 3MV8D 4BUGA 3QG7H 1C5DA 4PJBE 4BE5A 2KUTA 3FTSA 3PPSA 2Z0UA 4KFZC 4G6KH 2JKWA 2RFXB 5GSVB 1MQKL 5T1KD 4XCNB 2HKFH 1X7SA 4BFNA 4NC1E 4OCYH 1ZPUA 2F1AA 5CMAB 3MRLB 4JQIA 4AW7A 3IDIB 1CFSB 1NGWB 1AS6A 1TTBA 4NBYB 4Y19A 2NYZA 2X09A 1HXMA 5AYUH 3QDME 4K9EH 4KJWD 4BCZA 1KB5B 2J88H 4YT6L 2YD9A 3EO1B 1D6EA 3MRFA 3EJPA 4M5SA 2P42B 1E8YA 3FTYA 4GAFB 3AABA 4HXAH 1JUFB 5AVXB 3T9WA 4DSYA 3NSYA 2OYUP 1NBZB 3L1OL 4GAJL 4IRZA 4UZGA 5EHFA 5LCVA 2FLBL 5DQJA 1RZQA 1BFVL 3WDHA 2DWSA 2YD2A 4ZOAA 3FBKA 4Y9FA 3VTMA 5CHNB 1E4WH 4FQXC 2AK1L 4M7KH 4WFHE 2Z35B 3LRLA 3BGMA 1SUJA 2J72A 3O41B 3IWVA 5F21B 2J94B 1KCUL 2CKBH 5LAXA 3VWJC 3VXRE 3BO8B 1BIHA 2FECI 3P0GB 2KT6A 4C47A 1I1FB 2QTVA 1LD9B 5IGXL 4EN3B 2ZXBA 4WJ5A 2Y07H 4M8RA 3NFNB 1RQ5A 1GPOH 1AANA 1K8DB 1ZLDA 3EJTA 3MNWA 3P4NB 3IU3A 5AG9A 4FQQB 3OKDA 3BKML 4N0YL 5GZNC 1RKRA 4KNTA 1JCVA 2XBVL 3WXVL 3KCWA 4L3CB 3UBXI 2CO4A 4FQ2L 1YPZE 4LB8A 1D3CA 1IGMH 5C07D 4JFXB 3FAXA 1GC1C 4ELKB 4AYGA 4PWFA 1OCCB 2WUCL 3AWGA 3AREB 1A9BA 1YUFA 2K6ZA 2R39A 4H7VA 1XGQA 3L5JA 2XRAH 2KZ1B 3N50A 3TEWA 4FABH 3ULUH 4I3SL 2ZUUA 5E2UL 35C8L 3N40F 4NKIL 4LSPL 1P7KA 1BM7A 1QLRA 1VJSA 1KG0B 4FFZL 1GGYA 3ZGHA 4EOWL 4QF1B 5LJYH 5LN8A 4RETB 3BKJH 4ZUTA 2EI6B 4P5RA 1W0WA 2IALA 5HHMD 4XBMA 1AXTL 1FV1A 5IROA 3BMVA 2GD4A 1SM3L 4O4YL 3B2DC 5E4OA 1FO0L 4QOKE 4ZUUB 1RSYA 4EE2A 4XVOA 2PN5A 5COXA 4GMSH 4YOKA 1CURA 5FYLL 1KCRH 3TYGL 3B37A 3BVVA 1R0AH 4PS8A 1BJ1J 3DARA 3SGJA 3BMWA 4RFEB 1MREL 1JNNH 2YOAA 1BBJA 4BKSC 5KUKA 4YH6A 2GPZA 5I19H 4M93C 1JRHH 4YIQB 4FNTA 4ELME 3S48A 2C3VA 5GS0C 3DKHA 1MCQA 3RJQB 1GOHA 3QIBA 3B5HA 4G6MH 2BSDA 4ZTPH 1HXKA 4EBQH 4EQ2A 3IJHB 1Q9OA 3VFRA 3VFUA 4CW1B 1WWCA 2VAAA 3KH4A 4OFDA 1T7YA 1B9WA 4IOFD 2OTUA 3QRLA 2PXYC 1FYTE 1QFUH 3RWEA 4CNIA 4Z7NB 4Y7BB 3FB8A 3WIIH 1UM6H 2ITCB 3IKCB 4LOUD 1HCFX 4K3EH 1W72A 1Z3GH 2E8YA 2IAMA 2ZF8A 3D09A 5C08E 3ZTJH 1PAZA 1AY1L 5GRYA 3IAGC 1NMAL 2O5XL 2VR9A 2C3GA 5IBLC 4ZW6A 2DQ6A 3ZQWA 2ADIB 1XZ0B 3IGFA 3AFLA 4PRBA 3DJRA 3NCYS 1L9NA 1SMAA 3FN9A 3MNZA 4MDRA 2MPVA 4DGIL 2K3TA 5C0DB 4ZAKC 1E5BA 1HSAA 4ZD3L 3V4VB 1O5DL 1OP5K 5JHLL 1A1MA 3I6LE 3H4FA 4MBOA 1PFXL 4MASA 5E4IA 1JBUL 4XNQB 4P48A 1GA2A 5IMLA 4X8UL 3S5LB 4MDIA 5FFOA 3FO2B 3NP3A 3FQTA 2UZIH 3VJ6A 1TPXB 1CQEA 1CD1B 1E27A 4LKCA 5CUSH 1TPGA 1TCRA 3H0TB 1IUZA 1AC0A 1BLNA 1CTOA 3MCLH 4JZJC 5DRNB 2BXZA 2VDRB 3NRFA 2UWLB 3GS7A 1C1EL 1CGSH 2VXUH 3GJEA 5D6DA 1H15A 1O6SA 2O1AA 4R2GC 4GKOA 2R4RL 3KBEA 3MV9A 5CZXD 4XN9A 1YQ2A 3DSFH 4XE5B 4OCRL 3D12B 4RNRA 3OG4B 4X9HA 5JHLH 1NLBH 1U21A 3CFTA 4JPVL 3H9SD 4OF6A 1FFNB 1KXVA 3C6LB 4UMGA 3SJVE 5BZDA 4DW2H 2JKLA 3HCVA 1OSZB 3IDGB 2VN6A 1NIDA 4NDMA 5T5NF 4DVRH 4K15A 2R1YA 5BS0B 1ZVYA 3P30L 3NQIA 2Z7YA 3LPWA 2FYVA 4Y89A 1PBYA 1XH3A 3DX9B 4MD5A 2P5WB 3GMOA 1TUPA 1CI3M 3CCHA 5HHXH 2WP3T 2EDHA 2LU7A 4I1NB 1A3QA 1CZ8H 1LTXA 4L3FA 5LGHH 1X5GA 2ICES 2PR9A 4YBQD 5HJ3B 4NO2A 5MEQA 5C8JA 2AJZA 4R8WL 3WTSA 1MW3A 2VO8A 2MQGA 2YAFA 5E23A 1VAHA 1XSIA 3JT2A 4PJ8B 1XD0A 3FBQA 3QK0A 2FAUA 4OT1H 1DANU 2JJUA 1BVNP 3P0YL 2C26A 4HQQL 3NABH 1HAWA 4KRLB 5HPMA 1NBYA 1J0KA 2PCPA 1MWAA 4OJYA 4ABUA 5ABZA 4YLCA 3FT9A 3LIWB 4MD4B 4PB0H 4PJ7A 5KYWA 2NNFA 3CC1A 4ZDHA 5CCGE 1TEYA 2DMGA 3HC0B 4MJHA 1PY9A 3SKNB 3V4PA 1TTRA 3QH0A 1JK8A 2CXKA 1G6RA 2WWKT 3QJRB 5D93C 2VKWA 2VJ8A 4G8GD 5ECJE 3TTSA 3TCTA 3ZYIB 4RGMB 4WI0A 1MFDH 2DBLH 4BZ2L 4IIQB 2BY2A 3NEEA 1L0XA 3CH1B 3EYOA 5AL8A 4XI5D 3OKOB 2XWEA 2WYZA 3QQ4A 3RE0A 3TNNB 3T2NL 4Z0BL 3PWUB 3LHAA 5FHAL 1Z9LA 4Y76B 2X4PB 2IDFA 4ZOEA 5IQ7H 1DZBA 3WD5H 2E27H 3NIGE 2DEWX 3WDJA 2QVFB 2OI9B 3RKDD 1FL6A 1NAKL 1XBRA 2MPAL 1RZGA 4JL2A 1T21B 4E1GA 4R5XA 1HN1A 1JGVL 1UQSB 4YBHA 3MBEA 1LK3H 4ANVA 4B9KC 4LSRL 2E9IA 1OWWA 1UG9A 2CIKA 4M3KB 1E4JA 3F05A 4JRLA 3SYPA 2D0FA 4FNLH 2BSBA 2Z7UA 1MFAL 2O4EA