2YGOA

Wif domain-egf-like domain 1 of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
180
structure length
174
Chain Sequence
b'TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WNT INHIBITORY FACTOR 1
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 31
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygoA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygoA01
3ELAL 4X8SL 2XBXL 3TK6B 1MQ5L 4A7IA 2MHPA 3TGFA 3HPTA 1K37A 1NFUB 2W2ME 2YGQA 4M10A 2VWOL 3P5BL 2Y81B 2G00L 2BOUA 2WFXB 1IQML 2YGPA 3RR3A 3EGFA 4YZUB 1IJQA 2D1JB 5L2YL 4TGFA 3DEMA 2J94B 4E1GA 3ZYJB 1EQHA 1N7DA 4BXWA 2CJIB 4RS0A 1YUKB 1L3YA 2FLRL 4BTIA 5FDQA 1IQEL 3TBDA 1IP0A 1XDTR 4ZAEB 1EBVA 2PUQL 2RHPA 5IKQA 2YGNA 1NFWB 3M37L 1HAEA 3F6UL 1IOEL 3ASIA 3GISX 3CS7L 1LPZA 1HZ8A 1IQGL 1HJ7A 4NGAL 1U67A 1XKBA 3Q3KB 2P3FL 1UZJA 3HO3A 2W3KB 2UWPB 2BQ6A 3MQEA 1YGCL 1F7EA 1UZPA 3F1SB 1G2LB 2P3UA 1KSNB 2VWMK 5CISA 3U73A 6COXA 1M1XB 4JYUL 5JB9E 4Z0LA 4C16A 4Y7AB 1GK5A 4BTTA 2XBWL 5CKQA 1F0SB 4XBMA 4D0EA 1O5DL 2J34B 1IQNL 5JBCE 2J38B 4NA9L 2WG3C 2Y7XB 3H5CB 3BT1A 3NT1A 2WPJE 3HS7A 1ADXA 5I46L 3GCWE 1CCVA 4X8TL 1W7XL 1EPHA 2K2SB 2P28B 1X7AL 3OLUA 3BPSE 4MMZB 1I0UA 2WYJB 4JZFL 5E8DA 3LC3B 1ZAQA 2BMGA 4OTYA 1EAIC 1A3PA 1NZIA 1G1TA 1IOXA 3KQCL 1HX2A 1XFEA 2I9AA 1G2MB 1NPEB 4NG9L 1KLIL 2Y5GL 1IQLL 4BTUA 1MQ6L 5IKTA 3N8YB 4RUTA 3LTGD 1IQJL 3CFWA 3KQDL 1DVAL 3LC5B 5F1AA 1NT0A 2FLGA 1FE2A 2WFTA 1APOA 3N8YA 1IQFL 2UWLB 3ZYIB 1TPGA 3K9XA 2WPME 3KK6A 4PH9A 1EPGA 4BXSA 3POYA 1G1RA 3FBYA 3TK5B 3V64C 3LTFB 3Q7DA 2B7DL 1HT8A 1FF7A 1LQDA 2EI8B 4JYVL 1LPGA 3N8VA 5L2ZL 1V3XB 1EMNA 4ZXXL 3CENL 2P16L 4Y71B 5JVYA 4D0FA 2FLBL 1JV2B 1YUGA 2WPKE 3QH0A 4ISHL 2VVVL 3OLTA 2JKHL 4JZDL 1N1IA 3ZYGA 4BDXA 1CVUA 4Y7BB 3BT2A 2TGFA 2WPLE 3U7UG 2Y7ZB 5IKRA 3LAQA 2M74A 4LMFA 2MGPA 3FCSB 1MOXC 2Y5HL 2RNLA 2FD6A 2Y82B 2P3TA 1BF9A 3MDLA 4XL1A 2GD4A 1IQIL 1B9WA 2BOXA 2VH0B 1HRFA 1P9JA 1DQBA 1FJSL 4O02B 1QFKL 2VJ3A 3KRKA 2W2NE 4Y6DB 1OB1C 2RA0L 2YGOA 2BOHA 4XLWA 2W2PE 1APQA 4CSYA 3LN1A 1G1SA 1IGZA 2J95B 2VH6B 4Y79B 1IGXA 1WU1B 2XBYL 2XC4L 4Z6AL 1URKA 1FFMA 2P26A 2BZ6L 2UWOB 5CKMA 4RRZA 3HO4A 5L30L 5KIRA 2BOKL 2WYGB 1NFXB 1PRHA 3TH3L 2NPRA 1COUA 3N8WB 1DDXA 4AQTA 1EMOA 3HS5A 4YT7L 1WHEA 5IKVA 1LMJA 1ATEA 4M11A 4FM5A 2EI6B 5JBAE 1ATDA 2XBVL 3SOVA 1IQHL 1TLEA 1SZBA 1Z6EL 4MMXB 1P0SL 3N8ZA 2DDUA 2J2UB 5JB8E 3ENSA 3LN0A 2W26B 2OYEP 1ATAA 2EI7B 3KQEL 2OYUP 4RRYA 1W8BL 1HAFA 2P94L 1KLJL 1KIGL 1JL9A 2BQ7A 3SW2A 1RFNB 1F7MA 1FAXL 1UZKA 2FZZL 1Q4GA 2P93L 2Q1JB 4RRXA 2P95L 1K36A 1KLOA 3NTGA 5F19A 4CUFA 1DX5I 1PXXA 3N8XA 4CUEA 2XC0L 1HREA 2Y38A 1FAKL 1CEJA 2W86A 2BO2A 2VVUL 2H9EL 2J4IB 1FSBA 2PHBB 2ADXA 3QCWA 5EGMB 1IQKL 2KL7A 5KN5C 1F0RB 4D90A 1NFYB 5CKNA 3GCXE 2PR3B 5JBBE 2W2OE 1EPIA 1DIYA 3HO5A 2Y80B 2KB9A 1EZQB 4RRWA 3SOQA 1U8CB 3FFGL 1C5MF 4X8UL 4X8VL 2KV4A 4ZH8B 1WHFA 2MGRA 4CUDA 3NJPC 2K2TA 1PTHA 4BDWA 5JVZA 1HT5A 1JBUL 3SOBB 1IVOC 2WPHE 2D3JA 2WG4B 3KL6B 3QMOA 5JW1A 3NTBA 3PGHA 4COXA 1PFXL 4ZXYL 2XC5L 2Y5FL 2I9BA 3C9AC 2BQWA 1HCGB 1CX2A 5K0HB 3HS6A 3IJEB 4Y76B 1XKAL 1CQEA 2F9BL 1J9CL 4YT6L 4OTJA 4MMYB 3CA7A 2VVCK 4ZHAB 1EGFA 3N8WA 1EPJA 4O1ZA 3M36L 1PGEA 2VWLL 4Z0KB 1YUFA 4G1MB 2AYLA 2VWNL 4LORA 4JZEL 3IITB 3KQBL 1Z6CA 3KCGL 2W3IB 1ATBA 1LPKA 3TZIA 2W2QE 1G1QA 3R05A 1CCFA 4ISIL 1L5GB 2P3FN 1TOZA 1NQLB 3V65B 1EQGA 3LIWB 5COXA 1AUTL 2WPIE 1CVWL 1YO8A 1UZQA
chains in the Genus database with same CATH superfamily
2VZ1A 3Q2LA 5E5MA 1WP6A 1WEJL 1KCWA 1KYOK 1A4JA 5DVLA 1E2ZA 2XN1A 2D4DA 5TE6H 5MEOA 1XR9A 4LZKA 4JPIB 1LDPL 2AXGB 2VERN 2A3TA 3GTVA 5HJBA 1L9QA 5DURB 4BFBD 4KOCA 4IHBA 3FH8A 4LSPL 2Y81B 5DFVC 3NH7H 3ZE2E 4G9DA 1GR7A 2X4TB 3EO1B 1PX3A 3BIBX 4Q6IA 3WUWB 1E9OB 2HTKC 3PPEA 1LDSA 5KSBF 3EF7A 3VWKC 1UWFA 1E4HA 3F12A 3OBAA 4FQ1L 4FTVE 5GGSA 1CI3M 1XL6A 1ZVSA 3SY0A 4RS0A 4ZFGH 1NAMA 4LLUB 4PTTB 3C2AL 4RAVA 5FGCB 3ZL4L 1U8HB 2X4OA 1YA5A 4JB9H 2Y3NA 1NGYA 1WAEA 1ECZA 4OJYA 5KSAB 1PD0A 1P0SE 2HFGL 5J6HA 1JHTB 2VQ4A 5E1HB 5LGHH 1Q9KA 4I4WB 3IRPX 4QHLB 2QQKH 2DRUA 3BZ4A 4TLKA 4O58H 5B39A 1LPZA 3U4AA 1QR1B 2FJGA 3FO9B 1FAIH 1HXYB 5JPNC 1M2VA 2G3XA 2HSIA 3H3BC 4NN6C 4C56D 2Y7NA 4JM2F 5HP5A 4XP1H 4Y16A 4LIQH 2AGJL 1FBIL 5HY9B 4JR9L 2HFTA 2RTTA 3DIFA 3B1TA 1G6RH 1WAAA 3H9SA 4JFEA 1RZPA 1U91B 4YSPA 3V0IA 5D1XA 3BVUA 2BMKA 4AIOA 2WLNA 4PJFB 2R29H 1JP5A 2XA8L 4YPGA 2ZOKA 3AQXA 4DK3A 4XB8A 5FO8A 2CK2A 3TWYA 4NQCB 1O6SB 4JPVH 2E4TA 1KIQA 4X6BA 4IIQC 2EO1A 1OF2A 4Y1SA 1GZPB 1O9ZA 1UCBL 2IV9A 3QORD 1MHPL 2OYMA 1HQ4A 3BISA 4ALAL 1P1VA 3ISRA 4FQXB 5GRVL 2XWTB 4KQ4L 2P42B 4OZHA 3Q7JA 2X0WA 4AI7A 2VM9A 3NPSC 3BXNB 2DWXA 3EGSB 4NN5B 2ARJB 2WBJC 3NT1A 1MCIA 4OT1L 5GRYA 1T66D 3CUPB 4DAGH 4V11A 4UIKL 3WHE1 1HQRA 1X6NA 3U48A 1CICD 3S37L 3IDJB 2VWEC 4LO9A 3QQ4B 1J11A 3RNKA 5JPMA 1BVKB 5DT1L 3AWGA 4OZFB 2Q9OA 3A4DA 4WY7H 5KSVA 1VACA 1IM9B 2DM2A 2VOTA 5I1HL 5E24E 2V2WA 4DN3L 1HDMB 4NCDA 4GSXA 1T2JA 1YNTA 5JDJA 2VXSH 4PV8B 5DRNB 3ULVF 2H32H 3RI5F 1A3PA 4JRYA 4JRXB 4PJXE 1NAKH 2OCJA 3DGCR 5HSFA 5DQ9A 4YHML 1KN4H 3JTSB 3SY6A 3E9UA 3GUFA 5E6IC 4XVSH 3Q8FA 1P4IH 1G2MB 5HYIA 3RIFK 2HG5A 3L1EA 5BJTA 3UPAA 2ZXWB 3U0TA 5J1AA 3HBPA 4Q0XL 4R7DB 3N8YB 4B6ZA 4P5RA 1A3RH 3FPXA 4MB5A 2ID5A 1H6TA 3BP4A 1KBGL 3QYMA 2WANA 4N25A 3KQDL 1OO2A 4OB5L 5JORB 4ODBD 1OY3B 5FYJH 2FYYA 1TPGA 3C5SA 1AKJB 4WI9A 5HPMB 4RBPK 5C0IB 4XMPL 3V0JA 2AEOA 4TQPA 3KXFB 1OM9A 3K91A 2NY7L 4FXKC 4LVHC 3K72A 4GW4A 1HT8A 5DJCA 2R1WA 3L4WA 2D2CC 4L8SC 3F62A 5ERWB 1D5BA 2EE3A 1V3XB 3BH9A 2X4SA 2AVFA 1KCLA 3QFJB 4N8VA 3V9CA 1R3HA 3DHPA 3ZTJG 2BSTA 2XQBH 4PJAA 1TR7A 5ANMB 4DPCX 1BGXH 2Y7OA 4MHHG 2DWDB 3IN2A 4YX2L 4MNQB 4D0FA 2FNWA 2P5WB 2ZCZA 3ISWA 4NENA 2X4UA 4POZD 1SJMA 5I6XC 5EZJB 1E5ZA 3OLTA 2WTPA 3GI8L 4DQOL 4IBUA 1P7HL 5ETUB 1ACYH 3ZSTA 1NDGA 1PU0A 4HFUH 2YJLA 1ZEAL 4BDXA 4QXGL 1CVUA 1G5AA 2EEFA 3SBQA 4ZXBB 4Z5RB 2TGFA 3QEQD 4G6ML 3SZ6A 1EO8H 1QRNA 4LMFA 4IGBD 3T0WA 2V5TA 4KJPC 2BS71 2BZCA 5C07A 2OMVB 5AFAA 4ODSL 4A7GA 1SM3H 1YN7A 4DOHB 1HEJC 2G5BA 2PR4H 4JE0A 2H2SC 2YAOA 3KPQA 4QI3A 5FYKH 5CCKH 1IQIL 4MJ6B 2FX8H 2NUPB 1LQSR 3WSQH 1E28B 4UDTB 5KYWA 1C12A 4QJ4B 3LNHA 1NCWL 1ZSDA 1F6LL 1PAMA 4HHAB 2XG4A 3T2PA 2EABA 4UB0L 4Y6DB 3F7KA 4BFJA 1XR8B 1YO4A 4KO6A 3EW3B 4AIEA 2CLVA 3OD3A 3TWCL 1MQKH 2C3WA 1ZGLA 3BQUD 3CFBB 2NQ3A 3DX1A 4S1DC 1D5ZB 4L1DA 2W88A 3EOTL 4Y8AA 1N5AB 3LVTA 4J3WA 3D9AH 1A6ZA 1OGTA 3QO1B 4X5WA 1TQBB 1MDAA 4XOAA 5DGRA 5JIPA 4NPYB 4OZGA 1IGXA 1GS6X 4Q9QH 3ASOB 2DWSA 2E6PA 5HHOE 1AC0A 4M61B 5C0CB 5FFGA 4WDIA 3E6FA 1SXAA 1KUMA 4JY6A 4M00A 1YY9D 5J3HC 1ZPUA 1FL3A 1N59A 1S9KC 1YQ2A 5HYSA 5JXAL 1C8PA 5KYUA 3V4PL 5JHAA 4B7LA 3NFNB 1IGML 3F84A 2BOKL 1BXAA 3F5WA 3VFWB 1WO2A 2DMHA 1TMCB 2VLRB 4UZUA 1U8QA 2PTUA 3LN4B 2XVBA 2BIHA 3GMOA 1IFGA 4ODTH 2CDFA 3GK8H 5TE4L 1AGBB 1U8MA 3LIZL 3Q2NA 1MREH 4GXVL 1C5BH 4AH2A 1KY7A 2JB6A 2NDFA 1E5UI 3BUQA 1D3CA 4FNTA 4YZWA 4BWTA 3GGWA 3HNVL 1CT8B 1ORQA 4NQXB 3MODL 2W07A 3QXUA 3I2CL 4PP1C 1M53A 3QQNA 1GRWA 1ONQB 3LMJH 1H3PL 1CDUA 1Q94A 1DN0A 3E9TA 1GPOL 1EHAA 4FGMA 2BNQE 5L2KD 2J2UB 4PH8A 2QR0B 1KJ2A 2X4RA 1HIML 3LEVH 2N7BA 1LE9A 3ISYA 3MNDA 4PJBA 4NYLB 5E6UB 1W8BL 2YAQA 1HAFA 2B0SH 1U2CA 3N9GL 3KYNB 1S7XA 3RVUD 1X5YA 3KPRE 2X28A 4KGJA 4HEME 4YNYA 4BFEA 3H3KA 5MERB 25C8H 4BD4A 3UO1H 2DTML 4EIUA 4RRXA 1DCLA 2NNCA 3HZVA 3MLXH 4U1SB 1NGQL 4XHQA 3O9WA 5JW4R 2Q10A 2YXMA 1ES0A 4JFOB 3QZMA 3J7HA 3MUJA 4QTHB 1WAAF 1KEGH 3N43B 3OQRA 1CEJA 5C0JA 1F42A 1FCGA 3TBYB 2F7IA 2AV7A 1MH5A 2YD7A 3D48R 5G5DB 3BEWB 4XP6H 4G6AD 1WZAA 7PCYA 1XIWB 3QXAB 3OKNA 4Y2DD 3PAZA 3EGXB 3FT3B 4AQ1C 4PS3A 2PYEA 1TJXA 3G5WA 2V17L 1ZXKA 4JY5L 1P7QD 5TF0A 5BQDA 1CUOA 3IK2A 3OF6D 1MFCH 3GCXE 2DF3A 2W2OE 5IP4A 2H0EA 3F7LA 1U8OB 4HAKA 3SYCA 4XMLL 4K71C 4PGDB 4ZO7A 1OAZL 2BIIA 3D4ZA 1UUSA 4M62L 2HT3C 3X12A 1JYWA 1PQZA 4PWKA 1FQ9C 3TO2A 4ODUA 5HYFA 2MCPH 4RFOH 3AXHA 2P52A 4EKXA 2XZQL 4YAQA 4B27A 2WOBA 5GZNC 4MLIA 1XQ4A 2ZXGA 3E2HB 1GYCA 3HS9A 1JZ3A 4F8LA 3WEMA 3VFPA 4E5XG 2HT4D 3L3OB 1ZAGA 2IV8A 3FU7B 1QATA 3O8XC 4JG0H 5KBMA 1AIFB 4LCIH 3S3SA 1UB6A 4XE0A 2OI9C 1NBVH 3E6HB 3QT2A 4MJ2A 2XV6B 3FRPG 3U2IA 2OXHA 3U4EB 3FTGB 5H35A 4NT6B 1B90A 3G08B 2DYPD 4RQQB 4XMTA 4YHZL 4RZCB 5KJRL 1OP9A 4M7ZB 1BZ7A 1XCQB 3CN1A 3EFOB 3IVKA 4BXSV 5JOFB 4M4RB 5IW1B 4QNPE 2ADIB 3IDXL 4V1DA 1MCHA 1URIA 3CHSA 3ET9F 2VDMB 3G6JF 4X80L 3VRLF 1I1FA 5DA4A 3SGEH 4KX7A 1DE4B 4R4FL 4JHBA 3OHXA 2BVEA 4O51A 2CJTA 4YE0A 1HWWA 1YNLL 5LN8A 1TZ8A 1P9MA 3ZDXB 4GO9A 3L5JA 3UMNA 4AXWB 3UDWC 4DCQB 4Y16D 1DBMH 2AAAA 3VNYA 1S9VB 3QNZA 1DFBH 3OGCB 3V6BR 3OTTA 1SDDA 1BBDH 2NY1C 4X83A 4BUGA 1Z9LA 1FWXA 4G1MB 3HS0A 2P46B 4JFED 4WI4A 2Z91A 5D1XD 4M93B 1RFDL 3MRHB 1BAWA 2QKSA 1JGDB 1F6AB 3G9VA 2A77H 1HNYA 1MFAL 3O6FA 1SMDA 2XU9A 2F61A 1FYTA 1P4LA 4RWYL 1X7QB 4JO1L 4Z78A 1K5NA 4M8VA 2OW6A 4R4ND 1S9YA 3D2TA 1JTOA 4F1ZA 3CVIH 3QUZB 4Z0XB 4XP9L 2E7HA 2O6DA 1P5UA 2OMWB 3O41A 3QIBC 1NQLB 4HDIA 1UYWL 2BZDA 1NBZB 1CLOL 5LKNA 2Y9RT 4XOBA 4X7EC 1J1OH 2CLRA 3O45B 1RHFA 1D7DA 2EYTB 4B7IA 1UZQA 1OK8A 2I07B 1Z6JT 1NCNA 2W95A 1GS8A 4PJ8B 4M5YH 4F8NA 1EAOA 1TTCA 3IFLH 4XCEB 4Y4HC 4U3HA 2JK5A 4J3UA 1I9IL 3DARA 4XPGL 4XRCB 4YBLC 2P3YA 1R0AH 3MA9L 4HBCH 2IALA 4Y9EA 2OP4H 5DK2A 5B7MA 4P2YA 5BO0D 4BZ2A 1GYUA 4U3XA 1GKOA 3L9RA 3E1F1 3FRUA 3GXMA 5FXCH 4MZRA 1AQDB 2BOUA 5L7XH 3FB7A 4YH6A 3NABL 2D1JB 1H0DA 2FQEA 4OM0H 2IANE 4H5SB 3U7WL 3TO4D 1AR1D 4JRYD 4PJ7A 3RZCB 4F9LA 2AQ3A 1OZTG 3O6LL 4MJIA 3V0FA 5TDNB 4PGEB 5LDUA 3MO1B 4X4XA 5AZ2L 1GTFA 4HKBA 3PNWA 4PVMA 5D2NE 4U6YB 3ZJAA 3ZKSD 2XBZA 5HGAB 3NP3A 1ZLUK 4YHOH 3LEXA 3TBDA 1P84J 2GC4C 5KSBE 3LH2L 1EBVA 2H45A 4NJAH 2PPDA 2I9TA 3OMZA 2XG5A 3MREA 2VB5A 2ZUYA 3OM3B 3KLAB 3DXAE 2YD6A 1IOEL 1NEZG 3RG1C 1HESA 5EF3A 2YKLL 3PHOB 3HPJB 5KOMC 5AVYB 5A1AA 1BPVA 5FKPA 3ZVVA 1TJIL 3SKMB 2UUDH 3WLWD 4TLTA 3GC3A 1QFWM 3MBEB 1N2RB 3MRLA 2AZAA 1A6WL 3DX8A 2R2EA 2XIBA 4P05A 3H2PA 2ERJB 2QV4A 3UTSA 1OOWA 2WMPB 3DTUB 4MXVF 5HHVH 4Y4FC 4X42A 3GRWL 3HC4H 3SPHA 2IMNA 1MRFL 4Z76B 2MJWA 5DZVA 3LSOB 3N1GC 4NM8H 2FD6H 2J1YA 5I9QC 3FO1B 3P4OA 2A6IA 4GS7B 3HC3H 1CZ8L 3F65A 5BVPH 2NTFA 4KKRA 2GTWA 3CU1A 4K3DL 5CEXB 1NCDL 2CGRH 3D39A 3MR9A 4K15A 5HGDA 2YC1B 1R5VB 5A2IH 1ZDQA 3QQDA 4G7VH 1V7NL 4MYPA 3VD7A 4JFZL 4XMKL 3RL2B 4AIZB 5IMLA 3UGXA 3P9LA 1KJMB 3US0A 4BE5A 1YVLA 1QRND 4OW6A 3H5CB 4A7SA 1IQDB 3WUZA 5I1EH 1NCJA 1ZKAA 3ZHLA 1YNKL 2YD8A 1XGZA 4RFNB 4N2NA 3CMGA 3FBKA 2N4IA 1ADXA 1WFOA 3KL0A 4KKBC 3T4AA 4ERSH 4XO5A 1Q9LA 1G0YR 2EDHA 5A7BA 4P2OA 4FFVC 4OQTA 4RLDA 3OLUA 4GFTB 5AOIA 2A74C 3SEPA 4XXWA 3TH3T 2AP2A 2OMTA 2NNAB 4DNLA 1UA6L 1ADWA 1MJ7L 5F1OB 4RAHA 3D09A 1UQSB 1VB9A 1SBBA 3VACA 3NCJL 1U3NA 3TBWB 1WH0A 3TX4A 1SXBA 1KLIL 3WMPA 4U1JB 5D71H 2BNRB 1KKEA 4UOZA 4BHUI 3X1BA 1ORSA 4K94L 5CILH 3DROB 3FTYA 4KRLB 1MCBA 4Q56A 4KRPD 4HJ0C 3P3YA 1T6BX 4X8JB 1QBLL 3IXAB 4IDJH 4DTGH 1HILA 2IH1B 5F7WC 1FE8L 4JCWA 5ADPH 3ZIYA 5K59F 3U0PB 4L1SA 2BY2A 4YGVA 4Z3FA 2ADGB 3FQTA 1Y6KR 3L3IA 3AQYA 4ONFL 1M7DA 1AH1A 4IK6A 2W1NA 5I82A 2AQNA 5JHLH 3B9KC 4LARH 3QFDA 5D7SL 4LAQL 1OOAA 1EAPA 4HBQA 5I15L 3GBNL 5EWIL 5DJDA 4ETYA 5E2UH 3L1FA 4FNQA 5FO9A 4RISL 4A7VA 5C3IA 3WNKA 1J87A 4ODVH 5ESAB 2LR4A 3ULUD 4CUCA 2QMKA 4QGTA 4W9FC 1A02N 3GLZA 4YSDA 1ADQH 1XGYL 3LZPA 4U05A 5F7NC 1T2QL 2RQEA 3RWJA 2ICEC 4NRYA 2WQUA 1C1EH 1JV2B 2FLBT 1OSPL 4NRZB 3OZ9H 3NIFE 2GAZA 4J3SA 2VVVL 1CCZA 1T7VA 4WHYH 5C71A 1H8NA 1MHHB 3ZYGA 1ZLWH 2Q6WB 4Y7BB 1FO0B 4XNXL 5T3XH 5DTFA 2D4FA 2B3IA 3P9WB 2YD9A 4HKZB 1FIGL 1FNFA 5TH2A 5HYJA 1MCOH 3FCSB 1JMZA 4KUZH 2VDRL 5C8JB 2D7QA 2G3NA 2J73A 3AM8A 5I6PA 3RVWD 1BF9A 4FG4A 4KMQA 3MLWL 3CK0L 5FUOL 4FX5A 2GD4A 4QRRA 1I1YA 1G7HB 2JIXB 5EOCJ 3OAZK 1IQWL 1BLNA 5IESL 1UADC 4TN9A 1FJSL 1RD6A 4LHUG 1QFKL 5KYNA 2V5YA 4IRZH 3DETD 3LS5L 1BZOA 3B9AA 5HYQA 2VXTH 3OR6B 4ZPTA 1FNSL 3X14A 2O30A 1M6UA 2DM4A 4TNGA 5G4OA 2Z0BA 3KPMA 3UERA 5EDSA 5EUKB 1AIZA 4HXAH 2VDQB 5AYUL 4Q58C 3DOSB 4MMZC 4DO4A 3VB9A 4Z7QE 3SO3B 2CALA 4OZ4B 3FQYA 2NPLX 4DGVL 1FZMB 5JYMA 2PYED 4RNRA 2HJKB 1JVKA 3DK0A 3I75A 4Z9KB 1HC1A 1TFHA 5CEYA 3V9FA 3EBHA 4HLJA 1MFNA 4O02H 4NXSA 5CGMA 1MLBB 1OAYH 2DQCH 4H25A 1UA7A 1IZJA 5DD5H 2M26A 4RRZA 5AAMA 1CFNB 1L9RA 3TC9A 4NUJA 3NT0A 3CVHL 2AK1H 3MUY1 4O2EA 4R90L 3QUYB 2K7QA 3N5AA 4ZD3H 3FYIB 4E9TA 2ZOUA 5IQNA 1HNGA 3N1FC 2WXRA 4M43H 3VXPA 4JO5A 3FQRA 4GSUA 3BP5A 2ZYHA 1DDXA 4BQCA 1UFGA 5IFJB 2XQYG 5L6YL 1RZFH 3VD9A 4OTXH 2BSRB 4IS6B 3LRMA 2PP7A 5FYLH 2UXGA 3TEWA 4R7VA 1C9SA 2EIKB 4FM5A 4YHKH 3IETB 3QGVA 3FMGH 1KFAL 1QUPA 3QA3A 3V4VL 1N19A 2NZ9D 2P8PA 3MJ6A 1NMBL 1V3KA 4I5BA 4GLRH 3LD8B 1JTPA 4R0LB 1JWSA 1XCWA 4H20L 2OMYA 2DDUA 1J9RA 1HOEA 2BP8A 2GJZA 5LAXA 4DUVA 4NI6A 5EEUA 1TJHH 3GSRB 4H1LA 3AREC 1GJIA 4FQQA 4AGLA 1ETB1 4X4YB 3KBFA 4GAJL 4ZS6C 3W82A 5KVFH 1C8QA 3B3IB 2R0LL 2KPNA 4JVUA 4OFPA 3KG5A 4NSKB 2NY6D 4L3ED 5FC9A 4PJCF 1MELA 5J12B 1FGNL 4TPRL 4XPBL 4XN2A 3Q9PA 4V1DD 3SDCB 3W39B 3W9DB 2JFCA 4RGNB 3VXMD 1U93A 3EJRA 5GS1A 4G6JL 2XWXA 4XO4A 1CXEA 4RMWA 1FPTL 4GI8A 3L4CA 3ZZLA 1NPUA 3D3VA 3DURA 4F2MA 2WSKA 1T5XA 2R39A 1NMCC 3QWRA 4KK5C 1NJ9B 3MXWH 5SWSE 5BW7A 3DJZA 1F6FB 4PBDA 1NWPA 1L9MA 3BW9B 3GO1L 4QRPD 1JHLL 3BUPA 4JJOA 3S9DB 3QWNA 5EU6B 1G4MA 3SDDA 3VFOA 4NZJA 3REVA 5A2JH 1FDLL 1A7BA 1A7NH 5EBWA 2AEIT 1X5HA 3FHEA 4Z7WE 1U33A 4HOZA 3O6FD 3TNMB 4MQ7A 1FYTD 1I7TB 2G2NA 5DRZB 5FDWB 3RBSA 3C87A 4J3VA 3QEHB 4LSQH 1NEZB 4L0PB 1KOAA 1U8IB 4G11A 2QSCH 4KI5C 4N2EA 3SQRA 2HKAA 4R2GB 4NKOB 3HE6A 5J6GA 1FSKC 4MNGE 3DSNA 2Z8WC 4J8RB 1G87A 2VNCA 4QO1B 3VCLB 3VQLA 4AJWA 2VDLB 4M6OH 4MB4A 3IPFA 3RUGF 3HC0B 1QSEA 1QKZH 5IMMA 3O11B 3NRQA 2I60L 3ZKNC 5EHFA 2ILLA 2CO6A 4GY4A 1KCVL 4NO2A 3LOWA 4WU7A 4X4MA 3TURA 1RURH 3PJSB 1E6JH 1MLCA 1X7TA 4LVNC 3PGHA 1IVTA 1E27A 2CIKB 1IL1A 3LQAH 1OAXH 1MWAB 5IF0A 2XXMB 1Z9SA 4M7KL 4P3CL 4OI8A 4MJID 5IGXL 4EUPH 4S2SA 2H0FA 1P84K 1QIUA 1EZUA 3CVDA 2CR3A 3T0VA 4FCHA 4IM8A 5EU7E 1HCFX 1OTTC 5A16A 1IFRA 1E4XL 1LD9B 3CPUA 3O3BB 5HGHA 5IQOA 2R4RL 2WXQA 4M29A 4AGOA 4AGMA 4WW2C 5D5MB 1J5OL 3NJNA 4HF5H 1KTJA 4U1LB 1VDGA 1OPGH 3AXLB 4G9FB 5T3ZD 4FQHA 2Y6TE 1G9NL 3QJHA 1CXIA 1T0OA 4N2OA 4HCRL 2E75C 2OMUB 4A2MA 1QW8A 4AEIL 3S2AA 4Z3IA 5LG1A 1QVOB 1A3LL 3C75A 4WWKA 4WFHE 3NJVA 3A3YB 3N8WA 1OE2A 1YMME 2EYSA 4O1ZA 2F68X 2YRLA 4G8EA 1KACB 5JO5B 2ED7A 3GBEA 2ZCKL 1DBBH 1PSKL 2HX9A 1CK0L 4TUKL 4WCYL 2AYLA 1A47A 3UTSD 3HI1A 3FDWA 3I9AA 1ET5A 4HALA 2WINA 5BZXA 1TEFA 3BKJH 3HNSH 1BM7A 3FN3A 1FL5B 4QAMB 5ALCH 5I16B 3TZIA 1CD1B 3C09C 3VE0A 1PG7X 1MZYA 2FWOA 5IEHB 3G6AB 4PJDA 2OR8A 5EUOA 3LHPH 4KTDL 3OAUH 3CSBA 4CSPA 1AGDA 1MVYA 4HIHA 3SE9H 4RAUA 5JHDB 3MMEA 3LIWB 3I50H 3VD4A 4PRPB 4Z7UA 1HYSC 2WPIE 1SN0A 1AJ7H 2C3XA 3EH1A 2VKWA 4GU4A 1VRSA 3PG2A 1V54B 4X6CA 2C8NA 2GIYA 3NSXA 3FC8A 1H19A 4WUKL 4YEEA 1KYUA 2HVJB 4FE9A 3CQPA 4KX9A 3QULB 4DIXA 2MHPA 1I1AB 3HPTA 3O2DH 5GGUA 4IRJA 4JG1H 1N64H 3M1OA 5JIMA 3GJFH 1BX2A 3PHSA 1LGVA 3CG8A 2APSA 4KK6C 4M3HA 5T1LB 3VUAA 4A6YL 1DDTA 4QRQA 3AU0A 3NCMA 3SQBA 4Q14A 3V0EA 1UURA 2K6YA 3G5ZA 2MSPA 2WC7A 3RJDA 2F1EA 2O6EA 2NYZA 4JANB 1NUFA 1A9EA 3MUGB 4JPIA 4Z1PA 1K72A 2AXGA 5E4AA 5IV2A 3TP4A 1Q1JL 5JR1L 2Y2TA 4LPWA 4M02A 3WELA 2OL3B 1SJXA 3QAQA 4LU5L 4Z8FL 2X4TA 2ZSWA 3EO1A 4XC1H 5AKTA 1QBAA 4HMEA 5DF0A 4NPKA 3SJVB 1YEEH 1WUZA 3GBLA 1VZGA 3FT2B 2IBGA 3WMQA 1WZKA 4KJWD 5IKCA 1FZJA 5IKQA 1I75A 4XVTH 4V2BA 3AY2A 5IBLC 3EADA 4E9VA 4YO0A 2VC2L 4PTTA 5DYFA 1QEWB 4HWBH 4KZDL 4CVZB 1T2XA 3QRGL 5F70A 2YPVA 1WA0X 4BCYA 2PW1B 5DFWH 4DKAA 4E9XA 1T20B 2CK0H 3FTSA 3NSJA 1X7SA 4WI0B 4DESA 4NGAL 4HJGB 1AOZA 4I4WA 4QHLA 2VZ3A 1F41A 2FATL 1OQOA 1JK9A 1QR1A 1NSNL 4L4VB 1VHPA 3FO9A 2P7TA 1UWXH 2JTYA 4JO4H 4Z77A 4DT2A 2IH3B 2H6PB 4FZEH 2CDEA 3JV5A 1MSPA 2DIBA 3U83A 4Y2LA 1DBAH 1PZBA 4KFMA 5ICZA 1UZPA 1MJUL 1SXCA 3RGVB 1FP5A 3INUH 4CDHA 4PVBA 4Z7WB 4PRNB 5J9PB 1R3IH 1JZEA 2YAMA 1RIVH 1R5WA 1I31A 5I17B 3MROA 1Z66A 4XNZB 5DQDL 1F90H 5I1IL 4BTTA 2DL9A 3OV6A 2XZAH 4EVNA 2X4QB 5JPNA 2I7OA 1GAFL 3OKDB 5C09B 1F3RB 1G7LB 4ZOCA 5HYJD 1MFDH 4YSQA 1S7SB 2GEQA 3T0XA 2H9EC 2H2PC 5I1AB 4XC3H 1Z3GH 5E8PB 5FM4A 4Q9RH 2D7TL 1BXUA 2HFEA 3H42L 4K7PH 4ZK8A 3FFDA 1EV2E 4NKIL 3MJ9L 2ARJA 5I8OH 2APBA 4QRRD 4JHWH 1FNGA 2BH0A 2BOLA 3HCVA 3CUPA 3SYPA 3NZUA 1AMYA 3HBQA 3NVQA 3UZEC 3EZ8A 3IS0X 1Y1UA 2DQIL 1HH9B 3HAEH 3LC3B 4J4PA 3IDJA 3WFCL 1XO8A 4OZFA 4JFFE 1G1TA 4JY4A 4XVJL 5DJYA 3QS2A 3SDXF 1LWRA 3QDJB 1WIPA 2FQFA 1PIGA 4EN3B 1XF4B 4GMTH 1JZIA 43C9B 3PWUA 1RULL 5ADOL 4L4TD 5DRNA 5BQ7A 3HR5A 5L0QB 3L8QA 4RUTA 2VMCA 2GYSA 2V5RA 3LRSA 4HSQA 3JTSA 3ZTNH 2A9MH 1OP3K 2D0FA 4LF3B 2F5AH 3A47A 4ZOEA 5F1AA 1FVDA 1L7IL 2CCLA 4XPFH 3LTVA 1XH3B 4KJQD 5K9JL 4APQB 2OZ4L 4P2CG 4R7DA 3N8YA 1JPSH 5T1MB 3FAXA 2WKOF 3P0VH 3PFUA 3FBQA 3QJFB 1H8OA 2NY4B 4F2EA 3POYA 1CTOA 4FFZA 1HZHH 3LQAC 3V64C 1J8RA 3JXAA 4E9LA 1DVUA 1XMEB 2H7WA 3FTWA 2G60H 3C5JA 4UNVA 2OW7A 3DHUA 2VABA 1BEXA 2UZPA 4UQ2A 4YDLC 5C0IA 4U6HB 5E6IA 4OJDH 2BHFA 5FFOA 1JV5B 3KXFA 1BMGA 4CADB 5PAZA 3TBSA 2BOBA 2JELL 3PU7A 5DMGD 4X8GA 3WIHH 4HWUA 5AB9A 4PFEA 4YSUA 2F19H 2WW8A 4GP5B 4PY7B 3QWOB 5ERWA 3WENA 3DDGA 3QDGE 3PXJA 1KCRL 3QFJA 1CFBA 4NNPH 1F4AA 2CMRH 2GY7B 2FAUA 5K39B 2P5WA 1FV1B 1HZLA 2OCCB 2VUOA 2D03H 4MQTB 4LBEB 2UZIL 3KJ4C 1J10A 2DQTH 4H7VA 5EZJA 2FEJA 4Y8DC 1ZWIB 1QLRB 5HI5D 5KAQF 4FXKA 1KYDA 1MEXH 2ZX7A 5I1LB 3U0WL 3MUHL 4KJYB 1J5DA 2N0KA 3I02B 4PG2C 1TKWA 4FNRA 4YBHA 4OIBA 3MLRL 4Q52A 2R69A 4QWWD 2AXHA 2WIIB 3LS4L 1FLTX 2UX7A 2TRYA 4PJ5E 3CZFB 3D3VD 3MV8A 2PP8A 4KY1L 1IZKA 1ZVHA 2NY3B 4PLOB 3IGKA 4TVPD 4H44C 1ZV9A 3QWRD 5AKSA 4FZ8H 3CDCA 3ROLB 4ZMAT 2HYMA 4QIRA 2NLJA 4MJ6A 2NUPA 1E28A 3N50A 4BBWA 5AEAA 3KD4A 4UM8B 5ITBH 3QXTA 3SDDD 1NAML 4HWZA 4RA0C 4S0HA 4QHUA 3G6DH 3L54A 1XR8A 4FYSA 4MAYC 4N2GA 1WTLA 1BREA 4KQ3L 5CIPH 1QYGL 3PQYA 4N8PA 3CFBA 5IVXF 3W56A 3IKKA 12E8H 3MLYH 4ODHL 4G8FB 2XBYL 2F18A 1CFVH 1D5ZA 1WD9A 4Y5XB 5FCSH 1E42A 2XOTA 4NIKB 1F4XL 4PBWD 1ANUA 2JKXA 4Z7VB 3IDMB 3DMMC 5EU4B 3WV0A 4NPYA 2BZ6L 4MB3A 1REIA 2W0FB 5T1KB 2OYKA 4KROB 1KV7A 5C0CA 4YHNB 4GAGH 3NPZB 4LQFH 3H2QA 5AUMA 3HE6D 1YY8B 1H15A 1IEAB 1QTYT 4NQDD 3DI2B 4IBLT 3VFTA 3TH3L 1ZCRA 2DM7A 3N41B 4UV7H 4UT6A 3D52A 1IBZA 3NFNA 5TPWH 2XVKA 3FU6A 3L7EA 1F0LA 1JGUH 3LDBB 3MRIB 2VLRA 1J8HB 4TLSA 3VI4F 3NIDE 3LN4A 2DH2A 4G82A 4G42B 5F8QC 4WWNA 3K71B 3QZWG 2X2UA 3O6MH 4YHYB 3F7QA 4YE4L 1EUTA 2IG2H 1FH5L 1HS6A 2FX7L 4WGVB 3QPQC 1L6PA 4GINA 5KBNC 3GEFA 1D6VH 1ETJA 3OJVC 3ME0A 3U2JA 1DANU 3NIGB 3OPZL 5DUPL 2PPAA 2XKNB 1C5CL 4Z7NE 4LSRL 5GS0L 1Q9WA 4BKTC 2JTDA 3VSVA 1U3HB 4OCSH 4ANVA 1BOGB 4NLAA 4L23A 1CFMA 3GSVA 1E3ZA 1UZKA 4MRBA 1MY5A 2OTPA 4P2QE 3ZQWA 1Q72H 3MV01 2P95L 1JGIA 3NTGA 1XTLA 1CR9L 5E2VH 5EN3A 1RJYB 2A0LC 3KYNA 4PJCE 5EEWA 4AVIA 4ELMA 6CGTA 5CLTA 1QBML 5J6SA 2J6WA 3BD5A 4OD1H 4UNIA 4WWKD 4R8WL 3GSXA 3M86A 3UBXA 5CP7A 4D9QE 2YBGA 3LKQA 4DO6A 2E8ZA 2F2HA 4JFOA 3CHRA 3WTUA 3BAEL 1BQLL 3MTXA 4DVRL 1PEZA 2B14A 1T0NA 2KLTA 2KT6A 1FSBA 3OB8A 4U3SB 4AQEB 3TBYA 2PHBB 4FA7B 5G5DA 3ZHFA 3BEWA 2KL7A 1XCTB 2PPEA 2RALA 1G1OA 1IKFH 2DDQL 3ECVA 5HVFB 4Q97A 2E6JA 3EGXA 2N3JA 5FEBA 3WXVL 2R4SL 1GGYA 35C8H 4MCYB 2XTJE 2PKDA 2E7DA 1RJZB 4BUQA 1K9TA 32C2B 4GJTB 3B6SB 2XACC 1PNCA 2Y80B 2AKRA 3CHPA 4I8DA 3GSWA 1EO7A 3V4PB 2KZBA 2HWZL 1ID2A 2KHAA 5MEPB 5E08H 2XN9B 5CFHA 1SOQA 1AZVA 3FQ2A 2EIJB 5I24A 2P24B 1XD0A 4IRJD 3EO9H 3EYQC 4GI6A 1CB4A 1M6OA 4PGDA 3RDTC 3VXSE 4ZMYA 3ZN6A 1PG7L 2WKGA 4MXWL 1SJVA 3PGFH 1JDCA 3RWGB 4MCZB 4PV9B 3ENEA 4NNYA 3T6VA 1I3GH 4TQIA 3WEXB 4WHTB 2OK0L 5I6MA 3ARGB 4XXCC 3FT9A 4X6DB 1RZJH 5DURD 5D2LF 3ZW3A 2ISDA 4A39A 3FU7A 1SEBB 2I85A 4KHTH 4R7NB 4UBDD 3UAJA 3EHBB 4OIIH 3NCYS 2D9CA 2IAMB 2FECL 1BM3L 3E6HA 1CLYH 2YEVB 1UXWA 4PJGA 1DDHB 5E2WH 5E4IA 2Q8AH 3U4EA 5F3HA 2ZAGA 2BSDA 4CKQA 5ID1B 1LVEA 3IJSB 2V2XA 4HS8H 1AP2B 5FA4B 1S7WB 5DMYA 1H6FA 1SUJA 4RZCA 4AG4L 3DO3A 1RZ8B 4ATTA 2YFOA 3BPNC 3N1PC 5CU9A 4ZNEA 5JOFA 4M4RA 3BSZH 5IW1A 3ROOB 2ADIA 4H2AA 5KSAD 1JZHA 1QHQA 2J25A 3DVIA 4IU3A 1QFOA 3E8UH 3W0WA 1SYSB 3VD2A 2ADJB 2XC8A 1A4CA 2HTKD 3ZTCC 4TQEL 1F1GA 3B8SA 5F7YC 4P5KA 1U92B 2Z31C 4YHLH 3UTPE 3J2PA 4AXWA 2F5BH 3VU1A 5I5MA 1TVHB 4QHPA 2I9LB 3QR1A 3QXVA 5KVDL 5F1IA 4LSUH 1S9VA 2P4AB 1KWGA 4P99A 3GRGA 1TETH 3OGCA 4JO8A 5IJVA 3L17A 2K3HA 1E4JA 4G1MA 3S4SB 3QCTL 3B1UA 4HCFA 1Q0XL 4TNWF 3PP4L 1CCFA 1BFTA 3A6CL 1DVFB 3MRHA 3QUMH 1CDHA 2F7RA 1F6AA 1AZRA 2YAPA 1WISA 1BFVH 4CAGA 1X7QA 4X7CC 4NQCD 1ZLVH 5CUSL 3S3BB 3UDWA 3HG4A 2YEQA 5K9QG 2W9EL 4H88L 4Z0XA 5T1DL 1IGIL 5IHUH 3CFMA 2OMWA 3LKOB 2L3BA 1RVFL 3KCPA 5JQ6H 3WFHA 1NBZA 3ULUL 1MAKA 2Y6SD 3C6SB 4K7FB 2CD0A 3S3DB 3P11H 3VXUE 1WAPA 1SQ2N 3O45A 2EYTA 3BYYA 5B1KA 4I18C 4WTZG 2I07A 4EZLA 4PJ8A 4EMZA 4RBPH 5D96C 2VWOL 2ZUUA 2B39A 3W81A 1JFQH 1GYWA 5FKAB 5KUKA 2WFXB 3P3UA 5GPRA 4N68A 4H8HA 2G3MA 4J4PD 1IJQA 4JDZB 5GQBA 4PLKC 4I2XA 3JWNG 4JNXA 1IM9D 3QIBA 2J94B 1KJ2L 4A7UA 3KVPA 4DZBB 5FR3A 3R1GH 1A6TB 3VXTB 9CGTA 1XSOA 3V52H 4MGXA 1R5IB 3A21A 5BNXD 3K81A 4U6TA 5L8KB 4AC4A 1R34A 4YXLL 2OMBA 3TBTA 4Z7NB 4OJEH 3F7VA 4MD0B 3TBBA 2QDVA 4U1HA 2B2XL 4ZAEB 1OLLA 3DX9A 1KGIA 4Y4HA 5ESQB 3K6DA 2RHPA 4YR6B 5EBMB 3ZTJH 4PS4L 3EYVB 4H0GA 4A55A 2AI0H 2P80A 1I7UB 5B38A 3CZNA 1UM5L 3OXSB 5T5NG 3X1NA 1ITCA 4G7YL 1EZLA 2VDKL 4Y9FA 5H2BB 2QVMA 3BRFA 1JPGB 2E6QA 4HKJB 4PW9A 2NY2C 4B0MM 3V6OE 1AS7A 4UILL 4FP8H 2JJUA 5IMKB 4UT7H 1U0QA 1V3LA 1AKJD 4TL4A 2N59A 5GRXG 1S5IH 2HN7B 5E6ID 2O93L 5KS9F 2QHRH 4HK0B 3KXFD 3SKMA 4OJAA 3QEUB 4J3OH 1Z9NA 2IFFL 3D4CA 3B9VA 2CBPA 2ZOTA 3UABA 2JKIS 1MG2C 5CISA 1AZCA 4OLWL 4M5SA 3VXRB 4QAWA 2E5EA 2WMPA 3TIDB 3DVNA 3UX9B 3D0VB 3QFJD 3BPLB 5I71C 2ITDB 3FFOA 3MRFB 2XBWL 1VADA 2WXIA 3KPNA 3MRBA 3FO1A 1MXDA 2P5WD 1N4XH 2VXUL 5MEQB 3VM5A 4D0EA 1ZE3C 5GRWA 1PKOA 3CVCA 4JMXA 1IQNL 2AJSL 1EVUA 1ECYA 3EJUA 5CEXA 1UCTA 1PZCA 1BQHA 1XF1A 1TCMA 1R5VA 1VIWA 4PJIF 4JZOA 5C70A 1W8OA 4ZXBD 4F7MA 2NXYB 5D7KD 4OLVH 4GQ9L 1L9OA 3KPLB 5D6CB 2VR8A 4Y4FA 4PB0H 4JQIH 4RCAA 5E56A 4K73A 4Y5VC 1ZK5A 1IQDA 4RFEA 3U1SH 3TCXA 2H0PA 3IRZA 3VXSB 3SOBL 3IFOA 4OVVA 2F53B 3QZWB 2NX5E 4R26H 5EBGA 2GT9B 3JWNE 5D1QE 2O5NA 3OLGA 2GQHA 3A4FA 3CSTA 4QYOB 2OR9H 5F88B 3EDJA 4E9WA 5I5RA 1YEJH 4PMEA 1CBVH 3HFMH 3VI3E 1TF4A 3WO3B 2G9HB 2NNAA 3PUUA 4CJ1A 4A94C 2MCAA 4H8WH 1UQSA 3PQYD 1KJVB 1WBXA 3MLVH 4KJPD 1TVDA 5DDHB 1WC7A 2FO4A 1QABA 5ITFA 2ZF8A 3QJZA 3C60B 3IE4A 1O6TA 1APOA 2CJUL 1P2CB 2CHZA 3S2CA 3LNEA 4A2FA 1QA9B 1PL3A 1A7RL 1KEML 5IB3B 1T5WB 5HHME 5IQLA 3OXRA 3MRMB 5C0CD 2BP5M 2YOAA 3FOMB 1RZJC 3K2KA 1I9JL 4ZO8A 4X99B 4R5VA 4NP4L 3WN5C 3E0GA 3UAFA 4RRPG 4S1DD 4P2RA 3OKMB 4B9IA 3ZT5A 3U0PA 3FHAA 4OKVB 4OF5A 1GVIA 1NFDB 3LRHA 1BFOB 3HN8A 5GJSL 2VLRD 1DN2A 1MHCA 5D7JB 2DQJH 1OCWH 5AVXB 2DBLH 4B9PA 3DX2A 1GYAA 5F7DA 2K4WA 4BRVA 5BMFL 4DGYL 2WPKE 4FG6C 3WJJA 3VX1A 5I6KA 5JZ7C 1ZY9A 4HUUB 1J8SA 3I3DA 3MJ8B 1JV2A 5K1VA 2XUWA 4NRZA 3IFNH 2Y7ZB 3KYOB 1FN4B 2Q7NA 1FGVH 3DRQA 4IEFA 4GUCA 4CMHC 2R15A 3FQUB 4F7PA 2Q6WA 3B9KA 4ZJ9A 2FB4L 1N8ZA 1I85A 3PIQB 1GW0A 4XMUA 3HZYA 3L3KB 4FNUA 1KY6A 3ZXAC 4HKZA 2ZJSL 1ZOXA 4TSCH 5EF2A 4MA1C 4HPYH 2P43B 2NNRA 3FCSA 3VXUB 2Y2WA 1T1YA 1JL8A 2C9VA 1OB0A 5DWUH 1FFOA 3QUGA 3UP1A 1OARH 2P8MB 4AKQA 5DUMH 3DSFL 1TEYA 5ACLA 2G2RB 2ED9A 5D7IB 3TA3B 1G7HA 1FYHB 3DX6B 5F0JB 5KN5B 1K8IB 4LNRB 5GS2H 3IBEA 4PB9H 4CSYA 2IPKA 3IGUA 5DEZA 4UAOC 1G1SA 1RK7A 2B1HL 1L6ZA 1ZDSA 2EH8L 4FKKA 4M48L 4OFDA 1EEZA 3K6NA 3OR6A 4DKEH 1TTRA 1XH0A 4FLRA 4OLZL 3RURA 1X9RA 2OTUB 4EN2A 2V4LA 3LKPB 2NSXA 4HJJH 4YDKL 3V0WH 1A2YB 5T3ZL 1TZAA 2UVEA 4Z6AT 1S3KL 5JQHC 4W9HC 3B7UX 3LX9A 1K4CB 5D6DC 2J88H 5F96L 2H5UA 1JVLA 1BLIA 1T7WA 5CKMA 1F58L 4OIFA 5FX3A 1QD0A 2E46A 2HJKA 3TBCA 2NMSA 4GH7B 4C56E 5E4EB 2WXLA 2FJHA 2WYGB 3UYPA 4PWJA 1MLBA 1GCYA 4KHXL 2A1WH 1ZT7A 1UJ3B 5LXGL 3AS2A 1D7BA 3IMVA 3O4LA 3LXAA 1NCOA 4CN1A 5E94B 2WIMA 5ALBH 1DEEB 5DVKA 1NIAA 4PHXA 3ZLQC 2HPTA 2Y69B 5F9DC 3ECBB 4MMZA 1I7ZA 2WNXA 5IKVA 4K5MA 5AZEL 1X5FA 3QR2A 5JBAE 5FHBH 5B3JF 4AL8L 2IADA 4FQJH 2ZIDA 2EADA 2G3ZA 3EDEA 3LZFH 3BZDA 5IOKA 1P7KA 1Z9MA 5IIEB 4NXKA 2AS5M 1X5IA 2XSKA 1BQ5A 4LCYA 4U1NA 1YPZA 3FF7A 3IETA 1L7TH 2NUTA 3C9NB 3P69A 3TJEL 2HRLA 1IC5L 3QE5A 3W38A 3CXHJ 4I0KA 5DD3H 3SKUD 2IWEA 1VCBC 2HAZA 4R0LA 3UAJD 4WO4B 2OYUP 8PAZA 4WEMB 5E2JA 5FGBA 3D0LA 3TGXA 1BQKA 1XB6A 2FBJL 4FXLA 4M3JA 4N85A 2HT3D 3GSRA 4FTDA 4X4YA 1S9WA 3TVMB 3MACH 1D5IL 1JL9A 1JVOA 4J3OC 4AUUA 4F7TA 4OQTL 4E41A 2MQGA 1J1XH 2CUIA 1TOXA 2ITFA 2VDRB 3STLB 4NSKA 4DPRA 3HBGA 3BP6B 1TG8A 4WIQA 2XWJA 3SDCA 1V55B 2FRGP 2OQJB 2HVKB 3Q6FB 1S5HB 2LW3A 3T8XA 2XVLA 1HREA 2NY5H 1P7BA 4NNXB 5C0BB 3T0EC 4JJHA 4YLCA 4Z18A 1GW6A 1M05A 1DZ0A 4BSVB 3FONB 2NXZB 3SBWA 1NJ9A 2AMUA 3BGFC 3S35L 1RK1B 1U58B 3BZFA 3GXDA 3EXLA 1KXHA 2CGYA 5INDB 2VVUL 1E5AA 4W1TA 3VFSB 3ATEA 2J4IB 4GG6B 1QPPA 4RRPM 5FOJA 4OF7A 1UZGA 2B16A 3ZT7A 1XEDA 1CN4A 5T5FA 3LNDA 1KGYE 5JUEL 5BS0A 4IKNA 5IHLB 2R1YB 2VMFA 3D25B 4Y4KC 4EI0A 4KK8C 3KBEA 4D90A 3BGMB 5CKNA 3TM6A 2ZONA 1IFHH 2DL2A 2X2IA 2L7UA 3QQXA 2W0KA 4K5OA 5CKGA 2ZOOA 1AI1H 4X2UA 4CSSA 3N1MC 1ASOA 4E0RB 2X4PA 2PUQT 4X8XA 3QEHA 4ZQTA 5F9OH 3FFGL 1CYGA 4N5EC 3CVHB 4KDTA 1AQHA 2IIJA 4ZH8B 3CXDL 3K8LA 3EBAA 4XCFL 3X11A 5C7XH 4EPSA 2K2TA 4BDWA 1N5YL 1HHJB 5J1TC 2D0HA 4ZQKB 1ZS8B 4NKOA 2JB5L 1M4KA 2QGDA 3PV7A 4H8WC 4NAMA 3OAWA 4GW1B 4J8RA 5CXPA 1CU4H 3F58L 2XWZA 3P2DA 4PJ8D 5I5IA 1FFPB 4NKDB 4TNWK 3HUJB 4FD0A 3HC0A 1ZTXE 3NTBA 4XVOA 4QMEA 1ZMYA 2XFXA 3CFEB 4QDGA 5H94B 4EI5B 3O11A 5IR1A 5CBEA 4FFTA 4P5TC 2ITCA 5J56B 5I66A 2EVJA 1X4XA 3JV4B 3TCLA 3HG0A 4GIAA 4M5ZL 1X4ZA 3QIBD 3WFBH 1IJNA 4R84A 3EKCA 5HDBB 3QEQE 2CIKA 2EDLA 2HX8A 4UMSA 1AGEB 1V3JA 3FCTB 3GLEA 3C9AC 4NO0B 2FIKA 3N85L 4EF3A 1QZNA 2H26B 3TTSA 1KELH 2VL5A 3BWAB 3HE7B 4LKCB 5DHVB 1CX2A 3MUZ1 1E4WH 4Y4HD 1FNHA 2I24N 2I26N 5HD8C 4K2UL 1W9XA 2P80D 1LD9A 3O3BA 3QQ9C 5D1ZB 3HZKB 4YSSA 1J9CL 1SLWA 1T1WB 1MWAH 4WI7A 4OTJA 4H8UA 5D5MA 3S36X 3HN3A 5CSGA 2UWEA 4OGYL 1JGEB 1OV8A 3KLLA 3KPOA 1EHKB 3NEEA 3AXLA 4G9FA 4U1LA 4FFYH 4D9RD 1F3JB 1PW3A 2DLIA 1A4AA 2F8OA 2JKNA 3K1DA 2FL5B 2VWLL 1N0XL 3ABKB 3UG3A 5JMOC 1QVOA 4HV8B 5EIQA 3VGAB 4J5VA 1S7VA 4I0PC 5A43C 1F11B 3IITB 4P5MA 5E03A 4B41A 4F5CE 3U2SB 2CLZB 1T7ZA 2H4EA 2AXJA 4U4IA 2BSBA 2EO9A 5C6TH 2TAAA 3RX8A 2PCFA 4ISIL 3KHQA 1YUHB 3P3SA 4LAJH 2WTRB 4HPOL 5DMIL 3PWPB 2W60B 5I16A 3WJLC 5TGBB 1XGUB 2CUMA 4G59C 4LQ1A 5IEHA 5IHBA 4C56B 4JDTL 2ZG1A 4PWIA 4PLJD 5CEZD 1BF5A 2VAAB 1MQ5L 1RUAH 4PRPA 1CLZL 1T22B 1JPTL 1PD1A 2J1KA 3LN9A 2ZUSA 3K2UL 3FF8A 1NTDA 2RIKA 5HGBB 4FQLL 4JGMA 2CO7B 3QULA 4D2NA 1I1AA 1KBBA 1F1DA 1ETZB 3R8BB 5HDQL 3IGAA 5E00A 3RR3A 5CCHE 4UINH 5FB8A 4CSZA 1U2HA 3MNVB 5KYXA 5FPIA 5MI0C 5I2IB 1MIML 5L2KE 2EC9T 4AKOA 4JAMB 4O5LH 2JXMB 3NGBC 4NHCH 3ARDC 4KKZA 3SGEI 2SEBB 2VDOH 1ZTMA 4B3VA 5IUSA 2XCMC 1A66A 1F2XK 2WUCL 2C7UB 2FLRT 3MXVH 3CDZA 3ZDZB 5CINH 3V5KA 1VFAB 3PYCA 5JLZB 5D2NC 2OL3A 2WYIA 3BLPX 1SEQH 3BGAA 3GKWL 1JZ8A 4XWGL 1Y7VA 3H1ZA 3OR7B 4MA7H 2PABA 2CM5A 3SYAA 1NANH 2F58L 5B39G 3NBNA 4KWUA 2H6OA 3UZQA 2CGZA 2L7QA 1GGIL 1HZ8A 1HT6A 1HJ7A 4IBSA 3FTZA 2R0ZH 2YEZA 4BELD 3DV6B 3OWRA 4JZJC 4CVZA 3V4UL 3V95A 2X05A 1LMIA 3IN0A 2PW1A 3BEVB 3UTZA 4G8AC 4P2RD 1T20A 1ZA6A 4AQZA 2Z4QA 1T0MB 1D5XB 1TPXC 1KBWA 4O00A 5DK0A 3SPGA 2JCCE 1M3JA 4L4VA 3VQ2C 1F7EA 4YVUA 4EIBA 4XN1A 2EUXA 4H4NA 4LLQB 1TZIA 4MS8C 3DPDA 5C0DB 2H6PA 4M6NH 5I74C 5IT2L 4ZX3A 2ZCLH 2BDNH 1CFQB 3KE0A 3RGVA 2ZXEB 5J9PA 3V6FA 3L5XL 3A6BL 8FABA 3S5LB 3WYRA 4XNUL 3KJ6H 5JBCE 1QSZA 2NY5C 4B97A 5I17A 5K9KB 5A2LH 2B1AL 3C8DA 4P4KC 5F2FA 3GDBA 3B9KD 1E5YA 2EICA 3NA4A 3GMLB 3D8MA 3QZLA 3TEXA 4U2ZA 4O2FA 2VKXA 2H0JA 4JM2B 5C09A 2MQ0A 4L9DA 1W7XL 3QBTB 2P28B 5B1CA 3MLUL 4A2HA 1OEZW 1S7SA 2BWIA 2GG1A 1RJLB 1LWHA 4KVNL 3U7YL 5AG8A 1NFKA 2YWZA 5L8JB 5E8DA 4A6YB 4WV1C 1MHEB 1X6LA 1YMHB 4ZFFB 4NB7A 2HXAA 2VJ0A 3JUZA 2Q7YB 3VSQA 5K5YA 3RVXC 1NC2A 4PHZA 1RH8A 4CJ0A 3UJJL 2WPGA 4O9HH 4NIYE 2JJLA 5DLML 2EIEA 3GB7B 4R97B 1IGTB 4ZW3A 3QDJA 4IGBB 5AW3B 3N40F 4PG9B 2X0UA 2WKLA 1GHFL 5BZDB 1A1NB 3WE1A 3EYUH 4GKNB 1AD9A 3QHFL 1LDPH 3QCVL 3DUSA 5CD5D 2W92A 4LSPH 2DMGA 4M03A 4N9GB 3EYSL 4PUBL 2VC2B 5FHBL 1BD2E 4APQA 4OF6A 3HFFA 4KQ0A 3LZOA 1I8IB 5T1MA 4M7JH 3VGGA 3BQUB 4R83A 4E2OA 3MVSA 4JFEE 2IPUG 4FQ1H 4OFKA 2J57A 3B7RL 3QUYD 4P48A 3WD5H 3FOLA 4N8VG 1PMYA 4AITA 3ZL4H 3ZY7A 3MRGA 1TJGL 1EA9C 1ZLSL 1BZ9A 1PFOA 2GK0B 4W68A 4WJG3 1E2WA 3CXHK 2JJTA 3OJDA 4KI5F 1XGTB 2X9XA 2Y06H 3TF7C 1DCEA 4PY7A 4OZHE 2P5PA 5TE7H 3NJLA 3AY4C 1NINA 1R3JB 1RQ5A 5E0QA 3WHXB 2ESVB 4RMQA 1KGUA 1RIUH 4UNTA 2AQRA 5KYYB 2EUZA 5GRUL 1FBIH 4XPAL 5C92A 1ZPLA 3BN3B 2PYFA 4JR9H 3T3MF 3PWLB 4ZMQA 4L29B 5AALA 4N90D 2BVQB 1ZWIA 2BOXA 4E41D 2YSSB 1CXLA 2VERA 5HI3D 4FKHA 3DYPA 3BAJA 2D9QB 1BV8A 3I02A 1I4FB 1UWEL 4HWNA 4BK4A 1E3XA 2DW5A 3SDCD 4RGND 4ZSOE 3EFDH 4HFWA 4KKCC 1JZ6A 1FFNB 2WIIA 4NM4H 4MVBC 1M9SA 1D9KB 5L4FA 4JRYE 1HOCB 3ETBJ 5KBPA 3LHAA 5F9JA 1CIUA 1MI5B 4AZ8B 4O2CB 1BCIA 1PZ2A 4ALAH 4H0LC 1MHPH 5ICXB 4F24A 4KQ4H 3Q9QA 2WQ8A 4ZS6D 4WW2F 5AW2B 1LO0L 4UM8A 5EU6D 2F7QA 1VLXA 5DHXB 2QV2A 3A4EA 4PG2A 3O3DB 5LHDA 5BS0D 3N42F 2FLMA 5SWQB 2YPVL 3STBA 4N0UB 3BESR 1JYVA 3LPFA 4UZGA 3RX9A 1R19A 1BVLB 1SYVB 5HYSG 2YQ2A 3BSHA 4DFIA 1AFVL 1MN4A 2KQNA 1QFUL 3AT0A 1II4E 1JRHL 4M8UA 3C6LC 3JT0A 2WZ0A 2XXFA 4DN3H 3GHBH 4ELKB 4Z7VA 4ETQB 3IDMA 3UTOA 3M8OL 3WTWA 1JK8B 4CSTA 4OM1L 4YHMH 3VD0A 5GXBB 1XSIA 4PRIB 1DO5A 4YHNA 1OD9A 3AG4B 5DHYB 1A6UL 4R2GD 4H8VA 5BO1L 4PJAE 2VN7A 3MOAL 4MAYA 2H8PB 1YY8A 1AHMA 1E4KC 1PLGL 2KI6A 3T6XA 2XWRA 3F6IA 4YK4C 1GIGL 3IPEA 1INEH 4KPHH 3CHXA 3L3HB 1B3IA 1KBGH 2J5LC 1EHNA 3L3DB 3OLDA 3ZPDA 4QJ5B 3GJFA 1J8HA 2UYLA 4U49A 3ARXA 3LKNA 2XFGB 3D85A 4HUCA 3V0HA 4DGUA 4NWTH 4W9CC 1C7TA 1X44A 3DMMA 1A6AB 4G42A 4YSAA 2I5YL 3QRFM 1C16A 1WD8A 2J7LA 5B3JE 3K2IA 4UWQB 1QRNE 4WENB 3LB6D 4RMUA 5I6OA 2EXTA 4K23L 1P6AB 3NMEA 3D33A 4ZPVB 5LBSA 3UADA 1YHPA 3T0DA 3SPVB 3CFJA 2LGNA 5E5MB 3OAYH 1TEGA 2XKNA 5KVEL 4QXVA 2ENPA 3IAPA 5KVGE 3OQ3B 3LYRA 5K1NA 1MNUL 1CDYA 1XF3A 1XH2A 5AZUA 4YX2H 4GRWE 1OAQL 2ALWA 2R56L 4ZMLA 2J8HA 5D70H 4G9FD 1KYFA 3THML 1VENA 1W72A 4N4YB 3AT9A 1KB3A 2YD4A 4DQOH 1AXTL 3OSVA 1ZEAH 2C9PA 3MRJB 3P3RA 4Z3HA 3VSUA 1JZGA 2FEEI 1NQBA 2JV6A 4IOSA 1BP3B 2X12A 1OTSC 3F12B 5GGSB 1RLWA 2EZ0D 4M6ML 4XPHH 3TT3H 1NAMB 3RIAF 4OZGE 5EZOL 4RIRA 5KVDE 1PZ5B 4NZFA 1QI4A 1R3KB 5FUZL 1CDJA 3N04A 4Z0BL 3KGUA 3RVVC 2ZUXA 3TCTA 3T09A 1NGYB 1CF1A 5DO2D 1IAIL 3SE4C 5DJ2B 3FQ4A 2GHZA 1WCQA 3S36L 1Q9KB 1JWMA 4BGDA 3BZ4B 4U33A 1JHKH 3IMWA 2EDXA 4P07A 1ET7A 2FJGB 4XO3A 2K4AA 4GRLC 4UB0H 3HG1E 2Y1VA 1CDIA 4ZRGA 3SCMC 4XHJC 4MASA 3PHQA 2DLFH 1UHVA 5TQ0L 4OU3A 3RHWF 3BSGA 3RX7A 4Y7OC 4PRPD 1PTHA 4GLRI 1Z7JA 3DIFB 1ZVNA 5JVZA 3ZT6A 32C2A 2HT2C 3ULUE 1WS7A 3H9SB 4QRSA 2N01B 2D3JA 5D1XB 3KL6B 5MEPA 4FQ2L 2BMKB 1AOHA 3U1PA 4BFIB 5HGBA 4UF7C 2GY5A 2ZOKB 2RCSL 3AADB 2BO0A 3QEGH 1I1AD 4JVWA 1AY1H 4C57C 4ONOA 4QD2E 1LEGA 3V7AG 5FO8B 1EANA 5CGTA 3HW7A 5T1LD 3BI9X 3QG7L 1OF2B 2ZQKA 1AHWB 3UAEA 5JXAH 3RWGA 1GL4B 1HQ4B 3HAEA 5IQ9B 1MW3A 2IDQA 1J88A 2QZ5A 3WEXA 3LKRB 2K70A 1ZGLM 3ARGA 4BFNA 3ARFC 2WWKO 3DUHA 2XX1A 4LXFA 2DMCA 2IDSA 4FJYA 2EDKA 2LTQB 5AL0A 5EU7C 1SEBA 3DI3B 1HQRB 4R7NA 4CVUA 2JJSC 1Z9PA 1JCKA 5TE4H 2C4FT 1HCYA 3LIZH 3BOVA 3RNKB 1XKAL 1DDHA 2F54E 1CQEA 5KSVB 1VACB 3JT2A 2EDTA 1UXMA 4UANA 5ID1A 3DX0A 3IJSA 1AP2A 3MODH 3OSKA 4IKLA 5FA4A 2RACA 4FNLH 1G7PB 4YBQC 5LGJA 3Q8AA 4U7MA 1RZ8A 2GJ6A 3APNA 3RJOA 3MA7A 2F8IA 3BMWA 2JKWA 3ROOA 2NT0A 4MDIB 1GPOH 3V79C 1HWGB 5DQ9B 2AEWA 2UXFA 4ZUSB 4PRDB 2ADJA 5EZPA 4BCXA 5BJTB 3KQBL 3ULSA 1RP9A 5C08E 3KCGL 5I6NA 2PYEE 2HP4A 5J8OA 4L4VD 1G7MB 3NCBB 3N9GH 5GSRB 1TVHA 4KNUA 3QI9B 3RFRA 3GIVB 2NYYD 4G7RB 3IDIB 3OLEA 2XX0A 1J05A 2FYYB 2DTMH 4TV3A 3RGVD 5I75B 5COXA 2BRRH 1NGQH 2FGWL 2GABA 3C5SB 3D0AA 1PY0A 3G6JB 3S4SA 1UASA 2CM6A 2GBVA 1FNEB 3EOAB 1H3XA 2NQCA 1DVFA 1OP3H 4LDLB 2B15A 3P0YL 1XT5A 1RUPL 4LEXL 4N22A 3MPCA 1B4JL 1MAJA 4XCYA 4BJLA 1I1RA 3BRGC 5JYLA 1DQLL 1H3GA 3ESUF 5C09D 4KV5F 5F1NB 5F6HI 3LKOA 2BSTB 3AABA 3RWIB 4XZ4A 4FL4B 3IMTA 5TJWK 5KG9A 3TNNB 2XKSA 4NOFA 2YGPA 5I1KH 2V17H 2X4UB 2C3VA 4JY5H 3L9EA 4IMKC 3WTVA 5B3NA 3L16A 5JA8B 1WTGT 4WW1A 5F6HJ 3ZMEA 1EQHA 1UFUA 1N7DA 3SGDH 3FB8A 4JDZA 5CGBA 4OZIF 4IBQA 3ABZA 4ZUVA 4L3EE 4DETA 1HYRC 3EUDA 4QYAA 4Z3JA 1KNOA 1OAZH 4ZFGL 3QDJD 4V1DE 2BVPA 2H2PD 4M62H 3VXME 1NLBL 2PUQL 1A6TA 1JBJA 1EGJH 2WO4A 5C07B 4JB9L 5ACMA 3M37L 2D7MA 2XZQH 3KPQB 3ELQA 5EN2B 3R4DA 3CS7L 4GBXB 2PXYC 4MD0A 5F3BA 5KYWB 4HETA 2CQVA 2QQKL 2UUDK 3KLHC 5ESQA 5I0VA 2E76C 5EBMA 3C8KA 3T3PF 1UZ6E 1ZSDB 4APQD 1HKLH 1NUGA 1SHXA 2XG4B 4QRPE 4GRWB 3CCHA 5GJTH 4D0DA 5C3TA 4PAZA 3L5HA 2CLVB 4XP1L 3OXSA 4LIQL 1Z5LA 3SZKC 2NY4D 4HU8A 4PWGA 2MIZA 1MF2H 2YA1A 1AGCB 3T5WA 4PP2A 1G6RL 2WO3B 4JKMA 5DUBB 4YHZH 5BOJA 3BVTA 3NK3A 1EFXB 4IJ3C 1A6ZB 1JGVH 2MQ3A 1FYTE 1OGTB 2HN7A 4X5WB 4PJHF 3IDXH 2LV4A 1H5BC 1M1XB 1DQJA 1QTPA 4AEFA 4KRPB 4WDIB 3E6FB 5T8IA 1DJSA 4JPVL 4OBRA 2WLZA 1YZZA 1AGFB 1FL3B 1N59B 4WFED 5HYSB 5KBLA 1YNLH 3MYJB 1UT9A 3VXRA 4TOYL 4P46C 1V7ML 4XTRD 3JWDH 3D0VA 3IRCA 3D18B 3FT4A 4G8IB 3F5WB 2ITDA 3CE1A 3MRFA 3FQ1A 3KWXA 2ZNWA 1AQMA 5MEQA 2XPZA 3Q3GB 3M1BA 2J8UF 5EC1B 2A4ZA 3GMOB 3EJYC 1JD9A 1IGJB 2BVYA 3FSZA 2F8XC 1KTLB 3ZO9A 4DK6A 2V5MA 1BHGA 1PGRB 4YOKA 2JB6B 4AH2B 4BZ1H 5C2BL 4KKNA 4M9PA 1BEYL 3GGWB 3STZA 4H13C 1ORQB 5F6IC 1KBVA 4RWYH 1ZAQA 4JO1H 3FK3A 1LK9A 2W07B 4PMFA 4ANKA 1NZIA 4OLYH 1JOIA 4PJ7E 5ICUA 1QG3A 4XP9H 1Q94B 2EVIA 2UVFA 1UA3A 2NY3D 5GGVL 1NPEB 2WB1A 1NAKL 1GMIA 1S78C 2F53A 1CLOH 3TN0C 1WK0A 2GT9A 1KJ2B 2YD2A 4ZFZA 4K9JA 4Q8BA 4PJEF 5F88A 4PJBB 1E50A 4L18A 3ESOA 2ICCA 2X2YA 3QO0A 2DQHL 4FABH 1A3RL 2YK1H 1MY7A 1CJYA 2EDDA 3ARQA 4J7RA 1PLCA 1I9IH 4XPGH 4ZYKA 3S8WA 4L9LC 1DVZA 1W8EA 1UD3A 4YNYB 4E9RA 4WNSA 2QADC 4TSAL 1ZD6A 3QS3A 5FYJL 5DJ0A 1TENA 4TVUA 2VISB 3O9WB 1P2CA 1ES0B 1QLEL 4YSOA 5ENWA 3V8CA 4KXCA 3U7WH 2XZCH 1BAFH 1QA9A 4L8DB 2WZ5A 3O6LH 1T5WA 5T1KD 1NCHA 4JKPL 4KROD 3MRMA 3UTSE 5C0JB 3L9BA 3VFUA 2AV7B 4H40A 5CNHA 5AZ2H 1BVZA 1UM4L 1E43A 4L48A 4K9EH 1NCUA 2P16L 4X99A 4NHUB 3PUCA 2XQBL 3OKNB 4F37K 3OKMA 1BGXL 2JKJA 2AJXH 2CWRA 3LH2H 4D0CA 1JPEA 2PYEB 3QHZL 2R83A 4OKVA 4N2DA 1ZLWK 3IGFA 1NFDA 3FSOA 1BFOA 3US9A 4ZW7A 3OC5A 5D7JA 1J8HD 1P69B 1SDYA 1SMOA 1LP9F 3H7LA 4JHUA 3DMMD 2YKLH 4MAZA 1ACYL 1AG6A 3ZE0E 1TJIH 2G75A 4H0IA 1XH1A 1HEHC 4IMLA 4XN4A 5ISZB 1EO8L 3QYNA 1L9TA 1UOWA 4UM9B 2I27N 1IIKA 2HTLC 1VF5C 3KGRA 2DV6A 1BA9A 1PQZB 2B5IB 3TO2B 4ODUB 5F9WC 1FN4A 1SM3L 4N6RA 1MFVA 2PR4L 3GRWH 5FYKL 4P06A 1MRFH 1CE1L 2HUHA 1U3HD 3GHEH 2BY3A 1PZUB 3PIQA 2FBRA 4MKMA 3L3KA 3T3ME 1OB1C 3CLFL 3VFPB 2EDOA 1E8WA 1CZ8H 1DR9A 3P30H 5DHDA 1GGCL 1U3ZA 4ZAKB 2PO6C 2ATPA 2H3XC 4K3DH 5EA0H 5J4MA 1NCDH 5EB9A 4UOQA 3QPQD 2VXQA 1APQA 1G7JB 1MQKL 1Q8MA 2P8MA 1IGZA 5DVOA 4BCZA 1V7NH 1U8LB 3FT1A 4DEPB 2NZ1A 4Z23A 2OXHB 5H35B 1T1ZA 4XN8A 4IOSD 3WTXA 4NN7B 4WI6A 4ZFOB 4L3AA 2WHVA 3BO8A 4KTGA 1S7TA 1K8IA 4JO3L 1KIPB 1CL7I 3UGEA 1BZ7B 1BPLB 1YNKH 2R23A 1W6LA 5HDLA 4ZX5A 4Z95L 3IVKB 4Q9QL 3CN3A 4JHVA 1RUKH 2DKMA 1SXNA 3KBPA 2AAVA 1B0RB 3RP1A 1SFHA 4PJ9B 1I1FB 3LKPA 4JPKH 4Y2OB 3OHXB 3HOGA 4JJ5A 4NGHH 1MQ8A 1U8JB 1DJWA 1PBYA 2VN4A 4I3RH 3QUMA 4WRLA 1K4CA 5AL8A 2WB7A 4GW5A 4YDIH 1WFNA 3QNZB 4AJYV 3NCJH 4ADIA 4G7SB 3RIAK 2H47C 4Y89A 4BH7B 5K9OA 2J71A 2GUOB 4TNVF 1SDDB 3MU3A 4U6VH 3MLTA 4F8TA 1UJ3A 2ADFH 4FJ6A 2XWCA 4CC4A 3MV9E 4RDBA 3FUHA 2EE9A 2WLHA 3EH3B 1MCFA 4D8PA 1Z6EL 3HKFA 1FYTB 4P49A 1P4LB 4Z78B 1KBPA 3S8FB 1K5NB 1H3WM 3LXUX 4X9GA 1QX1A 2FT7A 1NBYA 1M42A 1QBLH 2C9UA 3NA9H 3NG5A 5HHOA 1P5UB 4WEBL 1FE8H 4H1LG 1A0QH 3N06B 2LLLA 3RHWK 5DZOA 4EKJA 1XF5B 3SDAC 2N56A 5IIEA 3ARGD 1JG9A 2CLRB 3LEVL 15C8L 4ZTOL 3C9NA 1W16A 5I15H 4JMNA 4ORGB 4R9HA 4S1RL 3QJQB 2BQ7A 4QRRE 2JK5B 3U36A 2F6AA 4WO4A 3ZYIA 5E5UB 1XHHA 2IAMD 3BH8A 5EO9A 5FLVA 1KLOA 5DK2B 3WGVB 1HSBB 1XGYH 25C8L 4KITB 3TVMA 2AEQH 3MLXL 1NKGA 1OSPH 4RX4A 3UH8A 3FB7B 1MVFA 3K7UA 3STLA 3TEZA 3VG0H 3BP6A 2ICES 2W86A 4J39A 1RERA 2EXSA 2DEXX 3JWDC 2OQJA 1N6QH 3PDOB 2P49B 3APFA 4L4TE 4LGSB 2QKIC 4MJIB 1HK6A 3Q6FA 1S5HA 4YGAB 3Q5OA 4CILA 1OHQA 3BAKA 4NOBA 4W4OC 4X4XB 1KTRL 3PNWB 4XP6L 1X5KA 4GIOA 2D3VA 1VEMA 1T03H 4D9LH 2VDRH 2R9HC 2D3NA 2OSXA 4FULA 4NWUL 4NFBA 4FHJA 4GKOA 3AACA 2EIBA 4XO8A 1ML0A 5SX4H 2XG5B 3MREB 1UWYA 5BZZA 2I9TB 4N26A 1NFYB 4WSJA 1VPOH 4B9YA 1IQWH 5IESH 4HEMA 1SHSA 3MGAA 1MFCL 5IQMA 4BINA 3LS5H 2R1YA 3B5TA 3D25A 3JWNH 5FKPB 1U6AL 2VJXA 3K6SB 1HJCA 3BGMA 1DVFD 1LNUB 2XTJC 4LOFA 3T0EA 4HT1H 2Q5BA 1F4YL 2AEPH 1OSZA 5IB1A 2WSDA 3MRLB 5GGTH 2B4CL 3EBIA 2HLFD 3QCUH 4XNYH 2P5EA 3UTSB 3IGLA 3QZBA 1ACZA 4RFOL 2MCPL 4LLYB 3EGDA 3BUBA 1E9PB 1GZHC 3N40P 2VSCA 4XP5H 5TQ2H 2APTA 4DGVH 4COXA 1HHJA 1PFXL 4D94A 3P4OB 2ZAHA 1ZS8A 1JE6A 1FLRH 2NTFB 4Y4KA 2KZKA 3CBJB 4QLWA 2XWDA 4JG0L 3BN9C 3D39B 4LCIL 3LPOA 3HUJA 4GXFA 3MR9B 5HGDB 3T1FB 5C86A 2W65A 4BDVA 3Q2VA 3QQDB 5H94A 4RGMC 3CVHH 5IMLB 5JA9A 1BXVA 4R90H 1NGXA 1H3UA 5J13B 3P9LB 3JV4A 4JS7A 3ZOAA 2VO5A 3HJ0A 2DBJA 4I3GA 3WTYA 1HCGB 2DQEH 1COBA 2I69A 5CZXD 4K9EC 2OM5A 5KAQG 4CW1A 3FCTA 2IO5A 3ZL2A 4EIZC 3S7GA 4MTMA 1LMKA 3D3VE 2H26A 5DD6A 3RUGB 3HE7A 4P2OB 4TVPE 4LKCA 4FOMA 5DHVA 4N87A 1KFAH 3Q01A 3V4VH 2VITB 2DMBA 5CLXA 4IBTA 1NMBH 2VVCK 1I8UA 2OMTB 4P5TA 3SBPA 4PJXF 4H20H 5D1ZA 5SV3A 5FCUH 3M36L 1DBML 4Z0KB 3TH2T 1F8TH 4ORZC 4APXB 2EXWD 4GAJH 3C5ZC 1F3JA 2AJUH 2R0LH 4LPCA 1Z6CA 5EIIB 4WFGD 1XAKA 1OT2A 4Z7OE 2AJVL 2CUHA 1I8LC 4N3UA 4TPRH 4XPBH 1ORSB 2A77L 4HV8A 2KLSA 3FUFA 5EU3B 5KSUB 5LQBH 4G6JH 1TOZA 1FPTH 5BUAA 2CLZA 5E95B 1J5IA 4NRXA 3KWUA 4YIQB 4LSSH 3VXRD 1FHNA 4TULH 4AK2A 4NQDE 2DI8A 3FQTB 4KGLA 2R8SL 1SPDA 1M7DB 1VEOA 1J1OL 2WTRA 4CDGC 1OLZA 3GJFK 2W80C 4Y5YC 1E5BA 3PE9A 5CR8A 1EAPB 4BIKA 4M5YL 2X0VA 1FDLH 1S7QA 3EOBB 3IFLL 3QIUB 5DJDB 4UQDA 3RTQB 5FO9B 3SQOL 1HHGB 2FGZA 1JPST 4I0PA 3AB0B 3ZTDC 2C1OA 1R0AL 4QRTB 3EG9A 4HBCL 4X4ME 2VAAA 5ELIA 4URKA 4LEEA 4JL1A 3ZUCA 5B7FA 1T22A 3RWJB 2BJMH 1NH6A 2NXYD 2QFRA 3EZJB 4K3EH 5FOBB 3HB3C 1U21A 3D34A 3FKUS 3NRPA 4OCMC 4B50A 4AV4A 4OV5A 2MOVA 3TA3C 4DJMA 5DC0A 3MGOB 2O5YH 5EF0A 3FO2B 1BAGA 4OM0L 4S11A 3X17A 1NIDA 3S37X 1ETZA 5C6PB 5ID0B 1TLKA 4BXWA 2F53D 3WG7B 5SWZE 2NY0B 4GT7A 4BFKA 1B2WH 1CGXA 5C3LD 5TH2B 3ZHNA 4AGNA 5I2IA 5HYJB 2OJZH 2FWUA 2Y25A 3FUDA 3LH9A 4JAMA 2EXYC 4YHOL 1PKQB 4HA1A 2BIMA 5BRPA 4GAFB 3C6EA 4NJAL 2BC4A 1FC1A 2CRZA 1I1YB 4FXGC 4GMSL 4QRRB 1VFAA 3IU3B 5F7KC 2R51A 2NNXA 5E4OA 3RWHB 2QQLL 4LRIC 3C60D 3OR7A 2G9KA 5EOQH 5KANI 1KB5B 1XX9C 3IJ8A 4RWHA 1A5FL 4G3YL 1J0KA 2JLPA 3RAJH 1A6PA 4ZPTB 3X14B 4P3CH 1ZT4B 3V6OC 1ZHNA 2C9RA 4LVOB 1I82A 3KPMB 2C4XA 2HPOA 5AQ0A 2VDPH 2B1OA 1RSYA 3B2XA 3T3PE 1WGOA 4HCRA 3NSCA 5HHVL 4X9YA 1E4XH 3HC4L 3BEVA 5IVZB 3UL4A 4AYID 2R4RH 5D2NA 1TU2A 2CRIA 1T0MA 3NJKA 4NM8L 3D4GA 3MV7B 4PJDE 4HUNB 4ICWA 2LABA 5CEYB 3RFZC 5D7JD 3HC3L 5KSBA 3IWUA 4H25B 5CKQA 1FL6A 1G9NH 1GXEA 4FMKA 5FW7A 4DHLA 4LLQA 3DXAA 2MKLC 4UU9B 1O5DT 4JGNA 1JZ5A 1HEZA 4G7VL 1H8SA 3PF2A 4NUJB 1WBZB 4NA9L 4PSRA 3WCYA 2WG3C 5I1GL 4DERA 4JZJA 4ZDHA 1CFQA 1QMUA 4TKWA 3ILQC 1KTDB 3VXPB 1Q0YH 3FQRB 3S5LA 3BP5B 2ZCKH 2WZAA 1YSOA 1PSKH 1PZ3A 1CK0H 4P23C 4DGWC 1MZZA 5KZCB 3BDBA 5K9KA 1IT9L 2R2BB 4ERSL 1UB5A 3J07A 3HRZC 5CJOL 4DP4X 4JZFL 4JM2A 2QLVB 4WWID 3MBWB 4FG6D 4UOW1 3NRFA 4I5BB 2C1PB 5AOKA 4OZFG 3GZPA 4CC1A 5GZOA 2VXVH 5ANHA 1JWSB 5JZ7D 2CKBH 1TIUA 4OF0A 2AJZA 1RJLA 2OMYB 4GO6B 4BA8A 2J6EA 2Q86A 2BP8B 2GJZB 5LAXB 3K4DA 5D1QC 4A6YA 4H1LB 4D7PA 1DL7H 1MHEA 4FQQB 1RPUA 2Z3FA 1OK0A 1IQJL 2NOYA 2VO8A 2YN3A 4P4KA 4RMVA 3ZU8A 5D71L 2YPKA 1NPJA 4JL2A 2BVOB 4PBXA 1IO4C 3KW7A 3AWFA 4P4RB 4TSBH 1E65A 1CS6A 1U93B 3GB7A 2A73B 5FGCE 5LN4A 1A65A 1IGTA 3GEWB 5FK9A 1FJ1B 5GS1B 3OKEB 2Y7QB 2WPME 3SKJL 1LXMA 1ZTXH 3VWJB 4PG9A 2QFPA 1OGAB 3D3VB 2HG0A 1XXFC 4Y9GA 4DTGL 4F2MB 5BZDA 2ZUQC 1AYOA 1X5GA 1T5XB 4RGOH 1MCNA 4WV1A 1PDKB 5ADPL 4N0FB 3QJXA 4HMDA 1Z1WA 1A3QA 1W80A 3VG9B 2B7DT 3WI9A 1Q1JH 3PXLA 1LPGA 2ALAA 5E8EA 4FLOA 4LARL 4OFYA 3REVB 4QOKB 1RUQL 4POYA 4Z8FH 3L7FB 2ZKMX 4FCAA 5EBWB 4X8CA 3O3AA 4JM0A 5DK3A 1I9RL 3QUXC 4ODVL 3ILDA 5AW9B 5IHWA 3UTTA 3MRPA 2CHDA 4MQ7B 3QISA 4PJFE 5G4NA 3RQ3A 2JKHL 2VR9A 4AYEC 1Z2KA 4KZDH 5HHOD 2YZ1A 1OTUC 1UD8A 3FU8A 4NQCE 2GK0A 3CQQA 3U7UG 1LWJA 5J11B 2OA9A 2W9DL 4RMBA 2O26U 1XGTA 2DZEA 3DIDA 4OGZA 5I26A 1BVNT 3DSNB 3KR3L 3QAZC 3S3JA 3ZX1A 1NSNH 4XNQB 1MCOL 3ARBC 3ESMA 1R3JA 2UY7B 1IGCH 1QSEB 2ESVA 4H26A 1KN2H 4WO4D 5IMMB 5KYYA 5DQJB 2WD0A 5E6ZA 2A99A 1T89C 4NUGH 3VU2A 1AQKH 3PWLA 1MJUH 1F4WH 5B1JC 6FABH 4WU7B 3TVMD 1MLCB 4ZW8A 2RA0L 4RX4D 4IRZL 2XYBA 4N2AA 4U0RB 2W2PE 3MNWA 1Z9SB 5I1IH 5IM7A 1I4FA 5ACZA 4Q4EA 2CBMA 1JF5A 1GGBH 1GAFH 3GSNH 4S2SB 1D9KA 4U1IB 5G2NA 4PGZA 4ZOAA 2OL3L 4K5NA 2F74A 4U1MB 4HXAL