2YGOA

Wif domain-egf-like domain 1 of human wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
180
structure length
174
Chain Sequence
b'TGSLYLWIDAHQARVLIGFEEDILIVSEGMAPFTHDFRAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDGIMADPTVNVPLLGTVPHASVVQVGFPCLGQDGVAAFEVDVIVMNSEGNTILTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WNT INHIBITORY FACTOR 1
molecule tags Signaling protein
source organism Homo sapiens
publication title Modular Mechanism of Wnt Signaling Inhibition by Wnt Inhibitory Factor 1
pubmed doi rcsb
total genus 31
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2ygoA02
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ygoA01
4CSYA 4Y71B 4E1GA 1IQJL 1DIYA 3HS7A 2P3TA 5IKQA 3K9XA 3POYA 4MMXB 2W2OE 2K2TA 2PR3B 2WPHE 4X8UL 4JZEL 3F1SB 3LAQA 5F1AA 2ADXA 2Y5HL 1AUTL 3TGFA 2EI6B 1W8BL 2KB9A 1B9WA 4Z0KB 2WG4B 5CKMA 1IGXA 2Y7ZB 2M74A 2BOHA 2W3IB 1NFXB 4NA9L 1Q4GA 2BQ7A 5EGMB 3IITB 1NT0A 4MMZB 1UZQA 1CQEA 1HJ7A 1EPGA 1FFMA 2W2QE 4BTUA 1IOXA 1ATEA 2YGNA 4Y79B 1ADXA 3ASIA 2P3FL 2Y5FL 4XLWA 1HREA 2P28B 3KQCL 3V64C 4YT7L 1G1TA 3R05A 1EAIC 2GD4A 3OLUA 1FF7A 4D90A 1HAEA 5COXA 1U8CB 2EI7B 1DQBA 1KSNB 2WFXB 2J94B 1G1SA 3NJPC 2BOXA 5KIRA 1EGFA 5L2YL 2K2SB 3NTGA 4M11A 2G00L 1EBVA 4LMFA 2BO2A 5I46L 1HT5A 1PRHA 5K0HB 3QH0A 4TGFA 3M36L 3KL6B 1DVAL 3N8WB 2NPRA 1COUA 2P26A 1APOA 1TLEA 1ATAA 1NPEB 3CS7L 3M37L 1OB1C 2FLRL 2VWOL 3HO5A 3Q7DA 2EI8B 1K36A 3SW2A 4O02B 2WPME 1ATDA 3HS5A 2P16L 5L2ZL 3LIWB 1NFYB 4ISIL 1GK5A 2BOUA 4MMYB 4D0FA 2J95B 1JV2B 2W2PE 1APQA 4XL1A 1ATBA 3N8XA 2OYUP 4X8VL 2RNLA 4COXA 4XBMA 4RRWA 2XBXL 4JZDL 1IOEL 3BT2A 1WHFA 2VWLL 1KIGL 4X8SL 3LTGD 1SZBA 3KQBL 2D1JB 3TK5B 4YT6L 1TPGA 1HCGB 4Y6DB 1PGEA 1HRFA 2KV4A 1WU1B 3QCWA 1F0SB 1M1XB 3SOBB 4Y7BB 4ISHL 3LTFB 4FM5A 1LPGA 1X7AL 5CKQA 1EPJA 1CVUA 1IQHL 2XC4L 1MOXC 1TOZA 2BQ6A 4JZFL 1UZJA 1NZIA 2WPIE 1FAXL 2RA0L 5FDQA 3MDLA 1IVOC 1CX2A 1ZAQA 4OTJA 3BPSE 1LMJA 1CCFA 3BT1A 2DDUA 4BDWA 2P95L 1KLIL 5JB9E 2FD6A 3CA7A 1IQLL 3U7UG 2F9BL 2Y81B 4Y7AB 4JYUL 1DDXA 2Y82B 2VWNL 1P0SL 2FLGA 3OLTA 2FZZL 2WPJE 3NTBA 2P3UA 2VWMK 3KK6A 1DX5I 1HX2A 4A7IA 1EMOA 1G1QA 3ELAL 5L30L 2J38B 3KQEL 1HZ8A 1HT8A 4Z6AL 2BMGA 3N8VA 3TK6B 1IQGL 4Z0LA 1IP0A 1BF9A 1LPZA 3TZIA 1K37A 5JBAE 4RRXA 3HPTA 4JYVL 1F7EA 2YGPA 2P94L 4AQTA 2XC5L 1YUFA 3RR3A 1L5GB 2XBYL 3PGHA 1YGCL 3MQEA 4NGAL 3TH3L 4C16A 3N8ZA 3KQDL 1KLOA 1PFXL 3LN1A 1EPHA 2JKHL 3IJEB 1EQHA 5JBBE 1A3PA 3LN0A 2W3KB 1N1IA 2AYLA 1XKBA 1IQEL 1CEJA 2VVUL 5KN5C 3F6UL 2I9AA 2W86A 3V65B 2W2ME 4BTIA 2BZ6L 3EGFA 1PXXA 2RHPA 1XDTR 2OYEP 3KRKA 2Q1JB 3SOVA 2MHPA 4LORA 4BXWA 1G2MB 1Z6EL 2XBWL 1WHEA 4CUDA 1CVWL 3GCXE 1IQIL 1UZKA 1FE2A 3LC5B 4M10A 1PTHA 4G1MB 1YUGA 2XC0L 1RFNB 2PUQL 2B7DL 5CISA 2MGPA 2UWOB 1P9JA 2PHBB 4O1ZA 3HO3A 2W26B 5IKRA 3HO4A 3N8YB 1MQ5L 2TGFA 2Y38A 1C5MF 2UWLB 3H5CB 1LQDA 3N8WA 2CJIB 3NT1A 5JVYA 2I9BA 4ZH8B 4YZUB 4OTYA 3GISX 3TBDA 1EZQB 2Y7XB 4RUTA 2MGRA 1W7XL 5CKNA 2VH6B 4PH9A 2Y5GL 5E8DA 1EPIA 5JBCE 2WG3C 5IKVA 2KL7A 1F0RB 2WYJB 2YGOA 3GCWE 1IQKL 4BTTA 6COXA 5IKTA 2J34B 2J4IB 5JVZA 1N7DA 2WPKE 3CENL 1QFKL 3ZYIB 3QMOA 2WPLE 3LC3B 4NG9L 1FJSL 1XFEA 1JL9A 3ENSA 1FAKL 1UZPA 5F19A 1JBUL 1F7MA 1IJQA 1CCVA 4ZXYL 3DEMA 1Z6CA 1EMNA 1XKAL 2Y80B 1U67A 2H9EL 2VH0B 1YO8A 2UWPB 1NQLB 1NFWB 3FBYA 2YGQA 3U73A 3Q3KB 1LPKA 1IQML 1NFUB 1G2LB 1EQGA 1IQNL 1O5DL 2VVCK 2VJ3A 2WFTA 2P3FN 4ZAEB 1J9CL 2D3JA 4RRYA 2WYGB 4D0EA 5JB8E 2J2UB 3C9AC 3ZYGA 1KLJL 4ZXXL 1IQFL 2FLBL 3ZYJB 2P93L 2BOKL 2W2NE 2VVVL 1I0UA 4RS0A 4CUEA 3HS6A 3KCGL 1FSBA 1MQ6L 4X8TL 3CFWA 4BXSA 1L3YA 1YUKB 3N8YA 4ZHAB 2BQWA 4RRZA 1URKA 5JW1A 1V3XB 2XBVL 3FCSB 1HAFA 1IGZA 4BDXA 4Y76B 1G1RA 3P5BL 3FFGL 3SOQA 4CUFA
chains in the Genus database with same CATH superfamily
4I3GA 3P30L 3C8HA 2XA3A 4HISA 4RQQA 2VDMH 2X4OB 1RFDL 3HAEB 1NMAL 2FJHA 2A9NL 4JFFB 4UTBL 1Y6NR 4LLYB 3SE9H 4CSPA 4NENB 3VGFA 1CF1A 2Q7YA 3HI6L 4P2OC 4NWUH 5FPIA 3UCQA 1YEHH 4X8UL 2NCMA 4QRSB 3QG7L 4PLKC 5D7SL 3UAFA 1Z9MA 5CD5C 1WEJL 4ODBD 4R7DB 4ELDA 4K9EC 3KYKL 5IZ7A 4DVRH 5KWYC 2QVMA 1LO3H 2BVEA 5CCKH 3ILDA 5JUEH 1TEFA 4AVHA 1BAFH 1TCMA 2HVKA 3KXFB 2BDNL 2V8MA 5E51A 1GIGL 2O6FA 2J72A 2ZXQA 3ARFD 4N2CA 1RJCA 1BM3H 4GKSB 3MLUH 4P59H 1FL5B 4LCWD 3F7VB 5HYQA 1MHPL 1DEEA 5TH2B 3WNLA 2FX8H 1NFXB 5LJYH 5DZOA 3FTGA 3D06A 4LRNL 3MLYL 1G84A 4QRUB 3QQ4A 1JTTA 3CMGA 5ADOH 2QVIA 1WGOA 2VW4A 4QWWC 4XNUH 3T65B 2AV1A 1TITA 4IU2A 3O41A 3IAPA 5JHLA 1PSKL 4YFLF 3GUTA 2YGNA 5B7FA 5GS1C 3CSTA 4QXUL 1U6AL 1PKQE 1ZY9A 2LTQC 1KIQA 2J1WA 4P2RB 4U4BA 1HH6A 1W6WA 3RVTC 2AJZA 2IADB 3N41F 3GZPA 1EAIC 2GPZA 3LKPA 4XX5A 1IAIM 4OJCA 4L1LA 4M8QA 4J3OG 2TAAA 2J94B 3IWUA 3NJPC 2BOXA 1KYFA 1Q9LB 4J1UB 3NTGA 3HLAA 4IJ3C 5GRJL 4N9GA 1YLBB 3HZVB 4PMFA 5HJGA 2V3DA 2W5PA 3ULUD 1EZLA 1CXHA 4WHTA 3IS0X 1QI3A 5DEJA 5DJYA 3QJTB 4X8JA 4N25A 2Z1PA 4IKNA 2Y7NA 3DSNB 4G42A 4OZFB 5DEFB 5AENA 5J13C 1WC7B 1N5AB 1RZGB 1KC5L 1TQWA 2VLRE 5TDPB 3J7HA 3CS7L 5EPMA 4F7PA 2FLRL 3W82A 3MBXH 3CZJA 3ZR6A 4L1BA 3VFSB 2Z0BA 3O0RH 5EF0A 1E65A 3DX1A 5F6HI 4AUUA 5FW6A 5L2ZL 2VKXA 3ZQXA 2YN3A 3K6DA 3KH4A 3N42F 4QXTA 3DBXB 1IM9B 3LIZH 4NNYA 2DQUH 3O6MH 4OFPA 4ZMLA 4A7VA 1IJ9A 4R7NA 2D7OA 2WXIA 1L0YA 1JV2B 2EXYC 1J5HA 4DGVH 1A6AB 4IMLB 2EO9A 2OX5A 3K2UH 4ONGL 3CFJA 2QR0B 4Q4EA 43CAB 3QORC 4X6EB 3D3VB 4QCIA 4LEXL 4LSRH 1Q90A 4GIAA 5FUZL 3VFVB 3W11C 4NO5B 1IFHH 2AJ3B 2D2OA 3CVDA 5I1KH 1SZBA 1GY1A 3TNNA 2DL2A 3U6XS 5DC0A 3FFCD 4NHUA 1XF4B 4KQ0A 1UQSA 1XQ4A 3HS9A 1S5HB 3BRDA 3VQ1C 2EKSA 4PYHA 5FYLE 3PGFH 1JJUA 4WW1B 5K39A 1DVUA 1OF2B 1T1XB 3RJOA 4DGWC 5J1AB 3ZMEA 4ZD3L 2JI1A 5CS7A 1DN2A 3DXAB 2DLTA 3C6LD 3D9AH 5I30H 1XBDA 3A23A 1NGPH 3CQQA 4LE8A 3CIAA 3GRWA 3MUY1 5AOJA 1NWPA 2DBLL 2DDQH 2ZKXA 3TIDB 4LFHD 2UYLB 2HVJA 4PWGA 3V0IA 1RCYA 4OLUL 2YOAA 2AV7B 2F15A 1BZ7A 5T1KB 3GXFA 1TJGL 4WIQA 2WP3O 4QIRA 5CF3A 3MV8D 12E8L 1HC1A 4XCCL 3BPSE 2GVYA 4DVBB 3PHQB 4WV1A 1Z0MA 2VE6B 1SMAA 3S3DB 3WJMB 1FA4A 4QY8A 2UZYA 2ARJQ 4AV4A 4XHQA 4OZIA 4R26L 2ZOKB 5GS2D 1KJ2B 2IDFA 3BWUC 3P3UA 1Z5LB 2C26A 1DSFL 4KQ4H 3FOMB 1PKQA 5HYSB 4Z7UE 1A7OL 5F7LB 2Z92A 4PIBA 1E50A 2DD8L 3L9YA 4NZJA 1SDAB 2EXWD 4YX2H 2PYED 3UFIA 2VAAA 3KGUA 3S0PA 1G9NC 1KLGA 1QG3A 2GHWB 2WQ8A 2GSGA 3DXAD 3HE6B 2COVD 2B4CC 2EDLA 2JCCB 4L4VB 2K4AA 3LEXB 1J0ZA 4MQXC 5DQ9B 4KKNA 1HYSD 1ODUA 5C0FB 2CE6A 1EMOA 2MOGA 3IU3B 3QIWA 4TLUA 5D7JC 5HD8D 5T1MA 3ZE2E 4PD4K 3HR6A 2Y22A 5A6LA 1YRKA 2J38B 4GBXB 5B3SB 3DHMA 1Q9KB 1PNDA 2IQAB 2ZWKA 3WEBA 4NUGL 2E9GA 2EICA 2V7NB 3QI9A 3HI1A 3SE3C 3WI9A 2OK0H 1UD2A 5EZLA 2HFFA 3RWHA 4H4NA 1LMIA 1J5IA 4QRQB 2XBZA 2X4NA 3KS0J 1YNKL 2C9XA 3CMOH 1ZHLB 4L4TE 4X7CC 3T0WA 5HSFA 3CIQA 1WH0A 4HGMA 5EBWA 1HJCA 3NPZB 4I7ZC 5E5LA 1CMOA 5DU7A 4JUTA 3TGXA 1BG1A 1IM9D 3C87A 5GS0D 2MQ3A 2FYYB 3GSVB 4FLSA 5INDB 2VDLH 2ATKB 3T1FA 1AE6H 4NUJB 2WBJD 3ARDB 2TRYA 4KO7A 1T6BX 3L5WA 4LOFA 1KXQE 3RVWD 4ES9A 1PZUB 5E4EC 1E6OH 1YN7A 4GUPB 2W3KB 1JWSA 6TAAA 4PEEA 3TA3C 5IBLD 3M1BA 2VVUL 1PY0A 3T1WA 2Q8AL 1KG0B 2CNZA 3B43A 5C08D 3QAZB 5LVEA 1FYTE 2AQSA 2ALWA 2R7EB 3LPWA 4XPHH 4B5EA 4NN6B 4AW7A 5JLZA 5IT2H 2CHNA 1R3IH 1YO4A 3EGDB 3NTCH 3V6ZB 2ZKHL 4LPUA 2HVKB 3KXFA 3WFDL 3IGAA 5CIPA 5BV7L 4OV5A 1BOGA 4GKZB 2AITA 1PYWB 3ZHLA 1WBZA 4JHBA 1HEHC 3G5XB 4KVPA 3KWWB 5KSAC 1BIIB 3IGLA 4QEGA 3SDCA 5J89A 4PWFA 5FAAA 3BX7C 2Y7MA 1J05B 8CGTA 1UB5B 1QWUA 1OSZB 4OCXL 1WHEA 2NYYC 2G60L 4CUDA 3HG5A 3MBWB 5LBGA 4DH2A 1I7UA 2EABA 3EFFA 4P2QB 2EXYD 3DJSA 3WY3A 1HEJC 2G2PA 4YZWA 3H6AA 2X88A 3SGDH 1YUGA 3GSRB 1A7NL 2X12A 2IG2L 4MBOA 2B7DL 5CISA 1W8EA 3U0TA 4AYID 4F9LC 1KWGA 3S3SA 4UTBA 1SJMA 3PREA 3VDCA 3AGWA 1Y1UA 1AD0A 4LBEB 5EU5A 5DC2A 3DX8A 3HO3A 4Y2OB 2W26B 3THML 3H1ZA 5DA4A 5DURD 5IKCB 3ABKB 2HFGH 1OPGL 3QFJB 4JFDB 3H5CB 1HHHA 4G71B 2BO0A 5C0DA 4DZ8A 4RETB 3WKNA 5EU7E 5J11C 2OMZA 2YPKA 3Q13A 5SX5H 4JFSA 5LGYA 2XI9A 1UZ8A 3NAAH 5HGDA 4UNIA 2OYMA 1S3KL 2AF2A 1RUML 4HK0B 3RGHA 3VXTA 3MREB 3ZBMA 1QBLH 2R0KL 5ICZB 1EMTH 4RDQG 3VG0H 5CR8A 2MGRA 3DTUB 2ZCKH 3HW7A 4E5XB 3ARGA 3HN5A 2FBOJ 4KO9A 2Y5GL 1JPST 4HUWB 5EO1A 3UEZA 4PGJA 2GK2A 4M5ZL 5GS1B 4NC0B 3EJCA 3QG7H 3DC0A 4EDXA 4NQQA 2Z31B 2WVTA 4RSYA 3V5KB 5TK2A 2WCGA 2VDPL 4U7SA 3I9GH 1OAQH 4M6AA 3VW3H 1D5ZA 4K9EL 1IC4L 1BQHA 2DKMA 4D2NA 4Y4FC 4WTWA 1UXSB 4FKEA 2BVQA 3P4NB 4KXCA 4XAWH 1K3IA 5C0NC 5L6YH 3BI9X 4A2LA 1PD6A 4GRMA 1A7RH 3C2SA 5A2KH 4JM2B 2WTOA 1A14L 4MMYA 1I8IA 3FRPA 3QG6B 3HRZA 4K8RH 2CJSA 4YBQD 5FKAA 4K23H 1L6ZA 3WIFA 4JFQB 4KZEH 4NQVB 4L9LB 3F7QA 3LHPH 4PB9L 3WS6C 3NIGB 1T4WA 2W1NA 3O0RL 1IGYA 1ZGLA 1P7HL 3VSQA 1F6LL 5J1TC 5GRZA 2L04A 2VLJB 3H9SE 5FM5O 4MX7B 3QUZD 4Z3EA 2ZP0T 3HLKA 4JBSA 1YO8A 1FZOB 2J88L 4M5YH 4B9ZA 1WC7A 4NQEE 2UV3A 2EUVA 1CLOH 3U73A 1CXIA 4L2YA 3ALXA 1U8JA 1W15A 2BWDA 2VXUH 3PJSB 3WJLC 2PYEA 1MJ8H 1IQNL 3QE5A 3PDOB 4GI8A 1A1NB 4DP7X 1IIIA 4K7PY 4Z95L 3P9MB 3MO1A 3C60A 2NY5C 4KZCA 4Z0BH 1ES0A 2H6PB 2H8PB 3WL9A 2ZSVB 1J9CL 3C5SA 3QH3A 3AM8A 3B6SA 3N42B 4LQFH 5F93C 3P4LA 4AENA 5A6IA 2E86A 2VM4A 1J8HB 3IGKA 4BJLA 2WVSA 2BNQE 3RILA 1GPOL 1XZ0A 2A0LD 4PV8B 4F2EA 1WCBB 3Q8BA 4ZX4A 2VZSA 2XWRA 5GRVK 4B9IA 3ZYGA 2CHZA 1I8KA 1BGXL 1HWWA 4AKOA 1J9CT 2DWTA 4DWHA 3KBEA 5DRXB 1SRDA 3HHMA 1EXGA 5ADOL 3QUMH 4XOAA 4WFGD 3T9WA 4U05A 3ULUF 2BOKL 4NO2A 4P5SA 4XODA 4C47A 4HMEA 3ILPA 3RUGF 1D6VH 2IO5A 1VFMA 4HVBA 1S3RA 3KCGL 5E99L 2K78A 4CSTA 1TQUA 5F7EL 4MASA 4FG6D 3S5LB 2X6CA 1LWJA 1MI5E 2EP6A 4MAUH 3M88A 5HHNA 3PUUA 1HJBC 2CM6A 4MNHA 1E8ZA 5E08L 1BFTA 3AQXA 4J2QA 2NUTB 4AK2A 3MNVA 4ZO8A 1E8YA 1A4BA 4ODHH 3JTSB 3V4VL 1V3JA 2ZF9A 5T3XE 5ELIA 5DJ2B 3WV0A 4BWTA 5FXCH 1SXZA 4JFPB 3D0LB 2C9AA 2CMRL 3O0LA 1EAOA 4AG4H 1UUNA 1MLBA 2A83B 2MNUA 2YMOA 2DOCA 1KTRL 6CGTA 3VXQA 3DIFA 1CLZH 1I1AC 4HUCA 4DJMA 3OKMA 1XCTB 1UASA 3VXSB 4HKXB 4GAJL 3WS6A 5IFJA 1XZWA 3EJYD 4XN2A 2L8AA 5HVFB 5H94A 2WGXA 1LEKB 2EECA 3QXWA 3GI9H 3GMQB 3P73B 4ZPTB 1ML0A 4F2ME 1F6AA 3LAQA 2ADXA 4EBQH 1AG0A 4AMWA 1KF9B 4S0SD 2V9UA 3F8UB 4DW2L 4Y16C 5B39B 4PJIA 3DDFA 1IC7L 2YD8A 4G9FA 3GSRA 3ASWA 5FUOL 2NY3D 2KB9A 2V17H 2V9RA 5A2AA 4FA8A 4OGAC 5DK2A 2D7TH 2R7EA 3WTTA 4PCYA 3M17B 2VXTH 4CC4C 5I8KH 3B2PA 4MB3A 3WEXA 3GXIA 4XXCA 4M6NL 4O4YH 5B1AB 2YA0A 2I60L 4U1IA 3QQ3A 4QO1B 3O2WL 1P53A 1IMHC 2ADJB 1CG9B 4MMZB 1U2YA 1KXVA 4TNWK 2VLLB 4UBDD 2X2UA 1JCKA 3BYTA 3OC5A 1VADB 3KW8A 2MH4A 3L4ZA 4WTQA 1NFAA 3ULSB 3ATFA 5GISL 1CXEA 1Z3GL 5EZLB 4M8UA 3MRIB 3MBWA 1E3ZA 2X7LA 3UAJD 5AOLA 3QJFB 4YK4C 3TA3D 3PGDB 3LIUA 1NIFA 3WNOA 2WKOA 1CFQA 4OGQC 5I1LB 2CRZA 1IGFH 2VW7A 4FJYA 5AVUB 2A9MH 2C9SA 1RZFH 4M7JH 1SZNA 2VAAB 3F05A 1KJVB 3LAFA 5IGXL 2BO2A 3B7RL 2BJMH 4XP5L 2DBLH 3WXWH 5JW4M 3CFMA 4JRYE 5HDQL 1TMQA 3TZVC 1S9WB 4L8SB 4OLZH 4OZHB 5MI0B 3TA3B 5I30L 1HL4A 1U8MA 4LO9A 3KL6B 1WBYA 2J8HA 2WANA 1RPUA 5KVDL 1ET5A 1I9RH 1CD0A 3PWNB 5FDYA 4B9CA 1QZ1A 4W4NA 2VZUA 1HWHB 3D50A 5LBSL 1EEYB 3C5ZD 3QORB 1DQDL 1JPTL 1JZ5A 3D5OF 1EXUB 2QFPA 5E8NA 5I16A 4PJ7F 1KY6A 3S2CA 3ZZQA 4IHBA 1QUNB 1W72L 4GEJA 3V0HA 3DVFA 5DJ6A 5TE4H 4PP2B 4D94A 4CC1A 4MLSA 4L0ZA 4LL4A 4PJCA 1ACYH 3JUYA 4EPSA 5H2BB 3OXRA 1RIUL 3MFFB 2RCSH 5C70A 3PL6B 1S7XA 3A6BH 1M7DB 4YGVA 3EO9H 2CBPA 4OGZA 4POYA 3FSOA 3MROA 1RZQA 1MRFL 1C1EH 2EH7L 3MLTB 1MUJA 5ESVA 1T04A 2VUOA 1ETJA 3PABB 3BP7B 1GTFA 2F7OA 2GTZA 4XPHL 1D2PA 3ATDA 4KK9C 4GAAA 4PJ9A 3BT2A 4PM1A 1JI2A 4R96A 5IVXF 2NY1D 3CFEB 4UM9B 4MB5A 2VDNL 3SDDC 3KQBL 1GC1C 4LDCA 3SGKA 3NN8B 3U4EB 4UIKH 5CLTA 5ANMA 3FMGH 2YXWA 2GSMB 3MRHB 1I8IB 3FRPB 2HWZH 2WSDA 4PB0H 3ROLA 4EN3B 1AJ7L 1KB9K 4F8PA 1NOLA 1R19A 1H3XA 1CR9H 2PUQT 3GHEH 4X80H 4JJHA 1NDGB 5DHVB 3T2NH 2H26A 2C1PB 2Q76B 1DJIA 3OAWA 5FKPA 2A77L 2XKSA 4BSVB 1GYUA 4NSKB 2FIKA 4MYWB 4NQCE 3KBPA 3BW9A 4RMBA 4YHZL 1QLRB 4PBDA 1HINL 4KHTL 5TFSH 3V55A 2BRRH 4F33B 5KVDE 4Y19D 2DQCH 1XH3B 3MDLA 4MB4A 1IO4C 3QO1A 2DIBA 3MRGA 1MFCL 2OR8A 1ZAQA 5JXAH 3MN8A 1J9RA 4B7IA 5D2NB 4O00A 3SE8H 1O0VA 3CH1B 3MREA 2H3NA 5KS9B 4QTFA 2DDUA 1YZZA 3GT6A 2K0RA 2X41A 4ELME 4AH2B 4CADA 2I27N 4KITB 5TPWH 2D9CA 1ES0B 3GRWH 5IREA 2TRHA 4MJ2A 1EEZB 1MCQA 1CUOA 2BSSB 3P3YA 3SBWC 4L3ED 1MCEA 1K2DA 3CA7A 2DYSB 3MAWA 5K59E 5JO5A 2XVGA 3GKWH 3GSXA 2WD0A 2VLJD 4ETQB 3CTTA 1LDSA 1OM9A 4X5XA 3AACA 1IBGH 5JNYB 4NOFA 2ADFH 1WHPA 2FSEB 1UWEL 2DF3A 1PIFA 4QRPB 1X7QA 1QSEA 2OL3A 1OGAE 1FPTL 3S5LG 2XPGA 1JUFB 2CA3A 2VZVA 3BWZA 3H9HB 2WCSA 3DV6A 3WHXA 4Q9QH 3OV6A 2DMKA 4YO0A 1DCEA 3D7PA 4GINA 5E2UH 2ICES 4M7LL 4IBUA 4QLRA 4ZO6A 1HXKA 2YD2A 4RFEA 1FNLA 2K3TA 4OCSL 2CAKA 3LPPA 2R56L 4R4ND 5BO0D 1A9EA 3FSAA 1MCLA 1V7MH 3U9UB 1MH5B 4KXDA 1A9VA 1WSST 3N1GC 4ZMNA 1BVLA 3IE9A 1KTDB 4OAWB 4E0RB 4MVBC 4Q74A 2YXVA 2X4QB 2VDPB 1JVKA 3SKJH 2CO6B 1YJDH 4PW3A 3GSQA 1H3PH 5DTFB 2GIMA 4Z7OE 4GMSL 1X5ZA 2IMNA 1YGCL 2M26A 1ANUA 1SHXA 1G0DA 4JLRB 1BJ1J 1T0OA 2XQYG 5E6RB 1MFAH 2AQNA 2KH2B 1I85A 2A83A 3NSCA 4LSSL 4OT1H 4EVNA 3L3HA 4ZDHB 5GS0H 5H37G 1Q8MA 3UG3A 2NNCA 2FNWA 3QFJD 4JFDD 1ZE3C 2CBMA 3UO8B 5BVJB 1NDTA 1L0PA 1R33A 3MRLB 4IBWA 5DD1H 2WXPA 1BFVH 1FGVH 5SWZA 1WA0X 1UM4H 3TBYA 2W2ME 1ID2A 2LW3A 3H4FA 1T66D 1S9WA 5T5NF 3EFDH 2HJLA 1LO0H 2HJKA 4PJDB 2Q7NA 4P4KB 3DMMC 2W0PA 1K72A 3CVHL 3KR3H 3H4HA 3UOAB 1FDLH 3G6JB 3QORA 5DDHA 1U21A 4HUUA 4NCC2 3JUZA 2BH0A 3FUJA 1QPKA 5D8JL 3BAJA 5AWNH 3DO4A 1ZLUH 4G2AA 2ZD0A 3S36L 3NK4A 5HI5D 3P02A 4LOUC 2C8NA 3GCXE 1FL5A 2IG2H 2XZQL 3PXJA 3IDYC 3C5SB 3QH3B 4P04A 2RFXB 5I17B 3CLEH 4AENB 4YHIB 4UAHA 2CGZA 3CG8A 3E2HB 3SPIA 3MV9E 4Y1AA 5ERWA 4G59C 2MGPA 4Y4FA 1DVQA 1JMZA 4LHUA 1RAMA 1TZIA 5IF0B 1NCBH 3CVIH 3B9KA 2BIOA 3U0WH 2PYEE 2ZCZA 2XXFA 3VXSA 2B5IB 5DUPL 5C08B 5IMLB 2VJ0A 5IKRA 1X5IA 5AKRA 2DZEA 1OWRM 2G0KA 4MXQC 2Y1YA 2HLFD 3L45A 4G70B 5KVMC 3QIBD 4PREB 4A6YA 3MA7B 4FCHA 4LPTA 5CO1A 3RWDB 4MXQD 2HRGA 3TURA 2I9BA 1QFPA 2EDEA 3R7RA 1JF1A 1LQSR 1X7SA 4QHLB 3GMRB 4M62H 4TLSA 5CSZB 3UXFA 1OK8A 2NUTA 4NN7B 3VDBA 1IAOB 1U8PB 2C1PA 2JB6A 4LBAA 1PD1A 4YAQB 3ETBJ 1SHMA 3GSUA 2ESVB 1IAKA 4NRZB 1EPIA 4RRPA 1G9NH 1J0JA 3DO7B 4AJ0A 3KLKA 3LRKA 4H88H 3QRBA 4R7XA 4G43A 1NGYA 3ZR5A 1YAZA 5CN1A 4YDLC 1N8ZA 1F1DA 3MV9D 4G7VH 5PCYA 5JHAA 1JHTB 4MA8L 2YGOA 5DD5L 3FUNA 3RVXD 1HSBB 5IKTA 2PKDA 4ODXB 4W9DC 3WEAA 3S9DB 5IVNA 2H32B 3WEMA 2PLTA 4X6DE 1GY2A 3BYYA 2ESVD 3E6HB 4FMFA 3SB3A 3LS4L 5MERA 3PGDA 4WFED 3SKUD 2VSCA 2Z8WC 3L6FB 3D2UD 1OSEA 5E4IA 1PFOA 3MRDA 5FEBA 1OK0A 1XX9C 3IFPB 2DWEA 1KIRB 4I4WA 4P2CG 3RTLA 3HPJB 5A3ID 4W9FC 2A9BA 5ADPL 1CCVA 1S2EA 1YN6B 2E3VA 2BOBA 3VXUA 1MQKH 5GGQH 5GSRA 4PJGB 3EYUH 4KAQH 1BREA 1ZHKA 4LHQB 4Y1TA 4U1IB 3EO9L 1D6EB 4R7DA 4K5NA 3TH4T 4FQJL 2HLAB 1RIUH 1TZGH 5I8CB 5CGBA 1INQA 1S5IH 2K8MA 3DHUA 4NAJA 3RGVC 4CDGC 2FLMA 5IHZA 2HUHA 4UB0L 1EQGA 3W81A 1L9RA 1UJ3C 3FQXB 4E9WA 3VCLB 3MHZA 2DD8H 4YHOL 1YEWA 3GSNB 1F0LA 4AT6A 3TN0B 1HDMB 3PAYA 3BZEA 1SNRA 1YMHB 3D4CA 1JZ6A 1QP1A 2D3NA 1RURL 3B5TA 4TSBL 3MRGB 2XRAH 1JZJA 4R97C 3WUWA 1VGEH 4GLRH 5T1KA 1I1FB 1DVZA 1QKZL 3B37A 3L1OL 1U4EA 5D70L 5FGCE 2MCAA 3TFBA 3ZT7A 5CU9A 4Y16A 1JNLL 3PHQA 1DQMH 3IK2A 3LH9A 1HCYA 2JKJA 3B9KC 4IIQA 4NQUA 5AWNL 1A6UH 1I0UA 5EU7C 2AABH 3SCMB 1FYHB 4GKNB 1IRAY 1OZTG 3GBDA 1MFBL 1FDLL 1XCWA 2ENQA 2WQWA 3CFWA 5EOCJ 5FO8B 2K9UA 2EVGA 4DCQA 1HE8A 2F54D 1N0XL 5ID0B 2XTLA 4HIEA 4KMQA 3SBRA 5CLWA 5IR1B 1QWNA 5D7JB 5F8QC 4B5ZA 4WEBH 1F2XK 1YY9D 3LKNB 4H8HA 4OFKA 1T1ZA 4LCIH 2GG1A 4H20L 2R2HA 5FO9A 2JCCA 1FAIH 3MMEA 1AGFA 5F1IA 1CLZL 3F5WA 2B1HH 2XZAL 5I6KA 3SPCA 1QATA 1JYXA 1FG9C 4PW4A 1DIYA 3I9PA 4UAOC 4XO9A 3ECWA 4I5BB 2DQGH 4NPYB 3O81A 1HTYA 1QAWA 2C3GA 3N43F 4G9FE 1WAPA 3ARBA 2XWCA 3AQDA 4AGQA 1UYWL 1JGDB 1VA9A 5DUBA 5A2IH 4KV5E 1P4IH 1XVSA 2AJSL 4DPAX 1EDQA 1IC7H 5DMGD 3RL2A 4HA1A 1IFHL 2KLTA 4QXTB 2Z4QB 1N64L 3HB3B 2NQCA 2P45B 1AUTL 4IRJA 4BUQA 5D1XC 3FSWA 3IGUA 4YXLH 1UEMA 3OZ9L 5M95B 5CHNA 3AXLA 3T8VA 3AZUA 3VI3A 4E42B 2WXGA 3IMTA 3ZO9A 2GCYB 3KJ4C 1IGXA 2CPCA 5IVOA 3S37X 1MN4A 4AQ1A 2BOCA 3QUGA 4X6BA 1GYVA 3DA0A 1Z0NA 3EDKA 4R8WL 4F20A 2GUOA 3BDBA 2VDKL 4P3DA 4HGKC 1NGZB 2W2QE 4XP6H 3BIKB 3QDME 3DJ9A 2Q10A 5DMKA 4TNGA 3WS3A 1XGYH 1UWEH 3GTVA 3H3PH 1A7PH 2GSIB 1RERA 4HD9A 5F9OH 3HFFA 4DK5A 4JRYA 2GD4A 4QRTB 2IANB 3TTSA 2ESVA 2VZTA 4DEUA 3UDWC 2J20A 2WSPA 2WBXA 1QO3A 4Y1AB 3SOTA 5GZNA 5F1OB 1JDDA 1GGCH 2MMXA 2K2SB 1UVQB 2BNQD 1KGIA 3FC8A 3JWNE 1UA6L 2FGWH 4PJGF 1BGXH 4BK5C 1DYZA 2XXGA 1QBBA 3FQUA 4GUQA 1CQYA 3FHQA 4HCRL 1PLGL 1UB5A 3UIZA 1V5JA 2XPYA 3M36L 4M48H 4W6WB 3UAJA 3QYNA 3KPPB 1PG7H 3S36H 1DVAL 2EVHA 2VXSL 5IQNA 2VDQL 1JUFA 2DQ6A 3M37L 4GW1B 3ABGA 3DUSB 3DK2A 3V0DA 2FX7L 1U0QA 3WENA 4QHLA 4AX3A 5C08A 5IMLA 1FNEB 1ZKAA 3MXVL 5F0PB 4ZUUA 3VH8G 2JH2A 2MNJB 2OTWB 3HS5A 3IJ7A 4ZG1A 3UPRA 1EO5A 2AFNA 4QRAA 1AC0A 4U0RC 4QRFA 5MEQB 4YL9A 1RMFL 3QZMA 1TG8A 1OTSD 4XWGH 5D5MB 3KWTA 2HYMA 1CD1B 1APQA 2QMKA 5T1MB 1IGIL 1S7TB 3ARWA 4IDJL 5GZOA 5KYYA 1CDUA 3TPUA 2V37A 4FNTA 3TF7C 3KPRE 4NBXB 4LF3A 1A6ZA 3OG4B 4OLYL 5FA3A 3FMGL 4QKTA 4YDJB 4FC3E 1CJYA 1DL7L 1M53A 4NQEA 2X70A 4N2GA 4ELMB 4G43B 2IBZX 2J73A 4GP4B 3CK0L 4UDTA 1F13A 2Q0ZX 5ICXB 4QYOA 2ICWJ 4LSQL 1VACA 2H3XC 1NLBL 1I9EA 4U3CA 2EEBA 4N2LA 3NJLA 4GG8B 1AQMA 3AFLA 3HOGA 1AQDA 2ENJA 3OXSA 4PY8I 4JGJA 2YEQA 5A1AA 2DBJA 3O6LH 1XSOA 4D0CA 2AXJA 4KUCD 4FM5A 4JY5L 4F57H 3IDIA 4HWBA 4H0LC 3ZHFA 1KYAA 2XTJB 1HI6A 5F9AC 2JCCE 4HS6B 1U3HC 5HDRA 4ZMAT 4A6YB 4MJIA 2HJFB 1ONQA 4Y4KD 2A5UA 2J25A 1I7RA 2X42A 1HEZA 2BCMA 1G7PB 3BEVB 4Y2DD 1A8ZA 5E6UB 3RLSA 3VXUB 3PU7A 4FXKA 2I69A 1CLYL 2K70A 4KJYA 4GU4A 2KERA 3FUKA 4PGDB 2VM9A 4KUZH 4PIRF 2Y7QB 5E9DD 3DGCR 3HKZA 1ZVHA 1CTMA 5AW0B 4ALAH 4OLZL 2ZUTA 2XQYA 4OF7A 1FZKB 4NQXB 1HL5A 5FCUL 1ADQH 3DO7A 4UZUA 1FIGL 4X5RA 2BJML 3G3LA 4XVUC 2JKWA 3GBLA 4FQJH 4Z7OB 4PVNA 4Z7VA 3JTBA 4ADJA 1FL6B 3A22A 1J1PL 2B9AA 4HH8A 4KAQL 1QI4A 3A6OA 5E24E 4N0UA 2EILB 5HHPA 5BS0E 1H5BC 5B22A 2XQBH 3MO1B 4XXCC 2OX5B 2XPZA 2DWDA 5L30L 3MU3A 3VFGH 4YGAB 4YSQA 3AWGA 4H8QA 3C6LA 2B1AL 1OL0A 1VEMA 3CFBA 3H3PL 3PWPA 1OVZA 1CF8H 2QJDA 2B59B 5DRNA 5DZNA 2D4FA 3VYPA 3MRBA 2KDGA 3MODL 3S3BB 2IC2A 1K37A 3KL0A 4HYTB 2G3NA 1UD8A 3MV7B 5E23A 2RACA 4UIKL 3EF7A 5E2TL 2UZIL 1MVYA 5LAXB 1E5ZA 3I6KB 4L9LA 3NABH 4JNXA 3SDAC 3NJGA 2H47C 1HX0A 4FADA 3QHZL 3DGDA 2O6EA 1U8OA 1IL1B 2VDNH 3DPBA 4PRPB 3W39A 2G4GA 2R4SH 4FP8L 4GQ9L 2PCYA 3M45A 3SODB 2E46A 4UUJA 2ADGB 4UBDC 5I19H 2HX8A 3DMMA 1MVUB 4NCC1 2YUVA 1G1OA 3KS0H 1IQEL 2XQYK 1LNUA 1NANI 2IDQA 4OLYH 2EDOA 4JRXD 3PL6D 1TYEB 3FQRB 1I1AB 3K4DA 3PQYA 4IS6A 4PJBF 4XMKL 4ODVH 2H8PA 2ITEA 5F89A 1ZPLA 2ZOKA 4K3JL 1NFDB 5E2JA 2ZT9C 1ZLWK 1BQRA 3QCVL 3T8XB 3U7AA 1GGIH 1KLFA 3GMMB 1DP0A 3FUEA 4U31A 4X6DA 2YSTA 4NO2B 3QEUB 1QFOA 3QWRA 3KPNB 4OLXH 4BELD 4L4TA 3ELAT 2F1EA 2CUAA 4MCYA 4BWUA 2MHPA 1EMTL 1HHJA 3HNTH 3HE6A 4IOSD 3V5DB 4MNHB 2OK0L 4HT1H 1KJ3L 5JR1H 1F3DJ 1IEBB 1EANA 2NW3A 1NAML 2IGFL 1KXHA 1U4FA 5L2KD 1MWAB 5T3XL 4MS6A 4OQTL 1FCGA 2FL5A 4HS3B 3BIKA 2ATPB 5JPNA 5DZ9A 4M6ML 5C0RH 2GI0A 3BT2L 5D9SB 5GGVH 2Q86B 4MJ5B 4Y88A 1WITA 4FMVA 5I1HH 4UI2A 3APNA 3A4AA 3M46A 4HJUA 1IGFL 3MOQA 4JHAL 4KC3B 3BE1H 2NMSA 4LOVA 4BZYA 2ZOTA 2ITCB 4GSDL 3ZN6A 2CK0L 1X7TA 2L7UA 3IN2A 3O9WB 4Q2ZB 5GS0C 4ALAL 4LLDB 4JHWH 4V1DB 2CO3A 3MOAH 1AR1C 5D71L 1TTRA 3G5VB 3II2A 3MCKA 4ZD3H 4M56A 4MCNA 3SPJA 1MF2L 3EJJX 3BZFA 4FQXA 3SSGA 5CD3B 4NGHL 2WWMC 3UMTA 1JNNL 2C4FU 4L3CA 1O9ZA 2FZ3A 4Z0XA 5JORA 2VXTL 2A3TA 2MQ0A 2VXUL 4XTRC 3O3UN 3SKOB 2ENYA 2AK4E 4X9IA 4X7TB 3US9A 4KKAD 1MY7A 5KG9A 2BSFA 4G82A 3RDJA 1NTDA 1I8KB 3BP5B 2Q6WA 3M17A 2EJ1A 3BPCB 2DMBA 2VJXA 3QW9A 2BHZA 4MA7L 5C07E 3QISA 4A66A 1Y18A 1VCAA 3FH8A 1KGCE 1Q4NX 3BKMH 3N1FC 4N20A 4EEEA 5C9JB 1F1AA 4N0RA 4I18C 3FTWA 3HBZA 1E4WL 1FSKB 4XMWA 5IMMA 1YEGH 1UT9A 2JMRA 2CKBB 4F9LA 3DBSA 4Z7VE 3G6AA 1KV7A 4KKBD 1N6UA 2OMYB 4M4RA 5FYKL 3EZ8A 3ULSA 2J34B 4WJG3 1N7DA 2UZXB 2WMPA 3K91A 4K5PA 3CENL 1HHKB 2SEBA 1CXKA 3S96A 1NMCB 1ZANH 4U1JB 5AUMB 4YR6A 2R1WB 1RZJL 4B60A 3FO9B 3T3PF 4MDIB 3IVKA 1SLUA 3VXUE 1GGBH 1ZXQA 5FECB 2CO4A 1XF2B 4HIJA 3MODH 3ENSA 4PRIE 1WHOA 3VRLE 3IBOA 1G1CA 1VFBB 5IVZA 2UZIH 3IETA 3OKLA 4XXWA 3BJLA 2FO8A 3F58L 4FFYL 4IBQA 2QKIB 3LZLA 4BSWB 3FQ1A 3RWJB 1JVOA 3DTXA 1U67A 4N0UB 4TTDD 2BNUB 4JQVC 2BHUA 2Q87A 3VXPA 1WBXB 4DP1X 4IGBA 5F1NB 5DVLA 4R5VA 4OGXL 4DGUA 2X4TA 5JOPD 3ROLB 2FEDD 1D5XB 4EN3A 3P40A 4DN3L 1FJ1A 3SDXE 4AGLA 1KCSH 2QLVB 4YC2B 1ZWIB 4D9RE 2OTWA 4FI6A 3IRPX 3EHBD 4UV4L 3OKOB 1UENA 4UM8A 1XH2A 4P2QD 4QXUH 5KUKA 2HFEB 4MDRA 3HE6C 4XOCA 2JKLA 1HHGB 4WWPA 3T3PB 1A6UL 1HE7A 2V5TA 4IDLA 2VR9A 4XOBA 4KY1L 4FZ8H 3QQDB 4CSSA 3HKFA 3R1GH 4Q9CA 5EZJA 5EMYA 3B2UD 4FFVD 1KLJL 1YY8A 1IQFL 2EQDA 1LD9A 3P3RA 4HJSA 5GRJH 3ZYJB 1AKJA 1R3HB 2CH8A 2A6DB 5F7MC 1U8QB 1JCVA 1DBJH 1MOEA 4FFYA 5HD8C 2JLPA 4GW1A 4C56E 1ORQA 4IRZA 3I3BA 4I3SH 3FO0H 3LDBB 4I77H 3TC9A 4OM0L 2QHRH 1JV2A 3UTTD 2QPSA 4GG8A 1NFIB 1EFXA 4UQDA 3LNDA 1SEBA 4X7DC 2D7MA 4A2GA 1BD2E 2KQMA 2DL9A 4M5YL 4N2IA 5ANMB 4GRMB 5E6ID 1TUPA 3ET9F 1UURA 4X6CA 3NTCL 5FR3A 1WZ1L 4NO5A 3EOAA 4YDLB 3PYCA 4KGLA 1EAJA 3P5BL 2QLYA 1C08B 3IJEA 4ZFGL 3ZVVA 5ILTH 2DQHL 1ZV5A 3SDXB 5IKQA 3GSWB 3U6RA 2W2OE 1IAIL 5DJ8B 5EOCL 1HCZA 3RIFK 1B0IA 5I24A 3TZVB 3GJFK 2ISDA 4PGCA 4OB5H 4Q6YA 3DWTA 5JXED 2P1YA 4X4KA 4NQTA 1FVDB 1FO0A 1NANH 1PZBA 2VDLL 4TPRL 1EVUA 3C60D 4OZFG 5E00A 1RZ8A 4YDVB 4DPRA 3TESA 5I23A 5TQ2H 5HGBB 5I1AB 1R5IA 3LVEA 1I9RL 3ZY7A 3F62A 3GSQB 2Z1KA 1V3KA 2YD4A 4PJFF 3V0VB 1Z9OA 4GUCA 4BFNA 2LAAA 4NQSA 2FECL 2YAEA 1ZEAH 2W60B 3IJ9A 3OPZH 4X4XB 5CGTA 3WJMA 4XN8A 4LVOC 2DLHA 3D8MA 3KPNA 1LNUB 4KUCF 4PD4J 2CSPA 4AIZA 4BK8A 1PZ5A 2N3JA 4FTVB 3OJDA 4JG1H 1FFMA 2CHXA 3HJ0A 1JPEA 3MJ8B 1A4KA 5KJRH 3MZTA 2PETA 1I3GL 3X3FL 4RGNB 1Q9OB 4M3HA 2X28A 4XLWA 2Z9TA 1YHPA 4LSPL 1PG7L 2NSMA 2MOVA 4XMTA 4WJ5B 3R05A 3AG2B 2WLIA 3BPLB 3MOBH 3OB8A 5D96C 3S88L 5COXA 1DQBA 3HMXH 5D1ZI 3IFOA 2WFXB 3QZBA 3RYMA 3V7MA 3QARA 5C0FA 1E3FA 4N5ED 1M2VB 4LCVA 3PAUA 4BQ6A 3NSJA 2WXJA 4K3HA 4K55A 5EZIH 3WO4C 4P4KA 3MV8B 3IPFA 5IP4A 5J11B 4X98A 2CKBA 5EUOA 4AEFA 4FN0A 3SJVD 3FFDA 5DA0B 3WDJA 3ROOA 1TLMA 4JLRA 3O11A 3HI1B 2Z7UA 3ESNA 4XMKH 2VDOH 1VSCA 1JGUL 1XF5B 4K3GA 2HP4A 3WSQL 3N8WB 2WQUA 1COUA 2QGBA 3QDJD 2CO6A 4GYBA 3AREA 2Y06H 1LE5A 3L48A 2BPBA 3C6LB 1M9SA 3K6SA 5AB2A 2R8SL 5LCVH 2CO2A 5I18L 5CJBA 1KB3A 3M86A 5L8JB 2WPME 1UG9A 3ZE2B 3BVNB 1MHHA 1OM3L 1LYQA 3QDJB 3KNBA 5E8OA 3T0ED 5K5YA 5FDWA 2HKAA 3BLPX 1RZKC 5DYOA 4I1PA 2APVA 3UPCA 2BOUA 3IFNH 4C55A 4LASL 2H6OA 2A4EA 5JA9A 2OYUP 1UYWH 2BS9A 3VXME 4HSAC 4YSPA 3ZO0A 3DHPA 5E94A 2ZQKA 3NYKA 5GGVY 2WXKA 5E2WL 1IGTA 3U4BH 2IVFC 1NEZA 5B1BB 4ZODA 5C6TL 5HGHB 3FOLB 4TSAL 3DX7B 1IB5A 5DC9B 3OGOE 5BJTB 2BVPA 2NY6C 1P4IL 5J3HC 4AEEA 4QRSA 2OXGB 2NW3B 4FYRA 1IARB 1G7JA 2XJLA 3EBAA 3ESMA 2DQEH 2G9KA 4HH9A 2IQAA 2A6IA 4JY4B 3AROA 4CN4A 3QI9B 1T7YA 4WEBL 2H0FA 4MJ5A 4WVRA 3UC2A 4LCUB 1RIHL 3Q06A 4PRNB 2WCPA 1ROCA 2JJVA 4GAFB 4RGOH 3MRCA 3TEXA 4BSWA 1H3TA 4H7VA 4OJAA 1KLFB 3GMMA 3OL2A 3IJHA 4YE0A 4JN2B 3IAGC 1CVUA 1F3JB 4ZFOL 1IQHL 3NCFB 2BIHA 1Z5YD 1XL6A 2E76C 3AY4A 4AJWA 2HCZX 4WEEA 3KEHA 2P5WE 3B3IA 1XIWC 4NUJA 1KPUB 4UOQA 5JDJA 5E1QA 4GO9A 5B4MD 4NEHB 1KJMA 3EYQC 2L4OA 4TMPA 3RJDA 1DN0B 2P95L 1O6SA 4Q89A 3VMPA 4MA3B 5D70H 1M6UA 2WINA 3BAKA 3MRRB 4RA0C 2MHAA 1QLEH 1UQSB 3DVNB 3KJ6H 3QEQE 1EHXA 4UU9B 4PBVC 5HGAB 3QQDA 1BLNB 1SDDB 2HLAA 4UIMA 3ALPA 5I8CA 3TT3H 1E0OB 5HYIA 2YFNA 2WZ0A 2F53D 3AS1A 5DS1A 3IU4L 1HT6A 3G6JA 1GHFL 3TBSB 4Z3JA 3V4UL 5EOTA 4OI8A 2WLZA 1TO5A 2WMPB 3NCEB 4K94L 4K8RC 4R26H 1ETZB 4R3SB 4H5SB 5BPPA 4OBSA 4PRPE 4W9HC 2HPOA 1MRCL 1SYVA 4A7IA 3FTGB 3RJQB 2GY5A 3HFML 2DY2A 2PP8A 3V0JA 2ZKYA 3MLTA 4O2EA 5KYXB 1ZK5A 4WU5B 3L6FA 4HIJB 1HH9A 3VTMA 4IOIB 1EFXB 1T1WB 2NY7L 3NDZE 4KBPA 1N18A 3N85L 2JQAA 3IMVA 1E9PB 1QFUL 1A7BA 3FU0A 1AGBB 1WFTA 2C9RA 2FX8L 3BD3A 3MDJA 4G8AC 4X6CB 2GW5A 2DQCL 2HN7A 2X0VA 4GW4B 4R0LA 3RWJA 1EFQA 5EA0H 4K71C 4Y16B 1UXSA 1UZ6E 1MIEH 4XMPL 2WJ5A 3Q0HA 1AO7E 3RNKA 5L7XH 4NRXA 3HPTA 4LLQA 2J1XA 1UWXH 2V6HA 1GOFA 3D39B 1PBYA 1NDGA 3GMOB 4NUMA 1BF2A 3UDWA 2QQNH 1L5GB 2AAVA 3SN6N 2F53B 5IG7A 2LT9A 5I8EB 4MHHI 3SYOA 2AK4B 4YDKL 2F53E 1OF0A 5DUML 4Z1PA 1M71A 2D2CC 1HL8A 3MKGA 1UACH 3MLZL 2ZCKL 4LSUH 1IAOA 1U8PA 1K6QL 4JRLA 4QHMB 4IHOA 4YAQA 3E1ZA 2GABA 5T3XD 2CA4A 3F01A 1FO0B 1LLAA 3LN9A 2DQUL 3MXVH 3O6ML 2YGVA 4KJQC 4DZBA 2A73B 2YPVL 3HZYB 3DI3B 5JW4N 1R1CA 1MREL 1UH2A 1TVDA 3UG4A 2HH0L 2ZWYA 3NRPA 4OU3A 4NOBA 3AU1B 2H6UA 4E5XA 3CN4A 2GBTA 3L1EA 4BFIB 3ROOB 1FUNA 4NQDE 1KC5H 2BNUA 4EZKA 1RZ8B 4YDVA 4IIQB 3ARFC 3WY2A 3O4OC 4DOHB 4QOKD 4BFGA 1D5XA 2BINA 4YE4L 4G1EA 4NKIH 4Q9QL 4X5WA 1MWAH 1QSFD 3SZ6A 5I5IA 4XCFH 3MUJA 1J86A 4GS7B 4NIKB 1QVOB 2VN6A 1SEBB 1G2MB 4DO6A 3LRSA 5CD5D 4MAUL 4R7VA 5F88B 5I1JH 3UP1A 4PVLA 1HESA 1IQIL 1MCRA 2Z64C 1FE2A 4M10A 2RGSA 3OC8A 4RMSA 3VD5A 4A2MA 2QHLA 2ZOOA 5AKSA 5MHSE 1KJ2A 4G1MB 1YN7B 2XU9A 2V3EA 2XC0L 5DO2C 2WZPD 4DKEH 3LXUX 4H8WC 1P2CB 4U6HB 3RBSA 4JFED 2Q3AA 3AQZA 3U4KA 3INUH 3Q8FA 4NQVA 3VDAA 3HG1B 4BKLB 4Y4HD 3PE9A 1G4MA 5HDQH 3OB0K 3UTSE 3A0OA 1DO6A 1R3LA 1JYNA 1FNGA 4PRBA 3DOHA 4XP5H 1TVHA 1BEYL 1CN4A 4ZTEA 1HSAB 4OLWL 1JAEA 4NC1E 1C5MF 2UYLA 4NYLB 1PZCA 2QFRA 3HPLA 4LQFL 2AV7A 5CEXB 3OPZL 3OKYA 4WU7B 3ULVL 3G5XA 4ZW3A 1QR1A 3EYFB 3T0EB 3QCUH 4BWWA 5HHXL 3S97C 3TO4A 3FFDB 5CEYA 3KYMA 5T1LD 3CWGA 5HGGS 3SOBL 4IGBD 4KHTH 3F7YB 3BMVA 2R69H 3OHXB 1W7XL 2Z4QA 1DQVA 2VH6B 3JWDH 1E5BA 4FNRA 4GG6B 1P7QB 4AL8C 5ACZB 2OKMA 3D05A 5KSUB 5D1QB 2NSQA 4NN5C 3HS0B 4NKOA 4FFZL 2C7UA 4LCWB 3FBQA 1RU9H 1XDTT 4HKJA 3WN5B 4Y2LA 1E28B 4WI0A 4HWZB 4YMPA 4MAZA 3LS5L 4K7FA 5I76B 1FFPB 5JOFB 3RFZA 1IQKL 3NIGE 1OE1A 2R0WH 1AD0B 5B39A 1S7UA 2BWIA 2XC8A 3AG1B 1AO7A 2JKNA 4MQTB 3BQUB 4FQPA 1QR4A 1BAGA 4GU3A 3VJ6A 5BRZE 3QJXA 1C16B 3I02B 3MACH 3LC3B 2FH8A 1DVTA 3N5AA 3VXSE 1F41A 1KBPA 3HR5B 4AV5A 3FN3A 3FTXA 1IGJB 5DJDB 1EO8L 2VQ1A 1IGCH 1AC6A 2VIRB 4YC2C 1VZGA 2DB8A 4PRNA 1UFUA 2JIXA 3TVMC 1HOCB 2W60A 1TIUA 1UHVA 2WK2A 3PHOA 4JM4H 1FF5A 4OCYH 1NCDH 4PS4L 5LB1A 1G9EA 1EHLL 4IMKC 4NFCA 4YX2L 2XZCH 1JP5A 2ZUQC 4YVUA 5BRQA 3VGBA 5KZCB 4O2EB 3HTLX 4FLOA 3L95A 4MS8D 4ZT1A 2BP3A 4HXBL 1H9DA 1FNEA 4ZUUB 3AWFA 4FE9A 4YXHL 1NCAL 4H2CA 1XSKA 2W0FA 3DROB 1YEJH 4I1RA 4UILL 3OXSB 1Z32X 3UTZB 3NH7L 2JVUA 4LPCA 4Y2NA 5L9DH 2NY0D 5KSVB 4RIRA 5HYSG 2P3FN 1M7IB 3KVDD 4OM1L 2PXYB 3FCTB 4JGNA 2F7RA 3RWIA 3QG6A 4IOFD 3AS2A 3KLLA 4RRYA 4ZUTA 3SBWA 3M1OA 3FW6A 3M1BB 2J2UB 5I1HL 1OTSC 2DKSA 5CZXC 4G5AA 5BXFB 3WU1A 1R0AL 2PPAA 3MRKB 1NEUA 3OMZA 3UMNA 5MEQA 2VQ4A 2P80D 3LZFL 1KCUH 2VZ1A 2XWTA 3CZSA 3ZT5A 1OTTC 3D12B 4KDTA 3VYOA 3QQ3B 1BFOA 4OJDH 4QO1A 4Y5XB 4FAAB 3O6KH 1S7TA 3RIFF 1PYWA 5IK3B 4BH7A 4YSRA 3HNTL 1LILA 1UCBL 4OZIE 4P0DA 4JCMA 2PTTB 3L9RA 1U8JB 3V8CA 4W9LC 1L3YA 4U2ZA 3IDNB 3R4DA 2F1AA 1ZIAA 1UCTA 4WNQA 1ZCRA 2BY3A 4YJZL 1MG3C 2OL3L 1QABA 3GXUB 5G4NA 1ZD6A 4TVSa 4WI6A 2OW6A 1MCWW 4PJ9B 4L1DA 4NXKA 1HAFA 2GTQA 2X4UB 5GSVB 3V6BR 2A77H 1T5WB 1KPVA 1G9ML 2Q1EA 2A2QT 1XSIA 4ZS6D 1WRFA 3FUIA 2OZ4L 1EWHA 1V3MA 3B2XA 3Q6FB 4X4ZA 2H0EA 3DJRA 4G3YH 3F04A 2FO1A 5I19L 4EI5A 1KPUA 1M71B 3AUWB 2K2TA 1C9SA 4OLVL 3VI4A 3MRJB 1FH2A 3LPFA 2B77A 1X5AA 2BFVH 3UZQB 3LB6D 2QSVA 2RCSL 3HI5L 4LKCA 4NQXA 5D7LD 4EZLA 4WTXA 5CZVL 1AHWB 4NXSA 5DJCB 4R4FL 2NX5D 4FQXC 1GGUA 3ZQ9A 2EI6B 3TCTA 2FR4A 1W8BL 4HJEA 3U0PB 4LCUA 5I1EL 1WFUA 1YC7A 4D9RD 3JVFC 1DVFB 4FQ2H 4FHJA 4PJ5A 1EDYA 3MV8E 5GGTA 3RHWK 4UOW1 2A4ZA 1FZKA 2DTML 1NAKH 2YEVB 1CXFA 3VSUA 1WS8A 1NDMA 1X4ZA 1PS3A 4NA9L 2YMXL 3X11A 1S7SB 1JNHB 3L3IB 5EDSA 1ZT7A 1B0GB 4MNQE 2JIXD 1MJUL 5IFAL 3E6FB 3LV3A 1RL1A 2AVFA 4IOIA 1I3UA 3TA4D 1QQDA 2O5ZH 3GNMH 3BGAA 3ZTDC 1CD9B 4JZOA 2DM4A 4HGWA 4NPKA 3I85A 2ZUQB 1R3JA 3IFLH 3T6QC 4FQLL 4QRRD 5FFLA 3D25B 5FWRA 1G7IB 1XF3A 4E9TA 3FN9A 1G43A 4KO6A 1U8LB 3LZOA 1NAMH 2IGFH 1SLVA 1LP9F 1NJ9B 1CT8B 1AVAA 5KIRA 2Z7WA 3IE4A 4ACPA 3LRGA 1JF6A 1E9QB 1NBZB 3OQ3B 4FTVE 4LLVB 1OW0C 1PJWA 2GJ6B 2DJ4A 1YCSA 4X5LA 3NMEA 1HXMB 2EIEA 3L5XH 4BZ1A 4OD1L 5LXVA 2APSA 3M7OA 3QWRD 4K2UL 1MCJA 1P5UA 3AB0C 5AW3B 5FGRA 3VA6A 4X7SH 1YEJL 4C8XA 3FB8B 3LN4B 5JPMA 3VWJB 2WJ7A 4QXWA 3S2AA 4U6VH 1NPEB 4KPHH 3QDMB 4RGMC 4R4NC 1GTNA 3DTDA 3HO5A 2XUWA 1IKFL 3APCA 3W0WB 3GF8A 2Y2TA 2ERJC 2BCKB 3E7JA 4KTYA 3P4MA 3QR1A 3T4YB 3UYRH 5H35B 3MNVB 2BVYA 3PP4L 4M6NH 1PZ2A 2R1XB 5D6DA 3CSFA 2BP0A 3ZL1A 1JXFA 1RK1B 1PY4A 1JXJA 1AQHA 1JZHA 2HT3D 2QT6A 3LMJH 1ZTMA 1KKEA 3I50L 5DMYA 5CLZA 3TX4A 5BOZG 2AVGA 3WFDH 5BV7H 5JO5B 2F9BT 1BZDA 2CLRB 4O2CA 4P23D 3H6JA 4L3FA 1TPXB 3NCWA 4OJFL 3HAEA 3DXAE 4NI6A 5EO9B 3MR9B 4Z3HA 4I0PA 5AZ2L 3ZIMA 4FFVC 3CZFB 5C0BD 2HTLC 4D9QD 3G5YA 3MV11 5I1GL 1EBPA 4PWIA 1CLVA 2BX5A 4AG4L 4GKLA 4GQRA 3STZB 3U46A 2EDNA 1Z9SB 4Y6DB 2H1LM 3BXNA 4NZ8A 2EDFA 4Z77A 1N68A 3R8BB 1HHJB 4KRLB 4DIXA 2LHAA 5HHNB 3SOBB 5CJ5A 4L4JA 4RDBA 3BN9C 1MW0A 1QNZL 2UY6A 2XWZA 2A7BA 2I9TA 4J6IA 4YSUA 2JXMB 4G8FA 2EIDA 5HPMA 5EC1A 4A39A 2OMNA 2BQ6A 2DTSA 3U9PL 1BMGA 2GBUA 2WPIE 2YSSB 2I9LA 3MJ9L 1MFMA 4TULH 5I0YA 2L7EA 1V10A 4X0KA 3OF6A 3QJHB 1EK3A 3TV3H 5IWLC 2NY2C 4S2SA 3NAAL 5CCHE 4HKXA 4TUJA 5CEYB 3B56A 2QQLH 5CBAB 2O61B 3D85D 1GYAA 4I8DA 3B9KB 1F6AB 3D2TA 3FSVA 4EVNB 1S7RB 5IFHL 4N3TA 4L3CB 3TBTA 2EAEA 4U1MA 3WO4B 2ZJSH 4WDIB 5IJKA 2BZ7A 1HAWA 2IAMC 3QULB 2Y25A 3H9SA 2BNQA 3NG5A 1TJXA 2Y7OA 4LLUA 1TOXA 4N9GB 3UC0H 3VG9C 3FCUB 2WZPA 5FYKE 4C57C 1W6LA 5C0CD 4K3EH 3LB6C 1QHQA 4MJID 1IBFA 4OD3L 1U8CA 3BW9B 3HC3L 2KPWA 3VM7A 5I2IB 2NY4C 1KCVH 4XCEA 3PUCA 2XBTA 3WFHB 1CR9L 1D2OA 1IAKB 2VLMD 2K6YA 1CE1L 2J71A 3CVCA 3N9GH 3K2IA 3A4EA 3NGBC 4ZMWA 4MZ2A 4FS0A 3KPMB 3LNGA 5DYFA 4F58L 1T3FB 4JO2H 3TK6B 5L88L 1IQGL 2Z3FA 1A7QH 2VN4A 3NFSH 2QKIA 1CICB 2WTPA 4IRJC 2IAMD 1LPZA 5I1DB 2EIZA 2VXQA 4XZ4A 2R23A 4YLCA 4JRFA 2NCEA 4F9PC 1XL4A 1YPZF 4IJ3B 3VD4A 1DUZA 2B9BA 5FK9A 4LHUB 4JYVL 5TQ0H 1O5PA 1OGSA 2QR0A 2AEQH 1QFWL 5JIIA 2ATKA 3PGHA 2JFCA 2PR9A 3O2DH 3Q2VA 5E2VH 1TZAA 2VR4A 3H2PA 4MB1A 5TQ2L 4LSTH 1JBJA 1KLOA 3F00A 2FSEA 2DEWX 3V4LA 3Q5TA 3M07A 4GG6E 2SODB 2XETA 1CBJA 2WV3A 4XVTL 4H40A 3ZKSD 4CKQA 3HCVA 3G08A 5IM7B 3R19A 1K85A 3E38A 2F68X 2WN3A 3QFGA 3DYPA 2I85A 2P5WD 2R69L 5D1XA 5FYJE 1MW3A 1Y0LB 4KI5F 1DO5A 5FYKU 2JK5B 1U8IA 3RX8A 1VGKA 4YEFA 4Y1SA 5BZZA 2K6ZA 3MLPA 4B53A 2LLNA 2FBJH 4XNXH 1CVSC 4UQAA 2VISB 2AEQL 4R84A 4JHVA 2I5YH 1QYGL 4DGVL 2VC2L 1G6VK 2DMGA 5J1SC 2PCPA 3VFMA 3D4GA 4J23A 1GSMA 1NCGA 1RUQH 5LCVA 2M1KA 3V8OA 3X1EA 2CLZB 3DOIA 4OFIA 3MBEC 1RPQA 2NXYD 5DRZA 5F3HB 4BEIA 4KQ3H 4AZ8A 5D4QA 2ZCHH 4BHUA 1UZKA 4EDWL 2WLLA 2C1OA 5IROA 4HFUH 1NCWL 4IU2B 4M00A 5HPOA 5BVPL 1NJ9A 1XGYL 1INDL 1AQKL 5KANG 2JKRM 2JTYA 1P9JA 2JJUA 4FHKA 2FX9H 2JB5L 2MPVA 4JDZA 4HQQL 1RURH 5SWZB 5ID0A 1CIUA 3WTXA 3DECA 2AKRB 2YBRA 4J3BA 4NRYB 4APQB 3K0WA 2ZWZA 3H56A 1J9QA 4LNRA 3UACA 1A3LH 1AXTH 4Y7OC 1RUPL 4B3VA 5ESAA 4OTYA 5FA4B 5F1IB 1HXMA 4OKVA 3D69A 3GJEA 3G04A 2QQLL 2AANA 1HVXA 2GT9A 4WW1A 5K39B 1SJVA 4A2HA 4A55A 1GW6A 3DK0A 4YL4A 5GRYA 3BJ91 2FQDA 2VR3A 4GFXA 4PY7B 2QPEB 3QZLA 4Z5RA 4JPIA 2WG3C 4KOCA 2R0WL 8FABB 3MLWL 5TDOB 1BW8A 2YOCA 1HINH 4WFHD 2DIJA 4ZUWA 5BRZA 3SGDI 3CV5A 4ONFL 3MLZH 5GGTL 3SJVA 2KLSA 1RSFA 2IOIA 3NIFF 1H8NA 3D2UA 4MQSB 3O2VH 3H85A 5IROD 4XC1L 1OSPH 2VH5L 1SM3H 5FW7A 1GIGH 5EU4B 2YPLA 3MLXH 5TE7L 3MNDA 2EIJB 3IMSA 1B88A 1R3JB 1FFRA 2IAND 2KUTA 4O2CB 4IBVA 2WLIB 1U3YA 3CDZA 3RPIB 3IKKA 1MI5D 3OAYK 5D1QE 2IH3A 7CGTA 2YRLA 1G7QB 4NX0A 3SDCD 4ADGA 5DJAA 1FNSL 1PKQB 1S9VB 1QFUH 2PPCA 2ZONA 4IM8A 4MD5B 3SQBB 2KDYA 3V5DA 3DX6B 4G7VL 3K2UL 2VLKA 1LK3H 4ONGH 4P3DB 5AZUA 3T6WA 1YYLL 1WAAF 3BP4A 3S6CA 2LVEA 2A6KA 3DEMA 1Z6CA 4G8FB 2FDBP 2P8MB 4F7MB 4YDIL 1PKOA 3LEXA 3ASNB 3K4ZA 1OM3H 3CCHA 3FU7B 1AZVA 3LMJL 1BVKA 1BZ7B 1YPZB 5C07A 3CBRA 4PJ8C 4E9RA 3INUL 4KI5E 1DDTA 4LXFA 2P5WA 2Z0UA 3DJZA 4DF9A 1NFUB 2H1PH 3H54A 4PMEA 1SEQH 4ODTH 3JTTB 1G7HA 4Y4KB 4LCWE 2OTUB 4OD2B 3N40F 5ITBH 3NCBB 4OFQA 2VLRB 5C2UB 5FGBC 2XJKA 2E59A 3KBFA 3K80A 5LBSH 1E7UA 4WNSA 1WG3A 1HIML 1RD6A 2HKHL 3P0VL 1HOEA 2RIKA 1KIPB 4OGAD 5MHSD 3UJTL 2B4CL 1CLOL 5JB8E 4JFFD 5F44A 2JJSA 3O8XD 4MNQA 3NK3A 1Q94A 1XB8A 5FDWB 3GPEA 4YHNB 1XCXA 2G2RB 2RHEA 2VN5A 3D39D 2J43A 3X1GA 5D1ZB 1CFNA 2I07B 1KWKA 3WO3B 1E9OA 2OMUA 2A9ML 3H2WA 3ZKXC 5GGRA 1EHAA 1ZLSH 4FXGC 3WLBA 4KROD 2VKWA 4U1LA 4YHPA 3IDGB 3ZMNA 4PJ5E 1AI1L 3MA7A 4E9XA 1NGWB 4DP5X 3TEUA 1E90A 4A7UA 5KS9F 1ZLWH 2GSGB 2WXFA 2VT0A 2YEZA 3MLRH 1MDTA 1VENA 4HPOH 4OVVA 3PIQB 6PCYA 1LK9A 1EFXD 1QASA 2WHVA 1AY1L 2ZXCA 3P4MB 3AU0A 3E9UA 3K5RA 1A64A 3IU3A 1DDHB 4FI7A 1YUHA 3VSTA 5CLYA 4XNZC 4XT1C 5DUMH 2OYLA 4YDJA 4TQEH 1QO3B 4WWOA 4H0GA 4JN1H 1NSNH 4MAYD 1CDCA 3GEWB 2WKLA 5I71B 5FUCC 1N59A 1UKSA 1N8ZB 1U9KA 4A67A 1WICA 1CD8A 3BKCH 3WD5H 1UXMA 3FQUB 3X14B 3KXFE 4WEUD 1EJFA 5AVVB 5T5NG 4KRPB 4XCNB 5CJXC 4QI3A 4L8CA 5F8RC 3U7WL 3BFWA 5D2NC 1DQIA 2UUDH 2QKSA 2R0KH 2Y5HL 1EJOL 1KXQA 5LG1A 3LEYH 4D8PB 4R0LB 3UGUA 4I87A 1UGKA 5IIEB 1E5AA 1GZQA 1OP3H 3DLQR 2W38A 4OIIH 2BNQB 5L88H 4NZUH 1ONQB 2ZXWB 3X13A 4GAJH 2NXYC 4PCTA 2YRZA 4F58H 5IEHB 2CLVB 3UJIL 1OAUL 3WEXB 2PO6C 1P1ZB 3O6FD 3ISRA 4PRAB 1YDPA 4XGZB 4RSVA 4X8GA 5GSRB 3OR6A 4JRWA 2K45A 1SY6A 5HYJD 4GKZA 2BQ7A 4YFDB 1R75A 3AQYA 4XCEB 1SJHB 2PMZA 4OBRA 3RA7H 4ANVA 1JERA 4MJ6A 3UCRA 4A63A 4NO3A 4CN6A 4AYFB 4DKEL 1FFOB 4Y5VC 3DVGB 4AKPA 3B5HA 1T1WA 3HA0A 5LQBH 5CINL 3S35X 1KYOK 4JRXE 5I1JL 1GCFA 3CFCL 2HA1A 1NM4A 2ADFL 3MUZ1 3VFPA 5L4JA 2JJWA 1ORQB 5C0BA 4N24A 1OAYL 3VWJC 3BZEB 2FJGA 2VERA 3QQXA 1KCRH 2FT8A 1T7VA 4JQIA 5H37A 4BKTC 1NPUA 1R17A 2ALAA 1OALA 1LK2B 1T89C 1BQLL 1SXCA 4JVWA 1AGBA 3QCTH 3WKQA 3MCYA 2VMCA 1RUQL 1NCCL 1GMEA 3CHOA 2WQSA 3OAUH 5IB2A 4HOWA 5D6DC 2C3VA 4RGOL 2BVQB 3QR0A 2Z91B 3T0BA 1ZEAL 1T1YA 4IBYA 4JFOA 1USZA 4UV7L 5E9NA 3KPRB 5I0VA 5IESH 5EEUA 2VWOL 5D7HA 2X3CA 5A2JH 3EDJA 1KBBA 3DX6A 5BV7B 3CZGA 1MCOH 1SOQA 1SFDA 1CICA 3HNVH 1ILSA 2NLJA 2WWKO 4YWGL 4PJCB 4OFYD 3ARGB 4UT9A 1GK5A 3HIZA 1CPUA 2ZPKH 4PS7A 1AE6L 4JDEB 3RVUC 2IANA 4YNYB 4LSSH 3TH2T 3BSHA 4Z23A 2N01B 2YLKA 5E70A 3UBGA 2NXZB 5D7JD 1ATBA 1Z9PA 4XVUD 3VXTB 4FABL 1MLBB 2BNRD 2RNLA 4D0BB 3DIDA 3DMMB 4F7TA 1IOEL 3KHQA 5J4MA 3TP4A 1A8JH 3GBEA 2UWEA 1XGUA 1Z5HA 2J6EA 4KMTL 4DTGL 4NZUL 1URLA 2XTJE 3KDMA 3ZUCA 5TDOA 3RDTC 4EDXB 3KL3A 2EEXA 1JZIA 1S7WB 2FAUA 5ETUA 4CDHA 4W81A 1C12A 1N3NA 2CR3A 3CHXA 4ZNEE 2WOBA 1MHEB 5EIIA 4PJ8D 1CLCA 1WU1B 1A4KB 3MTRA 3NFSL 4HAKA 4NRXB 3PV6A 5IV2A 3CFIC 3B3BA 3EF4A 5HJ3A 3W0WD 4NP4L 4X9HA 3QDAA 3IMUA 1AYOA 4ES8A 3REWB 2V2WA 2RQEA 5HI4C 5DRXA 3T2LA 3GBNL 3RTQD 4K5LA 5DJAB 1DJSA 2IJ0C 4JN1L 1MOXC 3CC1A 4PUBL 1UZJA 5GJSL 4XPGL 4HUMB 5B38A 1FAXL 1INDH 4AVIA 5KSAD 5MEOA 4E41E 2V2XA 5EUOB 2O4EA 4XMZA 4NPYA 4Q52A 5EUOE 1HSAA 3BEWA 3GJFA 3OG6B 3MCG1 1LMJA 2VLJA 5KSBA 4Y9FA 5A16A 3ZYIA 1MHCB 2VIRA 4AH2A 4NQEB 5IMKA 3C60B 4CADB 1ETA1 4CN1A 5LNGA 1CI5A 5JHDB 2Z31C 2IDCA 4UUJB 1OE3A 5DMJB 4XI5C 2DJMA 2H5UA 2K7QA 2ZUVA 3JZYA 4QYOB 2VJ8A 3PJSA 5IOKA 3ZRSA 1EAPA 1J87A 2EZ0D 4HXAH 1XZ0B 4PV8A 3S34H 3GB7B 1JZ8A 4PJFB 3UIYA 4TQIA 3ZL4L 4F2FA 5JHLH 1O75A 1QYGH 3CN1A 3DIFB 3NEOA 3QXUA 3L81A 4PYGA 1P7QA 4WKXA 4XVJL 5KSUA 4YEEA 2FK9A 3MPCA 3NTBA 1B4RA 5L2KA 3BSZH 2MCMA 1CU4L 1QSEB 2X53A 2AK1L 5GGRB 3PFQA 3BWAB 5AYUL 1CDYA 4P2QE 4K5MA 4HCFA 3BGMA 1T0PB 3FYEB 3BC9A 2FO4B 1ZS8A 5DQJB 4PTTA 1EPFA 4BFKA 2YEZB 3MUGA 1X5GA 5EWIL 1X5FA 1Z3RA 4OZIF 1UXWA 4MZ3A 4L4TD 1U41A 1DANT 2W95A 2H1PL 3FONB 1WV7T 4AYDC 5C0GB 4GQZA 5DJ6B 2VRKA 3ASOB 4NKIL 2E7CA 4S1QL 3O6FA 3L4TA 4JDVA 5IW1B 4LEXH 1M2OA 4LSRL 5E2WH 2UXVA 2YGPA 1V54B 4FQIH 3UROR 4HUVA 1FFTB 1BYPA 1NBCA 3UG5A 1TZHB 1P4BL 2OCFD 1GZPA 4LHUG 5FYKH 4R4FH 5AZ2H 3BRGC 1N5YH 1JHKL 1HHIA 3CZEA 2Q8AH 4G3YL 4IBSA 4KU1A 1KV3A 1FH5H 3T08A 3WKPA 1KIQB 1BYNA 5EZOL 4AE1A 1PFXL 4D9QE 2Q20A 3KEDA 3HRZC 5JW5B 2A9CA 3G5WA 4XXDA 1N10A 5JW3H 3OJMB 5C0BB 4FXKC 3T3MB 1PDKB 4GXUM 1U3ZA 2C9PA 4NM4H 3TH3T 3WN5A 2C9QA 5D1ZC 4HJ0D 4GMTH 1S8DA 2D7PA 4PG9B 4MSWB 4O02H 5SWSD 4JFXA 4Y2DA 4RNRB 1BOYA 3ARUA 1M7IA 4FULA 4PRAA 4Q97A 2WIIA 4B50A 1TYRA 5AB9A 1AH1A 2Y6SD 3EGFA 3JWNG 1HAUA 3EGXB 4ODHL 4G9FB 4N90D 5DVKA 3CDCA 4NNPL 5IK3A 4BH7B 5IJDC 2AQRA 4LAJH 1CG9A 4QTHA 4WHYH 3WJLA 2A74C 1IKNC 3PAZA 4JFOB 1M1SA 1FV1B 1MEXH 4IK6A 2P43B 2V5RA 3KPRA 3SCMC 1P1ZA 1YEFH 1DFXA 2Y9RT 4GKOA 5F7DB 5EOTB 3KLDA 1YNTF 4BXWA 4XPAH 1C5BH 4PJ5B 1I9IH 4XCYB 2PXYD 4PV9A 1AI1H 3RX7A 4NKMB 4RBPK 5KBKA 3ATEA 4GJTB 1AS7A 2QTVA 2VOTA 4XC3H 1MVUA 4L4VE 4NQED 3L3KB 2OSWA 3LZRA 3GHPA 4XRCA 5DEGB 5LDSA 4LESA 4NHCL 2PHBB 3TNMB 3KCPB 2MQCA 4F5CE 1FL6A 3X14A 5FCUH 3AW5A 2Q7AA 1RXLA 1NFDA 1YY9C 3GHBH 1MQ5L 2GJZB 1EHLH 4PREA 1MPAH 3D87B 3QIBC 1GZHA 4LLQB 1UM5H 4ZYKB 3RTQB 4AQAA 3ESPA 1BJ1H 2WKGA 4P05A 4B6ZA 1ACZA 5T1LA 1NAKL 4DGYH 3AM8C 3TBDA 3JWNH 1RZ7L 3LXCA 4E5XG 4HIHA 2FJUB 4U1SA 4NJAL 3TM6A 3VNZA 3L3OB 3JVGC 4HBCL 4NP9A 4OCYL 2E7HA 4LEBA 3SJVE 1T1YB 3QQ9C 4HJGA 1TR7A 1JPFA 3GI8L 4X8JB 1CFTB 1EA9C 1XF4A 3HC4H 1ULVA 1W72B 4OUUA 5KS9E 2ZYIA 3K6NA 3SHSA 4ZFGH 4R7LA 5F7YC 1P5VB 1N70A 1RZJC 1FVDA 4U2YA 2HAZA 5FCSH 4NO0B 1N12A 4W4OA 4M02A 5C3LD 3DUUB 5C8JA 5CP3H 4UQ3B 3GXMA 4WJKB 2BNRB 3D07A 5DHVH 3T0AA 5DJXA 1M7DA 4YGVB 3O3DB 5HYFA 1JNHA 4QRPD 4CW1B 1XGZA 2NQ3A 3ZZLA 1JL8A 3LKPB 5I9QB 5GRVL 1F02I 2DLFH 4PJ8B 1N4XL 1E4KA 1FAKL 1A3ZA 1IIKA 2D7NA 2XN2A 4N2FA 1P7KA 1IGMH 1XAKA 5KG9B 3MRLA 1IM3D 3B2MA 4ZMZA 2CJTA 4OZIB 1OGAB 3PWVB 2JKIS 1WIPA 2ZPKL 3GK8L 4S1RH 4Y9GA 4HUXA 3FQ2A 2IIJA 1OP5K 3V0GA 5I6OA 5A3IC 3I6GB 4YWGH 3BE1L 3RUGA 1X4XA 4JVUA 4F33A 5GZOC 4GPVA 3KPSD 2Z91A 1OKEA 5I1CH 1WS7A 5B8CB 4ZX6A 2JJLA 3W2DL 4XE0A 4UT6H 1JRHH 3TBVA 2MCPH 5GGSY 3S96B 4PGCB 4EIBA 2NZ1A 1C7TA 1N5AA 1RZGA 2P49B 5FIEA 3PJNA 5LXGH 2FD6L 1NCCH 1V3LA 1NOFA 2V2XB 3KE0A 3WFCH 3CFJB 1XMEB 3SDDD 3WUWB 4IEFA 2CHDA 2ORBH 5T3ZH 3UTQB 3AWEA 5D72H 3QJHA 3MGOB 5H35A 3RY5A 1JGVH 1HKFA 2NR6C 1IM9A 1XMWA 1AGEA 3JVGA 4N0UE 1XGUB 3NUKA 1OCCB 4BFFA 2WNKA 2UZYB 4ODSH 2E5EA 2OR7A 4P2OD 1M56B 3IDMA 3T09A 4BYHA 1J10A 1E28A 1VPOH 4N87A 1XF3B 3BZFB 4IBLT 4WI0B 2X1OA 4OFYA 2OSLA 5CD3A 2BM3A 2EEAA 2FZ3B 2FYVA 4QAWA 4UTAL 3N1MC 1SQ2N 3CFKB 4BXSA 4NBYB 4LRIA 1MRDH 1U33A 2BQWA 1IGCL 5AD0A 4Z9KB 5TDNA 2R4SL 2GJ6A 2Y72A 4DQOH 1J8RA 4JL1A 3RWGB 3STZA 2EZ0C 2GAZB 1A22B 1V3XB 4L8BA 1EHNA 3FCSB 3N0AA 1V1IA 4HHAA 1A7RL 4N22A 1UXWB 4JFEE 1NGXA 5I8OL 5DJDA 4OI9A 4WFHE 5CBEA 5F7AA 1KBWA 1IQJL 2F58H 2A6IB 4JY4A 4BZ2L 4BH8A 4IRZL 3K9XA 4BCYA 4CVWA 3QEQB 4MRCA 1X6LA 3N41B 3F12A 4PJXF 4DAGH 4Y4HC 1ZOXA 3OSVA 5TE7H 2YSSA 3IJSB 5TD4A 4V1DD 1NC4D 1WBZB 4HAGA 2IANE 3MI6A 5CZRA 5J13B 4DGIH 1JN6B 2VERN 1WZKA 5KAQF 4KZDH 3I75B 2N7SA 1IT9H 4B9PA 4QXGL 5DFVD 4U6VL 4XH2A 2AW2A 3O4OB 1IAIH 1ED3A 4E42A 5KVFL 2ERJB 1B2WH 5IW6B 2M83A 3MTXA 1RJZB 1YPZE 3BPCA 4JHWL 4PJXA 3QUZA 5AAWA 5JZ7C 2CK0H 5CMAB 4RWHA 3FUMA 4PG2C 3CHRA 4P2RE 5BVJA 1LWHA 4P46D 3S34L 3BMWA 1SHSA 2OLDA 4HCRH 1T6VN 1U91A 2J8UF 1EPGA 3ARYA 3B8YA 1PLBA 3GTTA 1BVZA 1ATEA 3LN5A 3MRKA 2QQQA 5HHQB 1HL9A 4OH2A 4Y79B 4UZGA 2HFFB 4V11A 2B7DT 3HBGA 5KEZA 1BZ9B 5BMFH 4KX9A 3MNWA 4JZNA 4DFIA 3FT0A 4MXVE 1NKGA 4XCYA 1G1TA 1UXLA 5KW9L 4ZPVA 1AS8A 1WE5A 5KBPA 1FF7A 1CYXA 4P5TD 4HUWA 2P8LA 1JPFB 1ETZA 4R3SA 1KSNB 1AZRA 2FBRA 1G1SA 1SYVB 1AQKH 3NJHA 4XAKE 1TZIB 3U36A 3UZVA 1LO2L 3V5KA 3E1F1 3WIIH 1ZHLA 5F0MB 1RK7A 3B9VA 3VTTA 5ALBL 3QH0A 4HC1A 2PW1B 4XTRD 4JE4B 4NAMA 3VGHA 5F0LB 5HDWA 4F7EA 1ZDQA 1R34A 3RTQA 4ZYKA 5D93C 5D96B 2O1AA 4HJJL 1MG2C 1QRND 1H0DA 3KPOA 3CVHB 3SGEH 2APWA 4L05A 5FYJL 1VEOA 3N55A 1ATDA 3VWKB 1P7KB 4MD4B 1ECZA 2AMGA 3KPSA 1TLKA 1W0WA 3TCLB 3LIWB 3C8KA 5DQDL 2YQ2A 2UXFA 4XP1L 3RWDA 3D18B 2VISA 3DETC 3RG1C 2ICWI 4MMYB 1X9LA 4FTDA 2KS0A 4PJBB 4TULL 4D0FA 1ZHKB 3DVNA 3TBWB 3EO1A 3MLXL 3EOYG 4NWTH 1VGKB 2YAQA 2OJ1A 1F5WA 1FVCB 2EE2A 3TT1L 1GC1H 1DQLH 3QZNA 2K3HA 3AT0A 4JZDL 3HZYA 3EJPA 3FHAA 3ZPDA 1KEMH 2BLFA 4XN7A 2XNAA 2QQNL 1WHFA 4Y1AD 4M1CC 5FHBL 4FNLL 1MIEL 1FAIL 4XC1H 2WLLB 4ODWB 5L7XL 1D9KA 4UOW0 4WUUE 1HH9B 3SDCB 5DQDH 3WFEL 4LU5H 3W9EB 5DMIH 5KVGL 2H32A 2BIPA 3CX5J 4OKDA 3VFOA 4F7CA 4GAGL 4QHNA 2ZOUA 4MAYB 5HI4D 1RUPH 2YS4A 1LPGA 2EIKB 1KBVA 3ULUE 2CXGA 1JFQH 1K8IB 4R4BB 4DZ8B 4Y19E 5AOZA 2WUCL 3EO0B 4LGRB 4AQAB 2VABA 4IIQC 5SWZD 2VR5A 2C9UA 4IMKA 4L5FL 1ACCA 1XGPA 4X9GA 5B1KA 1OD7A 1UB6B 1DTUA 1PGRB 3DX8B 3CLFH 3MBXL 3PP4H 3QI9C 4HCIA 5PAZA 5IB5A 4OTJA 4MQ7A 4AQOA 4PG2A 2BOLA 2WLYA 5HYEA 2K9FB 2WLJA 3WIHA 5TTRA 4K73A 4H1LG 2PW2B 1U95B 3NH7H 3B7SA 4KNUA 2PN5A 1TT6A 1TTUA 3CZKA 2IDSA 2WBJA 1FNHA 3RWEA 2EYTA 1SQMA 2R2HB 3KPLB 5E4EB 1F4XH 1KFAH 4CMHB 5DD0H 4HX1A 2F9BL 3VB9A 4B27A 2F7IA 5C0ND 3DOSB 3FB6A 5JDSB 1DDXA 4KKPA 3L5XL 5CP7B 3GM0A 2PTVA 3MV8A 2YQBA 2BS71 1L9TA 3WXWL 4JQXC 1R0AH 4A7SA 2R1XA 3LNEA 2FJFA 3MXWH 3S88H 2EDQA 2LU7A 3KD4A 1DX5I 2PO6A 2Y7LA 3KYAA 3QUKB 5E6IA 3BKYH 3FT2A 4G11A 3OLGA 3ARBC 1CTOA 5KJ4A 3SPVA 3WYRA 3Q05A 5CJ8A 1YNLH 3L7FB 1J8KA 5AALA 5EBMA 2O6PA 3R06A 1LM8V 3W56A 1SLWA 5I82A 3WIFB 1FL3B 1RIHH 3O3EB 4WSKA 1ASQA 3L3OA 4PJFE 4HD5A 1FCCA 1WCBA 1IP0A 5D2LA 5DK2B 3I84A 3UYPB 3KNBB 3ATAA 1QRNA 1MJUH 4GY4A 5JIKA 2HOXA 3NFNA 4FG4A 4JFTA 1PEZA 1E4JA 5ID1B 4HCRA 2YMXH 1D9KC 2YRBA 2ZZUT 4Z78B 1YUFA 3TPUB 5KSBF 2P8PB 3CGTA