2W2OE

Pcsk9-deltac d374y mutant bound to wt egf-a of ldlr
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
47
structure length
47
Chain Sequence
LYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/receptor
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
total genus 8
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF12662 cEGF Complement Clr-like EGF-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2w2oE00
1U67A 2VWNL 2BOUA 2W26B 3LTFB 1IGZA 2PR3B 2Y38A 3LN1A 5K0HB 4G1MB 3TK5B 5JBCE 3SOQA 1TLEA 1XKBA 2J4IB 2P3UA 3C9AC 4RS0A 2KV4A 1EQGA 4D90A 2TGFA 1HREA 2BQWA 3HPTA 4M11A 1F7MA 1EGFA 3MQEA 5F19A 5IKRA 4BDWA 4O1ZA 4D0FA 2K2TA 2BO2A 1IP0A 2P93L 1QFKL 2FLRL 3N8VA 2WFTA 2Y80B 2XBXL 1IOEL 4ISHL 4M10A 3QMOA 4BXWA 1G2LB 2UWPB 4X8SL 2RA0L 1LPKA 2BOHA 1G1QA 3FCSB 2EI8B 1KIGL 3BT1A 3Q3KB 2Y81B 1ADXA 3ASIA 1WHFA 2WYGB 2XC0L 1XDTR 2YGOA 1EMNA 1L3YA 4Y7AB 3N8XA 3GCXE 3N8WB 3R05A 4YZUB 1CX2A 3QH0A 1FFMA 2FZZL 3N8ZA 1OB1C 1W8BL 4JYVL 2WPME 2UWLB 4Y79B 3CS7L 2VVUL 2VWLL 1IQEL 2J2UB 1PXXA 3LN0A 4TGFA 4Z0LA 1Z6EL 3ZYIB 1HJ7A 4CUDA 2WFXB 3F6UL 1XKAL 2NPRA 2J94B 2VH0B 3LIWB 2P3TA 3N8YA 2W2PE 1YUKB 4MMZB 4CSYA 4X8UL 1ATDA 1DX5I 4RRXA 2KB9A 3M37L 4OTYA 1KLOA 1N7DA 1FAKL 2BOXA 3CA7A 1LPZA 2BQ6A 2WG4B 2P26A 2Y7XB 1G2MB 1IQLL 2WPLE 2Y5FL 3TH3L 4O02B 1G1RA 3Q7DA 3SOVA 1UZQA 1NQLB 4MMYB 1I0UA 1EMOA 1ATAA 2ADXA 4JYUL 2WG3C 1EBVA 5F1AA 2MHPA 2VWOL 1DVAL 1NFYB 2W2OE 1HT8A 1JBUL 2YGPA 1FE2A 1ATEA 1DQBA 2Y7ZB 1EQHA 1NFWB 1IQGL 1EPJA 5KIRA 1PTHA 5I46L 3TK6B 4BTUA 3RR3A 4ZH8B 2RNLA 5CKNA 3EGFA 1XFEA 1MQ6L 3OLTA 4CUEA 1SZBA 2W2QE 3IITB 4Z0KB 2MGPA 3LTGD 4E1GA 3NTBA 1UZKA 2VVVL 2WPKE 2FD6A 1YUFA 2P95L 2BQ7A 3V64C 5JB8E 1A3PA 4FM5A 1NPEB 3FBYA 2BZ6L 1CCFA 3KQCL 2XC4L 3BT2A 1KLIL 1MQ5L 1HAFA 4LORA 3NJPC 3TBDA 3ENSA 4YT6L 3KQDL 1K37A 3CENL 2VWMK 2PHBB 1YUGA 1J9CL 5IKTA 1WHEA 4LMFA 2D1JB 1LQDA 3V65B 4YT7L 3GCWE 1X7AL 2KL7A 2B7DL 1HZ8A 1JV2B 1LPGA 3H5CB 1EZQB 4JZFL 3OLUA 2J34B 2AYLA 5IKVA 1CQEA 3GISX 5JBAE 1C5MF 2MGRA 1F0RB 2J95B 2J38B 3BPSE 1L5GB 4CUFA 1UZJA 1PGEA 3ZYGA 2CJIB 1TPGA 3SOBB 1K36A 4ISIL 1IQIL 2BOKL 1IVOC 5EGMB 2FLGA 2P3FL 1CCVA 1EAIC 2Y5HL 1IQKL 1EPIA 2P94L 4BXSA 3KQEL 4XLWA 4Y71B 4Z6AL 2RHPA 3QCWA 1G1SA 1CEJA 5L30L 1ATBA 3NTGA 3ZYJB 4A7IA 3HO4A 2K2SB 1HT5A 2W2NE 3N8WA 1GK5A 4PH9A 5E8DA 4MMXB 4BTTA 3ELAL 1HAEA 1Q4GA 4ZXYL 1JL9A 2WPJE 2WPIE 2JKHL 1HCGB 3P5BL 1NFUB 4C16A 2W86A 2WPHE 1IGXA 1IQML 1FF7A 1B9WA 3HS6A 5JVYA 3CFWA 3KQBL 4BTIA 4RRWA 2I9AA 4ZHAB 4OTJA 3M36L 5IKQA 5CKQA 2VJ3A 1BF9A 1IQHL 2PUQL 4AQTA 1KSNB 4RRZA 3HS7A 2G00L 1YO8A 2Y82B 2W3IB 2P28B 5L2YL 3HO3A 2UWOB 1MOXC 1COUA 2H9EL 3U73A 2W2ME 3KL6B 5JBBE 2Q1JB 1CVUA 2XC5L 2P3FN 1HRFA 2DDUA 3K9XA 2GD4A 4NG9L 5JW1A 1PRHA 3KK6A 4ZAEB 1DIYA 1TOZA 2W3KB 5CISA 4ZXXL 2OYEP 1P9JA 2EI6B 4NA9L 1NFXB 1DDXA 1CVWL 1APOA 5KN5C 4X8TL 3SW2A 5JVZA 5COXA 1G1TA 1Z6CA 6COXA 1RFNB 1NT0A 1O5DL 4RUTA 1F7EA 1IQNL 5CKMA 3PGHA 1V3XB 4JZDL 1WU1B 3POYA 1HX2A 1FAXL 2WYJB 3U7UG 2P16L 1EPGA 3TGFA 2EI7B 2OYUP 5FDQA 4XL1A 1FSBA 4JZEL 4XBMA 4BDXA 3HS5A 1KLJL 2FLBL 1M1XB 3FFGL 2BMGA 3HO5A 4RRYA 1PFXL 2F9BL 4X8VL 5L2ZL 1IOXA 3IJEB 1FJSL 1P0SL 1U8CB 3KCGL 3MDLA 2XBVL 1ZAQA 3LAQA 3N8YB 1YGCL 3TZIA 1AUTL 1W7XL 2I9BA 4Y6DB 2XBWL 4Y76B 2VVCK 5JB9E 1IJQA 4NGAL 3KRKA 2Y5GL 1N1IA 1IQJL 1F0SB 1UZPA 1IQFL 3DEMA 2VH6B 1EPHA 1URKA 1NZIA 3LC3B 1LMJA 2M74A 3LC5B 3NT1A 1APQA 3F1SB 4COXA 4Y7BB 2XBYL 4D0EA
chains in the Genus database with same CATH superfamily
1U67A 2VWNL 2BOUA 2W26B 3LTFB 1IGZA 2PR3B 2Y38A 3LN1A 5K0HB 4G1MB 3TK5B 5JBCE 3SOQA 1TLEA 1XKBA 2J4IB 2P3UA 3C9AC 4RS0A 2KV4A 1EQGA 4D90A 2TGFA 1HREA 2BQWA 3HPTA 4M11A 1F7MA 1EGFA 3MQEA 5F19A 5IKRA 4BDWA 4O1ZA 4D0FA 2K2TA 2BO2A 1IP0A 2P93L 1QFKL 2FLRL 3N8VA 2BSFA 2WFTA 2Y80B 2XBXL 1IOEL 4ISHL 4M10A 3QMOA 4BXWA 1G2LB 2UWPB 4X8SL 2RA0L 1LPKA 2BOHA 1G1QA 2H9EC 2HORA 1LK9A 3FCSB 2EI8B 1KIGL 3BT1A 3Q3KB 2Y81B 1ADXA 3ASIA 1WHFA 2YGQA 2WYGB 2XC0L 1XDTR 2YGOA 1EMNA 1L3YA 4Y7AB 3N8XA 3GCXE 3N8WB 3R05A 4YZUB 1CX2A 3QH0A 1FFMA 2FZZL 3N8ZA 1OB1C 1W8BL 4JYVL 2WPME 2UWLB 4Y79B 3CS7L 2VVUL 2VWLL 3S6XA 1IQEL 2J2UB 1PXXA 3LN0A 4TGFA 2VRSA 4Z0LA 1Z6EL 3ZYIB 1HJ7A 1LMMA 4CUDA 2WFXB 3F6UL 1XKAL 2NPRA 2J94B 2VH0B 3LIWB 2P3TA 3N8YA 2W2PE 1YUKB 4MMZB 4CSYA 4X8UL 1ATDA 1DX5I 4RRXA 2KB9A 2JJLA 3M37L 4OTYA 1KLOA 1N7DA 1FAKL 2BOXA 3CA7A 1LPZA 2BQ6A 2WG4B 2P26A 2Y7XB 1G2MB 1IQLL 2WPLE 2Y5FL 3TH3L 4O02B 1G1RA 3Q7DA 3SOVA 1UZQA 1NQLB 4MMYB 1I0UA 1EMOA 1ATAA 2ADXA 4JYUL 2WZPP 2WG3C 1EBVA 5F1AA 2MHPA 2VWOL 1DVAL 1NFYB 2W2OE 1HT8A 1JBUL 2YGPA 1FE2A 1ATEA 1DQBA 2Y7ZB 1EQHA 1NFWB 1IQGL 1EPJA 5KIRA 1PTHA 5I46L 3TK6B 4BTUA 3RR3A 4ZH8B 2RNLA 5CKNA 3EGFA 1XFEA 1MQ6L 3OLTA 4CUEA 1SZBA 2W2QE 3IITB 4Z0KB 2MGPA 3LTGD 4E1GA 3NTBA 1UZKA 2VVVL 2WPKE 2FD6A 1YUFA 2P95L 2BQ7A 3V64C 5JB8E 1A3PA 4FM5A 2BT8A 1NPEB 3FBYA 2BZ6L 1CCFA 2KNIA 3KQCL 2XC4L 3BT2A 1KLIL 1MQ5L 1HAFA 3NJPC 4LORA 3TBDA 4A94C 3ENSA 4YT6L 3KQDL 1K37A 3CENL 2VWMK 2PHBB 1YUGA 4GU4A 1J9CL 5IKTA 1KKEA 1WHEA 4LMFA 2D1JB 1LQDA 3V65B 4YT7L 3GCWE 1X7AL 2KL7A 2B7DL 1HZ8A 1JV2B 1LPGA 3H5CB 1EZQB 4JZFL 3OLUA 2J34B 2AYLA 5IKVA 1CQEA 3GISX 5JBAE 1C5MF 2MGRA 1F0RB 2J95B 2J38B 3BPSE 1L5GB 4CUFA 1UZJA 1PGEA 3ZYGA 2CJIB 1TPGA 3SOBB 1K36A 4ISIL 1IQIL 2BOKL 1IVOC 5EGMB 2FLGA 4GU3A 2P3FL 1CCVA 1EAIC 2Y5HL 1IQKL 1EPIA 2P94L 4BXSA 3KQEL 4XLWA 4Y71B 4Z6AL 2RHPA 3QCWA 1G1SA 1CEJA 5L30L 1ATBA 3NTGA 3ZYJB 4A7IA 3HO4A 2K2SB 1HT5A 2W2NE 3N8WA 1GK5A 4PH9A 5E8DA 4MMXB 4BTTA 3ELAL 1HAEA 1Q4GA 4ZXYL 1JL9A 2WPJE 2WPIE 2JKHL 1HCGB 3P5BL 1NFUB 4C16A 1V1HA 2W86A 2WPHE 1IGXA 1IQML 1FF7A 1B9WA 3HS6A 5JVYA 3CFWA 3KQBL 4BTIA 4RRWA 2I9AA 1QIUA 1V1IA 2BT7A 4ZHAB 4OTJA 3M36L 5IKQA 5CKQA 2VJ3A 1BF9A 1IQHL 2PUQL 4AQTA 1KSNB 4RRZA 3HS7A 2G00L 1YO8A 2Y82B 2W3IB 2P28B 5L2YL 3HO3A 2UWOB 1MOXC 1COUA 2H9EL 3U73A 2W2ME 3KL6B 5JBBE 2Q1JB 1CVUA 2XC5L 2P3FN 1HRFA 2DDUA 3K9XA 2GD4A 4NG9L 5JW1A 1PRHA 3KK6A 4ZAEB 1DIYA 1TOZA 2W3KB 5CISA 4ZXXL 2OYEP 1P9JA 2EI6B 4NA9L 1NFXB 1DDXA 1CVWL 1APOA 5KN5C 4X8TL 3SW2A 5JVZA 5COXA 1G1TA 1Z6CA 6COXA 1RFNB 1NT0A 1O5DL 4RUTA 1F7EA 1IQNL 5CKMA 3PGHA 1V3XB 4JZDL 1WU1B 3POYA 1HX2A 1FAXL 2WYJB 3U7UG 2P16L 1EPGA 3TGFA 2EI7B 2OYUP 5FDQA 4XL1A 1FSBA 4JZEL 4XBMA 4BDXA 3HS5A 1KLJL 2FLBL 1M1XB 3FFGL 2BMGA 3HO5A 4RRYA 1PFXL 2F9BL 4X8VL 5L2ZL 1IOXA 3IJEB 1FJSL 1P0SL 1U8CB 3KCGL 3MDLA 2XBVL 1ZAQA 3LAQA 3N8YB 1YGCL 3TZIA 1AUTL 1W7XL 2I9BA 4Y6DB 2XBWL 4Y76B 2VVCK 5JB9E 1IJQA 4NGAL 3KRKA 2Y5GL 1N1IA 1IQJL 1F0SB 1UZPA 1IQFL 2HOXA 3DEMA 2VH6B 1EPHA 1URKA 1NZIA 3LC3B 1LMJA 2M74A 3LC5B 3NT1A 1APQA 3F1SB 4COXA 4Y7BB 2XBYL 4D0EA
chains in the Genus database with same CATH topology
1U67A 2VWNL 2BOUA 2W26B 3LTFB 1IGZA 2PR3B 2Y38A 3LN1A 5K0HB 4G1MB 3TK5B 5JBCE 3SOQA 1TLEA 1XKBA 2J4IB 2P3UA 3C9AC 4RS0A 2KV4A 1EQGA 4D90A 2TGFA 1HREA 2BQWA 3HPTA 4M11A 1F7MA 1EGFA 3MQEA 5F19A 5IKRA 4BDWA 4O1ZA 4D0FA 2K2TA 2BO2A 1IP0A 2P93L 1QFKL 2FLRL 3N8VA 2WFTA 2Y80B 2XBXL 1IOEL 4ISHL 4M10A 3QMOA 4BXWA 1G2LB 2UWPB 4X8SL 2RA0L 1LPKA 2BOHA 1G1QA 2H9EC 3FCSB 2EI8B 1KIGL 3BT1A 3Q3KB 2Y81B 1ADXA 3ASIA 1WHFA 2YGQA 2WYGB 2XC0L 1XDTR 2YGOA 1EMNA 1L3YA 4Y7AB 3N8XA 3GCXE 3N8WB 3R05A 4YZUB 1CX2A 3QH0A 1FFMA 2FZZL 3N8ZA 1OB1C 1W8BL 4JYVL 2WPME 2UWLB 4Y79B 3CS7L 2VVUL 2VWLL 3S6XA 1IQEL 2J2UB 1PXXA 3LN0A 4TGFA 4Z0LA 1Z6EL 3ZYIB 1HJ7A 1LMMA 4CUDA 2WFXB 3F6UL 1XKAL 2NPRA 2J94B 2VH0B 3LIWB 2P3TA 3N8YA 2W2PE 1YUKB 4MMZB 4CSYA 4X8UL 1ATDA 1DX5I 4RRXA 2KB9A 3M37L 4OTYA 1KLOA 1N7DA 1FAKL 2BOXA 3CA7A 1LPZA 2BQ6A 2WG4B 2P26A 2Y7XB 1G2MB 1IQLL 2WPLE 2Y5FL 3TH3L 4O02B 1G1RA 3Q7DA 3SOVA 1UZQA 1NQLB 4MMYB 1I0UA 1EMOA 1ATAA 2ADXA 4JYUL 2WZPP 2WG3C 1EBVA 5F1AA 2MHPA 2VWOL 1DVAL 1NFYB 2W2OE 1HT8A 1JBUL 2YGPA 1FE2A 1ATEA 1DQBA 2Y7ZB 1EQHA 1NFWB 1IQGL 1EPJA 5KIRA 1PTHA 5I46L 3TK6B 4BTUA 3RR3A 4ZH8B 2RNLA 5CKNA 3EGFA 1XFEA 1MQ6L 3OLTA 4CUEA 1SZBA 2W2QE 3IITB 4Z0KB 2MGPA 3LTGD 4E1GA 3NTBA 1UZKA 2VVVL 2WPKE 2FD6A 1YUFA 2P95L 2BQ7A 3V64C 5JB8E 1A3PA 4FM5A 1NPEB 3FBYA 2BZ6L 1CCFA 2KNIA 3KQCL 2XC4L 3BT2A 1KLIL 1MQ5L 1HAFA 3NJPC 4LORA 3TBDA 4A94C 3ENSA 4YT6L 3KQDL 1K37A 3CENL 2VWMK 2PHBB 1YUGA 1J9CL 5IKTA 1WHEA 4LMFA 2D1JB 1LQDA 3V65B 4YT7L 3GCWE 1X7AL 2KL7A 2B7DL 1HZ8A 1JV2B 1LPGA 3H5CB 1EZQB 4JZFL 3OLUA 2J34B 2AYLA 5IKVA 1CQEA 3GISX 5JBAE 1C5MF 2MGRA 1F0RB 2J95B 2J38B 3BPSE 1L5GB 4CUFA 1UZJA 1PGEA 3ZYGA 2CJIB 1TPGA 3SOBB 1K36A 4ISIL 1IQIL 2BOKL 1IVOC 5EGMB 2FLGA 2P3FL 1CCVA 1EAIC 2Y5HL 1IQKL 1EPIA 2P94L 4BXSA 3KQEL 4XLWA 4Y71B 4Z6AL 2RHPA 3QCWA 1G1SA 1CEJA 5L30L 1ATBA 3NTGA 3ZYJB 4A7IA 3HO4A 2K2SB 1HT5A 2W2NE 3N8WA 1GK5A 4PH9A 5E8DA 4MMXB 4BTTA 3ELAL 1HAEA 1Q4GA 4ZXYL 1JL9A 2WPJE 2WPIE 2JKHL 1HCGB 3P5BL 1NFUB 4C16A 2W86A 2WPHE 1IGXA 1IQML 1FF7A 1B9WA 3HS6A 5JVYA 3CFWA 3KQBL 4BTIA 4RRWA 2I9AA 4ZHAB 4OTJA 3M36L 5IKQA 5CKQA 2VJ3A 1BF9A 1IQHL 2PUQL 4AQTA 1KSNB 4RRZA 3HS7A 2G00L 1YO8A 2Y82B 2W3IB 2P28B 5L2YL 3HO3A 2UWOB 1MOXC 1COUA 2H9EL 3U73A 2W2ME 3KL6B 5JBBE 2Q1JB 1CVUA 2XC5L 2P3FN 1HRFA 2DDUA 3K9XA 2GD4A 4NG9L 5JW1A 1PRHA 3KK6A 4ZAEB 1DIYA 1TOZA 2W3KB 5CISA 4ZXXL 2OYEP 1P9JA 2EI6B 4NA9L 1NFXB 1DDXA 1CVWL 1APOA 5KN5C 4X8TL 3SW2A 5JVZA 5COXA 1G1TA 1Z6CA 6COXA 1RFNB 1NT0A 1O5DL 4RUTA 1F7EA 1IQNL 5CKMA 3PGHA 1V3XB 4JZDL 1WU1B 3POYA 1HX2A 1FAXL 2WYJB 3U7UG 2P16L 1EPGA 3TGFA 2EI7B 2OYUP 5FDQA 4XL1A 1FSBA 4JZEL 4XBMA 4BDXA 3HS5A 1KLJL 2FLBL 1M1XB 3FFGL 2BMGA 3HO5A 4RRYA 1PFXL 2F9BL 4X8VL 5L2ZL 1IOXA 3IJEB 1FJSL 1P0SL 1U8CB 3KCGL 3MDLA 2XBVL 1ZAQA 3LAQA 3N8YB 1YGCL 3TZIA 1AUTL 1W7XL 2I9BA 4Y6DB 2XBWL 4Y76B 2VVCK 5JB9E 1IJQA 4NGAL 3KRKA 2Y5GL 1N1IA 1IQJL 1F0SB 1UZPA 1IQFL 3DEMA 2VH6B 1EPHA 1URKA 1NZIA 3LC3B 1LMJA 2M74A 3LC5B 3NT1A 1APQA 3F1SB 4COXA 4Y7BB 2XBYL 4D0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U67 A;  2VWN L;  2BOU A;  2W26 B;  3LTF B;  1IGZ A;  2PR3 B;  2Y38 A;  3LN1 A;  5K0H B;  4G1M B;  3TK5 B;  5JBC E;  3SOQ A;  1TLE A;  1XKB A;  2J4I B;  2P3U A;  3C9A C;  4RS0 A;  2KV4 A;  1EQG A;  4D90 A;  2TGF A;  1HRE A;  2BQW A;  3HPT A;  4M11 A;  1F7M A;  1EGF A;  3MQE A;  5F19 A;  5IKR A;  4BDW A;  4O1Z A;  4D0F A;  2K2T A;  2BO2 A;  1IP0 A;  2P93 L;  1QFK L;  2FLR L;  3N8V A;  2WFT A;  2Y80 B;  2XBX L;  1IOE L;  4ISH L;  4M10 A;  3QMO A;  4BXW A;  1G2L B;  2UWP B;  4X8S L;  2RA0 L;  1LPK A;  2BOH A;  1G1Q A;  3FCS B;  2EI8 B;  1KIG L;  3BT1 A;  3Q3K B;  2Y81 B;  1ADX A;  3ASI A;  1WHF A;  2WYG B;  2XC0 L;  1XDT R;  2YGO A;  1EMN A;  1L3Y A;  4Y7A B;  3N8X A;  3GCX E;  3N8W B;  3R05 A;  4YZU B;  1CX2 A;  3QH0 A;  1FFM A;  2FZZ L;  3N8Z A;  1OB1 C;  1W8B L;  4JYV L;  2WPM E;  2UWL B;  4Y79 B;  3CS7 L;  2VVU L;  2VWL L;  1IQE L;  2J2U B;  1PXX A;  3LN0 A;  4TGF A;  4Z0L A;  1Z6E L;  3ZYI B;  1HJ7 A;  4CUD A;  2WFX B;  3F6U L;  1XKA L;  2NPR A;  2J94 B;  2VH0 B;  3LIW B;  2P3T A;  3N8Y A;  2W2P E;  1YUK B;  4MMZ B;  4CSY A;  4X8U L;  1ATD A;  1DX5 I;  4RRX A;  2KB9 A;  3M37 L;  4OTY A;  1KLO A;  1N7D A;  1FAK L;  2BOX A;  3CA7 A;  1LPZ A;  2BQ6 A;  2WG4 B;  2P26 A;  2Y7X B;  1G2M B;  1IQL L;  2WPL E;  2Y5F L;  3TH3 L;  4O02 B;  1G1R A;  3Q7D A;  3SOV A;  1UZQ A;  1NQL B;  4MMY B;  1I0U A;  1EMO A;  1ATA A;  2ADX A;  4JYU L;  2WG3 C;  1EBV A;  5F1A A;  2MHP A;  2VWO L;  1DVA L;  1NFY B;  2W2O E;  1HT8 A;  1JBU L;  2YGP A;  1FE2 A;  1ATE A;  1DQB A;  2Y7Z B;  1EQH A;  1NFW B;  1IQG L;  1EPJ A;  5KIR A;  1PTH A;  5I46 L;  3TK6 B;  4BTU A;  3RR3 A;  4ZH8 B;  2RNL A;  5CKN A;  3EGF A;  1XFE A;  1MQ6 L;  3OLT A;  4CUE A;  1SZB A;  2W2Q E;  3IIT B;  4Z0K B;  2MGP A;  3LTG D;  4E1G A;  3NTB A;  1UZK A;  2VVV L;  2WPK E;  2FD6 A;  1YUF A;  2P95 L;  2BQ7 A;  3V64 C;  5JB8 E;  1A3P A;  4FM5 A;  1NPE B;  3FBY A;  2BZ6 L;  1CCF A;  3KQC L;  2XC4 L;  3BT2 A;  1KLI L;  1MQ5 L;  1HAF A;  4LOR A;  3NJP C;  3TBD A;  3ENS A;  4YT6 L;  3KQD L;  1K37 A;  3CEN L;  2VWM K;  2PHB B;  1YUG A;  1J9C L;  5IKT A;  1WHE A;  4LMF A;  2D1J B;  1LQD A;  3V65 B;  4YT7 L;  3GCW E;  1X7A L;  2KL7 A;  2B7D L;  1HZ8 A;  1JV2 B;  1LPG A;  3H5C B;  1EZQ B;  4JZF L;  3OLU A;  2J34 B;  2AYL A;  5IKV A;  1CQE A;  3GIS X;  5JBA E;  1C5M F;  2MGR A;  1F0R B;  2J95 B;  2J38 B;  3BPS E;  1L5G B;  4CUF A;  1UZJ A;  1PGE A;  3ZYG A;  2CJI B;  1TPG A;  3SOB B;  1K36 A;  4ISI L;  1IQI L;  2BOK L;  1IVO C;  5EGM B;  2FLG A;  2P3F L;  1CCV A;  1EAI C;  2Y5H L;  1IQK L;  1EPI A;  2P94 L;  4BXS A;  3KQE L;  4XLW A;  4Y71 B;  4Z6A L;  2RHP A;  3QCW A;  1G1S A;  1CEJ A;  5L30 L;  1ATB A;  3NTG A;  3ZYJ B;  4A7I A;  3HO4 A;  2K2S B;  1HT5 A;  2W2N E;  3N8W A;  1GK5 A;  4PH9 A;  5E8D A;  4MMX B;  4BTT A;  3ELA L;  1HAE A;  1Q4G A;  4ZXY L;  1JL9 A;  2WPJ E;  2WPI E;  2JKH L;  1HCG B;  3P5B L;  1NFU B;  4C16 A;  2W86 A;  2WPH E;  1IGX A;  1IQM L;  1FF7 A;  1B9W A;  3HS6 A;  5JVY A;  3CFW A;  3KQB L;  4BTI A;  4RRW A;  2I9A A;  4ZHA B;  4OTJ A;  3M36 L;  5IKQ A;  5CKQ A;  2VJ3 A;  1BF9 A;  1IQH L;  2PUQ L;  4AQT A;  1KSN B;  4RRZ A;  3HS7 A;  2G00 L;  1YO8 A;  2Y82 B;  2W3I B;  2P28 B;  5L2Y L;  3HO3 A;  2UWO B;  1MOX C;  1COU A;  2H9E L;  3U73 A;  2W2M E;  3KL6 B;  5JBB E;  2Q1J B;  1CVU A;  2XC5 L;  2P3F N;  1HRF A;  2DDU A;  3K9X A;  2GD4 A;  4NG9 L;  5JW1 A;  1PRH A;  3KK6 A;  4ZAE B;  1DIY A;  1TOZ A;  2W3K B;  5CIS A;  4ZXX L;  2OYE P;  1P9J A;  2EI6 B;  4NA9 L;  1NFX B;  1DDX A;  1CVW L;  1APO A;  5KN5 C;  4X8T L;  3SW2 A;  5JVZ A;  5COX A;  1G1T A;  1Z6C A;  6COX A;  1RFN B;  1NT0 A;  1O5D L;  4RUT A;  1F7E A;  1IQN L;  5CKM A;  3PGH A;  1V3X B;  4JZD L;  1WU1 B;  3POY A;  1HX2 A;  1FAX L;  2WYJ B;  3U7U G;  2P16 L;  1EPG A;  3TGF A;  2EI7 B;  2OYU P;  5FDQ A;  4XL1 A;  1FSB A;  4JZE L;  4XBM A;  4BDX A;  3HS5 A;  1KLJ L;  2FLB L;  1M1X B;  3FFG L;  2BMG A;  3HO5 A;  4RRY A;  1PFX L;  2F9B L;  4X8V L;  5L2Z L;  1IOX A;  3IJE B;  1FJS L;  1P0S L;  1U8C B;  3KCG L;  3MDL A;  2XBV L;  1ZAQ A;  3LAQ A;  3N8Y B;  1YGC L;  3TZI A;  1AUT L;  1W7X L;  2I9B A;  4Y6D B;  2XBW L;  4Y76 B;  2VVC K;  5JB9 E;  1IJQ A;  4NGA L;  3KRK A;  2Y5G L;  1N1I A;  1IQJ L;  1F0S B;  1UZP A;  1IQF L;  3DEM A;  2VH6 B;  1EPH A;  1URK A;  1NZI A;  3LC3 B;  1LMJ A;  2M74 A;  3LC5 B;  3NT1 A;  1APQ A;  3F1S B;  4COX A;  4Y7B B;  2XBY L;  4D0E A; 
#chains in the Genus database with same CATH topology
 1U67 A;  2VWN L;  2BOU A;  2W26 B;  3LTF B;  1IGZ A;  2PR3 B;  2Y38 A;  3LN1 A;  5K0H B;  4G1M B;  3TK5 B;  5JBC E;  3SOQ A;  1TLE A;  1XKB A;  2J4I B;  2P3U A;  3C9A C;  4RS0 A;  2KV4 A;  1EQG A;  4D90 A;  2TGF A;  1HRE A;  2BQW A;  3HPT A;  4M11 A;  1F7M A;  1EGF A;  3MQE A;  5F19 A;  5IKR A;  4BDW A;  4O1Z A;  4D0F A;  2K2T A;  2BO2 A;  1IP0 A;  2P93 L;  1QFK L;  2FLR L;  3N8V A;  2BSF A;  2WFT A;  2Y80 B;  2XBX L;  1IOE L;  4ISH L;  4M10 A;  3QMO A;  4BXW A;  1G2L B;  2UWP B;  4X8S L;  2RA0 L;  1LPK A;  2BOH A;  1G1Q A;  2H9E C;  2HOR A;  1LK9 A;  3FCS B;  2EI8 B;  1KIG L;  3BT1 A;  3Q3K B;  2Y81 B;  1ADX A;  3ASI A;  1WHF A;  2YGQ A;  2WYG B;  2XC0 L;  1XDT R;  2YGO A;  1EMN A;  1L3Y A;  4Y7A B;  3N8X A;  3GCX E;  3N8W B;  3R05 A;  4YZU B;  1CX2 A;  3QH0 A;  1FFM A;  2FZZ L;  3N8Z A;  1OB1 C;  1W8B L;  4JYV L;  2WPM E;  2UWL B;  4Y79 B;  3CS7 L;  2VVU L;  2VWL L;  3S6X A;  1IQE L;  2J2U B;  1PXX A;  3LN0 A;  4TGF A;  2VRS A;  4Z0L A;  1Z6E L;  3ZYI B;  1HJ7 A;  1LMM A;  4CUD A;  2WFX B;  3F6U L;  1XKA L;  2NPR A;  2J94 B;  2VH0 B;  3LIW B;  2P3T A;  3N8Y A;  2W2P E;  1YUK B;  4MMZ B;  4CSY A;  4X8U L;  1ATD A;  1DX5 I;  4RRX A;  2KB9 A;  2JJL A;  3M37 L;  4OTY A;  1KLO A;  1N7D A;  1FAK L;  2BOX A;  3CA7 A;  1LPZ A;  2BQ6 A;  2WG4 B;  2P26 A;  2Y7X B;  1G2M B;  1IQL L;  2WPL E;  2Y5F L;  3TH3 L;  4O02 B;  1G1R A;  3Q7D A;  3SOV A;  1UZQ A;  1NQL B;  4MMY B;  1I0U A;  1EMO A;  1ATA A;  2ADX A;  4JYU L;  2WZP P;  2WG3 C;  1EBV A;  5F1A A;  2MHP A;  2VWO L;  1DVA L;  1NFY B;  2W2O E;  1HT8 A;  1JBU L;  2YGP A;  1FE2 A;  1ATE A;  1DQB A;  2Y7Z B;  1EQH A;  1NFW B;  1IQG L;  1EPJ A;  5KIR A;  1PTH A;  5I46 L;  3TK6 B;  4BTU A;  3RR3 A;  4ZH8 B;  2RNL A;  5CKN A;  3EGF A;  1XFE A;  1MQ6 L;  3OLT A;  4CUE A;  1SZB A;  2W2Q E;  3IIT B;  4Z0K B;  2MGP A;  3LTG D;  4E1G A;  3NTB A;  1UZK A;  2VVV L;  2WPK E;  2FD6 A;  1YUF A;  2P95 L;  2BQ7 A;  3V64 C;  5JB8 E;  1A3P A;  4FM5 A;  2BT8 A;  1NPE B;  3FBY A;  2BZ6 L;  1CCF A;  2KNI A;  3KQC L;  2XC4 L;  3BT2 A;  1KLI L;  1MQ5 L;  1HAF A;  3NJP C;  4LOR A;  3TBD A;  4A94 C;  3ENS A;  4YT6 L;  3KQD L;  1K37 A;  3CEN L;  2VWM K;  2PHB B;  1YUG A;  4GU4 A;  1J9C L;  5IKT A;  1KKE A;  1WHE A;  4LMF A;  2D1J B;  1LQD A;  3V65 B;  4YT7 L;  3GCW E;  1X7A L;  2KL7 A;  2B7D L;  1HZ8 A;  1JV2 B;  1LPG A;  3H5C B;  1EZQ B;  4JZF L;  3OLU A;  2J34 B;  2AYL A;  5IKV A;  1CQE A;  3GIS X;  5JBA E;  1C5M F;  2MGR A;  1F0R B;  2J95 B;  2J38 B;  3BPS E;  1L5G B;  4CUF A;  1UZJ A;  1PGE A;  3ZYG A;  2CJI B;  1TPG A;  3SOB B;  1K36 A;  4ISI L;  1IQI L;  2BOK L;  1IVO C;  5EGM B;  2FLG A;  4GU3 A;  2P3F L;  1CCV A;  1EAI C;  2Y5H L;  1IQK L;  1EPI A;  2P94 L;  4BXS A;  3KQE L;  4XLW A;  4Y71 B;  4Z6A L;  2RHP A;  3QCW A;  1G1S A;  1CEJ A;  5L30 L;  1ATB A;  3NTG A;  3ZYJ B;  4A7I A;  3HO4 A;  2K2S B;  1HT5 A;  2W2N E;  3N8W A;  1GK5 A;  4PH9 A;  5E8D A;  4MMX B;  4BTT A;  3ELA L;  1HAE A;  1Q4G A;  4ZXY L;  1JL9 A;  2WPJ E;  2WPI E;  2JKH L;  1HCG B;  3P5B L;  1NFU B;  4C16 A;  1V1H A;  2W86 A;  2WPH E;  1IGX A;  1IQM L;  1FF7 A;  1B9W A;  3HS6 A;  5JVY A;  3CFW A;  3KQB L;  4BTI A;  4RRW A;  2I9A A;  1QIU A;  1V1I A;  2BT7 A;  4ZHA B;  4OTJ A;  3M36 L;  5IKQ A;  5CKQ A;  2VJ3 A;  1BF9 A;  1IQH L;  2PUQ L;  4AQT A;  1KSN B;  4RRZ A;  3HS7 A;  2G00 L;  1YO8 A;  2Y82 B;  2W3I B;  2P28 B;  5L2Y L;  3HO3 A;  2UWO B;  1MOX C;  1COU A;  2H9E L;  3U73 A;  2W2M E;  3KL6 B;  5JBB E;  2Q1J B;  1CVU A;  2XC5 L;  2P3F N;  1HRF A;  2DDU A;  3K9X A;  2GD4 A;  4NG9 L;  5JW1 A;  1PRH A;  3KK6 A;  4ZAE B;  1DIY A;  1TOZ A;  2W3K B;  5CIS A;  4ZXX L;  2OYE P;  1P9J A;  2EI6 B;  4NA9 L;  1NFX B;  1DDX A;  1CVW L;  1APO A;  5KN5 C;  4X8T L;  3SW2 A;  5JVZ A;  5COX A;  1G1T A;  1Z6C A;  6COX A;  1RFN B;  1NT0 A;  1O5D L;  4RUT A;  1F7E A;  1IQN L;  5CKM A;  3PGH A;  1V3X B;  4JZD L;  1WU1 B;  3POY A;  1HX2 A;  1FAX L;  2WYJ B;  3U7U G;  2P16 L;  1EPG A;  3TGF A;  2EI7 B;  2OYU P;  5FDQ A;  4XL1 A;  1FSB A;  4JZE L;  4XBM A;  4BDX A;  3HS5 A;  1KLJ L;  2FLB L;  1M1X B;  3FFG L;  2BMG A;  3HO5 A;  4RRY A;  1PFX L;  2F9B L;  4X8V L;  5L2Z L;  1IOX A;  3IJE B;  1FJS L;  1P0S L;  1U8C B;  3KCG L;  3MDL A;  2XBV L;  1ZAQ A;  3LAQ A;  3N8Y B;  1YGC L;  3TZI A;  1AUT L;  1W7X L;  2I9B A;  4Y6D B;  2XBW L;  4Y76 B;  2VVC K;  5JB9 E;  1IJQ A;  4NGA L;  3KRK A;  2Y5G L;  1N1I A;  1IQJ L;  1F0S B;  1UZP A;  1IQF L;  2HOX A;  3DEM A;  2VH6 B;  1EPH A;  1URK A;  1NZI A;  3LC3 B;  1LMJ A;  2M74 A;  3LC5 B;  3NT1 A;  1APQ A;  3F1S B;  4COX A;  4Y7B B;  2XBY L;  4D0E A; 
#chains in the Genus database with same CATH homology
 1U67 A;  2VWN L;  2BOU A;  2W26 B;  3LTF B;  1IGZ A;  2PR3 B;  2Y38 A;  3LN1 A;  5K0H B;  4G1M B;  3TK5 B;  5JBC E;  3SOQ A;  1TLE A;  1XKB A;  2J4I B;  2P3U A;  3C9A C;  4RS0 A;  2KV4 A;  1EQG A;  4D90 A;  2TGF A;  1HRE A;  2BQW A;  3HPT A;  4M11 A;  1F7M A;  1EGF A;  3MQE A;  5F19 A;  5IKR A;  4BDW A;  4O1Z A;  4D0F A;  2K2T A;  2BO2 A;  1IP0 A;  2P93 L;  1QFK L;  2FLR L;  3N8V A;  2WFT A;  2Y80 B;  2XBX L;  1IOE L;  4ISH L;  4M10 A;  3QMO A;  4BXW A;  1G2L B;  2UWP B;  4X8S L;  2RA0 L;  1LPK A;  2BOH A;  1G1Q A;  2H9E C;  3FCS B;  2EI8 B;  1KIG L;  3BT1 A;  3Q3K B;  2Y81 B;  1ADX A;  3ASI A;  1WHF A;  2YGQ A;  2WYG B;  2XC0 L;  1XDT R;  2YGO A;  1EMN A;  1L3Y A;  4Y7A B;  3N8X A;  3GCX E;  3N8W B;  3R05 A;  4YZU B;  1CX2 A;  3QH0 A;  1FFM A;  2FZZ L;  3N8Z A;  1OB1 C;  1W8B L;  4JYV L;  2WPM E;  2UWL B;  4Y79 B;  3CS7 L;  2VVU L;  2VWL L;  3S6X A;  1IQE L;  2J2U B;  1PXX A;  3LN0 A;  4TGF A;  4Z0L A;  1Z6E L;  3ZYI B;  1HJ7 A;  1LMM A;  4CUD A;  2WFX B;  3F6U L;  1XKA L;  2NPR A;  2J94 B;  2VH0 B;  3LIW B;  2P3T A;  3N8Y A;  2W2P E;  1YUK B;  4MMZ B;  4CSY A;  4X8U L;  1ATD A;  1DX5 I;  4RRX A;  2KB9 A;  3M37 L;  4OTY A;  1KLO A;  1N7D A;  1FAK L;  2BOX A;  3CA7 A;  1LPZ A;  2BQ6 A;  2WG4 B;  2P26 A;  2Y7X B;  1G2M B;  1IQL L;  2WPL E;  2Y5F L;  3TH3 L;  4O02 B;  1G1R A;  3Q7D A;  3SOV A;  1UZQ A;  1NQL B;  4MMY B;  1I0U A;  1EMO A;  1ATA A;  2ADX A;  4JYU L;  2WZP P;  2WG3 C;  1EBV A;  5F1A A;  2MHP A;  2VWO L;  1DVA L;  1NFY B;  2W2O E;  1HT8 A;  1JBU L;  2YGP A;  1FE2 A;  1ATE A;  1DQB A;  2Y7Z B;  1EQH A;  1NFW B;  1IQG L;  1EPJ A;  5KIR A;  1PTH A;  5I46 L;  3TK6 B;  4BTU A;  3RR3 A;  4ZH8 B;  2RNL A;  5CKN A;  3EGF A;  1XFE A;  1MQ6 L;  3OLT A;  4CUE A;  1SZB A;  2W2Q E;  3IIT B;  4Z0K B;  2MGP A;  3LTG D;  4E1G A;  3NTB A;  1UZK A;  2VVV L;  2WPK E;  2FD6 A;  1YUF A;  2P95 L;  2BQ7 A;  3V64 C;  5JB8 E;  1A3P A;  4FM5 A;  1NPE B;  3FBY A;  2BZ6 L;  1CCF A;  2KNI A;  3KQC L;  2XC4 L;  3BT2 A;  1KLI L;  1MQ5 L;  1HAF A;  3NJP C;  4LOR A;  3TBD A;  4A94 C;  3ENS A;  4YT6 L;  3KQD L;  1K37 A;  3CEN L;  2VWM K;  2PHB B;  1YUG A;  1J9C L;  5IKT A;  1WHE A;  4LMF A;  2D1J B;  1LQD A;  3V65 B;  4YT7 L;  3GCW E;  1X7A L;  2KL7 A;  2B7D L;  1HZ8 A;  1JV2 B;  1LPG A;  3H5C B;  1EZQ B;  4JZF L;  3OLU A;  2J34 B;  2AYL A;  5IKV A;  1CQE A;  3GIS X;  5JBA E;  1C5M F;  2MGR A;  1F0R B;  2J95 B;  2J38 B;  3BPS E;  1L5G B;  4CUF A;  1UZJ A;  1PGE A;  3ZYG A;  2CJI B;  1TPG A;  3SOB B;  1K36 A;  4ISI L;  1IQI L;  2BOK L;  1IVO C;  5EGM B;  2FLG A;  2P3F L;  1CCV A;  1EAI C;  2Y5H L;  1IQK L;  1EPI A;  2P94 L;  4BXS A;  3KQE L;  4XLW A;  4Y71 B;  4Z6A L;  2RHP A;  3QCW A;  1G1S A;  1CEJ A;  5L30 L;  1ATB A;  3NTG A;  3ZYJ B;  4A7I A;  3HO4 A;  2K2S B;  1HT5 A;  2W2N E;  3N8W A;  1GK5 A;  4PH9 A;  5E8D A;  4MMX B;  4BTT A;  3ELA L;  1HAE A;  1Q4G A;  4ZXY L;  1JL9 A;  2WPJ E;  2WPI E;  2JKH L;  1HCG B;  3P5B L;  1NFU B;  4C16 A;  2W86 A;  2WPH E;  1IGX A;  1IQM L;  1FF7 A;  1B9W A;  3HS6 A;  5JVY A;  3CFW A;  3KQB L;  4BTI A;  4RRW A;  2I9A A;  4ZHA B;  4OTJ A;  3M36 L;  5IKQ A;  5CKQ A;  2VJ3 A;  1BF9 A;  1IQH L;  2PUQ L;  4AQT A;  1KSN B;  4RRZ A;  3HS7 A;  2G00 L;  1YO8 A;  2Y82 B;  2W3I B;  2P28 B;  5L2Y L;  3HO3 A;  2UWO B;  1MOX C;  1COU A;  2H9E L;  3U73 A;  2W2M E;  3KL6 B;  5JBB E;  2Q1J B;  1CVU A;  2XC5 L;  2P3F N;  1HRF A;  2DDU A;  3K9X A;  2GD4 A;  4NG9 L;  5JW1 A;  1PRH A;  3KK6 A;  4ZAE B;  1DIY A;  1TOZ A;  2W3K B;  5CIS A;  4ZXX L;  2OYE P;  1P9J A;  2EI6 B;  4NA9 L;  1NFX B;  1DDX A;  1CVW L;  1APO A;  5KN5 C;  4X8T L;  3SW2 A;  5JVZ A;  5COX A;  1G1T A;  1Z6C A;  6COX A;  1RFN B;  1NT0 A;  1O5D L;  4RUT A;  1F7E A;  1IQN L;  5CKM A;  3PGH A;  1V3X B;  4JZD L;  1WU1 B;  3POY A;  1HX2 A;  1FAX L;  2WYJ B;  3U7U G;  2P16 L;  1EPG A;  3TGF A;  2EI7 B;  2OYU P;  5FDQ A;  4XL1 A;  1FSB A;  4JZE L;  4XBM A;  4BDX A;  3HS5 A;  1KLJ L;  2FLB L;  1M1X B;  3FFG L;  2BMG A;  3HO5 A;  4RRY A;  1PFX L;  2F9B L;  4X8V L;  5L2Z L;  1IOX A;  3IJE B;  1FJS L;  1P0S L;  1U8C B;  3KCG L;  3MDL A;  2XBV L;  1ZAQ A;  3LAQ A;  3N8Y B;  1YGC L;  3TZI A;  1AUT L;  1W7X L;  2I9B A;  4Y6D B;  2XBW L;  4Y76 B;  2VVC K;  5JB9 E;  1IJQ A;  4NGA L;  3KRK A;  2Y5G L;  1N1I A;  1IQJ L;  1F0S B;  1UZP A;  1IQF L;  3DEM A;  2VH6 B;  1EPH A;  1URK A;  1NZI A;  3LC3 B;  1LMJ A;  2M74 A;  3LC5 B;  3NT1 A;  1APQ A;  3F1S B;  4COX A;  4Y7B B;  2XBY L;  4D0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...