4JZFL

Structure of factor viia in complex with the inhibitor 2-{2-[(3-carbamoylphenyl)carbamoyl]-6-methoxypyridin-3-yl}-5-{[(2s)-1-hydroxy-3,3-dimethylbutan-2-yl]carbamoyl}benzoic acid
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
ICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of nonbenzamidine factor VIIa inhibitors using a biaryl acid scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Factor VIIa (Heavy Chain)
total genus 12
structure length 55
sequence length 55
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2013-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4jzfL00
2W3KB 3NTGA 2BQ6A 1K37A 1U8CB 2XC0L 2I9AA 1DQBA 2JKHL 2VVUL 4AQTA 3HO3A 4OTJA 1PGEA 3QMOA 3ZYJB 2BOKL 4BDWA 4X8SL 1HAFA 4MMYB 1XKAL 1A3PA 3P5BL 5JB9E 2WPHE 3FFGL 4FM5A 1FJSL 3LC3B 5IKTA 1X7AL 1G1SA 3HO5A 5IKQA 1EPHA 1XDTR 2VH0B 2P26A 1M1XB 2B7DL 1Z6CA 1IGZA 1SZBA 1NPEB 1ADXA 2BO2A 1XFEA 4CUEA 1DIYA 2WFXB 2WPKE 4XLWA 5COXA 3SOBB 3TGFA 2Q1JB 1CVWL 2KB9A 2VVVL 1IQFL 1G1RA 5KIRA 2VWMK 3OLTA 3MDLA 4Z0KB 2WFTA 2VWNL 2WPJE 2PHBB 1QFKL 5FDQA 2W2OE 3SOQA 1YO8A 4Y6DB 1U67A 4E1GA 1LPKA 4RRZA 1C5MF 2KV4A 3F6UL 1HT8A 3V65B 3LTGD 3LTFB 2M74A 3POYA 3N8WA 3K9XA 2BOHA 1HCGB 2VH6B 1OB1C 2FD6A 5L30L 1IQGL 4O02B 4ISHL 4Z6AL 2J4IB 1IP0A 2P3FN 1CX2A 1YUFA 2D1JB 1PFXL 2BOUA 1NFXB 4BDXA 4G1MB 1YGCL 5L2ZL 2VJ3A 4NG9L 1HT5A 2I9BA 1HX2A 2J38B 1EGFA 1FSBA 4YT6L 1HAEA 3N8VA 3R05A 2XC4L 2G00L 3ZYIB 2P3UA 4MMZB 2P93L 1G1TA 1N1IA 4XBMA 2FLRL 3SOVA 1APOA 3HS7A 1EPJA 1DVAL 3U73A 4RRYA 4Z0LA 4JYUL 3ELAL 5I46L 4M10A 4YT7L 1EQGA 1W7XL 1LPGA 2XBWL 5F19A 1IQHL 5E8DA 1ATBA 1CCFA 1NZIA 4ZAEB 4Y7AB 1GK5A 5CISA 2YGPA 4RRXA 4CUFA 1IOEL 2F9BL 3OLUA 3CFWA 1IQIL 1KLJL 2WPLE 4JZEL 1F0SB 4XL1A 1AUTL 4JZFL 4D0FA 3LN1A 1LPZA 3CA7A 3M37L 2W2ME 2TGFA 4RS0A 2VWLL 2W3IB 1PTHA 5L2YL 2DDUA 1RFNB 3CENL 2XBYL 1IQEL 2BMGA 1COUA 2W86A 1IQJL 2J94B 2Y82B 4OTYA 4NGAL 1NQLB 1O5DL 2BQWA 1WHEA 3N8YA 2J34B 1EQHA 3BT1A 4Y76B 1WHFA 2P28B 1B9WA 2P95L 5F1AA 1IGXA 2WYJB 2XBVL 5IKVA 4A7IA 1L3YA 3GCXE 3KCGL 3TH3L 3HPTA 1EAIC 3KK6A 1K36A 1BF9A 5IKRA 1UZJA 1ATDA 2ADXA 2WPME 2PUQL 2VWOL 2UWPB 3LIWB 1UZPA 3N8XA 1F7EA 2EI8B 2Y5FL 2Y5GL 3NTBA 4ZH8B 3BT2A 4RUTA 3KQEL 2FZZL 2YGOA 3LN0A 3TZIA 2VVCK 2H9EL 1HZ8A 2Y81B 2Y7ZB 2J95B 2NPRA 1CQEA 4X8TL 5CKNA 1JL9A 3IJEB 6COXA 2BOXA 3IITB 3N8YB 4BXSA 5JVZA 4M11A 3SW2A 1UZKA 3ASIA 4BXWA 1P9JA 4Y71B 1DDXA 1FF7A 1APQA 1W8BL 3DEMA 1F7MA 2EI6B 2RHPA 4D0EA 2W2NE 4MMXB 5KN5C 3KQBL 4TGFA 3TK6B 1EBVA 3N8WB 1ATAA 2AYLA 1PRHA 4RRWA 1IQNL 3TBDA 2J2UB 4X8UL 3QH0A 1JV2B 1LQDA 3KQCL 1MQ5L 3RR3A 1EPIA 3BPSE 2P16L 1HREA 1EMNA 1LMJA 1DX5I 3MQEA 2WYGB 2XC5L 5K0HB 1NFWB 1J9CL 1KSNB 1FFMA 1FAKL 2W26B 3KRKA 4CSYA 3QCWA 2P94L 2RA0L 3ENSA 2MHPA 1JBUL 2P3TA 1YUKB 4ZXYL 5EGMB 2OYUP 1I0UA 2FLGA 4PH9A 2P3FL 1ATEA 2Y5HL 1EPGA 5JBCE 3HS5A 4JYVL 1NT0A 1UZQA 1G2MB 1IVOC 1IQML 1TLEA 3Q7DA 1PXXA 3PGHA 3FCSB 4JZDL 5JB8E 1FAXL 1ZAQA 1V3XB 3TK5B 1EZQB 1WU1B 4D90A 1KIGL 4BTIA 3KQDL 1YUGA 4YZUB 2OYEP 3U7UG 1TOZA 4NA9L 1CVUA 2Y38A 2MGRA 2BQ7A 2WG3C 3F1SB 3KL6B 5CKMA 5JVYA 4ZHAB 3H5CB 1TPGA 1MOXC 3M36L 1F0RB 3GISX 1Q4GA 2FLBL 4CUDA 2RNLA 2XBXL 2BZ6L 3V64C 1IQKL 2K2TA 3LC5B 3NT1A 4LMFA 4BTTA 1IJQA 4COXA 1IOXA 3FBYA 1N7DA 1IQLL 3HS6A 1EMOA 4ISIL 2WG4B 2W2QE 2Y80B 2UWOB 3CS7L 5JBAE 1CEJA 3HO4A 4Y79B 1G1QA 3ZYGA 3GCWE 1MQ6L 5CKQA 2PR3B 1NFUB 4ZXXL 2MGPA 1CCVA 2Y7XB 3EGFA 1URKA 5JBBE 3NJPC 1G2LB 1KLIL 2WPIE 3C9AC 2UWLB 2GD4A 1NFYB 1Z6EL 4X8VL 3N8ZA 5JW1A 2CJIB 4O1ZA 1HRFA 1XKBA 3LAQA 1L5GB 3Q3KB 4Y7BB 2EI7B 4BTUA 2W2PE 4C16A 1P0SL 1HJ7A 4LORA 1KLOA 2K2SB 1FE2A 2KL7A
chains in the Genus database with same CATH superfamily
2W3KB 3NTGA 2BQ6A 1K37A 1U8CB 2XC0L 2I9AA 1DQBA 2JKHL 2VVUL 4AQTA 3HO3A 4OTJA 1PGEA 2BT8A 3QMOA 3ZYJB 2BOKL 4BDWA 4X8SL 1HAFA 4MMYB 1XKAL 1A3PA 3P5BL 5JB9E 2WPHE 3FFGL 4FM5A 1FJSL 3LC3B 5IKTA 1X7AL 1G1SA 3HO5A 5IKQA 1EPHA 1XDTR 2VH0B 2P26A 1M1XB 2B7DL 1Z6CA 1IGZA 1SZBA 1NPEB 1ADXA 2BO2A 1XFEA 4CUEA 3S6XA 1DIYA 2WFXB 2WPKE 4XLWA 5COXA 3SOBB 3TGFA 2Q1JB 1CVWL 2KB9A 2VVVL 1IQFL 1G1RA 5KIRA 2VWMK 3OLTA 3MDLA 4Z0KB 2WFTA 2VWNL 2WPJE 2PHBB 1QFKL 5FDQA 2W2OE 3SOQA 1YO8A 4Y6DB 1U67A 4E1GA 1LPKA 4RRZA 1C5MF 2KV4A 3F6UL 1HT8A 3V65B 3LTGD 3LTFB 2M74A 3POYA 3N8WA 3K9XA 2BOHA 1HCGB 2VH6B 1OB1C 2FD6A 5L30L 1IQGL 4O02B 4ISHL 4Z6AL 2J4IB 1IP0A 2P3FN 1CX2A 1YUFA 2D1JB 1PFXL 2BOUA 1NFXB 4BDXA 4G1MB 1YGCL 5L2ZL 2VJ3A 4NG9L 2WZPP 1HT5A 2I9BA 1HX2A 2J38B 1EGFA 1FSBA 4YT6L 1HAEA 3N8VA 3R05A 2XC4L 2G00L 3ZYIB 2P3UA 4MMZB 2P93L 1G1TA 1N1IA 4XBMA 2FLRL 3SOVA 1APOA 3HS7A 1EPJA 1DVAL 3U73A 4RRYA 4Z0LA 4JYUL 3ELAL 5I46L 4M10A 4YT7L 1EQGA 1W7XL 1LPGA 2XBWL 2HORA 5F19A 1IQHL 5E8DA 1ATBA 1CCFA 1NZIA 4ZAEB 4Y7AB 1GK5A 5CISA 2YGPA 4RRXA 4CUFA 1IOEL 2F9BL 3OLUA 1LK9A 1IQIL 3CFWA 4A94C 1KLJL 2WPLE 4JZEL 1F0SB 4XL1A 1AUTL 4JZFL 4D0FA 4GU3A 3LN1A 1LPZA 3CA7A 3M37L 2W2ME 2TGFA 4RS0A 2VWLL 2W3IB 1PTHA 5L2YL 2DDUA 1RFNB 3CENL 2XBYL 1IQEL 2BMGA 1COUA 2W86A 1IQJL 2J94B 2Y82B 4OTYA 4NGAL 1NQLB 1O5DL 2BQWA 2YGQA 1WHEA 3N8YA 2J34B 1EQHA 3BT1A 4Y76B 1WHFA 2P28B 1B9WA 2P95L 5F1AA 1IGXA 2JJLA 2WYJB 2XBVL 5IKVA 4A7IA 1L3YA 3GCXE 3KCGL 3TH3L 3HPTA 1EAIC 2HOXA 3KK6A 1K36A 1BF9A 5IKRA 1UZJA 1ATDA 2ADXA 2WPME 2PUQL 1LMMA 2VWOL 2UWPB 3LIWB 1UZPA 3N8XA 1F7EA 2EI8B 2Y5FL 2Y5GL 3NTBA 4ZH8B 3BT2A 4RUTA 3KQEL 2FZZL 2YGOA 3LN0A 3TZIA 2VVCK 2H9EL 1HZ8A 2Y81B 2Y7ZB 2J95B 2NPRA 1CQEA 4X8TL 5CKNA 1JL9A 3IJEB 6COXA 2BOXA 3IITB 3N8YB 4BXSA 5JVZA 4M11A 1QIUA 3SW2A 1UZKA 3ASIA 4BXWA 1P9JA 4Y71B 1DDXA 1FF7A 1APQA 1W8BL 3DEMA 1F7MA 2EI6B 2RHPA 4D0EA 2W2NE 4MMXB 5KN5C 3KQBL 4TGFA 3TK6B 1EBVA 3N8WB 1ATAA 4GU4A 1V1IA 2AYLA 1PRHA 4RRWA 1IQNL 3TBDA 2J2UB 4X8UL 3QH0A 1JV2B 1LQDA 3KQCL 1MQ5L 2H9EC 3RR3A 1EPIA 3BPSE 2P16L 1HREA 2KNIA 1EMNA 1LMJA 1DX5I 3MQEA 2WYGB 2XC5L 5K0HB 1NFWB 1J9CL 1KSNB 1FFMA 1FAKL 2W26B 1V1HA 3KRKA 4CSYA 3QCWA 2P94L 2RA0L 3ENSA 2MHPA 1JBUL 2P3TA 1YUKB 4ZXYL 5EGMB 2OYUP 1I0UA 2FLGA 4PH9A 2P3FL 1ATEA 2Y5HL 1EPGA 5JBCE 3HS5A 4JYVL 1NT0A 1UZQA 1G2MB 1IVOC 1IQML 1TLEA 3Q7DA 1PXXA 3PGHA 3FCSB 4JZDL 5JB8E 1FAXL 1ZAQA 1V3XB 3TK5B 1EZQB 1WU1B 4D90A 1KIGL 4BTIA 3KQDL 1YUGA 4YZUB 2OYEP 3U7UG 1TOZA 4NA9L 1CVUA 2Y38A 2MGRA 2BQ7A 2WG3C 3F1SB 3KL6B 5CKMA 5JVYA 4ZHAB 3H5CB 1TPGA 1MOXC 2BSFA 3M36L 1F0RB 3GISX 1Q4GA 2VRSA 2FLBL 4CUDA 2RNLA 2XBXL 2BZ6L 3V64C 1IQKL 2K2TA 1KKEA 3LC5B 3NT1A 4LMFA 4BTTA 1IJQA 4COXA 1IOXA 3FBYA 1N7DA 1IQLL 3HS6A 1EMOA 4ISIL 2WG4B 2W2QE 2Y80B 2UWOB 3CS7L 5JBAE 1CEJA 3HO4A 4Y79B 1G1QA 3ZYGA 3GCWE 1MQ6L 5CKQA 2PR3B 1NFUB 4ZXXL 2MGPA 1CCVA 2Y7XB 3EGFA 1URKA 5JBBE 3NJPC 1G2LB 1KLIL 2WPIE 3C9AC 2UWLB 2GD4A 1NFYB 1Z6EL 4X8VL 3N8ZA 5JW1A 2CJIB 4O1ZA 1HRFA 2BT7A 1XKBA 3LAQA 1L5GB 3Q3KB 4Y7BB 2EI7B 4BTUA 2W2PE 4C16A 1P0SL 1HJ7A 4LORA 1KLOA 2K2SB 1FE2A 2KL7A
chains in the Genus database with same CATH topology
2W3KB 3NTGA 2BQ6A 1K37A 1U8CB 2XC0L 2I9AA 1DQBA 2JKHL 2VVUL 4AQTA 3HO3A 4OTJA 1PGEA 3QMOA 3ZYJB 2BOKL 4BDWA 4X8SL 1HAFA 4MMYB 1XKAL 1A3PA 3P5BL 5JB9E 2WPHE 3FFGL 4FM5A 1FJSL 3LC3B 5IKTA 1X7AL 1G1SA 3HO5A 5IKQA 1EPHA 1XDTR 2VH0B 2P26A 1M1XB 2B7DL 1Z6CA 1IGZA 1SZBA 1NPEB 1ADXA 2BO2A 1XFEA 4CUEA 3S6XA 1DIYA 2WFXB 2WPKE 4XLWA 5COXA 3SOBB 3TGFA 2Q1JB 1CVWL 2KB9A 2VVVL 1IQFL 1G1RA 5KIRA 2VWMK 3OLTA 3MDLA 4Z0KB 2WFTA 2VWNL 2WPJE 2PHBB 1QFKL 5FDQA 2W2OE 3SOQA 1YO8A 4Y6DB 1U67A 4E1GA 1LPKA 4RRZA 1C5MF 2KV4A 3F6UL 1HT8A 3V65B 3LTGD 3LTFB 2M74A 3POYA 3N8WA 3K9XA 2BOHA 1HCGB 2VH6B 1OB1C 2FD6A 5L30L 1IQGL 4O02B 4ISHL 4Z6AL 2J4IB 1IP0A 2P3FN 1CX2A 1YUFA 2D1JB 1PFXL 2BOUA 1NFXB 4BDXA 4G1MB 1YGCL 5L2ZL 2VJ3A 4NG9L 2WZPP 1HT5A 2I9BA 1HX2A 2J38B 1EGFA 1FSBA 4YT6L 1HAEA 3N8VA 3R05A 2XC4L 2G00L 3ZYIB 2P3UA 4MMZB 2P93L 1G1TA 1N1IA 4XBMA 2FLRL 3SOVA 1APOA 3HS7A 1EPJA 1DVAL 3U73A 4RRYA 4Z0LA 4JYUL 3ELAL 5I46L 4M10A 4YT7L 1EQGA 1W7XL 1LPGA 2XBWL 5F19A 1IQHL 5E8DA 1ATBA 1CCFA 1NZIA 4ZAEB 4Y7AB 1GK5A 5CISA 2YGPA 4RRXA 4CUFA 1IOEL 2F9BL 3OLUA 3CFWA 1IQIL 4A94C 1KLJL 2WPLE 4JZEL 1F0SB 4XL1A 1AUTL 4JZFL 4D0FA 3LN1A 1LPZA 3CA7A 3M37L 2W2ME 2TGFA 4RS0A 2VWLL 2W3IB 1PTHA 5L2YL 2DDUA 1RFNB 3CENL 2XBYL 1IQEL 2BMGA 1COUA 2W86A 1IQJL 2J94B 2Y82B 4OTYA 4NGAL 1NQLB 1O5DL 2BQWA 2YGQA 1WHEA 3N8YA 2J34B 1EQHA 3BT1A 4Y76B 1WHFA 2P28B 1B9WA 2P95L 5F1AA 1IGXA 2WYJB 2XBVL 5IKVA 4A7IA 1L3YA 3GCXE 3KCGL 3TH3L 3HPTA 1EAIC 3KK6A 1K36A 1BF9A 5IKRA 1UZJA 1ATDA 2ADXA 2WPME 2PUQL 1LMMA 2VWOL 2UWPB 3LIWB 1UZPA 3N8XA 1F7EA 2EI8B 2Y5FL 2Y5GL 3NTBA 4ZH8B 3BT2A 4RUTA 3KQEL 2FZZL 2YGOA 3LN0A 3TZIA 2VVCK 2H9EL 1HZ8A 2Y81B 2Y7ZB 2J95B 2NPRA 1CQEA 4X8TL 5CKNA 1JL9A 3IJEB 6COXA 2BOXA 3IITB 3N8YB 4BXSA 5JVZA 4M11A 3SW2A 1UZKA 3ASIA 4BXWA 1P9JA 4Y71B 1DDXA 1FF7A 1APQA 1W8BL 3DEMA 1F7MA 2EI6B 2RHPA 4D0EA 2W2NE 4MMXB 5KN5C 3KQBL 4TGFA 3TK6B 1EBVA 3N8WB 1ATAA 2AYLA 1PRHA 4RRWA 1IQNL 3TBDA 2J2UB 4X8UL 3QH0A 1JV2B 1LQDA 3KQCL 1MQ5L 2H9EC 3RR3A 1EPIA 3BPSE 2P16L 1HREA 2KNIA 1EMNA 1LMJA 1DX5I 3MQEA 2WYGB 2XC5L 5K0HB 1NFWB 1J9CL 1KSNB 1FFMA 1FAKL 2W26B 3KRKA 4CSYA 3QCWA 2P94L 2RA0L 3ENSA 2MHPA 1JBUL 2P3TA 1YUKB 4ZXYL 5EGMB 2OYUP 1I0UA 2FLGA 4PH9A 2P3FL 1ATEA 2Y5HL 1EPGA 5JBCE 3HS5A 4JYVL 1NT0A 1UZQA 1G2MB 1IVOC 1IQML 1TLEA 3Q7DA 1PXXA 3PGHA 3FCSB 4JZDL 5JB8E 1FAXL 1ZAQA 1V3XB 3TK5B 1EZQB 1WU1B 4D90A 1KIGL 4BTIA 3KQDL 1YUGA 4YZUB 2OYEP 3U7UG 1TOZA 4NA9L 1CVUA 2Y38A 2MGRA 2BQ7A 2WG3C 3F1SB 3KL6B 5CKMA 5JVYA 4ZHAB 3H5CB 1TPGA 1MOXC 3M36L 1F0RB 3GISX 1Q4GA 2FLBL 4CUDA 2RNLA 2XBXL 2BZ6L 3V64C 1IQKL 2K2TA 3LC5B 3NT1A 4LMFA 4BTTA 1IJQA 4COXA 1IOXA 3FBYA 1N7DA 1IQLL 3HS6A 1EMOA 4ISIL 2WG4B 2W2QE 2Y80B 2UWOB 3CS7L 5JBAE 1CEJA 3HO4A 4Y79B 1G1QA 3ZYGA 3GCWE 1MQ6L 5CKQA 2PR3B 1NFUB 4ZXXL 2MGPA 1CCVA 2Y7XB 3EGFA 1URKA 5JBBE 3NJPC 1G2LB 1KLIL 2WPIE 3C9AC 2UWLB 2GD4A 1NFYB 1Z6EL 4X8VL 3N8ZA 5JW1A 2CJIB 4O1ZA 1HRFA 1XKBA 3LAQA 1L5GB 3Q3KB 4Y7BB 2EI7B 4BTUA 2W2PE 4C16A 1P0SL 1HJ7A 4LORA 1KLOA 2K2SB 1FE2A 2KL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3K B;  3NTG A;  2BQ6 A;  1K37 A;  1U8C B;  2XC0 L;  2I9A A;  1DQB A;  2JKH L;  2VVU L;  4AQT A;  3HO3 A;  4OTJ A;  1PGE A;  3QMO A;  3ZYJ B;  2BOK L;  4BDW A;  4X8S L;  1HAF A;  4MMY B;  1XKA L;  1A3P A;  3P5B L;  5JB9 E;  2WPH E;  3FFG L;  4FM5 A;  1FJS L;  3LC3 B;  5IKT A;  1X7A L;  1G1S A;  3HO5 A;  5IKQ A;  1EPH A;  1XDT R;  2VH0 B;  2P26 A;  1M1X B;  2B7D L;  1Z6C A;  1IGZ A;  1SZB A;  1NPE B;  1ADX A;  2BO2 A;  1XFE A;  4CUE A;  1DIY A;  2WFX B;  2WPK E;  4XLW A;  5COX A;  3SOB B;  3TGF A;  2Q1J B;  1CVW L;  2KB9 A;  2VVV L;  1IQF L;  1G1R A;  5KIR A;  2VWM K;  3OLT A;  3MDL A;  4Z0K B;  2WFT A;  2VWN L;  2WPJ E;  2PHB B;  1QFK L;  5FDQ A;  2W2O E;  3SOQ A;  1YO8 A;  4Y6D B;  1U67 A;  4E1G A;  1LPK A;  4RRZ A;  1C5M F;  2KV4 A;  3F6U L;  1HT8 A;  3V65 B;  3LTG D;  3LTF B;  2M74 A;  3POY A;  3N8W A;  3K9X A;  2BOH A;  1HCG B;  2VH6 B;  1OB1 C;  2FD6 A;  5L30 L;  1IQG L;  4O02 B;  4ISH L;  4Z6A L;  2J4I B;  1IP0 A;  2P3F N;  1CX2 A;  1YUF A;  2D1J B;  1PFX L;  2BOU A;  1NFX B;  4BDX A;  4G1M B;  1YGC L;  5L2Z L;  2VJ3 A;  4NG9 L;  1HT5 A;  2I9B A;  1HX2 A;  2J38 B;  1EGF A;  1FSB A;  4YT6 L;  1HAE A;  3N8V A;  3R05 A;  2XC4 L;  2G00 L;  3ZYI B;  2P3U A;  4MMZ B;  2P93 L;  1G1T A;  1N1I A;  4XBM A;  2FLR L;  3SOV A;  1APO A;  3HS7 A;  1EPJ A;  1DVA L;  3U73 A;  4RRY A;  4Z0L A;  4JYU L;  3ELA L;  5I46 L;  4M10 A;  4YT7 L;  1EQG A;  1W7X L;  1LPG A;  2XBW L;  5F19 A;  1IQH L;  5E8D A;  1ATB A;  1CCF A;  1NZI A;  4ZAE B;  4Y7A B;  1GK5 A;  5CIS A;  2YGP A;  4RRX A;  4CUF A;  1IOE L;  2F9B L;  3OLU A;  3CFW A;  1IQI L;  1KLJ L;  2WPL E;  4JZE L;  1F0S B;  4XL1 A;  1AUT L;  4JZF L;  4D0F A;  3LN1 A;  1LPZ A;  3CA7 A;  3M37 L;  2W2M E;  2TGF A;  4RS0 A;  2VWL L;  2W3I B;  1PTH A;  5L2Y L;  2DDU A;  1RFN B;  3CEN L;  2XBY L;  1IQE L;  2BMG A;  1COU A;  2W86 A;  1IQJ L;  2J94 B;  2Y82 B;  4OTY A;  4NGA L;  1NQL B;  1O5D L;  2BQW A;  1WHE A;  3N8Y A;  2J34 B;  1EQH A;  3BT1 A;  4Y76 B;  1WHF A;  2P28 B;  1B9W A;  2P95 L;  5F1A A;  1IGX A;  2WYJ B;  2XBV L;  5IKV A;  4A7I A;  1L3Y A;  3GCX E;  3KCG L;  3TH3 L;  3HPT A;  1EAI C;  3KK6 A;  1K36 A;  1BF9 A;  5IKR A;  1UZJ A;  1ATD A;  2ADX A;  2WPM E;  2PUQ L;  2VWO L;  2UWP B;  3LIW B;  1UZP A;  3N8X A;  1F7E A;  2EI8 B;  2Y5F L;  2Y5G L;  3NTB A;  4ZH8 B;  3BT2 A;  4RUT A;  3KQE L;  2FZZ L;  2YGO A;  3LN0 A;  3TZI A;  2VVC K;  2H9E L;  1HZ8 A;  2Y81 B;  2Y7Z B;  2J95 B;  2NPR A;  1CQE A;  4X8T L;  5CKN A;  1JL9 A;  3IJE B;  6COX A;  2BOX A;  3IIT B;  3N8Y B;  4BXS A;  5JVZ A;  4M11 A;  3SW2 A;  1UZK A;  3ASI A;  4BXW A;  1P9J A;  4Y71 B;  1DDX A;  1FF7 A;  1APQ A;  1W8B L;  3DEM A;  1F7M A;  2EI6 B;  2RHP A;  4D0E A;  2W2N E;  4MMX B;  5KN5 C;  3KQB L;  4TGF A;  3TK6 B;  1EBV A;  3N8W B;  1ATA A;  2AYL A;  1PRH A;  4RRW A;  1IQN L;  3TBD A;  2J2U B;  4X8U L;  3QH0 A;  1JV2 B;  1LQD A;  3KQC L;  1MQ5 L;  3RR3 A;  1EPI A;  3BPS E;  2P16 L;  1HRE A;  1EMN A;  1LMJ A;  1DX5 I;  3MQE A;  2WYG B;  2XC5 L;  5K0H B;  1NFW B;  1J9C L;  1KSN B;  1FFM A;  1FAK L;  2W26 B;  3KRK A;  4CSY A;  3QCW A;  2P94 L;  2RA0 L;  3ENS A;  2MHP A;  1JBU L;  2P3T A;  1YUK B;  4ZXY L;  5EGM B;  2OYU P;  1I0U A;  2FLG A;  4PH9 A;  2P3F L;  1ATE A;  2Y5H L;  1EPG A;  5JBC E;  3HS5 A;  4JYV L;  1NT0 A;  1UZQ A;  1G2M B;  1IVO C;  1IQM L;  1TLE A;  3Q7D A;  1PXX A;  3PGH A;  3FCS B;  4JZD L;  5JB8 E;  1FAX L;  1ZAQ A;  1V3X B;  3TK5 B;  1EZQ B;  1WU1 B;  4D90 A;  1KIG L;  4BTI A;  3KQD L;  1YUG A;  4YZU B;  2OYE P;  3U7U G;  1TOZ A;  4NA9 L;  1CVU A;  2Y38 A;  2MGR A;  2BQ7 A;  2WG3 C;  3F1S B;  3KL6 B;  5CKM A;  5JVY A;  4ZHA B;  3H5C B;  1TPG A;  1MOX C;  3M36 L;  1F0R B;  3GIS X;  1Q4G A;  2FLB L;  4CUD A;  2RNL A;  2XBX L;  2BZ6 L;  3V64 C;  1IQK L;  2K2T A;  3LC5 B;  3NT1 A;  4LMF A;  4BTT A;  1IJQ A;  4COX A;  1IOX A;  3FBY A;  1N7D A;  1IQL L;  3HS6 A;  1EMO A;  4ISI L;  2WG4 B;  2W2Q E;  2Y80 B;  2UWO B;  3CS7 L;  5JBA E;  1CEJ A;  3HO4 A;  4Y79 B;  1G1Q A;  3ZYG A;  3GCW E;  1MQ6 L;  5CKQ A;  2PR3 B;  1NFU B;  4ZXX L;  2MGP A;  1CCV A;  2Y7X B;  3EGF A;  1URK A;  5JBB E;  3NJP C;  1G2L B;  1KLI L;  2WPI E;  3C9A C;  2UWL B;  2GD4 A;  1NFY B;  1Z6E L;  4X8V L;  3N8Z A;  5JW1 A;  2CJI B;  4O1Z A;  1HRF A;  1XKB A;  3LAQ A;  1L5G B;  3Q3K B;  4Y7B B;  2EI7 B;  4BTU A;  2W2P E;  4C16 A;  1P0S L;  1HJ7 A;  4LOR A;  1KLO A;  2K2S B;  1FE2 A;  2KL7 A; 
#chains in the Genus database with same CATH topology
 2W3K B;  3NTG A;  2BQ6 A;  1K37 A;  1U8C B;  2XC0 L;  2I9A A;  1DQB A;  2JKH L;  2VVU L;  4AQT A;  3HO3 A;  4OTJ A;  1PGE A;  2BT8 A;  3QMO A;  3ZYJ B;  2BOK L;  4BDW A;  4X8S L;  1HAF A;  4MMY B;  1XKA L;  1A3P A;  3P5B L;  5JB9 E;  2WPH E;  3FFG L;  4FM5 A;  1FJS L;  3LC3 B;  5IKT A;  1X7A L;  1G1S A;  3HO5 A;  5IKQ A;  1EPH A;  1XDT R;  2VH0 B;  2P26 A;  1M1X B;  2B7D L;  1Z6C A;  1IGZ A;  1SZB A;  1NPE B;  1ADX A;  2BO2 A;  1XFE A;  4CUE A;  3S6X A;  1DIY A;  2WFX B;  2WPK E;  4XLW A;  5COX A;  3SOB B;  3TGF A;  2Q1J B;  1CVW L;  2KB9 A;  2VVV L;  1IQF L;  1G1R A;  5KIR A;  2VWM K;  3OLT A;  3MDL A;  4Z0K B;  2WFT A;  2VWN L;  2WPJ E;  2PHB B;  1QFK L;  5FDQ A;  2W2O E;  3SOQ A;  1YO8 A;  4Y6D B;  1U67 A;  4E1G A;  1LPK A;  4RRZ A;  1C5M F;  2KV4 A;  3F6U L;  1HT8 A;  3V65 B;  3LTG D;  3LTF B;  2M74 A;  3POY A;  3N8W A;  3K9X A;  2BOH A;  1HCG B;  2VH6 B;  1OB1 C;  2FD6 A;  5L30 L;  1IQG L;  4O02 B;  4ISH L;  4Z6A L;  2J4I B;  1IP0 A;  2P3F N;  1CX2 A;  1YUF A;  2D1J B;  1PFX L;  2BOU A;  1NFX B;  4BDX A;  4G1M B;  1YGC L;  5L2Z L;  2VJ3 A;  4NG9 L;  2WZP P;  1HT5 A;  2I9B A;  1HX2 A;  2J38 B;  1EGF A;  1FSB A;  4YT6 L;  1HAE A;  3N8V A;  3R05 A;  2XC4 L;  2G00 L;  3ZYI B;  2P3U A;  4MMZ B;  2P93 L;  1G1T A;  1N1I A;  4XBM A;  2FLR L;  3SOV A;  1APO A;  3HS7 A;  1EPJ A;  1DVA L;  3U73 A;  4RRY A;  4Z0L A;  4JYU L;  3ELA L;  5I46 L;  4M10 A;  4YT7 L;  1EQG A;  1W7X L;  1LPG A;  2XBW L;  2HOR A;  5F19 A;  1IQH L;  5E8D A;  1ATB A;  1CCF A;  1NZI A;  4ZAE B;  4Y7A B;  1GK5 A;  5CIS A;  2YGP A;  4RRX A;  4CUF A;  1IOE L;  2F9B L;  3OLU A;  1LK9 A;  1IQI L;  3CFW A;  4A94 C;  1KLJ L;  2WPL E;  4JZE L;  1F0S B;  4XL1 A;  1AUT L;  4JZF L;  4D0F A;  4GU3 A;  3LN1 A;  1LPZ A;  3CA7 A;  3M37 L;  2W2M E;  2TGF A;  4RS0 A;  2VWL L;  2W3I B;  1PTH A;  5L2Y L;  2DDU A;  1RFN B;  3CEN L;  2XBY L;  1IQE L;  2BMG A;  1COU A;  2W86 A;  1IQJ L;  2J94 B;  2Y82 B;  4OTY A;  4NGA L;  1NQL B;  1O5D L;  2BQW A;  2YGQ A;  1WHE A;  3N8Y A;  2J34 B;  1EQH A;  3BT1 A;  4Y76 B;  1WHF A;  2P28 B;  1B9W A;  2P95 L;  5F1A A;  1IGX A;  2JJL A;  2WYJ B;  2XBV L;  5IKV A;  4A7I A;  1L3Y A;  3GCX E;  3KCG L;  3TH3 L;  3HPT A;  1EAI C;  2HOX A;  3KK6 A;  1K36 A;  1BF9 A;  5IKR A;  1UZJ A;  1ATD A;  2ADX A;  2WPM E;  2PUQ L;  1LMM A;  2VWO L;  2UWP B;  3LIW B;  1UZP A;  3N8X A;  1F7E A;  2EI8 B;  2Y5F L;  2Y5G L;  3NTB A;  4ZH8 B;  3BT2 A;  4RUT A;  3KQE L;  2FZZ L;  2YGO A;  3LN0 A;  3TZI A;  2VVC K;  2H9E L;  1HZ8 A;  2Y81 B;  2Y7Z B;  2J95 B;  2NPR A;  1CQE A;  4X8T L;  5CKN A;  1JL9 A;  3IJE B;  6COX A;  2BOX A;  3IIT B;  3N8Y B;  4BXS A;  5JVZ A;  4M11 A;  1QIU A;  3SW2 A;  1UZK A;  3ASI A;  4BXW A;  1P9J A;  4Y71 B;  1DDX A;  1FF7 A;  1APQ A;  1W8B L;  3DEM A;  1F7M A;  2EI6 B;  2RHP A;  4D0E A;  2W2N E;  4MMX B;  5KN5 C;  3KQB L;  4TGF A;  3TK6 B;  1EBV A;  3N8W B;  1ATA A;  4GU4 A;  1V1I A;  2AYL A;  1PRH A;  4RRW A;  1IQN L;  3TBD A;  2J2U B;  4X8U L;  3QH0 A;  1JV2 B;  1LQD A;  3KQC L;  1MQ5 L;  2H9E C;  3RR3 A;  1EPI A;  3BPS E;  2P16 L;  1HRE A;  2KNI A;  1EMN A;  1LMJ A;  1DX5 I;  3MQE A;  2WYG B;  2XC5 L;  5K0H B;  1NFW B;  1J9C L;  1KSN B;  1FFM A;  1FAK L;  2W26 B;  1V1H A;  3KRK A;  4CSY A;  3QCW A;  2P94 L;  2RA0 L;  3ENS A;  2MHP A;  1JBU L;  2P3T A;  1YUK B;  4ZXY L;  5EGM B;  2OYU P;  1I0U A;  2FLG A;  4PH9 A;  2P3F L;  1ATE A;  2Y5H L;  1EPG A;  5JBC E;  3HS5 A;  4JYV L;  1NT0 A;  1UZQ A;  1G2M B;  1IVO C;  1IQM L;  1TLE A;  3Q7D A;  1PXX A;  3PGH A;  3FCS B;  4JZD L;  5JB8 E;  1FAX L;  1ZAQ A;  1V3X B;  3TK5 B;  1EZQ B;  1WU1 B;  4D90 A;  1KIG L;  4BTI A;  3KQD L;  1YUG A;  4YZU B;  2OYE P;  3U7U G;  1TOZ A;  4NA9 L;  1CVU A;  2Y38 A;  2MGR A;  2BQ7 A;  2WG3 C;  3F1S B;  3KL6 B;  5CKM A;  5JVY A;  4ZHA B;  3H5C B;  1TPG A;  1MOX C;  2BSF A;  3M36 L;  1F0R B;  3GIS X;  1Q4G A;  2VRS A;  2FLB L;  4CUD A;  2RNL A;  2XBX L;  2BZ6 L;  3V64 C;  1IQK L;  2K2T A;  1KKE A;  3LC5 B;  3NT1 A;  4LMF A;  4BTT A;  1IJQ A;  4COX A;  1IOX A;  3FBY A;  1N7D A;  1IQL L;  3HS6 A;  1EMO A;  4ISI L;  2WG4 B;  2W2Q E;  2Y80 B;  2UWO B;  3CS7 L;  5JBA E;  1CEJ A;  3HO4 A;  4Y79 B;  1G1Q A;  3ZYG A;  3GCW E;  1MQ6 L;  5CKQ A;  2PR3 B;  1NFU B;  4ZXX L;  2MGP A;  1CCV A;  2Y7X B;  3EGF A;  1URK A;  5JBB E;  3NJP C;  1G2L B;  1KLI L;  2WPI E;  3C9A C;  2UWL B;  2GD4 A;  1NFY B;  1Z6E L;  4X8V L;  3N8Z A;  5JW1 A;  2CJI B;  4O1Z A;  1HRF A;  2BT7 A;  1XKB A;  3LAQ A;  1L5G B;  3Q3K B;  4Y7B B;  2EI7 B;  4BTU A;  2W2P E;  4C16 A;  1P0S L;  1HJ7 A;  4LOR A;  1KLO A;  2K2S B;  1FE2 A;  2KL7 A; 
#chains in the Genus database with same CATH homology
 2W3K B;  3NTG A;  2BQ6 A;  1K37 A;  1U8C B;  2XC0 L;  2I9A A;  1DQB A;  2JKH L;  2VVU L;  4AQT A;  3HO3 A;  4OTJ A;  1PGE A;  3QMO A;  3ZYJ B;  2BOK L;  4BDW A;  4X8S L;  1HAF A;  4MMY B;  1XKA L;  1A3P A;  3P5B L;  5JB9 E;  2WPH E;  3FFG L;  4FM5 A;  1FJS L;  3LC3 B;  5IKT A;  1X7A L;  1G1S A;  3HO5 A;  5IKQ A;  1EPH A;  1XDT R;  2VH0 B;  2P26 A;  1M1X B;  2B7D L;  1Z6C A;  1IGZ A;  1SZB A;  1NPE B;  1ADX A;  2BO2 A;  1XFE A;  4CUE A;  3S6X A;  1DIY A;  2WFX B;  2WPK E;  4XLW A;  5COX A;  3SOB B;  3TGF A;  2Q1J B;  1CVW L;  2KB9 A;  2VVV L;  1IQF L;  1G1R A;  5KIR A;  2VWM K;  3OLT A;  3MDL A;  4Z0K B;  2WFT A;  2VWN L;  2WPJ E;  2PHB B;  1QFK L;  5FDQ A;  2W2O E;  3SOQ A;  1YO8 A;  4Y6D B;  1U67 A;  4E1G A;  1LPK A;  4RRZ A;  1C5M F;  2KV4 A;  3F6U L;  1HT8 A;  3V65 B;  3LTG D;  3LTF B;  2M74 A;  3POY A;  3N8W A;  3K9X A;  2BOH A;  1HCG B;  2VH6 B;  1OB1 C;  2FD6 A;  5L30 L;  1IQG L;  4O02 B;  4ISH L;  4Z6A L;  2J4I B;  1IP0 A;  2P3F N;  1CX2 A;  1YUF A;  2D1J B;  1PFX L;  2BOU A;  1NFX B;  4BDX A;  4G1M B;  1YGC L;  5L2Z L;  2VJ3 A;  4NG9 L;  2WZP P;  1HT5 A;  2I9B A;  1HX2 A;  2J38 B;  1EGF A;  1FSB A;  4YT6 L;  1HAE A;  3N8V A;  3R05 A;  2XC4 L;  2G00 L;  3ZYI B;  2P3U A;  4MMZ B;  2P93 L;  1G1T A;  1N1I A;  4XBM A;  2FLR L;  3SOV A;  1APO A;  3HS7 A;  1EPJ A;  1DVA L;  3U73 A;  4RRY A;  4Z0L A;  4JYU L;  3ELA L;  5I46 L;  4M10 A;  4YT7 L;  1EQG A;  1W7X L;  1LPG A;  2XBW L;  5F19 A;  1IQH L;  5E8D A;  1ATB A;  1CCF A;  1NZI A;  4ZAE B;  4Y7A B;  1GK5 A;  5CIS A;  2YGP A;  4RRX A;  4CUF A;  1IOE L;  2F9B L;  3OLU A;  3CFW A;  1IQI L;  4A94 C;  1KLJ L;  2WPL E;  4JZE L;  1F0S B;  4XL1 A;  1AUT L;  4JZF L;  4D0F A;  3LN1 A;  1LPZ A;  3CA7 A;  3M37 L;  2W2M E;  2TGF A;  4RS0 A;  2VWL L;  2W3I B;  1PTH A;  5L2Y L;  2DDU A;  1RFN B;  3CEN L;  2XBY L;  1IQE L;  2BMG A;  1COU A;  2W86 A;  1IQJ L;  2J94 B;  2Y82 B;  4OTY A;  4NGA L;  1NQL B;  1O5D L;  2BQW A;  2YGQ A;  1WHE A;  3N8Y A;  2J34 B;  1EQH A;  3BT1 A;  4Y76 B;  1WHF A;  2P28 B;  1B9W A;  2P95 L;  5F1A A;  1IGX A;  2WYJ B;  2XBV L;  5IKV A;  4A7I A;  1L3Y A;  3GCX E;  3KCG L;  3TH3 L;  3HPT A;  1EAI C;  3KK6 A;  1K36 A;  1BF9 A;  5IKR A;  1UZJ A;  1ATD A;  2ADX A;  2WPM E;  2PUQ L;  1LMM A;  2VWO L;  2UWP B;  3LIW B;  1UZP A;  3N8X A;  1F7E A;  2EI8 B;  2Y5F L;  2Y5G L;  3NTB A;  4ZH8 B;  3BT2 A;  4RUT A;  3KQE L;  2FZZ L;  2YGO A;  3LN0 A;  3TZI A;  2VVC K;  2H9E L;  1HZ8 A;  2Y81 B;  2Y7Z B;  2J95 B;  2NPR A;  1CQE A;  4X8T L;  5CKN A;  1JL9 A;  3IJE B;  6COX A;  2BOX A;  3IIT B;  3N8Y B;  4BXS A;  5JVZ A;  4M11 A;  3SW2 A;  1UZK A;  3ASI A;  4BXW A;  1P9J A;  4Y71 B;  1DDX A;  1FF7 A;  1APQ A;  1W8B L;  3DEM A;  1F7M A;  2EI6 B;  2RHP A;  4D0E A;  2W2N E;  4MMX B;  5KN5 C;  3KQB L;  4TGF A;  3TK6 B;  1EBV A;  3N8W B;  1ATA A;  2AYL A;  1PRH A;  4RRW A;  1IQN L;  3TBD A;  2J2U B;  4X8U L;  3QH0 A;  1JV2 B;  1LQD A;  3KQC L;  1MQ5 L;  2H9E C;  3RR3 A;  1EPI A;  3BPS E;  2P16 L;  1HRE A;  2KNI A;  1EMN A;  1LMJ A;  1DX5 I;  3MQE A;  2WYG B;  2XC5 L;  5K0H B;  1NFW B;  1J9C L;  1KSN B;  1FFM A;  1FAK L;  2W26 B;  3KRK A;  4CSY A;  3QCW A;  2P94 L;  2RA0 L;  3ENS A;  2MHP A;  1JBU L;  2P3T A;  1YUK B;  4ZXY L;  5EGM B;  2OYU P;  1I0U A;  2FLG A;  4PH9 A;  2P3F L;  1ATE A;  2Y5H L;  1EPG A;  5JBC E;  3HS5 A;  4JYV L;  1NT0 A;  1UZQ A;  1G2M B;  1IVO C;  1IQM L;  1TLE A;  3Q7D A;  1PXX A;  3PGH A;  3FCS B;  4JZD L;  5JB8 E;  1FAX L;  1ZAQ A;  1V3X B;  3TK5 B;  1EZQ B;  1WU1 B;  4D90 A;  1KIG L;  4BTI A;  3KQD L;  1YUG A;  4YZU B;  2OYE P;  3U7U G;  1TOZ A;  4NA9 L;  1CVU A;  2Y38 A;  2MGR A;  2BQ7 A;  2WG3 C;  3F1S B;  3KL6 B;  5CKM A;  5JVY A;  4ZHA B;  3H5C B;  1TPG A;  1MOX C;  3M36 L;  1F0R B;  3GIS X;  1Q4G A;  2FLB L;  4CUD A;  2RNL A;  2XBX L;  2BZ6 L;  3V64 C;  1IQK L;  2K2T A;  3LC5 B;  3NT1 A;  4LMF A;  4BTT A;  1IJQ A;  4COX A;  1IOX A;  3FBY A;  1N7D A;  1IQL L;  3HS6 A;  1EMO A;  4ISI L;  2WG4 B;  2W2Q E;  2Y80 B;  2UWO B;  3CS7 L;  5JBA E;  1CEJ A;  3HO4 A;  4Y79 B;  1G1Q A;  3ZYG A;  3GCW E;  1MQ6 L;  5CKQ A;  2PR3 B;  1NFU B;  4ZXX L;  2MGP A;  1CCV A;  2Y7X B;  3EGF A;  1URK A;  5JBB E;  3NJP C;  1G2L B;  1KLI L;  2WPI E;  3C9A C;  2UWL B;  2GD4 A;  1NFY B;  1Z6E L;  4X8V L;  3N8Z A;  5JW1 A;  2CJI B;  4O1Z A;  1HRF A;  1XKB A;  3LAQ A;  1L5G B;  3Q3K B;  4Y7B B;  2EI7 B;  4BTU A;  2W2P E;  4C16 A;  1P0S L;  1HJ7 A;  4LOR A;  1KLO A;  2K2S B;  1FE2 A;  2KL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...