4XBMA

X-ray crystal structure of notch ligand delta-like 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
270
structure length
253
Chain Sequence
SGVFELKLQEFVNKKGLLGNRNCCRGPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPNPIRFPFGFTWPGTFSLIIEALHTDSPDLATPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Notch ligand delta-like1: X-ray crystal structure and binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Delta-like protein 1
total genus 38
structure length 253
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
A PF12661 hEGF Human growth factor-like EGF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4xbmA03
2.10.25.140 Mainly Beta Ribbon Laminin Laminin 4xbmA02
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4xbmA01
1IQLL 1DIYA 4LMFA 4OTJA 2B7DL 2WPLE 2BOUA 1ADXA 1CQEA 4CUDA 1KLJL 5CKNA 5IKVA 1TOZA 1NFYB 4NA9L 3KQBL 4PH9A 1NFXB 3KRKA 4BDWA 1F7MA 2PUQL 4Y6DB 2RA0L 1ATDA 1MOXC 1U67A 3M36L 3ZYJB 2WPJE 2Y5FL 1HT8A 1N1IA 1G1SA 3TBDA 3ENSA 3PGHA 4XL1A 2J38B 3V64C 5JBCE 1KLIL 1IGXA 2VH0B 2FLRL 1WHFA 3M37L 2P95L 2BMGA 6COXA 1N7DA 1ZAQA 5KN5C 2Y82B 1IQIL 4MMXB 1K37A 3BPSE 2F9BL 1JBUL 1HRFA 3NTGA 5JBBE 2VWNL 1CVWL 1G1TA 4BTUA 1B9WA 2D1JB 1G1QA 1JV2B 4RRYA 4ZXYL 4Y7BB 4YT7L 5JW1A 2FLGA 2XBXL 5I46L 4A7IA 2I9AA 1FAKL 4ZHAB 1UZJA 4AQTA 1IQJL 1XDTR 5L30L 4BTTA 1IOEL 4JYVL 2P16L 3ZYIB 2Y5GL 2W2ME 3DEMA 1CVUA 3HS5A 1RFNB 3CS7L 3HS6A 2XBYL 3LC3B 5IKTA 3R05A 1W7XL 3V65B 1F7EA 3C9AC 4ISIL 4Y79B 3SW2A 5COXA 1FJSL 2FZZL 4CBZA 2XC5L 4D0EA 2VH6B 4COXA 3TK6B 2BOXA 2YGOA 1ATBA 3N8YA 1NZIA 5CKMA 1BF9A 3EGFA 2BQ7A 3F1SB 3GCWE 4RRWA 4JYUL 1IVOC 2FD6A 4MMZB 1ATEA 1P0SL 3SOBB 2BOHA 4Y71B 1I0UA 1IQML 1UZQA 4RRXA 4Z6AL 3OLTA 1URKA 2WFTA 2PHBB 3ELAL 2UWPB 2XBVL 2VWMK 4O02B 2P93L 2RHPA 2EI6B 2G00L 1HZ8A 1DVAL 1EPHA 1HCGB 1FF7A 4CC1A 2W3KB 2XBWL 2MHPA 1EPIA 1HREA 5E8DA 4CUEA 1IJQA 3SOVA 5CISA 1F0SB 4ISHL 2P3FN 4BTIA 4XBMA 3N8ZA 2BZ6L 2GD4A 2P3UA 1EAIC 4D0FA 3FBYA 2J34B 1PFXL 1MQ6L 1COUA 1FAXL 3TK5B 2Y81B 4ZXXL 2J4IB 1W8BL 3NT1A 4BXSA 1O5DL 1L5GB 1CCVA 3Q7DA 2KB9A 1EMOA 2W2PE 1DQBA 1WU1B 2XC4L 3F6UL 3FCSB 4CSYA 2VWOL 3N8WB 1EPJA 1AUTL 3IJEB 1IQKL 1IGZA 2MGPA 1EMNA 2MGRA 2BQWA 4X8TL 1TPGA 2NPRA 2WYGB 2Y80B 1K36A 2EI8B 2K2SB 2UWLB 1YUGA 3HO4A 5EGMB 3ZYGA 2WPHE 2Y38A 3HS7A 3MDLA 4NG9L 1YUFA 2W3IB 2DDUA 3CFWA 1TLEA 1EGFA 5JVYA 2J95B 1IQHL 2P28B 1Z6EL 3TGFA 4YT6L 2WG4B 3LN0A 3TH3L 1YO8A 1LMJA 2OYEP 3RR3A 4XLWA 1HJ7A 2TGFA 2JKHL 1QFKL 1IP0A 1WHEA 3KQCL 2KL7A 3LTGD 1EQGA 1JL9A 3QCWA 1YGCL 2W86A 3IITB 2W26B 5F19A 2WYJB 2RNLA 3KQEL 5K0HB 1HAEA 3HO3A 1HX2A 4C16A 5L2YL 2WFXB 3NTBA 3TZIA 1PXXA 1X7AL 3U7UG 1HT5A 2ADXA 1EPGA 5JVZA 2WPME 4RRZA 1G2LB 4BDXA 4Y76B 1IQFL 5IKQA 1LPZA 3GCXE 1FFMA 1NFWB 2VWLL 3LIWB 3K9XA 3N8YB 1NT0A 5JB9E 4D90A 1XFEA 4OTYA 3GISX 3KCGL 1NPEB 4ZAEB 5KIRA 2WPKE 4LORA 1IQNL 1P9JA 3BT2A 4BXWA 3H5CB 4G1MB 4X8UL 3SOQA 1G2MB 1FSBA 1UZKA 1MQ5L 3N8XA 1DX5I 5JB8E 3LTFB 2CJIB 3QMOA 4ZH8B 2PR3B 1YUKB 1CX2A 1CCFA 3N8WA 1GK5A 2FLBL 1A3PA 1Z6CA 3ASIA 1EQHA 1LPKA 2AYLA 4O1ZA 1UZPA 2WPIE 2UWOB 3N8VA 1IOXA 5F1AA 2Y7ZB 2EI7B 1KLOA 1KIGL 2KV4A 1LPGA 4Z0KB 2J2UB 1APOA 3OLUA 2OYUP 4CUFA 2P94L 1L3YA 2H9EL 2K2TA 1NQLB 4M10A 1NFUB 4JZEL 4E1GA 1DDXA 2Q1JB 3POYA 4CC0A 1Q4GA 4JZDL 2W2NE 2YGPA 2VJ3A 2VVUL 5FDQA 1KSNB 3KL6B 2BOKL 1IQEL 4X8VL 5IKRA 1CEJA 1J9CL 1PGEA 1V3XB 1C5MF 4JZFL 3Q3KB 1SZBA 1G1RA 2M74A 3KQDL 3LAQA 2Y7XB 4RUTA 2WG3C 3LN1A 3CA7A 1EZQB 3HO5A 3LC5B 3U73A 3FFGL 2Y5HL 2BO2A 2P26A 3CENL 4M11A 1F0RB 1ATAA 4TGFA 2P3TA 1EBVA 3P5BL 3KK6A 4NGAL 4Y7AB 1PRHA 4Z0LA 4YZUB 3HPTA 1FE2A 2VVVL 2BQ6A 1APQA 2VVCK 1PTHA 1XKAL 3QH0A 1XKBA 5CKQA 2P3FL 4X8SL 4FM5A 2XC0L 5JBAE 2J94B 3BT1A 3NJPC 3MQEA 1U8CB 5L2ZL 2I9BA 4RS0A 2W2QE 1OB1C 1IQGL 1M1XB 2W2OE 4MMYB 1HAFA 1LQDA
chains in the Genus database with same CATH superfamily
2F61A 4P2QA 3SE6A 4OTJA 1O75A 1P0SE 4QY8B 3G9VA 4C56E 2E8ZA 1PFOA 2PMZA 1HCVA 2VW6A 2EDRA 4X4XB 4B96A 3G08B 5C0AE 3PJLA 3I9GL 2HLEB 4GKLA 5JXAL 4OLWH 3CCHA 4LSDA 3FQUB 4HCRA 4W81A 4XPHL 5D7JA 1AQKH 2WBJC 4LASH 5TGBA 4HT1H 3VB8A 2UY6B 3DSFL 1NFYB 1BFSA 1FFNA 1IM9D 2IDSA 2J8UA 3B34A 2OKMA 4GXVH 5DZPA 5AAWC 4B9GA 2X4TB 4MNQD 4GAJL 4XT1C 4WU5B 3X1NA 2YD9A 5DRXB 4RMVA 2RA0L 3UO1L 3T8VA 4J3XA 5IWLA 4FULA 2NY1C 3CSYA 3DUUA 3NZSA 5E5MA 3LKNA 4FG6C 1QEWB 2J2ZA 2X0VA 2Y5FL 5DWUH 3CXDL 3U6XA 4LO9A 3CXHJ 5CD5C 5KSUB 3CN2A 4G72B 4QXUL 3IDMB 2VISA 3EG9B 3QA3A 1AXSB 3JTSA 1GPOL 3MBWB 4FCHA 3WL9B 5D1QA 4KNQA 1FZMA 5C2BH 4QGYA 4KQ4L 2FQFA 3S97C 1XH0A 4IHOA 5F71A 5ID0B 3NAAH 1NCTA 5IK3B 3SB3A 3WUWA 1Q0EA 5D1ZA 1VFOA 5IQNA 3DHUA 3DBSA 4H5SB 1S3RA 4H26B 5DMGD 3PWNA 1T2QL 4C83B 4Q89A 3NJLA 3SDCD 2OCCB 1C8QA 4P5MA 5IOPB 3EO9H 2Y72A 5C09E 4Z6AT 5L2KE 3P73A 3C8KA 5ICZB 4NQEB 3RURA 5I0DA 4BFOA 1BFTA 1YG9A 4TL5A 3SSGA 3AY4A 1RZIB 1MW3A 1JBJA 1BZ7A 2OMYB 5F6HI 1JFHA 2WWKO 4H13C 2GSIB 1SN5A 2ICEC 4YH6A 2OYKA 2D1JB 2OK0H 4XXCC 3KYMB 3EOTH 4KFMA 4MA3A 5CJ8A 2CO7A 4EUPH 4E9VA 2EH8L 3QDHA 3RVTD 2ZKHH 3N42F 1NKRA 2Y2YA 5I8KH 2ICWI 3V0EA 1S4IA 2VDLB 3JV6A 4HUCA 3VXMA 2A9ML 5CCGE 1C9SA 2OXHB 1WIOA 1E43A 1LO0H 3GSVB 4PIRF 4PD4J 4CN1A 1XDTR 4EN2A 3WOVA 3DV6B 4YDMA 4X2UA 5I0XA 3NIGF 4K71C 2WBWB 3L9RA 5AKTA 1RP9A 3FT1A 2JJUA 3B83A 3QISA 4XX1G 5B1JC 3RY6C 4XNQB 5IB1B 4OF5A 4ZUUA 4JZNB 5HDLA 5T8IA 4BFNA 3SEPA 3EDKA 4X7FC 4BH7B 2W65A 3TBWA 2WXMA 5F9AC 4ZMZA 1QATA 3IDIA 3T0EE 4YXKL 1WEJH 4MYWB 4L5FE 5CN2A 4G6KH 4Y79B 3H9HA 5SWSA 2P5WA 3GZQA 4OVUA 5FM5M 4AQOA 4W9CC 4JGMA 1MLBA 4OCNC 4PJ5D 5EBMA 1CU4H 2GB2A 3HZMB 4D0EA 1XTMA 3FO0H 5LGHH 5A40E 5A2CA 1HX0A 1AVAA 2XV3A 3Q1SH 1XB6A 5CEYB 3TLRA 1NAMB 3QCUL 1A0QH 1SRDA 2BOXA 4NOBA 4XPTL 1FG2B 5JR1L 4PGBA 1P9MA 1MW2A 2M8XA 2YC1A 4WW2C 1F6AB 4I0KA 5AKVA 5IJKC 1XGYL 3JUYA 4GH7B 3IJ7A 4OF0A 2VDML 2YAQA 1X4XA 4XP4H 5CJQH 3IK2A 2QTVA 4L1DA 4M3KB 4MAZA 2BRRH 4Y71B 4QXTA 2HFFB 3TBSA 1ZPLA 3FFDB 1AXTL 5DDHB 4QRTA 2F7OA 2GVYA 3KYOB 1ITCA 1XV8A 1RUQH 2CMRH 3CU1A 5KOVC 4EDXA 1BVZA 4UOW1 1DUZB 4YSRA 3G6JE 5MP6H 2WFTA 1RULL 4LARH 4QLRA 3VUAA 4IIZA 4MCYB 3UTZA 3WHE0 1FQ9C 1L3NA 5A2FA 4G1EA 3BE1L 2OJ1A 4Z7WA 2ADFH 1H8SA 5I17B 3CVIL 2JCCE 4JN1H 3J2PA 3PWVA 1DJSA 2VZ1A 1QD0A 5I1IL 5AVZB 4WW2F 3MCKA 2CNYA 4PV1C 4HA1A 2WAQA 2UXGA 4NZDA 1B9KA 3EYFA 4G8IB 4XNMA 3NSDA 1F4XL 5IW1B 4WU7B 3CX2A 1EMTL 1DLFL 2AJXL 2X3AA 5T3ZL 4AY0A 3GSUB 2NR6A 3R4DA 4DO5A 1KCUL 2AFNA 4XCFH 1T0NA 2Y5QA 3IFOB 1J48A 1IVTA 3TT1H 3DUSB 5A3IC 1AE6L 4FCAA 2ROYA 3FTYA 4ODWA 4K3EL 3HG1A 3LN4B 1P5VB 1JJUA 3MV8B 4JFZL 5LBSL 4X6EA 2Q86B 4BSWB 4WEBH 3GEFA 2FX8H 1A3LL 2ATAA 1EXUA 2HG5A 4M8UA 4QYAA 4ZXXL 2AAVA 2KQNA 4A66A 2RAMA 4OB5H 4OIAA 5C0BE 3RY4A 4AWJC 2PCFB 2CKBL 3FS9A 2XI9A 2XZZA 5T1KA 3NDYE 5ICYB 5BUPA 5JNYB 4PGEB 2UWEF 3FMGL 3KWWA 5FA4A 4PVMA 4WI3A 4JGNA 4Z18A 5E4IA 2X05A 4XTRD 4MJ2A 3BH4A 4FFVD 5LAXA 3JWOC 3SDDB 3U46A 4H1LB 4B9FA 1AI1L 2MGPA 4OKVA 1CICD 1WIUA 3NJMA 4PJEF 4FMKA 4ZPTB 1BXXA 2XG5B 2IQ9L 3QNZA 1ACCA 4GRWB 1U21A 3RRQA 3W0WA 5JW3L 1OD7A 3LKQA 4WUUB 4X6DB 1T0MB 4YEFA 2ZUWA 2V2XA 4BXVA 2HFEB 1OGAA 1EEUA 4R5XA 3Q6FB 2VR6A 5FA3B 3UEZA 4YHKL 1CGXA 1T20A 3KJ4B 3F6LA 1KFAL 3HZVB 4A68A 4BGLA 4QMEA 3LDBB 4M03A 5KSVA 1KJ3H 1ORSA 5IKCB 4EZMA 3V0IA 5DRZA 3RYMA 1RURH 4OUOA 5EOCH 2ZIDA 4XNUH 2A73B 1M53A 5EU6A 4PJ5E 2WLIA 3MX0A 5K9QI 2DDUA 4P4RA 1DQLH 4XC3H 1M6OB 3VFMB 2DM2A 3QXWA 1S7VA 5I16B 5CILH 3OJVC 1Z6EL 3PGCA 4DOHB 1C12A 3BWUC 3ELQA 3NRQA 5BZWA 3LN0A 3IU4H 5C0JA 2J6WA 1LMJA 1IC5H 4Y4FD 1PU0A 2EDYA 2F7RA 4YHYB 2AQ3A 2FL5B 5FYKD 3PGDB 4FTDA 3VFSB 1ZSHA 2X41A 3GD1C 3HUJE 1E6JL 4OZHF 5K33A 4Z7NB 1T7WA 4MS8C 2B5IB 5LGHL 5FW8A 3DX7B 3KPNB 3X11A 2A83B 3KQCL 1VPOL 1IV8A 1PS3A 2W9DL 3STZB 3RWHB 4N68A 1UD6A 3IFLL 3HHSB 1OB0A 2IIJA 1BP3B 3C8HA 1UATA 4PJIA 1RZGA 4F91B 1ZS8A 4JJ5A 5H2BB 1TJGL 4N25A 4PWIA 3LZFL 3MLUL 5I8EA 1URZA 2ZOTA 2EIEA 5G2NA 4YPGA 2CLVB 1XCTB 2DEYX 4MXVE 3WENA 3EDFA 3S8WA 5JVZA 2F54B 4M7KL 3G3LA 4TVSa 3U0PA 1OF2A 3MRRB 3DARA 1I3VA 3M7FB 1JVKA 1Z5LA 1NKOA 3IJYB 5KZCB 2B1OA 3JT0A 2PETA 1NANI 3LIWB 4GRLD 4ODTL 5HVHC 5EZJA 5DYOA 2MOQA 3ISYA 3D3VE 2EH7L 1OTUD 3QUXC 2QVMA 1FO0H 5I5IA 4YHMH 3RZCD 2WPKE 1D5MB 5KOMC 3BT2A 1KWGA 2QSCH 3HMXH 2JIXB 2I25N 5H4YA 5HI5D 1E65A 4B3VA 3FU0A 1PCXA 4ZTOH 3HLKA 2XKNA 1FH5H 2WLJA 2NSQA 3MRNB 5DJXB 1DQQA 1WBXA 2R51A 4FFZA 1NPJA 4FQHA 3H1ZA 2X4QB 1OM9A 4Y16B 5FB8A 5KAQG 3VXPB 4UT6A 4CN4A 1AOZA 4HKBA 3PHQA 3P02A 1JZ6A 1I8MA 1XBRA 4J3OH 1A25A 1RSYA 3BUQA 4LLVB 3NCFB 1P7KA 2Z8WC 3BSHA 1HT6A 5HYIA 4JQIA 1IC7L 2MCPL 4Q9CA 4MRCA 4WHTA 1LE9B 3WS3B 1R5IA 2VR9A 2XQYG 2XTJD 3FQNA 4RAVA 2VDNL 4PREB 3RLSA 4JKPL 1LQSR 1V8HA 4KJQD 5ESQA 3RNKB 3ZHLA 2A3TA 2MPAH 5SV4A 3KLSA 1GPOH 4HC1H 1JK8B 3NIFF 4OUUA 1YYCA 3NK3A 3MBXH 1QSEE 3OAUL 1VACB 5FKPA 1F86A 1T1ZB 3TO2A 4KGLA 5E8DH 1A4JA 3VNYA 1X5HA 3A6BH 3D50A 3QDJE 5AVYB 2YUXA 2LLLA 1MFBL 2AJVH 3BMVA 3GSQB 1Q4GA 3G6DH 1OHZA 2EICA 4F58H 2VJ8A 2DYPA 3O0RL 3RVUD 1I7TB 2JF1A 3PWPA 4PJ5A 2WIMA 1KSNB 2FT8A 2C9UA 4LASL 1MCPL 2LGNA 2A74C 4L8SC 3VM7A 5IKRA 3BUYA 4GO9A 5J1AA 1NFKA 1TXKA 4OCMC 1K4DB 5CGTA 1V7NH 1RVFL 2DDQH 1RHHB 3L9YA 3Q3KB 4I2XA 2DQIH 4JRXB 5C0AA 3VXQB 3KQDL 4J3SA 5CJ5A 3R8BB 5I18H 3FU9A 3O4LB 4IBWA 4RUTA 2ZX7A 5EUOB 3O3DB 1XVSA 2E46A 4YWGH 3DNKA 3EBHA 4LPCA 8FABB 4YDJA 3B7YA 4PRDB 4Z5RA 2YR3A 3TVMA 4PS7A 2I24N 1MNUL 1BEYL 1RSFA 2V7NA 4PJ9B 4KHXL 4U1GC 4OY9A 4HWEH 5GQBA 3VQ1C 1LDSA 5IUSA 2QVTA 3K72A 1PX8A 2PTTB 1FYTD 2CIKB 4MBRA 3UZEC 4AJVA 1FGVL 2DKUA 2M83A 4M48H 3I9AA 1JGEB 5IB4A 2OQJB 5T1DL 3MU3A 2WBJD 2WSKA 1PNDA 4BDVB 2BC4A 3E2HC 2LFGA 4GFXA 1QPPA 5JO5A 2V3FA 5HYFA 4TUJA 3NCBB 3ROLB 3VFWA 2FNBA 4QKXB 5DZOA 1LWHA 3QQXA 2FJSA 4FQQB 4DH2A 2XSKA 3S8GB 1FLRH 4WNQB 4KVCL 1EHNA 5D6CA 4ZAKC 5KYYB 3S88L 4H0HB 3FU6A 1OE1A 3SJVE 3V4PB 1E4WL 2WQSA 3FN0L 4LDEB 2XQ0A 1AXSA 3JTSB 1JPSH 5KUMA 3M07A 1VKXB 2CIIB 2XQYK 3BXNA 4ODBD 2ZUQC 2X2UA 4G8AC 1U2HA 1ZLUH 3WKQA 3B2DC 4AQ1A 3GZPA 3MRKA 5J9PA 4IGBD 4JDVB 1MFAL 3O11A 4DF9A 4KKAC 2YMXL 4GRLB 3HFFA 2JB5H 4JQIH 1WBYA 2L0DA 4HJIA 3F5WA 5F1IB 1KBBA 3S36H 4PYGA 5T1KD 1ZLVH 4D9QE 5BRZA 4YXHH 1B4JL 3PNWA 1Q8MA 3V9CA 4Y2DD 3EOTL 1RZIA 3NP4A 4C4UA 2NTFA 1QO3A 3US1A 1BYPA 1S7TB 2JH2A 1U9KA 4S1RH 3BOVA 3B56A 4XN2A 3VD2A 3RX5A 2WXNA 2WUCL 1KBGH 3BT2H 1VESA 3PAYA 1LO2H 3KYMA 4U1NA 2Y5EA 4LHQB 2C1PA 1LEIB 1ZGLB 3PGHA 5EWIL 1A6WL 4AMWA 2Y2TA 3Q43A 3BH9B 4QF1A 1MFCH 4GG8B 3VXTA 3Q8BA 1BAWA 2H26A 3AXHA 3MLTB 1EVUA 3INUL 1NBZA 2YZ1A 2ORBH 2YFNA 3FQ1A 5CSZA 4LDCA 4IU3A 5G5DB 2EE9A 1JRHI 1ANUA 3HE6D 1AO7A 1KIQB 3FSVA 2FATH 2Y82B 2NY0B 3HC4L 3NEOA 3Q9QA 1UA6L 1S7SA 1IAIM 1OOWA 1YO4A 4HCIA 4UM9B 4PJBA 5JPMA 1WK0A 4Z9KB 4BH7A 1QLFA 4NDMA 4MZIA 3FTGB 1T89A 4Z7NF 4MXVF 2IAMD 4IEFA 3CV5A 5IIEB 3QC5X 3STBA 4ZMXA 2NW3B 4K8RC 3SKOA 4IKKA 3BEWA 1MI5E 3JWNG 3ZTNH 4M4RA 1KLFB 4HUWA 4NUMA 1KPVB 4UT7L 4YS4A 2D0FA 2GEQA 1G7JA 3GMMB 3C6SB 4S1DD 3TZVB 4AW7A 1B4RA 2DWEA 1NFDA 2DRUA 5EBGA 1QZNA 1SXAA 1MEXL 2X4RB 4WEMB 4PAZA 1T22B 5D7LE 1DBJH 1OT2A 4D3CL 5DZVA 1U8PA 2BFGA 1S7UB 3L6FB 4M6ML 1JNJA 4RAUA 3FSWA 3QI9A 4AZUA 1D5BA 4JN2A 1X5YA 3WMPA 5DDHA 2AP2A 4RMQA 3GJFH 5C0EB 4JRYE 4XP9L 2BSSB 5E1HB 2ICWB 4R9HA 3TOPA 2OBGA 1N0LB 1F45A 1S5HA 3Q5YA 4JFSA 5HVGB 5ILTH 1KXTB 3V65B 1BOGB 2G5RA 3L3KB 1WWBX 3N41B 3SPCA 2ZSWA 5MP6L 1A6UL 1R17A 4A04A 3NCJL 1IJNA 1K6QH 4F9PA 1OHQA 4J1UB 3S3CB 4E9WA 2G2RB 5E5UB 2I07B 4ZS7L 1LK2A 1RMFH 3ZMRA 1S9WB 2XTJE 4LLYB 3MDJA 4OZFG 4PJ8C 4W9JC 3WCYA 4G8IA 4F37F 3N8YA 3AVEA 2XXCB 1TJHL 4N2OA 3MYJB 4XO8A 3D0VB 4ZSOA 1YYMH 5HI4D 1DSFH 3DXAE 3ZHNA 4UNVA 1Z66A 3VSUA 2HMIC 3EF4A 4K71B 3UAJC 2Q2EB 1J8HB 3FQRA 4LRIC 3FUDA 3FQWB 4NBYB 4A7UA 2BVPA 5EORH 3AM8C 1JD9A 2HB0A 4NO5A 1FV1A 2D3VA 4K8RL 2ICEA 2OMXB 1D2OA 3RWJB 3LKRA 1ZWIB 4PGCB 5FYLH 5IK3A 4HULB 3LNEA 1KGYE 1MELA 2WQXA 4UDUA 5D1ZB 3KLAB 5F7LB 4LFHD 3VWKA 5HVFB 4WW1A 4UU9B 3ECBB 4QIRA 4OCXH 2PCFA 5EO1B 4O58L 3F05A 1UCBL 3GXMA 4PJ9D 4DVBB 1MHCA 1WBZA 3FAXA 4J3WA 4Z7AA 3P73B 1E4KC 1KXHA 3S37X 5LGYA 4CC1A 2QQQA 4ZAKA 5DI8B 3L3HA 1FL3B 3FCGA 3N1GC 4U3SA 5CISA 2WTOA 4BZ2A 1CICC 1EEQA 2R1YB 1UHVA 2DIJA 3BX7C 3EO0B 3OLEA 2FSDA 1MFCL 3QO0B 3QPXL 3QXUA 2QLVB 3BWUF 3SCMC 1OT4A 3QUYC 6PCYA 3RX7A 3VWJC 3BQUD 1U30A 1E28A 3PJNA 3Q6FA 3VACA 2XWTB 2EXTA 3I6SA 3MNZB 4A2DA 3N55A 5FYKL 2O6EA 3AY2A 2ITFA 3LPPA 1M7IB 1M56B 3CVHL 3NH7L 4NZUH 4DN3L 2XU9A 1JHKL 1L9OA 1CT8B 1F18A 3KLHC 3QEHB 3DO4A 1CCVA 1NGXB 2R2EB 3AJ7A 3MV7B 3KWVA 1BM7A 1H6UA 1YDPB 5DJ6B 3F6UL 3FCSB 4JO1H 3ZYJA 4IMKA 4DSYA 2DQHL 2EEDA 1MCWM 1HEZB 2CZNA 3Q9PA 5KEZA 4ZTEA 3WTYA 1MLBB 1AKJA 1EO7A 1JZFA 4PTUA 3BKCH 1UD8A 1I9IL 2APTA 3N1QC 1FN4A 2ID5A 1E8YA 2ZPKL 4X8TL 4O2FA 1AZNA 1FG2A 4N8CH 4MSWA 2H2SC 3VFSA 3DKHA 2DKMA 4G43B 5KSBA 1H9DA 1TVBB 1F6AA 2COQA 1SBSH 4ZMQA 2YSTA 3EKCA 3SQOH 1E42A 2XA8H 2CD0A 5JLZB 1HHKB 2X1PA 2XTJB 1UKQA 1KCLA 1NEZB 1AD0A 2P8LB 2VSCA 4DP7X 4LOFA 4XXDA 3WDHA 2CPUA 4YHNB 2FH8A 1CTMA 5E5LA 3FOLB 1IKFL 1NIBA 5SWZD 1AAJA 5JQIB 4KDWA 1UJ3A 1DUZA 2VDKL 3DVGA 3VI3A 4L3EB 1Q94B 1B0WA 1CUOA 2F5AH 2IF7A 4QRUB 2EUXA 1X5FA 3NZHH 3QEGL 5D72H 1DVXA 3OR6B 1B88A 3F7VB 4HEPG 5FGBA 5I17A 4J2XA 3IJYA 1WISA 3UPAA 3BWAB 3IAQA 4AL8C 3LVTA 4FZEL 2P8MB 1MSPA 4HCFA 2WG4B 2BWDA 4DEWA 4N3TA 3TH3L 3ZDYF 4IGBA 1AZRA 4X5QA 4IRZH 1HJ7A 2DJUA 4M56A 1U8KB 4NNPH 1DJGA 3HR6A 2F53A 5IWLC 3I3DA 3EOYG 5E56A 1V10A 5ANME 3AMLA 4WRLA 2ICES 2W26B 1UASA 4YFDB 3VI3E 1RVFH 5DO2C 2H8PB 4TV3A 2NY7L 1XQ4A 4YGAB 2IBZY 1XZ0A 3AABA 4ZQKA 3ZL2A 2C4XA 4PRNB 5DHVH 4NSKA 2PCYA 3HG0A 3US9A 1UADC 5KTEH 3QG6A 3UTPD 3VFNA 3NJNA 4QHMB 4KTYA 1QA9B 1YEJH 2AQRA 4RRZA 4HUXB 3QUZC 1VFBA 1X9RA 4X6CF 5EZPA 4OT1L 4I4WA 5GZOC 1E27B 5F3BB 4BUQA 1X7QA 2A9DA 3I9PA 3QA3B 1AGEA 1FNSH 1XFEA 1JDAA 2ZWYA 3HMWL 2UXVA 4OM1H 3VCLB 3ZDZB 4IOIA 3Q2WA 1Q9LB 3W9DB 1LK3H 4K2UL 2O5NA 2VABB 1NC2D 2AQ2A 3GK8L 4JO3H 4OD3L 2WIIB 3BWSA 4WHYH 1IQNL 2BNUA 2F54D 2AJYL 2H5UA 4LPXA 4UMSA 4UQEA 5I1LB 1JZJA 1S7RA 5EZLB 1PL3A 2IBGA 2HKHH 3EJZD 4AUYA 2R1XB 1AIFB 3KJ4C 5CD5D 4DPAX 1MCJA 1UXMA 1OGAB 4J6IA 3WTWA 5L4IA 2FEEI 2OL3B 1SJMA 3G5YA 1O6TA 5HD8D 4D9RD 4NRZA 1XH1A 4HPHA 5B38A 2DBLH 32C2B 3P2BA 1EAJA 1AS6A 4LVEA 2CO7B 1CF1A 2XYBA 4R2GD 3FT0A 5CFHA 3LQAC 3K0YA 1I1YB 2X40A 4UBDC 1LPKA 2H4EA 1QHQA 5C8JB 1WICA 4UT9A 1D5IL 1GYAA 3NH7H 5DEFA 3PQYB 1R3HB 3C75A 5L0QC 4TUOA 3ZGHA 5HYQB 3Q06A 2AJSL 2H6PA 2XX1A 3V4PH 4BZ1H 3T8XA 4ZJ9A 1CIUA 4UMGA 1AQMA 4X4ZA 4EI5D 4CDGC 4G8GD 4PB0H 1INQB 1UEMA 2NRDA 3AMKA 3QQDB 4FF9A 4C58B 1J8KA 5J8OA 2XKSA 4CC0A 3DETD 1ET8A 1AZZC 3MVSA 3ZTDC 1AR1C 2VJ0A 4P49A 4MXQD 5L2JA 2PCPA 4M1GL 4MNGB 2C9XA 2NY6D 4JFFD 4M93C 2LQRA 3FONB 1N6UA 3OXRB 4M7ZC 5SWSB 1U58A 3T0EA 1EXGA 1FC2D 3KR3H 1KCRH 4HMCA 4OLXH 2QJDA 4FQQA 4MA7H 1LO3H 2HLFC 1E8ZA 1HYRC 2KS0A 3VXOB 1B0GB 5ELIA 3UBFA 1DEEA 4F2FA 1Q38A 4P3DB 3CZFA 3CUPB 1RK0B 2H0EA 4GW5B 2X4UB 3IXAB 1EZQB 4L48A 3MOAH 3B3BA 2P3YA 3N0PB 3S0PA 2OYMA 1SJEB 3FXIC 1P6AB 2P80D 2CIIA 2AXGB 2CLZA 4LBEB 5IT2H 4Z3IA 2Z8VC 2Q10A 2FLRT 4OF8A 4X8XA 1Z9OA 3HC3H 5D7SH 3LIUA 2WQRA 2BIQA 4LSQL 4ABUA 4U6VH 4BFKA 5LB1A 4UQBA 1WBYB 3PQYD 4H0LC 3MBEB 5HY9A 4N9OB 1BW8A 2FIKA 3MA7B 1EAOA 4L0ZA 2IANE 4KFZC 3PNWB 4P46D 4XC1L 2F53D 3QXDB 4Q6IB 3ZGIA 2X88A 2JKIS 3UPRA 2ZSVA 3CFDA 3HR5B 2FX9L 5TE4L 4BELD 2F1BA 3RU8L 4MYPA 5FB8B 3K6NA 5DGQA 5F3HB 4AYID 4YXLH 4U1JB 2EIMB 3ARGC 3BDBA 1JTPA 3PHQB 4NQVA 4TNFA 4XNMB 3PFUA 3GJEA 1A6TB 3B7TA 1BREA 5FV1L 4HIXH 5FECB 3RTQB 1M1XB 4O9HH 4QF1B 3GSUA 4MMYB 2ZQKA 1WWWX 2X44D 3TA3D 1HAFA 4Q52A 4GSDL 3VDCA 3HS0A 4TPRH 1RHFA 2P48B 3AXLA 2RACA 1RZ8A 3RUGB 4UIKH 3T1FB 2XWJB 1KZQA 2X70A 2YIHA 3C87A 3CC1A 3DJRA 3GWJA 3ARGB 3II2A 4A2EA 4JZJB 4L23A 1QLEB 4N0FB 4RFEA 2PO6B 3DLQR 4W9ZA 2FB4L 4UM9A 2N1KA 5LN8A 1J0IA 5D2NC 1AP2B 1E4HA 2E7LC 2ED9A 1MQKH 1PG7H 4RA0C 1ILUA 1T1YA 5T33L 5ECGA 3L16A 1DDTA 1NFXB 3ULUC 1QBAA 3VXUB 2YGVA 3STLB 1RZQA 5DLMH 4ONFH 3B9EA 5KAQF 1OAZH 4FEIA 1FZJA 1NCDL 3L2LA 3C09C 4QKTA 3T2OA 3P9LA 4FNSA 4M5YH 1JZIA 2Y1ZA 1CLZL 1MAJA 4CU7A 3N5AA 4F80A 4J4PC 4ALAC 2XY1A 4MNGE 1BQ5A 2C7FA 4YAQA 3QO1A 4LVNB 4EIGB 3W39A 5K59F 5BQ7A 5FGCB 1HTYA 1VADB 1KB5L 3PP3H 1EJOL 4WO4B 1QABA 3W38A 5IVXF 3GKWH 4RMSA 4K3GA 5C07A 4HAFA 4LDOB 2DWDA 1HRFA 2AK1H 5DHVB 5KVGH 4XP1L 2LT9A 5EF2A 2XN9B 1MXDA 1CICA 4LQFL 4B27A 1B9WA 3DOHA 2X4OB 2HVJA 1MQ8A 2KDGA 4Z7NE 1T04A 3PGFH 1UXWA 2WZ5A 1TZGH 4MWFA 1RJZA 2DM3A 5E9DD 5ADOL 1SHWA 1S9WA 1CE1H 2XV6B 4NRXB 3SO3C 3TO4D 5MEQB 3U2SB 1KJMB 3TESA 3O4LD 3AACA 2ZOKB 1KJ2H 4CJ1A 1Y1DA 3BZEA 2FEDD 2X4NB 4I3SH 4ERSH 5DJYA 3WEAA 3QR1A 2RMNA 1RUML 2YMXH 2HMID 3MRCB 4O02H 1GMIA 4K7PH 4N8PA 4RISL 3FB6B 3BZFB 4HIHA 3OPZH 1P2CB 2NX5B 3INOA 5LN4A 1MPAL 1AKJD 1NQBA 2NY0C 4JRXD 1HH9B 1A9EB 4M7LH 2AJUL 4AQ1B 3GSOB 1GS6X 2QPFA 1ZWIA 1TTFA 1XAUA 3B5TA 4D7PA 5I73B 2PW2B 4P3CH 1XCXA 3ECBA 4KK8D 4P99A 3MKKA 3S3PA 1FJ1A 5IVZA 4OTXH 4JG1H 1G9NH 1P6FA 5I5JA 2YD1A 1E2VA 1FNAA 5I6PA 3CE1A 2OR9H 4G9FE 4KQ3L 3U0WL 3IWVA 3RUGE 1B3IA 2CALA 4QO1B 4MJIE 4PJEB 5FO7B 3BRFA 4O2EB 1AZBA 2ZG1A 1KC5H 2CBQA 3TBCA 3QEQA 4ZO6A 1NC2A 4Y5YA 1CLYH 4HJ0C 5KVFL 1NBVH 1ZV2A 4KKCC 5DRWB 3TP4A 3WXVL 2GUYA 4R97B 4XP5L 1IUZA 3FW6A 5AG9A 5EBWA 2W88A 3BP7A 4ERSL 3KG5A 3GMOB 3U48A 2ZZUT 1KDIA 1QLEL 4UNUA 2H26B 3MLTA 1QFWH 1S2EA 3CFBA 1CCZA 2L4OA 1BVLA 2VLJD 1UT2A 4AGLA 2EEBA 2FCBA 2NY5H 5EOQL 4FLQA 1QWUA 2YAEA 3ARFB 2FB4H 2OMZA 1N18A 1T5WA 3QP3A 2HX8A 2W91A 5DMKA 4D2NA 4UIKL 2G00L 4JDEB 1YA5A 3ULVE 1EPHA 3EOAA 3PL6D 2WLKA 1AYRA 5DC4B 5DJ6A 3QZWB 3HE7A 5F7UA 1U8QB 4KKRA 3QK0A 4PREA 5BUAA 4R8WL 1A9BA 2DQEH 1PF3A 2QGEA 5E95B 4AYBA 1J0KA 1RU9L 1KB5H 3GI9L 4PSPA 5LXGL 1IJQA 3TO2B 2ESVB 4LDLB 3B5HA 1IFGA 3I75B 3NTCL 5IFHH 3TCLA 4KZCA 4K7PX 3LZNA 4OIFA 5KVEH 1Y0LB 5GZND 1AD9B 4G6JL 1Y18A 1V55B 4ODUB 4I8DA 2R69A 1N19A 4UTBA 3E6FB 3MV9A 3LZLA 4DKEL 4ZZFA 4BCXA 4EE2A 2FT7A 1PX4A 5F9OH 1E6OL 5SWZA 1QI3A 5A2BA 1L9MA 4D8PA 2FLMA 1CD8A 4DZBB 3MUGA 5EDSA 3WY4A 3Q8CA 4HT1L 4DHLA 3LQAL 3QUYD 4G6JH 2WYHA 4GMTH 1L9QA 4L3FA 2VLME 2R0ZL 1YYLL 3I6GB 4N86A 5GRYA 3F7KA 5C07D 2DQ6A 3RNQB 3TN0D 3VFOA 2R9HD 5MENE 4H8HA 2YOAA 1NAKH 1FRGL 5G55A 3T2NL 2PP7A 3BAYA 5TH2B 3K4DA 4G80B 2HKHL 2ZD0A 3NSFA 4JKKA 4NEHB 5F6HJ 4OM0H 4WI8A 1QI5A 3JTBA 2BW4A 3ML9A 4JDZB 3TX4A 1NAMH 1LK3L 1SOKA 1SEBA 2YWZA 3EJTA 3TWCL 1NINA 4OQTA 1HWGB 2HTKC 2IALA 4XNAA 4QRQB 3SN6N 1I75A 1J05A 4H5SA 1AJ7H 3SOTA 5DLML 3FO9A 3TO4A 5BV7L 4H8UA 4NKIH 2PR4L 5SX4I 4Y19B 3BT2L 1ZOXA 5JZ7C 2FSEB 1MCRA 2UWLB 4YGVB 2EDJA 1ZHNA 2EE3A 2C8NA 2Y23A 5IVNA 2VXQL 2D73A 2NQDA 2KL6A 3SY0A 5JYLA 2J8UB 1WUZA 3FNKA 3KPRE 3BAEL 1DSFL 2L7QA 3UADA 3VDBA 2NX5D 3UEQA 3LSOA 1VEMA 4W9DC 3D0AA 4NO3A 2DYRB 3IS0X 3Q2LA 5C0DA 1ZGLM 4HISA 4NFDA 5T3XH 4DTGL 1BQRA 1NC4B 1MFDH 2P28B 3SE4A 1LD9A 1U3HA 3EYQD 3KPLA 3RE0A 2X28A 5EC2B 1KYAA 5I1JH 1PG7X 1FBIH 4XMUA 1I1AB 3KNBB 2NXZB 3PDGA 1R46A 5T1LD 3VCLA 3CLEL 3H9SE 5TDNB 2B1HH 5I1CL 3VI4F 2LHAA 5DI8A 1HL5A 2I69A 1AGBA 4TTDD 4WWID 2W8CA 3ILPA 1FF5A 4AG4L 4CSPA 4D0DA 3QCVL 43CAB 4EI6B 4AIZB 3NZ8B 1OF0A 1YC8A 2HJLB 3H0TB 4ZMYA 3EJSA 3OSKA 1N2RB 1FBIL 1I8KB 3IITB 4FG6D 15C8H 2E6PA 3EBGA 2A0LC 1F58H 3HHRB 3O6FC 1ZT1B 3S5LG 5KSAB 1FE8H 1SDDB 2XTSA 5HBBA 1D9KC 2VDKB 1HT5A 3LXBA 5D93B 2JV6A 4BSVB 3MV11 4XNUL 3HZMA 2ATPB 4HIPA 2PYFB 1A7RL 3BUTA 4QJ4B 2E74C 4PY7B 1LTXA 3EYOB 2WD0A 4H44C 4HHGA 2F68X 4HWEL 3GTTA 1JHLH 5AZUA 1YNTB 4HPYH 4BHUA 2OMTB 3OXSB 3WN5A 5CWSB 4MQ7A 4BUHA 1MOEA 2XWBA 3AWFA 3KW8A 4GRWE 4GS7B 2QKSA 3BZDA 3ZTJG 5TF0A 1ZA6A 2HZHA 1JN6B 3CDYA 4PTUB 4C4KO 2DBJA 5F89A 3CSTA 4HLEA 3KPQB 4XO5A 3RIFK 4ZZKA 3T04D 4G1MB 4YL4A 1JMXA 3OWEA 5CUSL 4KJQC 3N8XA 4MSWB 4Z7UA 4PJCB 1QKZL 3O6KH 4X4YB 4J12A 4FP8L 4KI1A 2MKLC 4G83A 2ZX8A 1LL1A 3CDGA 1S9YB 4AEIH 4A2LA 3MJ8A 4CU6A 3SKOB 2KHAA 5HPMB 3OX8A 3UPCA 1CG9A 4DK5A 4YO0B 5ACZA 1T2JA 3MQIA 4UIMA 3MCKB 5IJVA 2NY2C 1QKZH 3O6KL 4IMKC 5DVKA 3U2IA 2WPIE 2XXMB 2UWOB 4GSUA 4TULL 2VXVL 1A3LH 3UZQB 1ND0B 2AV1A 3H6AA 4NQCD 2QT6A 1BPLB 2BZ7A 1YNKH 2KV4A 2NY5L 4QRSA 1JWSB 4OV6F 1APOA 3ENEA 4XBEH 4NC1E 3JVGA 1BCIA 1PLBA 5HYEA 4YR6B 2YD0A 3P30L 3O41A 2EZ0C 5DF0A 4M10A 3D4CA 2IOOA 3MV9E 4R4NC 1MHEB 4L4VB 4MDJB 1MFUA 3OKDB 3KPTA 3CWGA 2WPGA 3EHBB 2I27N 1E90A 3OJ2C 3QFJB 4AM0A 2UV3A 4FFVC 4G9FA 2PP9A 3SJVD 1UKTA 5CLTA 1IEHA 4MCYA 4FNQA 1TVHB 4AENB 1JVLA 3VD9A 3V95A 3PAUA 2IDFA 1JPTH 5CN3A 3H9SA 4KROD 3TVMD 1KJVB 1FL6A 3D06A 2Q87A 1WAAE 2WP3T 4AH2B 3QDGE 1ET5A 1XSJA 4KQ3H 2YD4A 4LNVA 1G9NL 1HH6A 3QG6B 3BGMB 2WLZA 3VMNA 3NFNA 4L2LA 4MJ5B 4U6YB 5A2IH 4P23C 5DWPA 1EVTC 2B2XL 2MIZA 5DS8A 2ODIA 3LJ3A 1FSKC 4OV5B 2Y5HL 4KKNA 3PP3K 3VU1A 3CENL 2P26A 3IMVA 4XBGB 4PWFA 2Q7AA 3SBWC 4FZ8H 4HXAL 5CBAA 4PLKD 1PFCA 1EBVA 4K23L 4QRBA 4BQCA 1A3QA 4V1DB 3UG3A 2F18A 3TEZA 4HHWA 4ZUWB 3LKRB 5I75C 1OAKH 4CKQA 2W0KA 4I3SL 2I32A 3UZEA 3NDZE 4X9BA 2NNAB 2WYZA 2WWMD 3TYGL 2K6WA 1D9KD 2C34A 4JFHD 4F7TB 2VDQH 5EA0H 3FB5B 4QNPE 1J5OL 2H2SD 1ZLDA 1SPDA 4HSAC 3O4LE 1PIFA 2LR4A 3ZO9A 2XC0L 1B4TA 4LFHG 2ADIA 3CH8A 2E47A 3U4EB 3S2CA 5E8PB 2OW6A 1LNUA 1U8CA 1HJBC 2VZTA 3GRWA 1G6RB 4G6KL 1EBAA 4U1SB 3ARUA 1GC1L 4Q6KA 3L4UA 2VLRB 3O81A 3D39D 4ECNA 4WW2B 1EHXA 1I31A 2BP8A 3ARED 2Y36L 3SPVA 1WP6A 4FJYA 4M8QA 5FW7A 4K5NA 1NMBL 3ABLB 3U1SL 1IC5L 1NA8A 2MNJB 2HP4A 4FL4B 4H88L 1OP5H 4WAFA 2BOUA 3GMRA 4XE5B 1RCYA 5FAAA 3SGKA 5SWZE 4DO6A 3F62A 4CL7A 1PLGH 3BSGA 2JJSC 1I9EA 1LHZA 5E94A 4OFIA 4DZ8B 5EIVA 2Z93A 4A7TA 1HILB 3TPUA 1H8OA 4F9LA 2JCWA 5K69A 4AQAB 3PGFL 3HZKB 3LV3B 2X6BA 1PD6A 2DEWX 5DEJA 4F9LC 4AM0Q 2J7LA 1AGDA 2J4WL 2K0RA 3OMNB 4FFTA 4RQQA 5HYJD 3SQOL 2VL5A 1Y6MR 3UTZB 4H1LH 4X99B 4HKJA 2WPJE 5DCCA 4P06A 2BW5A 3T0EB 4R5TA 1ZS2A 3AZUA 2HTLC 3F7YB 5DMGC 1QNZL 2VLLB 1DR9A 1B0GA 4OGZA 1S7XB 1IGYA 4GS7C 3LY6A 3ARRA 5L7XL 4P2QB 3CUPA 3GS4A 4NQCE 3TGXA 2PPFA 4KNSA 3U83A 5BRPA 4DK3A 5BV7B 4ELMA 3U1SH 1MLCA 4L4TE 1BXUA 3R8QA 3NABL 1DTUA 3BPLC 5TQ2L 2XBTA 4R2GB 1P4IH 2EDKA 2Z4TA 1FL5A 1QHOA 3VMPA 4MJ6B 3INUH 1CLZH 2OX5A 3HMXL 4FDWA 1DDHB 1CFNA 3NYKA 5D4JA 1G9ML 1C5CH 2P5WD 3MRLA 1NANH 2VWNL 3ABKB 3HOGA 4GAYA 1QUPA 4J23A 4JS7A 4UQ2A 3FTSA 1YJDH 1I8MB 3E8UL 1ID2A 2JB6B 5BV7C 4WTZA 4D0BB 1KMGA 3OMIB 3W11D 1UQSB 3AGWA 4WWNA 2EC9U 3FB7A 4RRYA 1L3WA 4NZRH 2YAMA 2XCMC 1AACA 3OR6A 4JO3L 3F7VA 1ZE3C 4OD3H 4J39A 3QEQE 3OKOA 4X5XA 1R5WA 1QW8A 1UXSA 3GXTA 3QXAB 4QTHA 3VDAA 2H0PA 5L30L 1IAMA 3T4AB 2P7TA 3BQVA 2BSDA 5I8CA 4BTTA 4UI2A 4XB3A 4H1LG 5D1QC 1U8KA 3HC0B 4WI7A 4GBXA 3C2AL 3NN8B 4CC4A 3FT3B 2AK4E 4XH2A 2YGNA 4FHJA 3T0WA 3UG5A 2BWQA 5F7DA 3C6LC 4H26A 3F65A 3CFBB 1UGKA 3CC5B 3TO4C 1ASPA 3BP5B 3UYRL 4JRYD 5KSBF 3MLSH 3RUGA 1EANA 4JAMB 1ZSDB 2PWDA 3HCVA 4TUUA 2BFVL 4Y4FA 4Y16A 1J1XL 4N8UA 3KPRD 4ISIL 4KVCH 3LRGA 4FNLL 3KGSA 3SW2A 2GSIA 4OZFB 3AU1B 3DMMB 3VGHA 5IHLB 3CVHA 1MNNA 1H9VA 4CMMB 1TQTA 3HZVA 1U8HA 4KO6A 4XVJH 4PJCF 2ZKYA 2KLRA 3MV8E 1MH5A 5DVPA 2F74A 3TASA 1CXEA 4NAQA 1MPAH 4LCWB 4ES9A 3VRIA 2NCMA 3O8XB 2VTFA 4APQD 1WE5A 5DRZB 3UAAA 2R4RL 4RAVB 3WDIA 1U92B 3RL1B 3UAJA 5I0ZA 3MCLL 3GRWL 4IOIB 3QRFM 1BAGA 3GCWE 1KIRA 4RRWA 4LLWB 1CD1B 4Z76B 4H0IA 4XP4L 2VDPB 3DWTA 4X80L 4AGOA 1ATEA 3T2QA 3NUKA 2DQMA 3WELA 4MX7B 3WIFA 1UZQA 2WBKA 1VRSA 3IMRA 3JV4A 2QHRH 1BFOA 1BBJB 3TBBA 4ABWA 5MEND 1XF2A 1RP8A 1S7WA 3A24A 4YVNA 2ZXWB 4ZI8A 3V4PL 4BZ1L 5I1GH 4TVPL 4LQFH 5BVPL 3E1F1 5D71L 5HI4C 5DVLA 3IFNH 3O9WC 1BV8A 2B20A 1IRAY 5CEXB 1IBHA 1SGKA 1OAXL 1JOIA 4FE9A 3ZDXB 4GINA 3V9EA 1RHHA 5C0AB 4J8QA 3VWJA 5LCVL 3RNQA 1IL1B 1QSZA 4S10A 3VG9B 4MASA 3VRLE 1BQHG 3DTXB 3I9IA 5JMRA 4P46C 1TTAA 5ENWA 4EUPB 2P5ED 4OZHE 3SOVA 4ISHL 2QFPA 1KB5B 2IADA 3A4DA 2Z31C 3HI6H 4XPFL 4DO4A 2A2QT 3CVHH 1E9PA 3OG6B 4X8JB 2K7PA 5FWQA 1TIUA 3VYPA 4PV9A 4PJDF 4P9ML 3PNRB 2AQTA 3N43B 4G5ZH 3EXJA 3NSCA 3DYOA 2AZUA 4GRLA 2QHLA 5E2UH 2BOLA 4K3EH 2OPCA 1D5MA 4OZIB 3GHBL 5I15L 4B9ZA 1COBA 3SQRA 1AQ8A 2GITA 4XMPH 3GSOA 5L88H 1AGFA 3V5KA 2DN7A 2L8AA 4FQHB 3KWTA 4JFXA 4YUEL 2XKUA 3WFCL 4Z3TA 4CN6A 2V33A 3MPCA 4N2KA 5AZ2H 2O1AA 1RD6A 3P2DA 5FV2A 1OALA 1MJJA 1QFWM 3MBEC 3CXHK 5C7XH 1KOAA 3OZKA 1DANT 2MOVA 2JNZA 2ADGA 3APFA 2E6JA 3DXAB 1LE9A 4ZTOL 3U30B 4ODSL 1WV7T 2CK2A 1EH9A 1FP5A 5TDNA 5EWIH 3LIZL 3T6ZA 2NY4C 5JOFB 5ABAA 1C08B 2PPDA 4PPTA 1XMWA 3W5NA 3TFBA 2WYGB 4AE0A 4F57L 2CHDA 3F7QA 3CDFA 1IM3A 4NN6B 2K2SB 4NWTH 4ABVA 4NUGL 5DD1L 2A0LD 1MJUL 4L8DB 4R96A 3UTPE 4AQEB 4AYFA 1TNNA 4Q6IA 4HU8A 5DJ8B 4FXKA 1Q9OA 5IG7A 1OE3A 3DOIA 3HVDA 4NG9L 2B15A 3ZDYE 5SWQA 2IWFA 3QEUA 5L2KA 1TJGH 4ANXA 2F8XC 5B8CB 1WHPA 2V0AA 3CN4A 4XTRC 4YZFF 1P9MC 4NKOA 4XCEB 4Z3GA 1ZTXL 3EOAB 2AV7B 4J3UA 3HPLB 4BE6A 2VW7A 4MA8H 3MGOA 4WI0A 4X9YA 1LE5B 1T80A 3VMOA 3TJEL 1GXEA 5E4EB 3UBXB 1GOFA 2PR9A 2FR4A 2CUAA 3D6GA 1JGDA 4PHZA 3WNPA 3ROOA 3TVMB 1E30A 3OC8A 1EQGA 4N2AA 5LUMA 1INDL 4MA7L 3R0NA 5E9DE 2Y7OA 4MA8L 3QBTB 3LKOB 4HIIA 1OCCB 4M3HA 3KR3L 3RWGB 1V1HA 5I82A 3D09A 4YFLI 5EEZA 3K72B 4TTDC 1D6EB 1K5NA 3QDJB 3CDGB 4E9QA 5AYTA 1WVZA 2ZSWB 4QHPA 4MXWH 5C08E 4P2RB 3RJDA 3TNNA 3F64A 1FGVH 1G94A 1QRND 4W9KC 5C6TL 1IKFH 3K1DA 2FTAA 3R1GL 4PVNA 5EIIB 5DR5L 5FDWA 1HXMA 1IQFL 1KPVA 2R29L 3ILQD 3HE6C 2WXGA 3X1EA 1U8JA 2V2TB 4Q9QL 2IGTA 1NCIA 4AGPA 3N8YB 2YRZA 1AO7E 4GKZA 2ITCB 4Z7QF 2ZWSA 3IKCA 4UDTB 4L9DA 6CGTA 4JMNA 1RH8A 4X7SL 5JMOC 4YHPA 3VRJA 1U8PB 3KEHA 3NCMA 4DGIH 2WINB 3DJ9A 2ENQA 4MAYA 4UT7H 4XO9A 1TCRA 3VFVB 4KXZI 3RWHA 3OKDA 2NW2B 4LMQI 3RAJH 5JW4N 5ERWA 2CDGA 3BIKA 4ELKA 3TF7C 2ICWA 1PBYA 3L54A 5DHMC 4HKZB 3KLAA 4LQ1A 3V6FA 5C0IA 1KXTA 5LKNA 2Q8BL 3G04A 4IBQA 5AZ2L 1J5IA 1CICB 1F56A 1QLRB 4F58L 3L08A 5AYUH 5C86A 2I60H 3ZKND 4H0GA 4NZTH 1N67A 2DAVA 4XXCA 1MKFA 2VM9A 2W94A 3DHPA 3F12A 1KCVL 2ENPA 2MKWA 1ED3A 3VD3A 3EJZC 3T0VA 4KJPC 3MLYH 2EKSB 4RH4A 4H2AA 1KIGL 4OCRL 4U3SB 3VXSD 5A2AA 4DW2L 2XQBL 4APXA 4OFYA 3ECUA 4LP4A 1EA9C 4PJDA 4BRVA 5M95B 1TQVA 3ES6A 2G30A 4MVBD 3POYA 5C6WH 4S1RL 3GIZH 3DX9B 1PY4A 2W2NE 2YGPA 1OP4A 3MRNA 1KTKE 5FK9B 4EIZC 4FA8A 3V5DA 4JHAH 4NNXA 1DSWA 5CP7B 1FZOB 2CCLA 3MRBA 2QQNH 1UURA 3MNWA 1S9XB 2BS8A 1KPRB 1U36A 1XXFC 2OXGB 1ASQA 1F2XK 1WZAA 3ALPA 3CVIH 2CWRA 4HWUA 4WUUE 4LPUA 1ZY9A 2HYMA 2CJ3A 4JFWA 4FG4A 3LAQA 4GLRI 3NSJA 1GL4B 1U8IB 1ZMYA 1T0OA 3DETC 1ODAA 4GSQA 1PKQA 3K7UA 3CHPA 3DDGA 4G6AD 4TNVK 3M45A 3RVTC 1VZGA 4BSVA 3VFGH 1XD1A 2J3SA 3B2XA 2R59A 4I77L 4CVWA 3L48A 4ODHL 3SPVB 3ZRFC 4JPIA 4DUXA 2R1YA 3K2MC 3NJGA 4RMRA 5DHYA 1C5BH 2IPUK 4M11A 3K71B 1GAFH 2QPSA 4JHUA 2DQFA 4XN1A 4HG4J 3CFKA 2VN3A 3CPLA 1FHGA 5I1DA 2WMPA 1WA0X 4JUTA 3HE7C 2D0GA 3QJSB 1I3RA 4FX5A 1S3KL 5LLIC 4KK5D 4WEBL 1JZGA 1AHKA 5I1EH 4IRSC 4RNRB 4TNEA 2OJEA 2YQ2A 5HYJA 1VERA 5PAZA 2F7IA 3QQNA 4AEHL 2VN4A 1K6QL 5CKQA 4A38A 4PM1A 5E8NB 3QEHA 4X5RA 2EEAA 4GQZA 4KV5E 5K9JL 2HRLA 5INDA 5JHLA 3HE7B 2APVA 4OGAC 2GFBA 2R2HB 4YDZA 5DVNA 1WDAA 3P4OA 1H5BA 5DJ2A 2D9CA 4YO0A 1OB1C 2IPKB 4XVOA 1M7UA 2YK1H 5AG8A 1RZJC 4L8CB 4TQEH 4JLRB 4GAGL 1FN4B 1YECL 1YMMA 2ZX9A 1OSYA 2VMEA 5C92A 1H15B 3V6ZB 3B9DA 3IJHB 1AH1A 2CO3A 4DGVL 3VGDA 3C2AH 4B53A 1RFDH 2ARWA 2DQHH 5I66B 3C5ZD 4OZGE 1S46A 4OCWL 1RUAH 1AQDB 2R4SL 1FG9C 2EDBA 3P3RA 2FWOA 3SGEI 3NFSH 4AVJA 3NA9H 4X98A 2OL3H 2OZ4H 2BZDA 3O6LL 1T7ZA 2NOYA 3MLZH 4CC4C 1IEAB 4X5LA 2CJTA 1XZ0B 2UY6A 1B0RA 5DXWA 2WLLB 2L04A 4L9LB 4UQ2B 3SKMA 2FE0A 4P23A 4A6YH 1YNKL 3D0LB 2RBLA 3VFNB 3MLYL 3K6SA 3QJXA 3ELAT 2WUCH 4KK9C 1ZLEA 2X6VA 1URLA 3M36L 5D7JD 1Q0YL 1EJ6A 2VDMH 5CJQL 4UINL 3TT3L 2ENJA 3L8QA 5D1ZD 4ZMLA 1G1SA 4G9DB 4XL1A 1A7QL 4QEGA 4LSSL 1EDQA 2WO2B 3HUJF 5I6LA 1JFQH 1K8DA 1FZKA 3QUKB 4OFDA 2XN1A 3P3SA 1F0LA 2Y3AA 2FLRL 3GRGA 3QPXH 3RGVC 1FZMB 1J0HA 4HIQA 4MJ5A 2BVQB 1OWWA 1QUNA 4OD2A 3RWEA 5AVXB 2ZAHA 3PV6B 1CFBA 1IAIH 4PGDB 3FTUA 5BCAA 3W81A 2E27H 1JFQL 6TAAA 4OFQA 5E8EA 1K37A 1YRKA 1I1RA 2YD8A 3MGTA 2CKBA 2RCSL 4YBQD 1HYSD 4UTAA 3AU0A 3HG4A 4PS4L 1ZA3B 2B59A 1E7UA 4Y4FB 4XOCA 4AQ8A 3C8KB 1ZANL 2VXTL 3LKPB 4ISVA 2OL3A 2VE6A 1QO3B 5E99H 3ZRCC 4CSTA 3TBVA 4LKXA 4QJ5B 2GTWA 4GSXA 3G5XA 4K3HA 3L45A 7TAAA 2HPOA 4A6YL 2ITEA 2PWFA 3L13A 5IBLD 5GGRA 1J5DA 1EJ8A 1JV2B 1N12A 2YUVA 4F7TA 4RIRB 3QIUB 4DQOL 4LCWA 5AOMA 4ZHAB 4KV5F 3WNKA 2G75B 1KTBA 1DYZA 4OLWL 3EGSA 5F21B 5KYUA 4MXWL 2BNRD 1N4XL 3QIBA 3RGHA 1KEMH 3ZMEA 5FEBA 3JWOH 1NDMB 5AVQB 3I6KA 4B3EA 2H6PB 3ULSA 4Z77B 4JYVL 1EFXD 3KPOA 4M9OA 3L5WA 5D1XB 1LYQA 1CLYL 1PSKL 2RJMA 3OSVA 1IC1A 3LAFA 2X9XA 4FL4C 4MNQB 3OKLB 4Y1AD 1W2KT 3DX1A 3CS7L 1AZVA 1IVLA 3ZKMD 3ZN6A 4MCZB 4ABQA 1VLXA 3NEEA 1E9OB 5C08A 2OI9C 3LZFH 2FH6A 5F9WB 1HSBB 1IIKA 4NHCH 4S1SL 1IZKA 4UV4L 3UTSB 1FLRL 2Y3NA 3KPSD 4LPTA 4U6XA 3KLHD 3LQZB 4HIJB 3SD2A 4NJAL 4LAQH 5KJ7E 1CFVL 2AQNA 2R1WB 3KAAA 2EXYC 3NAAL 4PP2B 2QV2A 1RIUH 1MCIA 1HOCB 3GSRA 1TTGA 5EBMB 3RY6A 5KBLA 3QCTH 3GMMA 4PI2A 3VXOA 1F4YH 1GSKA 5DZJA 2BPBA 2EE0A 4L3EA 2A6JB 4OZHB 1ZT7A 2D7TL 3BO8B 1XGQA 1MG2C 2G3MA 3KDMB 1S7UA 3L6FA 1KB5A 2CDEA 4AKQA 2NXYD 3ETTA 3WJLC 1Z3RA 3B37A 1IVOC 3JZYA 4KROC 4PWJA 2QZ5A 3CIQA 1P0SL 4PV9B 1J18A 5FHAH 3CIAA 5H94A 1JGIA 2F8IA 3GXPA 5FUCC 2J88L 1H6FA 1RZ7L 4MS8D 4K5OA 3CZNA 3MYZA 2D3JA 1EUUA 1VGKB 3ZTJH 2N7SA 4ELMB 4AV5A 4DPCX 2N0MA 1K4CA 1GY1A 1DJXA 3S37H 3G6JB 2XY2A 4P2AA 5EUOF 2JCCB 4YEEA 4FI6A 1J86A 5GGSY 1A1OB 1H3VA 5CP3H 2OTPA 5AB1A 1NEUA 4GAYB 5IJDC 5AYUL 4FYSA 1OTTD 1Q4NX 4LL4A 1NGWA 4PY8I 4QY8A 4DUVA 4XR8C 3WFCH 2D3LA 1YYLH 2R0WH 5E8DA 3QDJD 4HMDA 4ZSOB 5SV3A 5JW5B 1JZ4A 2PWEA 3O9WD 4NPJA 3E3QC 3V0VB 4YDKH 3V4VB 1IGFL 5A2LH 2N59A 2APSA 5FW6A 5D7JB 1IQDA 5EH1A 3U6XS 4KHTL 4OI9A 5HHOB 1YHPA 4L3CA 4ZUVA 4BWUA 3DPBA 1AGEB 1JNHA 5TF1L 1EAIC 2ZXCA 3CGTA 4YBQC 2TRHA 3CDCA 5B7FA 2PO6A 3MJGX 2MMXA 5ICUA 3U36A 5AOIA 3ZK0A 5I2IB 2WIIA 3IGUA 3I74A 4WKZA 3QDMD 4LHUA 1JWMB 4NC1C 5C0BB 3V52H 3HI6L 3GSNA 1HAWA 4AQEA 1CLOL 4BXSA 3AY4C 4AENA 2PKDA 5IROA 3UDWA 2DI9A 2D7QA 3D2UD 4JL1A 3O2DH 1N8ZA 4OCSL 1YECH 5JPNC 5DLLA 2YARA 4PRIE 5EU5B 1L4IA 1LJMA 1JL8A 3DBXA 4OCWH 4UB0H 2QLYA 3CLFH 4GYBA 1KJ2A 2PPCA 3VXRA 2WQ8A 5DSCA 4QXUH 5FYJD 2EDMA 1WS7A 1RUKL 3BCDA 3PXJA 4F24A 4DAGL 3A4FA 3K91A 5KS9F 5C0CA 4NQEA 4AMXA 1BG1A 1NUFA 4V1DA 3ROOB 2NPRA 5IB3B 3LNFA 5E1QA 3GTVA 2IVFC 4IRZL 4N0FA 3OHXC 1BX2B 1JDCA 1AR1B 1NCCL 2Z1KA 1JF5A 5CINL 1I7RA 43C9A 1JHLL 1VSCA 3EFFB 4D8OA 4JW3A 4GXVL 3UJTH 1TU2B 3FZUD 4RZKA 1XGTA 1XX9C 2W5PA 4UOW0 3V7MA 3ARBD 3FN9A 4BFEA 2CR3A 1ZT4A 3ESOA 4JCWA 3FBKA 1FVCB 3N41F 3IRZA 4LCCA 1PZBA 2CKNA 4JFDB 3CHRA 3BGAA 4OLUH 1S5IL 4R26L 2MRYA 4ZG1A 4IDJL 4MWFB 1H3GA 1NFIA 3V79C 5GGTH 5MERA 1T1XB 5GS0C 3ULVH 4ZPVB 4WFFE 4JJOA 3BD3A 2VDNB 4XNQA 5IB1A 5I24A 5JHDB 5B3SB 4Z78B 4TQ8A 4G7RB 1KYOK 4PG9A 5FYKE 1Z2KA 3VTAA 1CZ8H 3CFJB 5C0BD 3MXWH 4N0CC 4L8BA 1ZANH 5MEPA 2EDXA 2QQNL 4ZQTA 4JHWL 4N8VG 4AYDC 2KL7A 3GMQB 3V0GA 3W2DH 1F02I 5F9WC 2X1QA 1KCBA 2A5UA 3KQEL 4RGMC 2FJHA 5HGAB 1J1PH 4Z0BL 5GZOD 2IWKA 1RUPH 2WVTA 4KZ0A 2CBPA 1KEML 4B60A 2UXFA 3H7BA 4PGBB 3U7UG 3BPCA 1AGDB 3RWCB 3TBYB 2C3VB 4OW6A 4PW9A 3KJ6L 2WPME 4MDIA 2HUHA 1IBYA 3QULB 4Z3FA 5IKQA 35C8H 2AVGA 4AI7A 5AVVB 3SE8L 3SBRA 1R33A 4QXTB 1HSAB 3D3VB 5ISZE 4LT7A 3RTQC 1J87A 3VD0A 5DRWA 1PGRB 3GISX 2X5PA 4KJYA 1PDKA 4OBSA 5I0VA 3GBEA 4YLBA 1VCBC 3CHSA 4RAHA 4X0KA 1YNLL 3E6HA 4ZMWA 1PEZA 4ATTA 1D5IH 3MBXL 3OAUH 1BVKA 3EH5B 1CQYA 4U2YA 1JYVA 3DX8B 3NFSL 1UZKA 2CUMA 1XGUA 2FLBT 2IGFH 4W9IC 2OMVA 4PRHA 2J5LB 4MB5A 4YBHA 2KZ1B 4CNIB 3AG3B 3T1WA 2PW2A 4NSKB 5F6IB 5CLYA 5AW4B 4CW1A 2GCYA 4OLZH 5ESAA 3JVFC 1WFIA 4N2IA 2FLBL 3VSQA 3QUZD 4M5YL 3QZWA 1UXSB 3HE6B 4J3OG 5EZIH 3POHA 4TVPE 4BK5A 5T3XE 4ZFOL 3QEUB 5L2KB 3K2KA 3LS5L 1VACA 3FH7A 2DYPD 4QRAA 1PEWA 4YHIA 3KCPA 5EU4B 2ARJB 3DVNA 5DUPH 2PXYD 3PDOB 3NSYA 4NCDA 4JZEL 2QKIC 2RIKA 4AIEA 5GRVL 2AJXH 3WUWG 2Y6TE 1TUPA 3GSQA 5B1CA 2J72A 3KGUA 4X5WB 4X7CC 2H7WA 1Z32X 3IDNB 4IIQC 2VJ3A 3OR7A 4PS4H 5JNYA 1JGDB 1GGCH 1PCSA 1EFXB 4K7FA 5JHDE 4HJ0D 4XWOD 4HJ1A 4XPHH 3UGUA 4XNYL 1UD4A 5DMKB 3KHQA 2LABA 4X0NA 4BSJA 5CBEB 4ZS6C 4MZRA 4NJAH 3DV4B 1BZ9A 3OL2A 1TG8A 1NOFA 2JJWA 4J6RL 5DJZA 3QR0A 1XF5B 1H8LA 4TVPH 5DO8A 3MV8D 2WG3C 3MRQB 4PRBB 5FWRA 3W0WB 4IHBA 4ZMNA 3J07A 4BKLB 2NYZA 2FZ3B 5I76B 4Z76A 5DK2A 3T8XB 1CQKA 3KPSA 3TYGH 5JHLL 3QJRB 4E9RA 4MD5A 4UT9H 2EE6A 5DMIL 1D6VH 5JTWA 4KI5D 5DS2A 4IDJH 4QRQA 3QORA 1CJYA 1V05A 4LSQH 5IV2A 3JWOL 3KYAA 1Y18B 4JZOA 3KL5A 1U3JA 2VR4A 2WLIB 2BO0A 2YO3A 4PJ7E 4P23D 1JIBA 2FRGP 5L4MA 4GW4A 1RJCA 1IAOA 2W1NA 1I8IA 2DWXA 3LVEA 3PWPE 2CDGB 4URTB 5JO5B 3BHBB 4Q0XL 2PW1A 2N56A 1L7IH 1R3KB 1TQBB 3MOAL 1UA3A 3BN9D 2O6FA 1NGZA 2XTLA 4UCFA 2VDRH 3KGTA 4NLHA 3ZJAA 1I7UA 3BKMH 3OQRA 1NCAH 2KYIA 4TSAH 4LIQE 2Q3AA 3NK4A 5T5FH 2HRPL 3PS6A 5ENWB 1C5CL 1M3IA 4WV1B 8FABA 3QHTC 5BUGA 1RK1B 2BOBA 5LO7A 3NIFE 2FEDC 4R4ND 3MA9H 3AS0A 1ZS8B 1ZXQA 1G7HA 4NKMA 3N04A 4L4VE 2EDEA 1N9PA 5E7FA 43CAA 2X4PB 3MRGB 3O3AA 5DJCB 5ITFB 1EO5A 4LSTH 1X5LA 4TNGA 4PJBF 4YPGB 5HY9B 3PRZA 1A7QH 1P5UA 2Q5BA 1QOKA 3ZHFA 1AHWB 5E1AA 4ATWA 1OF2B 3KQBL 3MACH 4KKBD 2Y7NA 2X42A 3LKPA 1AGFB 3R4RA 4HJJH 5E70A 5EB9A 1RZKH 2NY4B 4FABH 3RVWC 3QDGB 1WFUA 1A7NH 3QQ3B 3WEXA 4U1NB 3QIWB 2QQKL 3ESPA 5IBUB 4BZ2L 4NO0A 1W72A 4I77H 2OL3L 2WVUA 3GBML 3C60B 3QJFB 3RPKA 1PZCA 1LDPH 3AAZB 4KUZH 4P9MH 3HJ0A 3ALWA 1M7XA 3MLVL 2B8OT 3L4CA 2V8MA 3H2QA 1AGBB 3C5SB 1MY5A 5GGRY 2O61B 3OMAB 1ZAQA 1U6AH 5C08D 5BVPH 5E6IC 4GAGH 1VB9A 2AJ3B 3JV0A 1ACZA 2WZPA 4G1MA 3SBQA 4QR7A 5KVMC 4XMZA 4A7GA 5LCVH 2BP3A 3D85D 4L8DA 4R96B 1MWAB 1KB3A 1HHIA 5DD6B 5J1TC 5BOZG 1YEIH 4B9JA 3SZ6A 1SDDA 3WIHH 5K9JH 3DI3B 4GRMB 1MCFA 1G1QA 2QTEA 1MI5B 5BS0D 4KPHL 2VQ1A 5IFAL 5HDQH 3MTXA 4C56B 2Y5TA 4Q9RL 1WAPA 5HHME 1WC7A 1WJ3A 4U49A 5FKAB 2HSIA 3VXNA 1Z5HA 3UAFA 3ZRSA 1H6TA 2G5BB 4G7VL 3UX9B 3V0JA 2Q7YA 2HG0A 4BWTA 1Y07A 4FTVA 2PN5A 4TTGA 3BT0A 1IOEL 1XDTT 3G5VB 4HKXB 2P16L 5KSBE 1BD2B 1C5DB 2D7TH 5SWSE 3CZEA 3JWDH 3PWPB 4GQ9L 1GTFA 4PJ5B 3GRWH 4DN4L 4PJ7A 5H94B 1VHPA 4ZYKB 5CZVH 5I19H 1ZVHA 3KLLA 3QCTL 4Z3HA 5T3ZE 2FT6A 3K6DA 3LC3B 1M2VA 2BT7A 5IEHA 1EO8L 2GT9A 3QB7C 5LG6A 1A5FL 3QNXA 1WITA 3S9DB 2HT2C 1WPCA 1KTLA 1VDGA 2X4SB 4UWQB 1CFQA 1EEZB 4XHQA 1DQJB 1ZDSA 4QRPB 1XIWD 4P2RA 3IDYC 4XCCH 4ILDA 3VTTA 2X09A 3O3BA 5DC9B 5T1JA 1IM3D 2AEQH 1Y6KR 4OU3A 4KRPC 3SPGA 2HRHA 2A9NL 1CR9L 3LN5A 5D9SA 4NZ8A 4AH2A 1RJZB 1G9MC 1ZV5A 1U8JB 3TN0C 2ZWZA 3A67H 3MNDA 1I85A 4JRWA 4JPSA 1NGWB 1H19A 4L5FH 2YEZA 4QOKE 4CBPA 2P5EE 4N20A 1WA1X 1MVFA 4BH8B 4FYTA 2AITA 3NP3A 4LGSB 1MCSA 3CQFA 1NGPH 5BZZA 3GT6A 3VRJB 2E8YA 4UYQA 4WENB 4XPAH 2Y7QA 3MNVB 1TETL 1M4KA 3RBSA 5F7KC 4P5TD 2VAJA 5C3TA 4HUVB 3L1OH 4YFEA 1MHEA 1LO5A 5LNEA 4DCQA 1A8JH 1IMHC 1SYSB 2N0KA 2HKFL 2YBRB 5EZOH 1QUNB 4OD2B 5ICXB 3RWEB 4Z0XB 3MXVH 5D96B 4EI6A 3PJSB 1BMGA 3NZ8A 2Z3FA 2X3BA 3AREC 5C0BA 1REIA 4FHBD 1TTUA 1HCYA 4Y9BA 3IETB 4UU9A 5H35A 4F33A 1KCVH 1GGYA 3TXAA 5E23A 5A6IA 1C16A 3H42H 3KXFE 5AUMA 4YZFE 3QUMB 4CADB 1E67A 4LCIH 3IGFA 5GJSH 4PJGB 3TBVB 5CFAA 1SHMA 1R47A 4U1SA 5J9PB 1P1ZA 3NFNB 1CN4A 1E4XH 4JM0A 5HGBB 4DP4X 1B2WH 4AT6A 5DRNB 2P3FN 5I1HH 3GHBH 2UYLA 5I15H 4OV5A 4B97A 3SOBL 3QYCA 4LEOB 2CGYA 3HNSL 3LEYH 5IUCA 1T2XA 2AK4B 3LCYA 2BZ6L 1YAIA 3GXNA 3X14A 2H9EC 2GD4A 4N2EA 3TJHC 3WNNA 2A6IA 2EH7H 1BVLB 1D7CA 2AQPA 1KB9K 5E6RB 3FUIA 3OAYH 1PFXL 3SKNB 1GOHA 1KYUA 2V5SA 2Q76B 3GJFA 3MRDB 3I50L 4U7MA 4P07A 4Q9QH 1NBQA 1NCUA 3GDBA 1F3DJ 1SMAA 3SDXB 1XGTB 1HI6A 4S11A 4JPQA 4YXHL 4R8WH 2VZOA 2OMUA 1CK0H 2V5MA 1JDDA 3FU8A 3MLXL 3EGXB 5DT1H 4I89A 2UY7B 2ZJSL 2ZUXA 1SLVA 1U8MB 1ORQB 5E8PA 3OC5A 1WGVA 4R2GC 3U4AA 1FWXA 3N8WB 2MQ3A 4NI6A 1L9PA 2CO6A 3SGEH 2WCGA 3RVXC 3NGBB 5IJVB 3P11L 2G0LA 3S6XA 1S7XA 3UYPB 4JQVC 2B77A 4DKDC 3HIZA 2DLTA 4M8QB 4NHCL 4S1SH 3V7AG 4PJBE 1IQWL 4X7TA 2YC1B 3BYYA 1ZT7B 1YMHA 4KMQA 2BFVH 3WEBA 4M6NH 4QTFA 4NBZB 1CDIA 1E8XA 1I3RB 4R7NB 3FOMA 5I74B 4Z23A 5FXCH 2R2BB 4OJDH 2MNWA 4K3DL 4N5ED 3U9WA 2HFFA 1QSFA 4EI0A 1YUGA 4CMHC 3HO4A 4G8GA 1ZHKA 1J0ZA 4XPAL 2C3GA 2OR7A 5AD0B 3DX3A 1NCWL 3HNTH 4G8EA 3SE9L 2AK4D 3HS7A 5GGVL 2WXFA 1JSYA 4UOZA 5FPIA 4UF7C 3TPKA 5INDB 4NT6B 4F15B 1YY9C 5JPNB 2TRYA 5B1BB 5KTEL 4FA6A 3OKMB 2BHYA 1MJUH 4X99A 3LB6D 5HGHB 1H5BB 1E0OB 1D5BB 4NZRL 4CA4A 3OAYK 5TH2A 2VDRB 5GSVB 1TQCC 3SBPA 3IAPA 2IFFH 1IGJB 3GFUA 2PYEE 4PJGF 4FKKA 3RZWA 5BXFA 3TS8A 1J7VR 5IW1A 1ZK5A 2QPUA 5DUMH 1N7MH 3KYNA 2X2HA 1HE7A 4JQXC 1R6VA 5DK0B 5CGYD 3GBDA 3TEXA 2A6DB 5GS0D 3MLRL 1DFXA 2FK9A 3CC5A 2E6QA 3B2UC 1GGIL 4JCMA 4FNTA 4ESKA 1FDLH 4H8VA 5E08H 1EDYA 1A14H 3V9FA 3AREA 1KZYA 2MJWA 2CQVA 3U36B 2B14A 2W60A 2NR6D 2WYIA 3ZXAC 3U82B 3OGOE 2IOMA 1NTDA 4QUOA 1E2ZA 1TZGL 2CDFB 2FWSA 1G4RA 5GISH 2X9WA 5AB0A 5ADOH 3DJZA 5E0QA 3GCXE 1FFMA 5T1KB 3BSZL 1OOAA 1IAKA 2VWEE 3F7LA 2UWEA 3LS4L 3U4EA 4JFYA 3RWDA 1CGYA 3QPKA 3HRZB 4PJXB 3ARFD 2BDNH 4HXBH 4EMZA 2IG2H 2EACA 3IU3B 1UZGA 5LQBH 3EUDA 4Y4KA 3N0AA 3U46B 2K70A 3L4VA 4LLDB 2V7HA 1P9JA 4UZGA 1JPST 3QH3B 4P9HL 4HK0A 4XCFL 4XP6H 4EOWL 1GYVA 5BO1H 4KZEH 3K46A 2D8KA 4JKNA 4O51B 4GT0A 2DLFH 1MFMA 1X5IA 4FS0A 4NZTL 5IF0A 3ECQA 4CVXB 1USZA 3CQPA 1CLCA 2C3XA 1UZ6E 3MRPB 4HEPA 5ALBL 1JXGA 4PJHE 1X9UA 5IQ7L 2ZOLB 4KAQH 4MS6A 2OS7A 4S2SB 1NUNB 2GY5A 4DP9X 1G7MB 4ZH8B 5E94B 4TQEL 1JI1A 5EOCJ 5DJDA 3DOSA 1WA2X 1WFJA 1G84A 1TR7A 1IEBA 1YPZB 2VAAA 3TL5A 4BA8A 4RIRA 2YZ8A 2EILB 3G5ZB 5ID1B 4NKDB 1I4FB 4YQXH 3L2NA 3EHBD 2R83A 1V3MA 3O8XA 4U1HA 3V0AC 4PRBA 5JDSB 3US0A 3D9AL 2ATKB 4WHDA 5AB9A 1NDMA 2Y7ZB 3KBPA 2AERT 1X7SA 2VNCA 4G8FB 4TLKA 5I16A 4HOWA 2XJKA 4QAWA 3X13A 3E0GA 3H3PH 4UZSA 2YPVL 1WS8A 3WTSA 2K2TA 1R34A 2VLLA 3MJ9A 4Z78A 2WKGA 3LNDA 1F4AA 4JFEA 1KN2H 1N5AA 3LIZA 2XZCL 4NCC1 2UZPA 3FSZA 1G9MH 4RZCA 5FDQA 2HWZL 1TMCB 2FUTA 2QPDB 3OTTA 4KMLB 1BBDL 2OMBA 3MJ8B 3DROA 3KPMA 3D52A 3FO0L 3SDAA 4Y9GA 1KGXA 2BJML 2ZWLT 1OSZA 4FQXA 3TH2T 5ACZB 2VDPL 4NM8L 4HG4K 5H2BA 2XVGA 4IRJB 1FFTB 4FNLH 2J21A 1A4KB 4JRYB 5JIKA 1I7UB 1A1NB 3LRKA 4G43A 2B9AA 4L37A 2FBRA 4ACPA 2G2PA 1AZCA 1K3ZA 1MRDH 2XWDA 1DCEA 3UGEA 2JI3A 3FFGL 1TT6A 4JG0L 4LNRA 1RJYA 3EYSL 3F58H 2UVEA 3MUHL 5F3FA 1M05B 5L9DH 1TZHA 4TS6A 5EZJB 5GS2D 5I8CB 1EGJH 4K3JL 2B0SH 2P8PB 1JF6A 1Q94A 1KXVA 4R7DA 5EO0A 2GW5A 3HAEA 4XZUA 2BY2A 4WI2A 3RDTA 1D5RA 3THMH 5F6IC 1G7LB 1PLGL 2D31A 4PG2A 1PTHA 3QRGH 4UTAL 4Q14A 3DMMC 2J1KA 1Z3GH 4FM5A 2BVTA 3NJIA 3U1QA 3EG9A 5DUBB 1G0XA 1SN0A 2MTAA 1P4BH 4YWGL 3T0XA 4G6MH 3DMMA 2HFGL 4LCWE 4GJTB 2KNIA 3UC0L 5DVMA 3T77B 4G7QB 5FCUH 4OF6A 3OPZL 4R83A 4KBPA 1QI4A 3T6WA 4MMYA 4UTBL 3QARA 1DIYA 1IQDB 1CK0L 3NT0A 1DQKA 1P4BL 1UM5H 2WZPD 5J5EA 5LJYH 1QR4A 4OUUB 4PRNA 2OM5A 1CYXA 1MIML 1RIVL 2GBUA 2ZKXA 3PWLB 5EEYA 3HI1B 3UTTE 1SN2A 2N7BA 5EU4A 1IGML 5C0FA 5FGSA 4BFFA 3GINA 3WLWD 3D34A 3D69B 5D2LA 2Z7ZA 2XPYA 3NFPB 3RX9A 1K5NB 1MRFH 4HP5A 5I1KH 1IE5A 4I13B 1FNFA 3H3KA 3O9WB 3Q13A 3T65A 2CNZA 1OB1A 1DO5A 1ATDA 1TQBC 5IR1B 1U67A 3VXUE 2VQ1B 3V6OA 3HJEA 5F7FA 1KPUB 4FFYL 1WUNT 3SDCC 3P9LB 3R06B 5CEXA 3TBDA 3ENSA 1AG0A 4FI8A 1JGUL 2E9JA 2A74A 4P46B 4Y0GA 3FFOA 3CHOA 5AW0B 3BUIA 4NQDA 3ZL1A 3IMUA 5J12C 3SGDH 5J6GB 1U42A 2AZAA 1T3FA 1F4XH 4ZXBD 1G7QA 2YPLA 5D7IA 3V6BR 1DZ0A 1BJ1H 4CU8A 2LVEA 2Z35A 2IH1B 1XSIA 2M2DA 3A6OA 3OJDB 3V5HA 3HW7A 2D03L 2ICCA 5KVEE 5C07B 1P69B 2YRLA 4P4KA 1CVWL 1G1TA 3O4OC 3F04A 1KTLB 1NEZG 5J12B 2IANA 4JZOB 1EX0A 3SQBB 3BESR 2GUOB 3L3GA 2VR5A 4N9GB 1SHXA 4YT7L 5EU7E 4TM9A 3UZVA 2I9AA 4V1DD 4FGMA 1UZJA 1UA7A 3OWRA 3THML 4M1CD 2FYYA 1NGZB 3BYTA 1KJMA 1QPXA 2EKSA 3DX4A 2DQUL 1QRKA 1W15A 4ANVA 5IJBC 4DVRL 3S4SG 5CGMA 3EYUL 3O6MH 3WD5H 3IPEA 6PAZA 5DYFA 3HS5A 5EC1A 5GXBB 3RPBA 1P2CA 4OD1H 1U58B 4FJZA 2HTKD 2KZKA 1XF1A 2OX5B 5DUML 5JUEL 4HLJA 2WB1A 2YBRA 5ICXA 4CRPA 1V7MH 2XA3A 2O5ZH 4X9GA 2ZXBA 4JFUA 1A6ZA 1NIFA 3MROB 5DQ9B 1F2QA 5ITFA 1KYFA 5AKSA 1F3DH 3L5IA 3REWA 3H7BB 4GBXD 2X4UA 3JWDL 1FJ1B 4TOYH 4PJHF 4EOWH 2HN7A 3IDJB 1F8TH 2FZZL 4X83A 1OV8A 3QULA 4MJIA 5D55A 2E7CA 3WAKA 3WJJA 1BQHB 5C9JB 1MCWW 1UXLA 2C7UA 1Q9OB 5TDPA 1BF9A 1NZIA 5CKMA 3Q2VA 4PJEE 4BQ9A 1NCWH 2XG4A 3H53A 1BLNA 1BWWA 4JM2B 1DBKL 4KJYB 2ZYHA 2P47B 2YA2A 2VXSL 1CVSC 1TYJA 4I3RH 3IJSB 5EDXA 2YPKA 1YY8A 3FQTA 3NRFA 5CIPH 1QFUH 4X6DE 2YD3A 4Q7DA 1IQML 4WWKC 4HQQH 4KY1H 2EH8H 3VWJD 3GNML 1QNIA 2E56A 5IJCC 3QJZA 4NHUA 1V1IA 3WAJA 1ZK9A 1TTRA 4JAMA 1GYWA 2LV4A 4N24A 1URKA 5IQMA 4PGEA 2CLRA 1WO2A 3ARFA 5M7QA 1FZOA 1RIHL 4JFFE 2F08A 2SEBA 4PY8J 4XCYB 3BRDA 4BQBA 2HCZX 3MNWB 3N40F 3UG4A 3ATAA 3IDYB 5FOBA 1HZ8A 4PMEA 4PCKA 1DVAL 2AK1L 3CSFA 4XAKD 4X8CA 2DV6A 1BF8A 2B1HL 3HS0B 4KTEL 5I1CH 3HE6A 5DT1L 2P5WE 3BEWB 3RHWF 3D85B 4GMTL 2O93L 2W59A 3T1FA 3MO1A 2XRAH 3QI9C 3O3EA 5AVSB 1ZLSH 4JZJA 4CUEA 3LRSB 4Z7VF 1CD1A 1QRNA 1HKLH 1GS8A 3NZUA 4Y2DA 4GW1A 1DBAL 1KUMA 2A7BA 4ZXBC 2CRYA 3ULUH 4NQDE 3NQKA 3PFQA 5KYXB 2J73A 4XCNA 3SDCA 3I75A 3M88A 3EW3B 3NIDF 4MJJA 5I1GL 4N0CD 5KSVB 4KZEL 2I9LB 3U0TB 4U6TA 2BP5M 4LCCC 5GS3A 3HRPA 4MAUH 1BFOB 2XTJC 4HFWA 1GZPB 1UD5A 3IDNA 1MQ6L 2W38A 3Q6GH 3HG5A 4LSPL 3C2SA 3AT9A 4FQ1H 3UTSE 2EUZA 4HBCH 2I85A 1NGQH 3SPJA 3WLBB 2NXZD 2CO1A 3T8MA 1O5DL 2ZCKH 4QXVA 5GJTH 3BIKB 4ELKB 5IROC 1S5HB 3UDWC 1BD2D 3LZOA 1TJXA 1WF5A 2C9PA 4L4TD 4LKCA 4NENB 3BKJL 4KH9A 3BDYH 3O3UN 4JFED 3L3KA 4CVZA 4MA1B 4L5FL 3BZ5A 3VFUB 4X6BB 1W72H 2VRSA 1Y1UA 3MI6A 4H20L 1IGIH 4FXGC 2I7SA 1OEZW 2A99A 2C9VA 3K6FA 4N2HA 1ADQH 5HDBE