4XBMA

X-ray crystal structure of notch ligand delta-like 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
270
structure length
253
Chain Sequence
b'SGVFELKLQEFVNKKGLLGNRNCCRGPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPNPIRFPFGFTWPGTFSLIIEALHTDSPDLATPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta-like protein 1
molecule tags Signaling protein
source organism Homo sapiens
publication title Notch ligand delta-like1: X-ray crystal structure and binding affinity.
pubmed doi rcsb
total genus 38
structure length 253
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
A PF12661 hEGF Human growth factor-like EGF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4xbmA03
2.10.25.140 Mainly Beta Ribbon Laminin Laminin 4xbmA02
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4xbmA01
4BTTA 4ISIL 5IKRA 2PUQL 3N8WA 3TGFA 1YO8A 4D0EA 3CFWA 1PRHA 1HX2A 6COXA 2UWOB 3ASIA 1ATEA 5JBAE 3M37L 2B7DL 4Y6DB 2J38B 2VVVL 3NT1A 2BQWA 1IQIL 4CUEA 4RRYA 1J9CL 5CKMA 1LMJA 1CVUA 4ZH8B 2P3FL 2P3TA 1F7EA 3NTGA 1HRFA 1TOZA 1NFUB 2XBYL 2Y5HL 2MGPA 2BOKL 2BQ6A 3LN1A 1HAEA 2J34B 4TGFA 3LAQA 2WPIE 5IKVA 4Z0LA 2XBWL 1ATBA 2W26B 2FLRL 3FBYA 1CEJA 1FE2A 1HJ7A 2H9EL 5JVZA 2M74A 3HO4A 1ATAA 2P3FN 1F0RB 1G1RA 1ZAQA 1CCFA 2WPKE 2WYJB 4CUDA 4RS0A 1NZIA 2W2OE 1P9JA 2VVUL 1NFYB 2WFXB 2P93L 4MMZB 1YUKB 1AUTL 1G1SA 1G1QA 1EQGA 1EQHA 3LTGD 2WYGB 1EMOA 2BMGA 3TZIA 2FZZL 3BPSE 2I9AA 5JB8E 2VJ3A 1IQEL 4NGAL 2UWPB 1X7AL 1APQA 1N1IA 5L2ZL 1CVWL 2W2QE 3TH3L 4Z0KB 4CC0A 5JVYA 1NFWB 3KQEL 2RA0L 3BT2A 2DDUA 1IQNL 2PR3B 1WHEA 5CKNA 1QFKL 4X8TL 3F6UL 2J2UB 4NA9L 1LQDA 1V3XB 1LPZA 3OLUA 3CENL 1L5GB 4CSYA 1G2LB 2Y38A 1NT0A 3QCWA 2K2TA 2CJIB 3POYA 4JZFL 4RRWA 2RHPA 2VVCK 1WHFA 2WPME 4ZXYL 3MQEA 5KIRA 1DIYA 5FDQA 2JKHL 4JYUL 3CA7A 3ENSA 1IQJL 3Q3KB 4Y7AB 1XFEA 3GISX 3LC5B 1IJQA 4BTIA 4AQTA 1URKA 2Q1JB 2VWMK 1K36A 1EPGA 1PGEA 1N7DA 5L30L 2P26A 3IITB 1MOXC 1HAFA 4Y71B 4FM5A 1IOXA 1ADXA 1IQLL 2W3IB 3N8YA 4JYVL 1MQ5L 3CS7L 2XBXL 3ELAL 2ADXA 2P28B 1JL9A 4MMXB 1XKBA 3N8VA 2RNLA 2XBVL 1TPGA 2Y7XB 2W2PE 1EPJA 1YGCL 2FLGA 1FSBA 1HT8A 1XDTR 2TGFA 3N8WB 1EPIA 4XLWA 3KL6B 5JBCE 3HO3A 2BOXA 1NQLB 1EMNA 3Q7DA 1YUGA 3ZYJB 4Z6AL 3GCXE 3U73A 4X8VL 1I0UA 1Q4GA 2P95L 5IKQA 2VH0B 1W8BL 4XL1A 3C9AC 2Y80B 3R05A 4M11A 1IQFL 5I46L 2W2ME 4RRXA 3ZYGA 4YZUB 3KRKA 1LPKA 4OTYA 4XBMA 1FAXL 3KQCL 1JV2B 5CKQA 2BZ6L 3SOVA 3SW2A 1IVOC 1PFXL 1IGZA 5JB9E 2FLBL 3H5CB 1UZKA 5F1AA 2VWNL 1WU1B 2UWLB 2KL7A 2F9BL 2Y7ZB 4BDXA 1IP0A 4Y7BB 1EPHA 2W2NE 2W86A 1PXXA 2VH6B 3HS7A 3HS5A 1Z6EL 4C16A 1IQGL 2YGOA 1NFXB 2W3KB 2Y5FL 4O02B 1M1XB 4YT6L 2J94B 4D0FA 3LC3B 4ZXXL 4ZAEB 2YGPA 4CBZA 3MDLA 1COUA 2WG3C 1IOEL 1EAIC 2BO2A 3U7UG 2KB9A 4O1ZA 2KV4A 1FJSL 4COXA 1DVAL 3LTFB 3HPTA 2Y82B 1U8CB 1FF7A 1IGXA 2GD4A 2MHPA 3QH0A 3OLTA 4A7IA 1IQKL 2I9BA 3N8XA 2BOHA 3M36L 4BXWA 1KLIL 2FD6A 1NPEB 2WPLE 1TLEA 3TK5B 3KCGL 1MQ6L 2VWOL 3K9XA 3KQBL 4BDWA 1L3YA 4OTJA 1YUFA 3F1SB 3V65B 1CX2A 5L2YL 1F0SB 4X8SL 2XC4L 3TBDA 2VWLL 3P5BL 1P0SL 2WG4B 2J95B 1IQHL 3LN0A 1C5MF 1FAKL 4ISHL 4ZHAB 3NJPC 1PTHA 1HREA 4JZDL 1IQML 1RFNB 3IJEB 4YT7L 5K0HB 3BT1A 1DQBA 3V64C 1F7MA 2WPJE 2WPHE 1GK5A 1UZPA 2G00L 3LIWB 1KLOA 1SZBA 1HCGB 2NPRA 2XC0L 3ZYIB 4BTUA 4E1GA 2K2SB 1EGFA 2BQ7A 4CC1A 2D1JB 1EZQB 5KN5C 4X8UL 1W7XL 3N8ZA 2OYEP 3FFGL 1U67A 3HO5A 1FFMA 2J4IB 1ATDA 3TK6B 3RR3A 4Y79B 2Y81B 1B9WA 3EGFA 1KLJL 3DEMA 3PGHA 3SOBB 5E8DA 4D90A 1DX5I 4Y76B 4CUFA 3HS6A 2PHBB 2EI7B 1JBUL 2WFTA 5F19A 1UZJA 1EBVA 4JZEL 2MGRA 2P94L 2AYLA 1HT5A 2P3UA 3QMOA 1UZQA 4G1MB 1G1TA 1K37A 4PH9A 3NTBA 1KSNB 2XC5L 2P16L 5COXA 1CQEA 1BF9A 4RRZA 4RUTA 2OYUP 4NG9L 3GCWE 1APOA 1DDXA 1HZ8A 4M10A 3SOQA 1KIGL 1LPGA 3N8YB 5JBBE 5JW1A 1OB1C 3KK6A 2EI8B 1CCVA 1XKAL 2BOUA 4BXSA 4LMFA 4MMYB 1Z6CA 2EI6B 1O5DL 1A3PA 1G2MB 3FCSB 5EGMB 2Y5GL 4LORA 5CISA 5IKTA 3KQDL
chains in the Genus database with same CATH superfamily
2AQ2A 4Z7WB 5BV7L 5CCKH 5IJCC 3OKEA 2H8PB 3LH2H 3T4AC 2AQQA 3L9EA 1ULVA 3W11C 2A9BA 5EO9A 5IVOA 3PFUA 1BZQK 5I6XC 3BPLB 2UWOB 5B4MD 3KBEA 4ODHH 3HNTH 5D1QB 4ZW3A 3M37L 2VVVL 2QPSA 3CXDH 2PTTA 2BVPB 1IL1B 4B7IA 3K8LA 5CM1A 2MIZA 5CKMA 5GQBA 1Q0EA 4XPGL 4QXUH 1KCLA 4QCIB 2ZCKL 1IC7L 3EDDA 3OD3A 5FHAH 3K3QA 4KZEH 4XE0A 4JJ5B 1JF1B 5FM4A 5HYIA 1MH5A 6PCYA 1Z7JA 4FNLH 2C3GA 1HL5A 2V5YA 4NN7B 3GBLA 5D7HA 4JZJA 1ZHKB 5IKVA 3T4AB 1G7QA 3DXAA 5CKAA 4JAMA 4F27A 5HPMA 1QRNA 1WA2X 4TNVK 5DMIL 1PL3A 1XIWC 4MCZB 4M1GL 2VCOA 4N6RB 1R19A 3ZE0F 4PJCF 2VXSH 1A2YA 3D69B 1Y6KR 3MRDB 4HKBB 4R2GC 3KLAB 4FERA 4RAUA 4ZXBD 5KVFE 5AB9A 1UT9A 4L3ED 2A6KA 4Y1TA 5GGSY 4CUDA 1JV5A 1FNGB 2P80D 2VLJE 4P3CL 4FG2A 4FL4C 4BK8A 4D0CA 2EVHA 3GMMA 2WAHA 4QRSA 1UTDA 1KXTA 3PAVA 3TEYA 2O5XH 1OB1B 1VFMA 4NC1C 3L4WA 4YGVA 2D31A 3ARFD 1KPRA 2FJHA 2YXFA 1I7UA 5H4ZA 2Z0UA 1IC7H 2J1ZA 2Y5EA 3FONB 5BZXA 5JDSB 2VLKA 1RP9A 4G6AD 3T8XA 5C07E 2ZUVA 2X42A 2EE0A 3VFMA 4ZUWB 1A1NB 1JWUB 3GXDA 1WLHA 4LCCA 5F7EH 4YE4H 4WV1B 3VVWA 5HHQB 1K6QL 4BUHA 1WAAA 5ID1B 2OJZH 4Y2DC 4KU1A 5FPIA 2VJ3A 3NA4A 4QRAA 2BX5A 4TULH 4ADGA 4LNVA 1NIBA 2YC1B 4MA8L 5ERWA 4Z0KB 2BNRA 3C6LC 2YBRA 2O61B 2DMBA 2JKLA 3H85A 2JJTA 3P4OA 2CJUL 4LLUB 1D5IH 4FNTA 2XZCH 3EUUA 3WO4C 5E6IB 4AYDC 1U8PA 1MCJA 1F0LA 4DN4L 2FRGP 1LILA 4K8RC 5ESVB 4GNKB 3HPLA 3MOAH 1MQKH 2YN5A 3L5WA 4HUXB 2V9TA 2HLAB 4K0OA 4DO6A 1TYRA 2QELA 5MEOA 2QQKL 4MD4A 5FYKL 4OGXH 1T6BX 4A7VA 1S8DA 2FX9H 1B0IA 3M45A 4K5NA 3F3HA 1OAJA 3QWRA 4P3WA 5GIRB 3DBXA 1S3KL 4PWHA 1NWPA 1JTTA 2YWZA 2O5YL 4P2RA 4Y4HB 1BZ9B 1IBDA 3NRFA 4QHUA 3KR3L 2MOQA 5TE7L 4YSAA 1UWGL 1M05B 2QKIC 3F6JA 3RWGB 3V8OA 2A6DB 1K8DB 2VLLA 1UXSA 1BZEA 5ID0B 1BQ5A 3MDJA 3I2CH 1SYVB 3BN9C 3FOMB 4C83B 5I8OH 5I5IA 4WO4C 5I1IH 1U8HA 2VVCK 5AW3B 1HSBA 2JF1A 3VNYA 4R97B 3MQEA 4YZWA 5E2WH 5CCGE 5ICYA 3QEQE 1MXGA 4NZTL 4OF5A 4AQAA 1H8NA 3G9VA 1KWKA 3ILQC 3NPZB 3U79A 3SQRA 1DVXA 4A66A 4WWKB 3CA7A 4J3OG 5KYXA 3WAKA 4UDTA 3L45A 3BGFB 1U95A 5JW5A 3V5DA 4PD4J 2GI7A 1XFEA 2YO3A 1S7SB 5FYJH 3ROLA 1IJQA 4C47A 3ZKNC 4NBXB 4ZFFA 2NW3B 2Q1JB 1WIUA 3QISA 4L8DB 2XQYA 2VDOH 1EFQA 2YGNA 1CFTB 3QH3B 4OKVB 4RGOL 2EYRA 4ZPVA 1T7WA 3L3KA 1I82A 4KQ4H 2VITB 5K39B 3BCDA 3LSOA 5DDHB 5D7IA 2YMXL 1FNSL 1T2QL 1SHSA 1X6LA 5J6GB 1T1XB 3CZFB 4MTMA 4X7CC 1B4JH 4Z7UA 2A4ZA 2Q86B 3LQAH 4KROD 2W3IB 2H3XC 1KYUA 4XNZC 2AZAA 4F9LA 1VSCA 1PDKA 3ASWA 3GK8L 1PEWA 1VFAB 5IFAH 1BPLB 3QUXC 4X4YA 3DV6A 1KTRL 5FDYA 5AKSA 1IKNC 4OJFL 1DL7L 1UHVA 2NRDA 5D7JA 4U6VL 3HHMA 4FTVB 2F08A 1XCWA 3UBHA 1N3NA 1CXHA 2Q0ZX 4WDIA 4L4VE 4GIAA 2VR3A 4LQ1A 4U1SB 2V5RA 3ARYA 4FYRA 4HLZH 2BOBB 2JB5H 3PIQA 1YUGA 2QPFA 4PGDB 5HHPB 4ABQA 2BNRE 5FUCC 4DKAA 4JFHE 1J8KA 1BOGB 1L9RA 2NUTB 1CB4A 2XZQH 3O41B 4X0KB 4YQXL 3SOBH 4G6AC 3UTTE 4O2FA 2BHFA 2WW8A 2JIXA 2VH0B 3OF6D 4NS0A 3PUCA 1QFWM 5D4QA 5GGVL 3O6FD 4HCRL 1Q9KB 3N40F 5SV4A 2DLFH 4HIEA 5EDXA 5T1LD 3VRIB 1J5IA 1BVNT 4UV4L 5LAXB 3CZNA 1ETJA 1I8AA 1I3VA 2RA1A 5DD6A 3UTSA 4ZUSA 1E9QA 3PS6A 5IB4B 5LXGH 2HKFH 3QIWB 1L9TA 2B0SL 2FX8H 5CNHA 2BNRB 3CD4A 1HU8A 3KJ6H 2UZIH 1I8LA 2FDBP 5TQ2L 2BIIA 4H44C 1PFXL 4N0UB 1M9SA 1S9XA 4PWJA 3M86A 5KSVA 1HK6A 4NX0A 3N2JA 3ROOB 1RV6X 4JDEB 3L3OC 3DHPA 2DEYX 5IJKC 1HYRC 3ARGD 4CMMB 3ULVC 3QUXD 5EUOB 1H3PH 4DGIL 1A6TB 1CLOH 4X6CE 3Q9PA 2ATPA 5C0BA 2F61A 3QUYC 1JAEA 3NIDF 5CIPH 3MYJB 2W2NE 2OQJA 3NGBB 4GXUM 5HTSA 2VDNL 1FBIH 4LSVH 3HS7A 1EHKB 4KMQA 4YX2H 3FFCB 1P5VA 2PF6A 3ZT5A 1SXBA 2DWSA 3QIBD 5DMKB 1I1AC 3I6LD 1CZ8L 5I6PA 1D7CA 4Y0GA 2W5PA 3VSVA 5KSAD 1JNLH 4M93C 4IIQB 3IDXL 5D1ZB 4GKSA 2CKBL 5AOLA 5DJ6B 3BWUF 5JMRA 4OCLC 4WTXA 2DYRB 3PDOA 2AEQL 3QDAA 1KGCD 1PZAA 1EAJA 1DN0A 4XOAA 3NK4A 2B4CH 3AS1A 4KTEL 1E43A 5EUOE 4X5PA 1EO8H 3PGDA 3TV3H 2R59A 4I3GA 1JZ2A 1QTYT 4PW4A 4YSQA 2VSKB 2LABA 2GQHA 3VXPA 3SPHA 3HPTA 1MREL 5C0GA 4H7VA 1R3HB 1WT5A 1Q9LA 3FFCA 1JPTH 1HZHH 4ZW8A 3FF7A 3DSFH 4LU5H 3FCTB 4A7IA 1VFOA 4PGEB 4U1LB 5EU6D 3IJHA 3VU2A 4PWGA 1MCEA 3I50H 4E36A 4CA4A 1BPVA 3VX1A 2H1LM 4NPYB 3RIFK 4EOWL 4X99B 5DUBA 3HJ0A 1U4FA 4M8VA 4YDVB 2BHZA 3PL6D 3U2SA 3ULUH 1TU2B 2VLKD 2X87A 4Z7NB 2VWOL 3SKUD 5CCHE 1T22B 4YLBA 1W9XA 3HVNA 3DMMA 2F5BL 2VWLL 2R69L 1MZZA 5MENB 1XX9C 5L4FA 4NUPA 2PP8A 5I82A 3BEWB 2FWLB 3EDJA 3VM7A 3EOAA 5E2TL 3TIEB 5FF6B 1E9QB 1MCNA 5IB4A 3FFDB 5DS8B 1QWUA 4IIQC 1QLFA 3ZR5A 3MRJA 1LGVA 2NCMA 1RFNB 2JFCA 4KY2A 3RWEB 4KKZA 5FDWB 5D71H 4OSUH 4R5VA 3BPLC 4A2GA 1FE8L 1DQBA 3NOIA 5A2JH 5K39A 4RX4A 3TA4D 1WHPA 1GK5A 3MOBH 4MCYA 3KYNB 2Y2TA 3GNMH 4ZBJA 2IG2H 5C09B 1XBRA 4FFYH 3NP3A 4IBUA 2OMTA 4K3DH 3U36B 2CO7A 1CIDA 2N0MA 3EOTH 4MJ4A 4U6YA 3SZ6A 5I1CL 3E3QC 2EE9A 2ADJB 2X4SB 4NN6C 3K2UL 4BFGA 2BZ7A 2XICA 1ONQB 1WC7A 2YD8A 3PGDB 1QOKA 3M8OH 4XE5B 5KS9E 2OYEP 3GSQA 3PLYA 3CVHH 3MXVL 2DWEB 1LO5B 2H1PH 5AZ2L 2SEBA 1S7VB 3CVIH 2IBGA 3IMSA 2AQSA 4U6XB 4UB0L 5D1QD 1XH2A 4ATWA 3KDPB 1G9NH 4PREA 5KOVC 3HZMB 3DUUB 5KSAA 1MCHA 3RZWA 2ZKHH 3K6SB 4NN5B 3RTQC 2B4CC 1T1YA 3CMOL 2G9HB 4K7FA 3LXUX 3WGVB 4HOXA 3LRMA 3D5OF 5IBUB 2Z64C 1GHFL 2O6EA 1XSOA 3EH3B 2NOYA 3CVBA 2FYYA 1CGWA 3EBHA 5I1AA 3A67H 2F68X 4LVOB 4HWBA 1OAZH 2VERN 1GOFA 3FH7A 1D5XB 3VG0L 2YWYA 1QSFD 2NDGA 2ZCHL 3FU5A 1LQBC 4R26H 4F1SA 4HJIA 4YHMH 5EO1A 3B9KD 1GJIA 2P43B 5C0BB 2ZP9A 5B22A 4LKXB 4XO4A 3U9UB 2IANE 5T3XE 1JSYA 4QCIA 4Y9BA 5GS0H 1AJ7L 2ETWA 5D1XB 1OAKL 2AJ3A 3AGVA 1JV5B 3EYSL 4XRCA 4QO1A 1U95B 5AB2A 2X4QB 2XKNB 1SQ2N 4LLVB 4M29A 4NEHB 3N6YA 5LCVA 5CJXA 3K91A 3RUGB 4UQ3B 4X8JA 1LO4L 4OV6F 4HU8A 1DDXA 3NA9L 4PJDB 2DY2A 1KPVA 3F05A 5K9KB 4NGHH 1YDPB 4WLCA 2EE2A 3VSTA 2YJLA 4GMTL 3HRZC 2VDKB 5JBBE 2IANA 4FMKA 4YSCA 3TVMC 1TR7A 3HBZA 1RZQA 2EZ0C 3VCLA 1FBIL 4LSVL 3V4UL 4G1EA 2ZXEB 1XXDC 4D9LL 3T0EA 4WI6A 1G2MB 3HI1A 4L2YA 4KC3B 1EJ8A 1WCBA 2QKIA 5JOPD 2JKXA 3FRPA 1ZLEA 3IAQA 3PP3H 2WHVA 2BSSA 3HIZA 1INQB 1T04A 3SBPA 1GC1H 1NCOA 2J8UA 3L13A 5FX3A 4HH9B 4M8RA 1CI5A 2Z93B 3JV4A 3CZSA 4MDIA 3I9PA 4HXAL 3ARPA 4JM4L 1JHTA 1IM9B 1VPOH 1KEGL 3AWGA 3UJTH 4QOKD 4WQOA 2BIOA 2ZKMX 4M43H 3T65A 5EOTA 5ESVA 3VI3B 2N56A 4BZ2L 4QTFA 2HORA 4QXTB 2G60H 5LHDA 5C8JB 1BXAA 3LEYH 1U8PB 4TQEH 1AR2A 5DJXB 3RX7A 4PRAA 1IKFL 5IJDC 2DM2A 2FSEB 2J6EL 1QLRB 2XY1A 1J9CL 5A6MA 1ZK9A 4FEIA 3DV4B 4OFYA 3ZKMC 1LMJA 1YNLL 3T6WA 4IDJH 3KYOB 3IFPB 1FGNH 1ACYH 1BREA 3MRBA 1QSFB 4UF7C 3ZUNC 3SGKC 5E94B 4HZ1A 2QKIB 3PWLB 1TOZA 2BH0A 3MV9E 1J5DA 4DCQA 4W70A 4U0QB 4AM0A 1PAMA 3LTVA 4DEUA 5L2JA 2OZ4L 5IVNA 1ASPA 5A16B 3SGJA 4JKPL 1INDH 4XMLH 1A7QL 1G7JA 3QQ9C 2CQVA 3EGDB 3V0WL 5KTEH 4NWUL 3STLB 3MLTB 3IGLA 4I0PA 1EH9A 1CGXA 1YEDB 5L2KE 2JKWA 2V7HA 2Y6TE 3D9AH 1RY7B 3LZFL 4FQIH 4JL1A 1OZTG 4EVNB 1A5FL 1QP1A 5BXFB 3BOVA 5FUOH 2EIDA 4JQXA 3K2KA 3BDYH 4HKZB 4GMTH 4OFPA 2E7LC 3HBQA 4QYAA 3H8NA 3DX7B 4IU3B 4RS0A 1L6ZA 1ADQA 1XEDA 4QMEA 4OZIA 2HPTA 4NRXA 1N4XH 4IJTA 3BW9B 3F7RA 2QDWA 4AXWB 5KYNA 4L1HA 2CR6A 4JHBA 2IALB 1OAUL 3BW9A 3ARBB 2DICA 4GRWF 3WIAA 5IOKA 3TT3L 4PEEA 4YXHH 3LRSA 1E5BA 3C5ZC 2WYGB 1GSMA 3D06A 2F74A 2P8MA 4FYSA 3K46A 4NZTH 4JZJC 2Q2EB 3OZLA 2I9AA 1A7OH 2R0KH 3L3HB 2PXYC 3A4FA 5IFHL 3S34H 4J3OH 1S7VA 2PPDA 4PQXA 1WJ3A 5CKGA 5LN8A 3WY2A 3P1VA 2CDEB 5E5UB 1D7BA 3CFIC 5B3SB 1GHFH 3F00A 4Q52A 3TBYB 1D5MB 3F7LA 3RGBA 4PRNA 3VW3H 2IMMA 2H8PA 1RZ8B 3GSXA 1WHEA 4U6YB 1FFQA 3UO1L 1YQVL 3O8XC 4TTDD 2LLLA 5ICZA 3QYMA 2YHGA 5AEAA 3TVMA 2QPEB 1MY7A 4LP4A 1AKJA 4WV1A 3ZE1F 4O4YH 3FTWA 3HKFA 5AVTB 3EYQD 5I75C 2CR3A 3C12A 4LSQH 4PBVC 2BSCA 4PI2A 1USQA 1U9KA 4A6YL 1LPZA 1TJGL 4YVUA 4PGBB 4YK4B 1LM8V 1S3RA 1QSEB 5HI3D 4ZAKA 2DF3A 1GSKA 1FL3A 2ZOOA 2FWSA 1GJUA 1WA1X 3B2VL 4QRSB 3W39B 4KJYA 2X6CA 3EH5B 2APVA 1IFRA 5IW1B 4BFOA 2IDQA 5GGTA 1EVTC 5I17A 1XGRA 4D2NA 1NUDA 4OZHA 2G2NA 2FEEI 4OSUL 5DD5L 1GZPB 4JDZB 1D5MA 1DBJL 4NYLB 2DS4A 4HS8L 3VFRA 1ZVSA 3ULAB 1CBVL 1EGJL 3DK0A 5C6PB 4F5CE 1WHFA 1I9JL 2BHUA 2F54E 1II4E 1VA9A 2P52A 3FL7A 3O11B 1RMFH 2AMGA 2PYEA 1GS7A 1ZV2A 2JJUA 3QJQB 1KDIA 1NDMB 4NAMA 3UTTD 4JPVL 4E9SA 2OR9L 1DSFH 3W37A 1L0XA 1AXSB 3BH4A 3BQUA 3LC5B 2NY5L 4P5KA 4PP1D 4UM8B 5EBWB 1P7QD 3GD1C 1ZS2A 4JKLA 4KHXL 3QZBA 3BWZA 3MA7B 4HUKB 1I9JH 5CP3A 2AK4B 4KWUA 2PCFB 3FQ4A 1JF1A 4EI5D 1EXHA 2CUAA 2VJ8A 2A5UA 3HS9A 2I5YH 3H9ZA 5DZVA 5FYJE 4I18A 3QFJE 1U92B 4M8QB 1FIGL 3TPUA 4HA1A 3DPDA 4BSJA 5F0LB 3EYQC 4DAGL 3HMXA 4OZIE 4JMNA 2FEJA 5F9AC 1PD1A 4ZTOL 3FSWA 2VB5A 2VN4A 5FO9B 3J07A 2VXSL 2ENPA 5M7QA 2WVVB 2BVPA 2R51A 3SDCB 4TSBH 4HWZA 2WQ8A 3DTXA 1K3IA 4FQXD 4EVNA 2IFGA 4DGVH 2CGRL 3HR6A 5DEGB 4HK0A 3MKGA 4O02A 4CU8A 3WE6A 8CGTA 4X5WB 2FGZA 2TGFA 4XLWA 2HSIA 3FTSA 3SO5A 4GKZB 3Q5OA 5JBCE 5HHOA 4GAGL 4KUCD 5AOJA 2GK0B 4MNQE 5J11C 4I4WA 3RB7A 1JGDB 1XF5A 2KDGA 4QJ3B 1N2RB 3T9WA 3ESMA 1G9MH 1OWWA 1ZANL 4I3SL 4OQ1A 4AL8L 3GSNH 1CDGA 1F11A 3NEEA 1FO0L 1I0UA 4QXUL 1P2CB 2Q76B 3QRGH 3T1WA 1W8BL 1DP0A 4KKCD 3C9AC 4K8RL 4MX7A 5DJYB 3IFPA 3X11A 3ABKB 4ZX3A 2DLEA 3IMWA 1Q8MA 2VXUL 5L8LB 1E8XA 4PLJD 1GGIH 3AT8A 3EOAB 2X44D 4J4PD 5TQ0H 3X1NA 1T20A 3KPSA 1JZ5A 3DIVA 4RMQA 1LPKA 3CUPA 4PY8J 5D5MB 3AS2A 5EU7C 3LV3B 3EFDH 4MNQD 3KQCL 1PIGA 2M8XA 1FZMA 3F7PC 4NFCA 4EDWH 4YK4C 4PJ9D 4BK4A 2J3SA 1WRFA 3MODL 2BC4B 1U8MB 4HAFA 4UT9A 5JPNA 1YC8A 5ESAA 4J4PA 2D7PA 4P07A 4APQA 4O2FB 1OGAA 1N4XL 1T5KA 1HFUA 2XU9A 4DP8X 1YYCA 1ML0A 3BDYL 5T1KB 3ARBA 4GUQA 2UWLB 4PS7A 4HJJH 5I76B 5B1JA 3TWYA 1WO2A 2WO4A 2WWNA 1EPHA 5EU4A 4XNDA 4JFYB 2R56L 2ZIDA 3HE7D 4B3VA 1R3HA 5D55A 4FKHA 3V4PB 5KTEL 4LCWD 1NEZA 3VFVB 1AS7A 1CT8A 1XGYH 5ABZA 2BP8B 1QHOA 5C92A 2E4FA 1XCQA 3BGFC 5IV2B 3KLSA 2JELH 3P9LB 2M26A 3R0MA 4XN7A 1IAIL 3RGVB 1A7QH 4PREB 1IB5A 1TPXB 2V3DA 1F1DA 1P4LA 2KMWA 5C0BE 1YMHB 4ZS7L 4AJYV 4WWID 4TQHA 5DMGD 5AVRB 1MFBL 2WQVA 3GXPA 2B1AL 4RWYH 4JFVA 4LLQA 4BH8A 5IEHA 2DEXX 4PLOB 4Z95H 1DE4A 1XGYL 3HZKA 5CMAA 2NNRA 1DQQA 1IV8A 1I8LC 3D39D 3MZTA 4PG9B 3W9DB 4XNMA 4RMVA 3P4NB 4IOSD 4BDVB 3QIUC 2VJXA 4GG8B 1RZFH 1XXFC 1Q9OB 2VDML 4YZFE 1DVTA 2WWMD 3T3PE 4RVBA 3FF8A 4OLYL 1MCLA 2WQSA 4OT1H 4DEPC 4F3FB 3KYKL 1EAOA 5DJ0B 3REWA 4L8BA 3NTCH 1RAMA 5HHVL 1ETZB 1GJWA 2C34A 2WBWB 2IOIA 2HRPH 2YZ8A 4OZGE 4X9FA 4P2OB 3HRZB 1DQVA 1OF0A 3E0GA 1S4IA 4GPVA 4EPSA 5HYJE 5DHMC 4XNZB 2WWOA 4HBQA 4I85A 5B3NA 2VISB 3S37X 2AC0A 3OKMA 1I8MA 4U05A 2AKRA 4W9CC 3ZN6A 5ADPL 1GC1L 1A6WH 1CLZL 2ZP0T 5AALA 2VZTA 2YKLL 1FZKA 5AW2B 2C9PA 4LASL 3BEVA 5E2VL 1KJVA 1C5MF 3ILPA 4P48A 1T04B 3B2UD 2YA0A 2EVIA 1QQDB 3VMOA 5I8OL 1AYOA 2Z1KA 4M4RB 2FO4A 3KLKA 3FB5A 2FBOJ 1I3RA 3KPQB 4YLCA 1AO7A 1I7TA 2WPJE 1ANUA 1BFOB 1JERA 2XWTB 4YO0B 1BOGA 2UWEF 5B39A 1MAMH 1FFPA 1UZPA 3C9NA 4FTDA 3TBVA 2A1WL 4ZMNA 4WI5A 4LHUD 5I23A 3VH8B 2XC0L 5I19H 5CEYA 2FBRA 4JJOA 3WNNA 1L9PA 1U8CA 5KN5C 4QRQA 3D18B 5IJVA 4AK1A 1OCWH 4IU2A 4L1SA 5DD6B 5LAXA 5DQ9B 3VWJA 1S7RB 1MCPL 3QBTB 1F1GA 4GUCA 4XP9L 3MTXA 1EXUA 4M7ZB 3LHPL 2PO6A 1EANA 3GHPA 2MKLC 5C0DA 4W6YB 5IVXA 4Y9GA 4CVZB 3ZLQC 1YEKH 4F7CA 2ZKHL 1FN4B 4J3WA 4Y1SA 5J3HC 3WJLA 4HLEA 5FOBA 3QT2A 3MBED 5GSVA 4MZ3A 3ZE0B 5M95B 5C6TH 4OZGF 1OB1A 2JE8A 2R1XB 1PG7X 4XN9A 1AC6A 5EUOA 4NAQA 3RE0A 1P7HL 2HB0A 4HUVA 4ADJA 3WE1A 1S7SA 2CH8A 4HGWA 1Z2KA 3V5DB 4G1MB 1UGNA 3LOWA 3HFFA 3APFA 5FFGA 5FK9B 5JPMB 1OK8A 3NIFB 3GSRB 5GS2H 4H1LH 2VLME 3OAUH 3WKYA 3MJ9L 1DQTA 4L0ZA 4OZHF 4RMTA 4ERSH 1BWWA 2GIMA 4LEXH 5C3LD 2J20A 1F13A 2WYHA 4HFUH 1QZNA 4NZUH 2AJYL 4IEFB 3EUDA 4JZJB 2IH9A 4OLEA 4WEBL 1HSAA 2UWEE 3EKCA 1JXJA 5F44A 2QV2A 4FFTA 4MAYC 3MJGX 4WJ5B 3LNDA 5I5RA 5EUOF 4A2FA 2X70A 2I9LB 4NO2B 2NY1B 5SX5K 5IF0A 5DEJA 4G83A 32C2A 2QVTA 3FMGH 3M7FB 2IF7A 4YXLL 1SJHA 1S8DB 2X10A 3BMVA 4QAWA 3UH8A 1E90A 1PZDA 2VO5A 3ARWA 3GSUA 3H9SA 3QQ4A 4P2QD 4ONFH 2AK1L 3WHE1 4POYA 1MJ8H 1P0SE 4NXSA 2VWEE 2NY2C 4LU5L 3TGFA 4NQVA 1FHNA 1MOEA 5HHXL 4NN6B 4KI5D 1SDAB 4PWFA 3CPLB 3ASIA 3RWGA 3OKDB 3IMBA 4NZRH 5BW7C 4XPTL 4LE8A 4LK4A 5EFIB 3QDMD 4XP9H 4W81A 3FUKA 4WO4D 4YBQD 5CEYB 4O58H 1BIIA 5IMKA 1WFJA 4QHKI 3MUUA 1YN7B 3PHSA 4M62H 1NL0H 4NERA 4OJDH 1NMCC 5T3ZH 3VRIA 3BKJH 1DUYB 1JPSL 4WSGA 3WTVA 1AXTH 4LAQL 4FFWD 4N90D 3M1BA 3EFFB 4LF3A 2P3FL 4QWWD 5MHSE 2OW6A 2AEQH 3PP4H 3ATDA 1HRFA 1NGWA 1YAIA 4CKQA 5A2BA 4M4RA 1RHFA 2EVGA 5LNEA 3KPRE 5E6YA 4K15A 4KKAD 3UBGA 2Z92B 2UZYB 5LWYH 2J4WL 4QXGH 2V2XA 4QHLB 3VQLA 3G5ZA 4QPEA 1YVLA 4Z77B 1DO6A 1PSKL 2IH8A 2EEXA 2ILLA 1KJ2L 1R46A 1EJOL 4FQ2H 1ID2A 5DXWA 3MBWA 4YDLC 2I85A 3C6SB 3SPGA 3S3CB 4N4YB 4UTBA 1A21A 2JCWA 1BVLB 3V79C 4P23A 2LFEA 2WKGA 2QSCL 3ALWA 4FQIL 2GAZB 3D8MA 2WLKA 2WMPB 2P3FN 3HAEG 1FLRL 2UV3A 2G5UA 3PY9A 1G1RA 4URKA 3TWCL 4JO2L 1LHZA 2VR5A 3HI5L 4R4FL 3K72A 2YSTA 3SGDI 1NLBH 4FQLL 1KCSL 1ETA1 4X9IA 3TIDA 5CZKA 3NQKA 1H8LA 5F72S 5FFLA 5KYYB 3ZL2A 1QNZH 4CADB 2UZIL 5TDPB 4KH9A 4UQBA 3QEGH 1VB9A 3TYFA 3P73A 2JLLA 2ARJA 1EK3A 2OPCA 3GJFA 3KPNB 1PTZA 2BWIA 2FL5B 3T1FA 2FZZL 3BPSE 4LPCA 1PZCA 2JVUA 2YXMA 1PD0A 1IO4C 2WXIA 3FUDA 3AXLB 2A9NL 2GJPA 5FCSH 3N55A 1X7AL 1JGEA 4IMKC 1K9TA 3GDBA 4YC2C 1OT2A 4HX1A 4JK0D 1NFWB 3DXAB 1JUFA 5LGJA 1PZBA 5ANME 5HD8C 1JK8B 1QNIA 3EFOB 3LEXA 1A7PL 1A9EA 2LV4A 2YD3A 2Q6WA 4X8TL 4Y2OB 5J12C 1KCVH 5BRZB 4Q0XL 2ENSA 1Z9LA 4Z7QF 1JZ8A 1BW8A 1U8IB 3Q48A 4LGRB 5JNYB 2V5TA 1M2OA 5ICXA 1EHAA 3C6SA 1DN2A 5EBMA 1MRDL 4FLQA 4HCIA 5B1CA 5L4MA 4S1QL 5B7EA 4FQXC 2ADGB 4RFOH 5I1DA 4XI5C 1D2PA 3ZXAC 4K9JA 4XO5A 2J5WA 2VDKL 2XPGB 2XWBA 3C75A 3RX8A 1ND0B 1SNRA 3MV8B 2DQGH 1M3IA 2WOBA 3NZ8A 2OM5A 4HGMA 3RDTD 3P2BA 3KPMB 3MRNB 4RGOH 3MLPA 4G80B 1T21A 5HDWA 3QPKA 5MERB 1NCWH 2YMXH 4U6HB 3CFJA 5C07B 1X5ZA 1LDSA 2ESVD 2P9RA 3HBGA 2Z4TA 3D0VB 4JANB 4AZ8A 1WFUA 4ETQA 2OCFD 3MV01 4LPYA 4HQQH 4MX7B 1OAKH 3F01A 2K0RA 4A2LA 4XVUC 1NAMH 5HGAB 5IR1B 5IKCB 4Z95L 3EG9A 4MYPA 4ODXB 1G7IA 4PG2C 1UZ8A 3HN5A 3VXNA 1OVZA 3QG7H 3DNKA 4K8RH 2VRAA 4MJHA 1C9SA 4DHLA 4JG1H 1V05A 5HYFA 1W72A 2N7SA 2P8LA 4Z3JA 1FO0H 3UTPE 1R3KA 5JOFA 2YAQA 1E9PB 5FLVA 1YUHB 3IRZA 1N0XL 3IITB 2O6PA 5DJDA 1N68A 4TQPA 4P9HC 1R5VB 1T4WA 4JFPB 4A7SA 3HFMH 3ZZQA 2Q87A 3AUWB 5JW3H 4ANWA 1JFHA 2J71A 2EH8H 1ZLVH 3TH4T 2VWEC 3G7TA 4PP2A 3LS5H 3C08L 4LCYA 1M71A 2ZYIA 2I7SA 5AZEL 3B7SA 4BSWB 1LO3L 1FVCA 2CA3A 2FLRT 1I31A 1KENH 2PPEA 3BX7C 3HOGA 1J9SA 4OD2A 4X6DB 5KBMA 5GGTH 1G43A 4Z7QE 4TSBL 2KZ1B 2XBVL 1DBBH 1J9QA 5KAQF 5DVLA 4DP9X 1Q0XL 2WMPA 1FYTB 2XACC 3WTWA 5F3HA 1EPJA 1I9EA 1PSKH 1YGCL 1B90A 2VQ4A 4FCAA 4G71B 3FQXB 1RUPH 5KBPA 5I71C 1MFCH 2NUPB 4DWHA 5C0FA 5KW9L 3VFWB 3ZYZA 2VUYA 4RGNE 2RFXB 5I26A 1BQUA 3QG6B 4NNYA 4E42B 1T4KB 3I6KA 4PY7A 3MV9A 5C0CB 4FG6C 3D85A 1D5IL 4JRXD 1W72L 4HJGB 4QF1A 4H8QA 5F3BA 2HLAA 3GHEH 2ZNXA 2NY1D 4YBLB 1FWXA 4HKJA 2PWHA 4YVNA 3VGGA 3HKZA 2DQCH 2H41A 5EEXA 4N22A 4P0DA 5TPWL 4KY1L 2R69H 4N2AA 5E7BA 4JQIL 3FHEA 4ORGA 1IQFL 1A6VL 2WLLB 4MVBD 2QMKA 2UUDH 4L23A 2HFGH 4GIPD 2K7QA 4TUUA 1PS3A 4XBMA 1BX2A 4KXDA 3PXHA 2EC8A 4N24A 3N43B 3L3GA 2A0LC 3VI4F 2E0PA 5EOCJ 4Y8AA 3DO3A 1VADA 1ZHNA 4J12A 3MLXL 3K1DA 5KVDH 4M7KH 4DTGH 4JPKL 1HZHL 4ANVA 5KN5B 1SHXA 1U58B 4HWNA 5CJXC 2QGCA 1U2YA 3IB4A 2NY7L 5ABAA 3T2PA 1T1ZA 2JQZA 1SXAA 3ZDZE 1M56B 4U1KB 1IZJA 4N2HA 3F83A 3JWDL 5HDQH 4ZX6A 1YEWA 2LLGA 3WJJC 4MAUH 4IBTA 1JGLH 1ADQH 3FO1A 2Z7WA 1RZJL 4ZO6A 1IQGL 2H6PB 4MJID 4XCCL 4Z7OF 1NCJA 1P7KA 4YPGA 2AXGB 2BSDA 4ZAEB 3I02B 3G6AB 4HWBL 2IWFA 5J1AA 4WUUE 1RIHL 1MFAL 4L37A 1U36A 2GBAA 4LCUA 3BUTA 3VXSA 4H2CA 3ZDYB 4FNLL 4JHUA 2XWZA 3L16A 2WG3C 2XV0A 5BCAA 3LYRA 3RZCC 2LW3A 5GHWL 1AMYA 5BZDA 4M61A 1AGCB 3LNIA 3V0JA 3FQUB 3QSKB 2VN6A 2KV4A 1A7OL 1YYMH 2R0KL 1OM3H 1DVAL 3GHEL 3L7EA 3EOBA 1AYRA 5IHWA 1FF7A 4LHUB 4LKCB 3N9GH 4DKEL 4OU3A 5FLUA 3S3PA 3TS8A 1K4DB 1L0QA 2IPTH 3VGEA 1IM3B 2P8PA 2XWEA 3FHQA 3UL4A 3KVPA 3VXTA 1LO0L 1Z5LA 4JFWA 3PDGA 1VENA 3GJEB 3QH0A 5KW9H 1KNOA 1E9OA 1TOXA 3DX8A 2BIMA 3MRGA 1WP6A 1AAJA 1CD1A 1LWHA 5BV7H 2BOHA 4YMPA 3SSGA 1KG0A 2ZXDA 4ELDA 1CGVA 3I6LE 3CHRA 2GSIB 3NIDE 3MMEB 2HX8A 3A6BL 3FO2A 3P3YA 1RD6A 4R90H 1X5XA 4S1RL 4LSQL 2J1YA 1XSIA 4PJHF 3Q1SH 4YSOA 4AQOA 2LU3A 2IBBA 4Q89A 4ABUA 2DJMA 4PJIF 2VKXA 3BAIA 3BUPA 5CWSB 4PS4L 4HWUA 1GOGA 3NJPC 1QWHA 3NIGE 4ODUB 2I7OA 3O4LA 2EDLA 3DI2B 3SCMD 2FD6H 3PHQB 4DSYA 4E9LA 1HREA 2AJXL 4KJWC 2AABH 2PABA 2KC0A 4FXKC 5BVJB 1RHHA 1WTGT 4FC3E 3T0XA 1DQML 3EH4B 1TQVA 1I7RB 3VH8A 5DCCA 2X4RA 4O2EA 4QOKA 1D7DA 3CK0H 3DVGB 5B1AB 1FNHA 4FQJH 3RTQA 3UPRB 1OGAE 1ED3A 3ME0A 3ISWA 2QSQA 1BQHB 1M7DA 3RIFF 1EGFA 1I9IL 3DSNA 3LDBC 2OYPA 3DUSB 4WKXA 4L8SC 4B9FA 1QPPA 4HIXH 3NZUA 3VXRB 2V9QA 5AVVB 4MYWB 2VABB 1QBMH 1A6UL 2WANA 3G5VA 1BQHG 4FKEA 1B4JL 2HRHA 3GLAA 1BG1A 3TK6B 4HP5A 3WNJA 1C16A 2BNRD 2HRPL 5E2UL 2ZUQC 3QIBB 4Q6IB 3ECVA 2RBLA 3APCA 1GKOA 1A6PA 3K2MC 4ZPTB 4R96B 3B2DC 1KYOJ 1WBYB 2DQGL 1OSZA 5E4EC 1RJYA 3IVKA 3IM1A 3GPSA 1B3IA 1NDTA 2F9BT 4TPRL 3WSQH 5K5YA 3D9AL 3LZFH 3TBSB 1HKLH 1P4IH 3BGMB 4NUGH 5HGHA 1XH0A 5DJYA 1BVOA 5I8EB 1IMHC 5CXPA 2XTSA 4FXGC 3SPCA 3Q7JA 1E5UI 4N0FA 4U1JB 2NYYC 3OSKA 4PJFF 2MNUA 1KSNB 4GBXD 4LLVA 4MXVF 3ARFB 3AG3B 5T3XH 3P54A 4QO1B 2FBJL 3RWCA 5A3IC 4Z8FL 4OCXL 2AP2A 1IJ9A 4QRRE 5IESL 2P1YA 4P3DB 5IHBA 5J56B 1TZAA 3NCJH 2DBLH 3BRDA 3QIBC 4G8FA 4GW4A 1R0AL 3WL9B 5B8CC 1TCRA 5T1LB 1H8OA 5JW1A 1P6AB 2Y7QB 2HTKC 2D9CA 2YXWA 3SDCA 5SX4H 4PS4H 3N1PC 1XKAL 3QEHA 4BXSA 1Z6CA 4PRBA 2JSFA 2KPNA 2EIEA 2E7HA 4KUZH 5C7ZA 3MX0B 3QEGL 4ONHB 1ORQA 2CCVA 3IJ7A 3NQIA 1NAMB 2NY4C 3ZZLA 2WGXA 3Q1SL 1JCVA 2X9WA 3MX0A 2NX5A 2Z35B 3CVCA 3QHZH 4P5SA 5CISA 4X7EC 3RWHA 2EXWD 2J34B 1CYGA 2UZXB 1YJDL 4OCNC 3N1FC 2PUQL 4QYOA 4CJ0A 5J13B 4H25A 3PWPE 3KWVA 5HHMD 4AC2A 1BWMA 5CGBA 3C6LB 5AVXB 3H54A 4P4KA 2ZG2A 1JNNL 3H55A 3CX5K 1M3JA 3DGGA 2ZYSA 1RL1A 3MGOA 4N25A 5E24E 1MVFA 5FO8A 2EDTA 4I1PA 1IQIL 1FZOB 4ONGL 4UB0H 5E6IC 3GFUA 3CQQA 4I48B 2L4OA 5GHWH 1KPUB 1N64L 3DSNB 1AGDB 1BDYA 3ILQD 2X89A 1SYSA 2NX5E 2BVOA 3KPSB 1F7EA 1EJOH 3E1ZA 4FQ2L 3GXFA 5BRZD 1WT5C 2FTAA 3WKPA 3K6DA 3IEAA 2J4WH 3NCCB 1YJDC 3FFCE 3K0WA 4X4KA 3RI5F 3LNEA 4M7ZC 4F7MB 1A3RL 1AOHA 5DO2D 2EUVA 1IAMA 3OB0K 4KJYB 1BFOA 3T6VA 2KHAA 2H2SD 5IB5A 4C8XA 2NY3C 4YHYB 4S0HA 3BZ5A 3FULA 3GZOA 3RTQB 4MJ5B 4EZJA 3UPRA 3DVGA 4XPBH 3BAWA 3O3DA 3SDCD 2K9UA 1FG9C 4NUJB 5F7KC 4X4YB 4XCCH 4JPWH 1LD9B 1SLWA 1EX0A 3MJ9A 4GRWB 4KAQL 2O1AA 4MMXA 4DPBX 1AKJB 1T0MB 3MACL 2E75C 3A67L 3PWUB 4XMZA 2VN5A 3ZO0A 2JQMA 4UTBH 2F5BH 4P2CG 3RIAK 1WSST 1R47A 3CQPA 2NY7H 5EZJA 3X2QB 4UTCA 4EI5B 4PGZA 3BLKA 4KPHH 1A4KA 1K5NA 5DFTA 3RDTC 1LK9A 4ZS6C 2CDEA 4TVPL 4P2OA 1NC2B 5HDOA 2AXJA 1DBKH 1QHQA 4G8AC 5CHNB 5GGVY 3TN0B 2E9IA 5FV1L 2WUCL 3IDIB 4Z18A 1GYUA 3LTGD 5CJQL 4PTTA 3BGMA 1ZTXE 5HGHB 2DJUA 2WUBL 4AEIL 2BMGA 4ZK8A 3WLWC 1AD9A 5I1CH 4JN1L 3ZIMA 2DQCL 4GG8A 2APSA 2NQCA 5IJKA 1HDMA 2R0ZH 3B9VA 1P9MA 2ICWA 5HI3C 5KZCD 5JB8E 2YEZB 4KY1H 4WFGE 3BSHA 2AJYH 3WIHL 4YR6B 4LDEB 1EHXA 1X5MA 1CD0A 3RDJA 1JWMB 5JVYA 5FYKE 3KXFE 1FI8C 4WU5A 3Q01A 4OI9A 4H2AA 1S9YB 4WEMB 1MHHB 3MA9L 5LO7A 3IDGA 3ML9A 2WNKA 4X0NA 3U6RB 1NBYA 2WUBH 4RDQG 5EBGA 1ZKAA 2CLVB 2Y4SA 5CILL 4M7LH 7PAZA 1HHGB 3PQYA 1AZVA 3BVNA 4W6XB 2JJWA 3TBSA 3ULVH 3PPSA 2PPCA 4HHAA 5IBLD 3MC0A 1XR9B 4PGBA 5EOCL 2QGBA 1UA6L 2B08A 1YQVH 4D9RE 1RULH 5IB3A 2Y38A 3HNVH 4AM0B 4XXWA 2HJFB 2ZXWB 6PAZA 1FDLH 1MI5A 3MNZA 3ARTA 3PABA 3PHQA 2YBRB 2KI6A 2VXVH 3HG1A 4M3HA 2BC4A 4A67A 1NGZA 2N1TE 4UAOC 3QWNA 2WSPA 4CMHC 1X5AA 4K3HA 1TEFA 1U2HA 5KIRA 2LAGB 4ZOEA 2CRYA 2QQQA 5FDQA 5D1XD 4XPBL 1HNGA 1H6TA 1UM5L 2AJSL 1BLNA 1S78C 4OJYA 4HWEL 3QDMB 3MGTB 4P5RA 43C9B 1CGYA 4XCFH 3TEXA 2Z65C 3NUKA 4BTIA 2MPVA 1WF5A 5FA3B 3VGHA 4DNLA 3CIAA 1JCKA 2Z35A 4HQQL 3T0EE 1S5IH 2VWMK 1KXTB 3QI9A 5FGBA 2O72A 5EH1A 3DTDA 5DRWB 1KJ3L 1KIRB 5GS3A 2H7WA 1PFCA 1O9ZA 5DRZB 3DETC 1RLBA 3KGUA 2P47B 2DIJA 4XCEA 1N12A 2E59A 2FLBT 2XOTA 1ADXA 2YPVH 1IQLL 4NDMA 5D1ZC 1IGYB 4WO4A 3L4TA 4NLAA 1LWJA 3O8XA 3MRDA 4GY4A 2CO3A 2CIIB 2K45A 4NZ8A 1EMTL 4XZ4A 2ADXA 3VVVA 3QRLA 5BZDB 4OD2B 2YD9A 4K2UL 3TN0C 1JVKA 2DQEH 4OJFH 4RRPM 3BVWA 2X2UA 1FCCA 4Y5VC 4MXVE 3UACA 3VXSD 4KK6C 1A14H 2GSGB 1BP3B 3MLZL 3VFSA 2XWCA 2NR6A 3MCKA 3FCSA 1T0OA 5ABDE 2MQGA 2J55A 3G6AA 4LOUD 5HHVH 5J1AB 5D2LA 5HHMB 5HJDA 1AY1H 2NW3A 1TETL 2DQTL 2G3ZA 4PG2A 4JN2A 1NWOA 4OLYH 1PZUB 3NSCA 1TTUA 2CDFB 1HHIB 1PNCA 4EN2A 2WXOA 4TSCL 2WLIB 1JYXA 3SIKA 1I1FB 2AFNA 4PV8B 5ISZB 4U1KA 5CR1A 5JPNC 4JCWA 1AXSA 4HIXL 4PUBH 5JHLH 1VACA 4M00A 3L4YA 1AR1D 3L4XA 4GO6B 1XAKA 2Z34A 3RGVC 2VLJB 5DTFA 5D4JA 4BQBA 3KRKA 4FI7A 3RIAF 1M05A 3LZLA 4XN5A 2OR8A 5ITBL 4TOYH 1VJSA 4XPAL 2ICCA 2ADIB 5CKQA 2B1HH 1IGTA 1RZGB 2F54A 2HP4A 4JY6B 2BZ6L 3WEXA 2JELL 4HXAH 1IAII 2CUMA 3WHXA 1HHJA 1FFNB 3SW2A 3CLFL 3P9MA 1S2EA 5D1ZD 1A8ZA 4X5RA 5DK2B 1HNFA 1IGZA 2IPKA 5DRZA 1CU4L 3QORA 4EXPX 3ZYIA 4ZMYA 3ZDXB 3CFJB 5C07A 5FWRA 3V9CA 2E27L 4ZMVA 4GS7C 4FCHA 4PJCA 3RPIA 3VXQA 2FIRT 1S3KH 2XTJB 5EBMB 3WKQA 3UERA 4Z78B 3F2LA 4MWFA 2RCSH 2NY0D 3VXQB 4M6AA 3S35L 4JY4A 1LMKA 3GIZH 4UUJB 3IDMA 1NGWB 1WYJA 1UZ8B 2LTQB 3HW7A 3IK2A 3D87B 4FMVA 4E42A 3MODH 5DHVH 2DWXA 1H3GA 1S5IL 1TKWA 2WZAA 1H6FA 1FA4A 4J39A 1W2KT 3KYAA 1XEUA 1QBML 1X7QB 4PRHA 1E30A 2HLFD 5FYJL 5K9KA 3U0TA 1V10A 3EYOA 4QT5B 3EFOA 4RMSA 4QR7A 4FXTA 3I6GA 1IOEL 4WENB 4XCNB 4AEHH 5IQ7L 3U7UG 5KS9F 3KH3A 1RZ7L 5G4OA 3L3IB 3NMEA 1M6OA 4M62L 4S1DD 3EBIA 1NJ9B 4H5SA 1M71B 4J7RA 4QRTA 2P44B 4P5MB 4ANKA 2OJZL 5AW9B 2Y82B 1DQMH 4AE1A 3HC3H 5D93C 5FV2A 3D30A 5KVGH 3GJEA 1F1AA 3HNSL 5GS2D 2W60B 3V55A 5BS0B 1H9DA 4PRHE 2WUCH 5IM7A 3UG3A 4NSKB 1BM3H 4JY6A 4D0DB 3RPBA 4WTWA 3K6OA 4LBEB 1QTSA 3MRFA 2UXGA 4OZHE 4RETB 3KS0J 1S7TB 2VDQL 3UAJD 1NPEB 3BP7B 4FA6A 1O9WA 2BWDA 2HTKD 4DFHA 3MLRL 1HS6A 4OGXL 3AQYA 1DJZA 1YECL 1YUFA 4R4BA 3UIYA 5L2YL 4O2CA 5L0QB 5LNGA 3B2MA 1P84K 3R7QA 1UWYA 2Y9RT 1AO7D 2IQAB 5FGBC 3UAEA 4AGMA 4FABL 4FP8L 1CXEA 1S7XB 3HUJB 4JM2A 1SY6L 3LIZA 4ISHL 4ELME 1LEIB 4F7TB 1GXEA 4F33A 2GIYA 5F6IB 4N8CL 2DDQL 5DWPA 4AGNA 4LPVA 3SGEI 3V2AR 2IGFH 2IGTA 2MFNA 4F8OA 5F9JB 1A3RH 1ZA6B 4FKKA 3GI8H 3GUTA 4HUUA 3BE1H 3ZYIB 3OAUL 2Q20A 4N8VA 3PQYD 5F1NA 2VM4A 1A6VH 2XX0A 4I0PC 4F58L 3LN9A 3KYOA 3MRBB 2YFOA 4HSQA 5F6HI 4WHYG 1CBVH 4M6NH 3AREA 3SZKC 3ULUL 3Q8BA 1MCSA 3CH8A 2A0LD 5L0QC 4BQ8A 5IWLA 2DDQH 3HMWL 5DZPA 5GRUL 4G7RB 1OQXA 1B9WA 1ZTMA 4GG6B 2Z3FA 5FYLE 3DYOA 3FPYA 4IBQA 3SDAD 3C5ZA 2HX7A 1JTPA 3QRFM 5LBGA 4Q9BA 2OSLA 2A83A 4UTBL 4R4NC 4PPTA 1Z5HA 5SWZB 2AQRA 3PJLA 4IK6A 4K5LA 1FVDA 4LRNL 3NPSB 4MNQA 4PV9B 2NW2B 2J56A 3ZGHA 2UVEA 1OQOA 2ADFH 4EN3C 2P94L 3X3GH 2QTVA 4YBLC 1X7TA 4NOBA 4ELKB 1NBVL 4IOIB 2V8LA 3WEAA 1IZKA 2B4CL 5C0GB 2G9KA 1H5BC 4YAQB 2Q8AH 2I9LA 1OAYH 4NO2A 3ZKMD 3T2QA 2C9UA 2NTFA 4LLAA 5HHPA 3VW3L 4Z9KB 2J12B 1XGTB 4WGVB 1F4YH 2WXNA 5I0VA 1XQ4A 2CBTA 3OKYA 5D93B 2JMRA 2DBLL 1CXLA 2BZCA 1CZ8H 4MXQC 3DMMC 1F90L 1AD0A 4EZKA 3UDWC 4WWNA 5ISZA 1XD1A 2AK4D 3IBEA 3RUGA 3TV8A 2X09A 4LBEA 4PU2A 1E4XL 5C08E 4AYSA 4MHHI 4JG1L 4UCFA 3L9YA 4WEEA 1KIGL 2H0FA 2PCPA 5GGRA 4ONOA 4CSTA 2ARJQ 5D7IE 1YN6A 1JF6A 3S4SA 4CDHA 4AJWA 2FQFA 4YUEL 4UNIA 1FL5A 2A74A 4APQD 3WUZA 1C8QA 1Z0MA 5B7MA 3GSRA 1SJHB 4QTIL 3AACA 3GWJA 2YAEA 3LAFA 1HKLL 1V27A 4W9LC 2X4UA 5HDBB 2HVJA 3KJ4C 3O4LE 4XZUB 1KB9J 4R4ND 2EXSA 3RJDA 4UQ2B 5I28A 4G8FB 1C08B 1FNEB 2E6QA 3TNNA 1FNLA 3BH8A 1SJMA 4NO3A 3KNBB 4QRUA 1SN5A 3LQMA 2N0KA 3ZQWA 1NIAA 4KVCH 5KG9B 1TJHL 3L8QA 5TDOB 5I66B 1RZKH 3S6XA 1CF8L 3GBEA 4UDUB 1O0VA 1DQDL 3D39B 1QI5A 3UYRH 3ULUD 2GG1A 4AQAB 1LO5A 2F1BA 4U1JA 3GT6A 4ES9A 2HJKB 3D48R 5C0AE 3UTTA 2ZWZA 4G6JH 4JKPH 7TAAA 1C1EH 1I1AA 2G2RB 2RJMA 4NNPL 4U6TA 5FYLD 3ZMEA 1F2QA 5MI0C 1XCQB 2BOLA 5IV2A 3NTGA 4PJGA 1NFUB 2XWTA 1OOWA 3U48A 4OD1L 4YEEA 5BZZA 1M7UA 3U1QA 3INUL 2DKUA 3ZTEA 1L9MA 4TUKH 4KO5A 3U4EB 1PX3A 3FTGB 3M07A 4ZOBA 3CV5A 4R7NA 4WIQA 1QFUL 3E3QE 2XBWL 2GHWB 5IB2B 1FFNA 1P1VA 1AGBB 1IAIH 3QHFL 2P5PA 5D1XC 4BFNA 4PB0H 1XF2A 1BIIB 2XG4B 1QSED 4JREC 5IMKB 2FLRL 4HIPA 2D0HA 3WS3A 3FUNA 1U8LB 2VQ1A 5DI8B 1R75A 4QHNB 4LARH 4PJAF 5EZOH 1JP5A 5GPRA 1E28B 1BQSA 4HLJA 1VKXA 4BZ2H 3LKRB 3V6OC 1PW3A 3LQAC 3HPJB 4WTZG 3HBPA 2YBGA 4U33A 3CUPB 1AY1L 1JD9A 4R0LA 1UVQA 4K94H 4JG5A 2Y1YA 2WTRA 5E7FA 3EADA 3LQZB 2JI1A 5IEKB 4POUB 2PWDA 5IB5B 1FG2A 3GPEA 3BPCA 2HT2D 3MV7B 1ETZA 3GMQB 3QA3A 1E42A 1KOAA 2FO8A 3IU3B 3BRGC 4XVOA 4MJIB 1U4EA 4B5EA 3BSZH 4GI8A 3P4MA 1HCZA 3GJFB 4XBEL 1FLRH 2WB1A 4IRSD 2IPTL 3OJDB 3TASA 2VXUH 3G08A 3PJSB 4N2DA 4PJEB 1HJBC 4XC1H 1XF1A 3V0GA 4E41B 1Y18B 1LK2B 3GLZA 3LN5B 4XI5D 4JFZL 3NAAH 2P42B 4IHOB 2WZPP 1E4KA 4FNPA 2KYIA 3WG7B 1M7XA 2D7OA 1DLHB 3D1MC 1UWXH 4L8SB 3TH3T 1UCTA 1IC4H 2AABL 4H26A 5ALCH 1ZLSL 1UWGH 3NDYE 3OHMB 5TE7H 3RFZC 3GBNH 3VWJD 1IC0A 4XCEB 3B2XA 1RIHH 1OGSA 3DDFA 1BZ8A 1GMEA 4KXZI 3ZDZF 4AQ1B 1L9OA 4NENB 4FG0A 2OJEB 3FT3A 4XCFL 2X4OB 5CEZH 1B0RA 4JCMA 1AHKA 5HI4D 2YOCA 1IE5A 3UJIL 2IWKA 3GYRA 1TCMA 3C5XA 1LQDA 3CDCA 1GMIA 1PFOA 3QEHB 5LBSL 4P2RB 3RJQB 4ZTOH 4TQIA 3VD5A 3BVTA 3P77B 3QS3A 5EU3B 3DJSA 2GJJA 1FIGH 3KPRA 5AB0A 2JI2A 4UM8A 1YEEL 2VXVL 2WNXA 3JTBA 5F70A 5IVXB 1UVQB 1JZIA 2E5EA 4WCYL 3HVDA 4EZMA 2KT6A 1VLXA 5KVDL 4N0UA 3AG2B 3WD5H 1KXVC 2F53D 4RRWA 4IRZL 3FO0L 4FYTA 5AG8A 1E8WA 1MLBB 1SOQA 2ZUYA 3MQIA 3L4VA 4U0RB 5GRUH 4IRSA 3MRCB 4YXLH 2C4FU 5KOMC 2Y3AA 4I5BA 3VFRB 2XG4A 2QLYA 2WBJD 4K73A 1IAIM 3LX9A 3JYBA 4JYUL 5I8EA 2PTTB 1ZDQA 3UTSB 4YHLH 4IRJA 1B2WH 4KRPC 3TBCA 5I71B 4GLRI 3TCTA 3QO0A 2VDNB 1L0YA 1OT1A 2Q8BH 3TT1L 3EOTL 2XNAB 4UYPA 4YWGH 3N5AA 4ZFQA 2WWMC 3Q05A 4POZD 4HWBH 3QJUB 3H9SE 3NN8B 5GRVK 3VSUA 5EEUA 5DJ8A 4YUEH 2XBZA 4MAYD 1I3GL 3OG6B 3HG5A 4MNGB 2OAAA 5D71L 1NGQL 1MOXC 5T3ZL 4PJBB 4NQXB 4AYFB 4P4KB 3G04A 1E3ZA 4WVRA 1RZKC 5E70A 5ICZB 2AXHA 2BY1A 3P4NA 5DUJA 5TDOA 4YHLL 3OQ3B 1GY1A 3II1A 1H3TA 4LSUL 4B9IA 1X9UA 1JRHI 3MLRH 1OB0A 2WVVA 4TMPA 3MJ7B 4YHIB 4QAMB 1EAPA 1JDDA 2RNLA 1M2VB 3I84A 4D8OA 5K9OA 1XO8A 2ESVB 4WU7B 5L6YH 2E7DA 2KKQA 1HDMB 3TVMD 3NP4A 1ORQB 2FECL 4RZKA 4FE9A 3VUAA 2G5RA 4PJ5B 3VFPA 4FFYA 3HO3A 4PRIE 1EVUA 4DO4A 3N44B 1QFHA 4YDJB 2AK4A 1UD3A 4FMFA 2VIRA 5LLIC 2V0AA 4P2QB 2ROXA 3WL9A 3FH5A 1U92A 4M8QA 4B0MM 5IKQA 1CL7L 1OP3K 1E2WA 4W6WB 4NZUL 3ZQ9A 4JO1L 5TE6L 5DRXB 3WNKA 2AHIA 4ZFOL 1X4YA 5FB8B 3UJJH 1MHEB 2QVKA 3AMKA 5IVZB 4K5OA 3FPXA 2I69A 1LJMA 1S5HB 2V2TA 3IMVA 3QIUD 1ZWIB 2JB6B 2XXCB 3D52A 2F8OA 2VXTL 4G9FE 3PNWA 3LH2L 3P0YH 1OE3A 1E5YA 3UTOA 2BY3A 1JNLL 3I02A 2CO2A 3KYMA 1G9NC 1N64H 4HJUA 1BAFH 2QSTA 1R5IB 1UB6B 3BT2L 1F3RB 3H3KA 4M8UA 3TPUB 1WU1B 2YFNA 4MB1A 4DZ8B 4U1MA 3HAEA 2EIKB 4RQQB 4YSDA 4JLRB 5AZUA 2EDYA 1QBLH 2MCMA 2GJ6E 3NRPA 4C54A 1CTNA 4DEWA 1DJGA 5FUOL 1OTUC 2GHZA 3T8MA 3PUUA 2Q10A 1LMMA 1SBSL 4NWUH 2WCSA 2VW6A 4PRPE 5ADPH 4C16A 1UEYA 2AS5M 1V7NH 5E99H 3W0WE 3S88L 4R7LA 4FQHB 2PP7A 1AS8A 1IAOA 3GHBH 3KJ6L 4GKLA 1ACXA 3GEFA 3F8UB 3V0WH 4ALAC 3D2UA 4OLVH 4F7EA 4XMWA 4LCUB 2VRKA 2DWDB 3DOSA 1YJDH 1T7XA 1UURA 4PH8A 1W0WB 5AG9A 1L6PA 2BSFA 4QRPA 3BXNA 1MI5E 1JS4A 4XHJD 4OT1L 2VH5L 5LXGL 1KEML 4NQEB 1P4BH 1NCTA 2V17L 3LY6A 3QEUB 2P80A 5BOJA 2BJMH 2XIIA 2YPVA 1M7DB 1UH4A 3VFUA 2DH3A 4ZW5A 1OF2B 1T80A 4N0CD 5KVFL 9CGTA 1X6NA 3ELQA 2XQYK 1FFOB 4XXCC 3SO3B 4ZSOB 4JFQA 2AQNA 2LAAA 2EICA 2BSSB 5AQ0A 4NFDA 1JI2A 1NGXA 4HT1H 3ZMRA 3U7YL 4HUNB 4KTDL 3BP6A 3VXUA 2AJVH 2C1OB 4BCZA 3TVMB 1H6UA 3KPLA 2CMRH 4G6FB 4S1QH 3MNWA 2NY2B 1NLBL 4C4UA 3JZ7A 3MMEA 2DLIA 2XWJB 1ORSA 4F2ME 4XMKH 3BSGA 3S97C 4FZ8H 3HB3C 5BXFA 2R23B 1QA9B 1RUQL 2R15A 5KANG 3P5BL 1DQDH 1RZKL 1A7PH 2I60H 1QO3B 1G6RH 1TVDA 4JFSA 3HS8A 2WYTA 4N20A 3VXTB 1FAKL 1NSNH 2QVFB 3D3VD 2X4UB 1D5BA 4J3XA 4FEMA 4KX7A 4O9HH 2YPLE 2NSXA 4MAYB 4K5PA 5HDLA 3UZEA 1RSFA 4L4TD 3UBXB 2DWYA 4BBWA 5AKVA 5CO1A 2BP8A 3MZGB 2WBKA 5TJWK 5K0HB 2PW2B 2A3TA 3O6FC 1T2QH 5IW6A 4OI7A 4EEEA 2VDMH 5DUMH 2X3AA 2EC9T 1U8JA 1G7JB 1U58A 1MH5B 4QXGL 5DMJB 4CSZA 4M5TA 4IJ3B 4R6UA 4RAVB 2ITEA 1XT5A 3FU3A 3BN9D 3GINA 3OKNA 1FIEA 1IQDB 4WWOA 2WWKT 2VLRE 1FORL 1DEEA 2YUWA 3EG9B 4R26L 3QGVA 4JRYB 3FFGL 1U67A 1AQMA 5I1IL 2GAZA 4NKIH 2NTFB 2XTJC 2XV3A 2DM4A 2LLNA 1Q4NX 3A21A 3GHBL 3RWDB 3S88H 1IM9A 3QJFB 3HI5H 1T21B 5DJDB 1TZIB 3TWCH 3SDAA 4N2IA 3V8CA 2DWDA 1N7MH 3OX8B 1BZ7B 2PHBB 3P69A 3Q2WA 2EYTB 4EUPA 2AK1H 2H1PL 1CFVL 2H0PA 1NIEA 1N5YL 4JNXA 3KBPA 1OHZA 3FTVA 4OZ4B 4KHTH 1FFRA 4M7LL 5AUMB 1X3DA 1M7IB 5FA4A 5TH2B 3B43A 1KLUB 1M9WA 2J6EA 3CVHL 3JV5A 1MVYA 3PL6B 3ZE1E 2ZOUA 3UTPD 1AFVL 5I16A 4Z0XB 1VZIA 3QUZD 5CILH 2EXWC 2XFXB 4PYGA 5BJTB 3MRRB 1XMWA 3O6FA 4PJ7E 4J8RB 3EGSA 4DAGH 1Q1PA 5COXA 3JVGA 4KJPC 3TBYA 1SHWA 3ESUF 4TKWA 3FT4B 2XZCL 3TA3D 4G80A 2OYUP 5LGJB 2V33A 1KLGB 4HVBA 2XKNA 5GXBB 4KBPA 3HMWH 5HJ3A 4A2HA 1AKPA 4M10A 2VM9A 1JPSH 2E9WA 2ITCB 3T6XA 2J57A 5I0YA 1VFBA 4NT6B 3LEVH 4CNIA 1SMDA 4L3EE 4JVWA 1NUGA 4M7LT 4LMFA 1N6UA 3FQWB 5FR3A 2RGSA 1RCYA 4PJXE 3QXAB 4BGLA 5EO1B 1INQA 4ZSOE 1DBKL 1CDHA 4LLDA 4XWOD 2IPUG 3ZE2E 2C5DC 3B1TA 3FS9A 3MA7A 3BIKA 5D2LB 1TENA 5SWSB 3WXVL 1NCHA 1MFAH 4HZAA 2OCCB 5IQLA 2CUIA 2WIMA 4O51B 2PW2A 3SKOA 4ZT1A 1Z3RA 1H15A 3FT0A 3KW7A 3Q2CA 1KY6A 3MRPA 4WCYH 5I75B 5HDQL 4LRIC 3QI9C 3FFCD 1ATEA 3PWVA 3HZVB 3CSTA 4FABH 1B3JA 1T0PB 4DESA 4ELKA 3R06A 1U91A 4OCSH 1TJGH 1R3IL 2IC2A 1Z9OA 3DJRA 1JWSB 3NSJA 5HYQB 4M7KL 3H9HB 1YECH 1G0DA 1G7MA 1CVUA 3BT0A 3FO1B 3TM6A 1ND0A 3MHZA 3MV8A 2SEBB 2CXKA 4YFDB 2HTLC 3IMUA 5ESQB 3W39A 2XC8A 2GITA 1PX8A 2EYSB 3VRLE 1WFIA 3D08A 3CTTA 2CUHA 3FH8A 3GIVA 3C8KB 1R3KB 5JOFB 2A1WH 2FECI 4ELMF 1MAML 2OMWB 4Z7OE 4N9OB 1N59A 4QHMA 4ZZFA 3AAZA 2WPIE 1BD2D 2Z92A 1U8NA 4OJCA 4XVTL 1ROWA 4Y4HD 3ZW3A 2AF2A 2D0GA 3BMWA 3O8XD 2WBJC 4QT5A 1I85A 1JK8A 3VFUB 2XA8L 4ONGH 4JFED 4P2OC 2YEVB 1KIUB 3MLUH 4H1LB 4AKQA 2W95A 2IXQA 1FE2A 5C97A 5C0JA 5CD3B 3RA7L 2P7TA 3VG9C 1QBAA 3IDNB 5F7AA 5EEZA 3TT3H 1SUJA 4XBEH 2WSKA 3E6HA 1MWAL 1IBGL 2WPKE 2YQGA 3UZQB 4H1LG 4B9CA 5JR1L 3JTTB 3SPVB 4JRXB 2X4QA 2WPGA 1XB3A 1BJMA 2BNQE 4IRJD 4X7TA 4K8RD 4CVWA 1MCRA 4L29A 2QJDA 2EH7L 4C4KO 4YBHA 1PKQA 1W0VB 3ARDA 1FH5H 4LVHB 3F7KA 4CADA 4OLZL 5SX5H 1BM7A 3AY2A 4OGYL 1PPIA 5GGVH 1KTDA 4JVPA 4ZFZA 1BFSA 2QHLA 4F93B 1BD2B 1DQKA 1R3LA 2JIXD 3OF6A 4AQEA 4NGAL 1APQA 2FJFA 2VDPB 3HFML 4GSQA 4YR6A 4J3TA 2BFGA 4NQUA 1C5BH 2CSPA 4UT7L 3QG7L 4RLDA 1L7IH 1XVSA 4H8UA 5I1LA 3NK3A 1QRNE 2NNFA 5D7LA 4X6CA 2E7MA 1IU1A 3F64A 2JKRM 5IQMA 3QUKB 2VKWA 2WQUA 3EZJB 3KWWA 4FXGB 4X98B 5D7JD 4NPYA 1T0NB 1K85A 3EGDA 4GUOA 4U6VH 1UA3A 2CGZA 1THAA 4FHBD 2I26N 4LEEA 2DTSA 2ED8A 3UC2A 3WSQL 3KPNA 3U30B 2AV1A 1K5WA 1CCZA 2X6MA 4KROB 4UQIM 5DZAA 1AS6A 3ZTJH 3AWEA 3NACL 4QY8B 3N06B 3UTQB 3PWJA 4L3CB 4M5ZL 1G7IB 1NGYB 5DUML 3UABA 2IAND 4DUXA 3UTSE 4TS6A 4YEFA 3CDGB 4PS3A 3LQAL 4NKOB 1XZWA 3NTCL 4JZNB 2F15A 5D7SH 3B1UA 1IM3D 3ZU8A 2BMKA 2W80C 3DVFA 1INEL 3GMPA 3N85L 3C09C 1J8HA 5MERA 3BESR 5CBAB 1S9XB 3IJ9A 4GT7A 1TMCB 1QI3A 2BSRA 3PV7A 3S2CA 1BQRA 1DIYA 5C8JA 2WN2A 4HG4K 3IXAA 3BUQA 5C0RH 1WEJL 2CO7B 5EF1A 4AZ8B 5CZXD 4XNUL 2P46B 3QYCA 4RSVA 3OWEA 1AG0A 3RNQB 1JGVH 4X7DC 1F58L 4Y7OC 3U82B 4F7MA 4B0MB 3OMZA 1E4XH 3FUHA 3EJQA 2ERJC 3KBFA 2R1YB 1XGZA 2UXTA 2EIJB 2IH3A 4PJFE 4NQDE 3CSYA 1TJIH 2R8SH 4AUJA 2WWKO 5C0DB 2TAAA 5DVMA 3QQ3A 2ZUXA 4OGYH 4L29B 4Z7VF 3NZHH 2ITFA 3QIUB 2A9NH 4E5XG 3GMNA 5CGYD 1KULA 5DO2C 2R1WA 2G5BA 3UAJC 4AVIA 3HRPA 1IAKA 2NX5D 2QGEA 3LEYL 4TQEL 4WI8A 3ZKQD 2DKMA 5IJVB 4LP8A 2D2OA 2O6FA 4OVVA 5FHBL 5DQDH 1JGEB 2HT2C 4LSTH 2VDPL 5KBKA 4F15B 2ICES 3W81A 2UX7A 4X7FC 1CG9A 3L3JA 4WW2F 3VFTB 1J1XL 2EC9U 1OO2A 1OPGL 5F9OL 3ZUCA 2Q3ZA 4IIQA 4U1LA 1N8ZB 3MOAL 2EDRA 4EDWL 4IRJC 2AXWA 3ZYJB 3Q7DA 1KCSH 4PR5A 1WBXA 3ILEA 4UQ2A 5D7EA 4LSRL 2NUTA 3TBTA 3Q5TA 3CSYB 4KFMA 4PRID 4S10A 5IHLB 3BZEB 2OMNA 1U8NB 1NFDF 4KKQA 4NCC2 4OCMC 1DSWA 4X8VL 3FQNA 5GSVB 1OM3L 3ULSB 3ZHDA 2OV0A 3I75B 4HYTB 3WBDA 5HY9B 5FM5M 3MFFB 3RDTA 3N9GL 4DKEH 1MJJB 3RA7H 5JW5B 1UKTA 3R05A 1T0NA 3MR9A 4JGMA 3ULVL 3TF7C 2ZAIA 2X12A 3QDHA 4FTVA 4EBQH 3LPPA 1K6QH 2W2ME 4RRXA 1UYWL 2H9GB 4ZOAA 1YEGH 4OUUB 4YHNB 3ES6A 1AH1A 2QDVA 4EN3B 2DYPD 1J0YA 1MFMA 1TYEB 1EGJH 4M02A 2IGFL 2UYLA 4KDVA 2Z1PA 3GUFA 4PJ7F 2Z9TA 3QNXB 4XPFL 4NRYA 5GS0C 5CJOH 3WENA 1NL0L 5BUGA 4PJFA 3QS2A 5FOBB 1QRNB 1YY8A 2EE6A 4YHML 1UOLA 1SY6H 2AEIT 1BMGA 3MYJA 1CR9L 5D72H 4KJQC 4YFEA 2NXZB 2OMTB 1PNDA 4P46B 3RI5K 4J27A 1PZSA 2R7EA 3WUWB 4OCSL 4Z7VE 1KCWA 1QHPA 4MD4B 2CKBB 3QR2A 3V6ZA 3QCVL 2WZ6A 1HHKA 3F7QA 4YHPA 1ZGLB 3LDBB 2QFRA 5D6DA 4Q9CA 2Y5FL 1OTSD 2A74C 4MMZA 2OTWA 1NMBH 3HG1B 4KI5E 5EV7A 4PWEA 1VDGA 1MCBA 4KFZC 4HJTA 1ZGLP 1CYXA 2EILB 5AZ2H 1IEHA 3G5XB 2HFGL 1TLMA 2JJSC 2OI9C 3EDKA 3NSFA 3UBXG 4JQIH 1O9VA 1JPTL 2QQNH 3EO1B 1AE6H 4XODA 3OMIB 2C26A 5DZOA 2GCYA 5TPWH 4QJ4B 5KZCB 1FNAA 2VUKA 3IU4H 3RYMA 1ED3B 4ZTEA 4JPWL 2VL4A 3ABGA 4QXVA 1A1NA 1JWUA 3CXDL 4YSEA 5F0JB 1QQDA 3HNTL 5IF0B 1QLEH 4K23H 5CJOL 2DIAA 4NM4H 5KYWA 4X9HA 4KTEH 1MG2C 4K71C 1Q9OA 2N1KA 1OALA 1LK3H 2AQ3A 5IHUH 4LLWB 5D1ZI 3KGRA 1CGTA 3B2VH 3HLAB 5JTWA 4JE4B 1TTFA 2GK0A 1CDJA 1QVOA 2Y36H 4X6CF 4FJYA 4XWGL 2E7BA 2EYTA 2H6UA 3SBQA 1QWNA 3HZYA 5H37H 4NI6A 3U7AA 4EUPB 1OK0A 4H8WC 3CCHA 3MGOB 2D31B 5CGYC 4OIIH 5D4IA 5T33L 5CBAA 1MQ6L 1WIOA 4Z7OB 4ZQKB 3AM8A 4FQ1L 4IKKA 4OLUL 2Z7ZA 3BLPX 3DETD 5AZEH 4NQSB 3D51A 2WXHA 2AKRB 1E4KC 3TX4A 5I66A 3DX6B 1LO3H 1TXKA 3I85A 5EULV 1ZLVK 3MNVB 2Q7NA 4NKOA 3V4PL 5EDSA 3FCBA 2LFGA 5AYTA 3WD5L 3AT9A 2CRZA 3VD9A 3PWNB 1NFDA 4PVMA 2GJZB 3GO1L 5D7KE 4AQ8A 4JZDL 4F80A 3AS0A 2DIEA 4KRPB 4AQEB 3LHPH 5AW4B 1P6FA 3SDYL 1F3DJ 3EJJX 4Y16A 3MRFB 2OMZA 4L8BB 3BUYA 3GLDA 4GBXC 3MLSH 4PRHD 5B7FA 2G00L 1L9NA 3LIWB 1ZE3H 3AVEA 3FQNB 3ULSA 2E9JA 2HJLA 3ABMB 3CN1A 3UG5A 1OP3H 4B9JA 2X9YA 2I25N 5HVFB 4EIGB 5ES4B 3TFBA 4IBVA 2YPLA 3HMXL 5KJ7E 5ETUB 3LIZH 1EXUB 5EC2B 1YN6B 5AW0B 3FNKA 4G5AA 2OMBA 1FL6A 4H8WH 1SN0A 2XN9D 2ZE0A 3TH2T 1WFMA 5BRQA 3VDBA 1CT8B 1T03H 2A99A 1Y1DA 1ZLSH 2AJZA 4HIIB 2OXGA 5TF1H 4FHKA 1LE5B 4H8VA 5IB1A 3P9LA 5GS0D 1UJ3A 1TETH 2DQTH 1A22B 3IJ8A 1EUTA 4RFOL 3KZ8A 1CICC 5I8KL 5T1KA 1I7TB 4XNUH 2J5LC 2ZUUA 4XMKL 1G6RL 5FA4B 4IBZA 1C7SA 1DL7H 5DHYA 4CC4A 4PBDA 3KMDA 4JFFD 4BZ1A 2CHWA 4JY4B 1HQRA 4X5XB 1KB5A 3NJKA 4Q0XH 1IT9L 2AYLA 5CFHA 3SD2A 3V4VA 4N3UA 2R0WH 5FO8B 1HH6B 5ENWA 5A6LA 4GKZA 2X5PA 3CLFH 4H13C 5J9PA 1Z32X 3BEVB 5A2IH 3E1F1 4PJAE 1T20B 1OV8A 3Q8EA 3U46A 1C12A 4TVSa 4XPAH 1NQBA 3SBRA 1RK7A 1ID5I 4ICXA 5EN2B 2P5WE 1W80A 1NGPH 4PGCA 2J1KA 3QXDA 3NA9H 4R3SA 4BCXA 2YQ2A 4BRVA 1OZUA 3KPOA 4GQPH 1AR1C 5EEWA 2EECA 3BXNB 1N5AB 3C5SA 3OAYH 5DC2A 1D5ZB 4WUUD 2A6JA 3O4LD 1OD7A 3WFBL 2ZOTA 4HCRH 2OSWA 2XRAL 4ZO9A 3VD7A 2JNZA 3EYSH 1YO4A 2VH5H 2YPKA 2FGWL 3KK6A 3FONA 1LXMA 2V17H 4GSDH 5DLLA 4PCTA 4ZNEE 3DX0A 3RTLA 1S7QB 3QNYB 5DFVC 2MNJB 4E0RA 5SWSA 3CK0L 1OSPL 5B3JE 3ZJAA 5CD5D 4I77L 4RISL 3NCFB 1EAQA 4B97A 1I8IB 5F3HB 4JJ5A 4NHCL 1KPVB 4WI7A 3SGJC 3H4FA 4K9EL 1FDLL 2J5LB 3L5JA 4AV0A 3N50A 3QFDA 5AD0A 1MFVA 3VXUE 1ZD6A 3CMOH 3GK8H 1QBLL 1UA6H 4R7DB 2Z91A 3Q6FB 4OTXL 4YL9A 2VSDA 4ECNA 2AVFA 3GBMH 1F4XL 2P4AB 2Q9OA 2Z91B 4B60A 4DOHE 5I15H 3JWNE 2YPLB 3MRIB 4P57A 3AY4C 3A6CL 3CDFA 4ZH8B 2NNCA 2ZUQB 1KYOK 4TN9A 1FAKT 4TUJA 5IVZA 3QVAA 2HFTA 2CWRA 3TBWA 3T04D 1XSKA 3K8KA 4GRLD 4J3OF 4UQAA 2XTJE 4IOFC 1EZLA 3QFJA 1E0OB 5EU6B 3LJ3A 5DGQA 4C56E 5A16A 1UD2A 5C9JA 4TM9A 3GNML 5TQ0L 1LK3L 3ZK0A 1P53A 1QW9A 2P48B 1AXIB 4X6EA 5H4YA 4AIZA 1MIEH 3PFQA 4QTIH 3WDJA 2EVJA 3C5SB 4PS8A 1E40A 1LTXA 4NYLA 5DJCA 5AW7B 3W9EA 3QJHB 1CYWA 4L5FH 4KO6A 4MDJB 2PYEB 3FBYA 3Q6FA 43C9A 1N6QL 3K6IA 2H9EL 4JO1H 4NQSA 5TE6H 5CEXB 1MNNA 3KBHE 5FO7B 4NZJA 5DC9B 3E6HB 1DQLL 4XVTH 3AJ7A 1HINL 3OHXC 1JNJA 2RIKA 2WYJB 1K3ZA 2BOCB 1F5WA 2D4FA 3VH8G 1RVFH 1A4AA 1WFTA 4TTDC 4PJ7A 5FOJA 2CJSA 3LKNB 4NQEE 5ISZE 3GB7B 2X38A 3A0OA 2WFXB 5D1QC 4AH2A 1VGKA 3D25B 3H42L 2CGRH 4I4WB 5CF3A 4A7GA 2N01B 2ZPKL 3HG3A 1EQGA 4YHZH 5C08D 3LPWA 3WN5C 2ALWA 3D3VE 4AY0A 1DVFA 3FW6A 4AENA 4F7PA 3B7UX 2GJRA 1WG3A 1HHHB 5E8PB 1BMWA 3MA9H 4YDLB 2DWTA 2EDKA 3SBWC 1N9PA 5MENA 5CJ5A 1F6FB 2YRZA 3IJEA 1GTFA 4OFIA 2HKHL 2YAFA 4IRJB 1EO8L 4A7TA 5L2ZL 3IGAA 3AT0A 1AGEB 4UINH 4PRNB 1ZTXL 3KG5A 2DL2A 3WIHH 3VMNA 3WEXB 4F2EA 1KFAH 4UQ3A 4X8JB 3WJMA 1D3CA 1OGAD 4YE0A 1HAUA 1OLLA 2R0ZL 4KHXH 3T3MF 4M6NL 1TQCB 4MCZA 4WKZB 3ZT6A 1ZAGA 1TMQA 1DSFL 5ETUA 1X5LA 4MLSA 2BW4A 2XVBA 1TLKA 1TVBB 3TYFB 1E4JA 2NY0B 3LEVL 1ET8A 4XMPH 5IK3A 3T0EB 1PZ5A 2YQBA 2EKSB 2HLEB 3DVIA 1DBJH 3VB9A 2ZT9C 3TO4D 4M1DH 4W9IC 1QSZA 2IDUA 1SUHA 3FQXA 5IG7B 1IBYA 3UBXA 1U8QB 4XO3A 1FQ9C 1ZV9A 3DX6A 3EYUL 1GZQB 1J8SA 4Y7MA 1EEYB 1KLFB 1JIBA 2K2TA 4GUPA 2LTQC 1KY7A 5CLZA 2GB2A 1DDTA 1ZVSB 2QTEA 3POYA 4AYGA 1J1XH 4HG4J 3TESA 2DW5A 4LCYB 4LMQI 4GKSB 1IL1A 1OCWL 3OAZK 1V5JA 5J3HD 4PHZA 2IOMA 2E74C 5C08A 3VI3A 4JRYE 2NY1C 4Z23A 1BGXH 1GPOH 2EDNA 4GRLA 2F7QA 4KHTL 4DF9A 3MNDA 5F1SA 2BIPA 2J88L 1YEDA 4KZCA 2HTLD 4G43B 3U46B 3W38A 3IN0A 4ZAKB 3Q3KB 4N2OA 1URIA 1JRHL 2A73A 4AYBA 3GBNL 1ACZA 2KUTA 1D6VL 4JMXA 5E94A 4OIAA 4XAWL 1NAKL 4L0YA 3E2HC 4N0YH 1QSFA 4EDXA 2ZOLA 4XB8A 2DMHA 1BM3L 2Y24A 3IDXH 1R5WA 2VW4A 5IHHA 1F00I 4B50A 5IESH 2A6JB 3HNSH 5IFHH 4J1UB 3GB7A 4MDRA 3LKNA 4Y71B 2JB5L 4WSKA 1GTNA 3OPZH 4YX2L 4F2FA 1BZ7A 1JGVL 2VDOB 1DUZA 2XKUA 4HBCL 3N8YA 3B9DA 4XMVA 4MKTA 4BELD 3NIFF 1FORH 1BEYH 4BSVB 8PAZA 3N0AA 5E2VH 4UIKL 4BUGA 4XP5H 2E3VA 4MNHA 4FX5A 1AZZC 1MW1A 3HI6H 4NIYE 4CSPA 5EIVA 3MRKB 4UM9D 4HF5L 3K71A 4NBZB 3EF4A 5LCVL 4JGUA 2EDOA 2FLGA 1INEH 4X9YA 5PCYA 1Q1JL 4JGNA 3T3PF 1NQLB 4N1EA 2B0SH