4XBMA

X-ray crystal structure of notch ligand delta-like 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
270
structure length
253
Chain Sequence
SGVFELKLQEFVNKKGLLGNRNCCRGPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPNPIRFPFGFTWPGTFSLIIEALHTDSPDLATPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta-like protein 1
publication title Notch ligand delta-like1: X-ray crystal structure and binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 253
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
A PF12661 hEGF Human growth factor-like EGF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4xbmA03
2.10.25.140 Mainly Beta Ribbon Laminin Laminin 4xbmA02
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4xbmA01
2PUQL 2D1JB 1L5GB 2EI8B 1Q4GA 2WPKE 2WPME 1FSBA 4NA9L 1HJ7A 2FZZL 3FBYA 3NTBA 3K9XA 2UWLB 5KIRA 2TGFA 4JYVL 5CKMA 1IQML 1PRHA 2RNLA 3CA7A 4X8UL 4D0EA 1FAXL 1YUGA 2P16L 1K36A 2P3TA 2KV4A 4RS0A 5JVZA 3GCWE 1N7DA 1EAIC 1CCFA 2XC5L 1URKA 1G2LB 2K2TA 2P26A 1KLIL 2P94L 1G1RA 3NT1A 1LPGA 3ZYJB 1LQDA 1TLEA 5F19A 4C16A 4OTJA 4BTUA 4BDWA 2WPJE 4LORA 1CVUA 1K37A 3SOQA 3KK6A 1G1QA 4LMFA 5CKNA 1JBUL 4Z0LA 3ENSA 3OLUA 1COUA 4ZHAB 2NPRA 3N8WB 4CC1A 2OYEP 3CENL 3LIWB 1WHEA 3N8VA 5IKRA 4XL1A 1IQGL 4CUFA 1DIYA 5JW1A 3TBDA 1APQA 5I46L 1TPGA 3F6UL 1CEJA 1EBVA 3RR3A 4ISIL 5JVYA 1ATBA 2W2NE 4RUTA 2EI6B 3BPSE 1YUKB 2P3FL 1V3XB 1F0RB 1NZIA 2W2OE 2FLGA 3LC3B 4JYUL 3PGHA 5JBCE 2DDUA 1EGFA 2VWNL 3HPTA 3ASIA 1NQLB 2Y80B 2MGRA 1ZAQA 1EZQB 5JB9E 3HO4A 2MGPA 1PXXA 1IVOC 4YT7L 5E8DA 3KQBL 2BO2A 4AQTA 4ISHL 3DEMA 2XC4L 2XBYL 2VJ3A 3QH0A 3TK5B 1HZ8A 3KQEL 2W3IB 1IP0A 1IQLL 3H5CB 1CX2A 1JL9A 1F0SB 1CVWL 5EGMB 1F7EA 1C5MF 4Y76B 2WPLE 4BTTA 1JV2B 1NPEB 3M37L 1MQ5L 2J4IB 1UZQA 2WYGB 5IKVA 2WPHE 2P3FN 1IQNL 4RRZA 2Y82B 1P9JA 2VWMK 1ATDA 3POYA 3QMOA 4RRYA 1LPKA 1W7XL 1EQHA 4A7IA 1TOZA 4NG9L 1HX2A 4MMXB 2Y7XB 3CFWA 2WG4B 4O1ZA 3SW2A 2W26B 4CUDA 1LPZA 1G1TA 3OLTA 1LMJA 5JBAE 1CCVA 2P3UA 2CJIB 4JZDL 3QCWA 5CKQA 3TZIA 3N8ZA 4XBMA 4JZFL 3IITB 5FDQA 1RFNB 4ZAEB 3HS5A 4RRXA 2W2QE 3V64C 1I0UA 2J95B 3Q3KB 4D90A 3N8WA 4YT6L 2UWOB 3HO5A 4FM5A 1IGXA 3GISX 1NFWB 5CISA 1HT5A 2VWLL 2BQ7A 5IKQA 2B7DL 1APOA 3TH3L 3LTFB 4Z0KB 2Y7ZB 3HS7A 3N8YB 4O02B 4ZXYL 2I9BA 2ADXA 5L30L 1SZBA 2XC0L 1HAEA 4X8TL 1Z6EL 2RA0L 1NT0A 4Z6AL 1XDTR 1UZPA 3KCGL 5L2YL 2Y5GL 4Y6DB 1EQGA 3KQCL 1IQIL 2YGOA 3U73A 1IOXA 3FFGL 3Q7DA 4Y7AB 1PFXL 1U67A 3C9AC 1IQEL 2WG3C 3NTGA 5JB8E 1FE2A 1FJSL 2BZ6L 1B9WA 2VVCK 1XKBA 1M1XB 2JKHL 2J2UB 5F1AA 3LTGD 3F1SB 4MMZB 2WPIE 2I9AA 1IQJL 1YO8A 2WYJB 2WFXB 1EPGA 2G00L 2J34B 1FFMA 2Y38A 1BF9A 1DDXA 3MQEA 1CQEA 3LC5B 5IKTA 1U8CB 1F7MA 1GK5A 2Y81B 2KL7A 2W2ME 4CBZA 1HT8A 1YGCL 4G1MB 1YUFA 3CS7L 1UZJA 1DQBA 3HS6A 3TGFA 4CSYA 2H9EL 1EPJA 3NJPC 1ADXA 3V65B 1ATAA 3EGFA 1EPIA 1XKAL 6COXA 2Q1JB 2KB9A 2VH0B 2UWPB 2F9BL 2YGPA 2VWOL 2Y5HL 1HAFA 1IQFL 4Y79B 1KIGL 2OYUP 5L2ZL 3KQDL 3R05A 1A3PA 1HRFA 3M36L 1HCGB 2GD4A 3ZYIB 4PH9A 2P93L 3MDLA 4YZUB 1G1SA 1NFUB 1Z6CA 1EMOA 4TGFA 4OTYA 2BOHA 3ELAL 1IJQA 1QFKL 2W3KB 3SOVA 2BQ6A 2XBWL 3KL6B 5KN5C 3N8YA 3KRKA 1FAKL 4BXSA 2BOXA 4X8VL 1IQKL 1NFYB 4BXWA 2BMGA 2FLRL 3P5BL 3SOBB 3LN0A 2K2SB 2W2PE 2J38B 4XLWA 2FLBL 1J9CL 1OB1C 3LAQA 5COXA 1WHFA 4ZH8B 4MMYB 2PHBB 3GCXE 3HO3A 2J94B 1KSNB 1IOEL 4JZEL 1N1IA 1EPHA 1ATEA 3LN1A 1EMNA 3BT2A 2W86A 1KLJL 2RHPA 3FCSB 1W8BL 2M74A 4CC0A 1O5DL 2FD6A 4Y71B 1XFEA 1MOXC 2P95L 1HREA 3ZYGA 4E1GA 2BOKL 5K0HB 1MQ6L 2MHPA 1L3YA 2BQWA 1WU1B 2VH6B 1DVAL 1NFXB 2AYLA 1P0SL 1KLOA 4RRWA 4ZXXL 1G2MB 1UZKA 1AUTL 2WFTA 4Y7BB 3TK6B 4D0FA 4M10A 4M11A 1FF7A 3N8XA 4X8SL 2XBXL 1DX5I 4COXA 2EI7B 2P28B 1PGEA 4BDXA 3U7UG 1PTHA 5JBBE 2XBVL 4NGAL 3BT1A 4BTIA 4CUEA 1IGZA 2VVVL 2PR3B 2VVUL 2BOUA 2Y5FL 3IJEB 1IQHL 1X7AL
chains in the Genus database with same CATH superfamily
3EJPA 2ZWLT 4DN4L 1AQKL 1XL6A 1EH9A 2WIMA 3I6SA 4UM9A 3GNML 1JYWA 3HG0A 1N5YL 5DCCA 3MLRL 4G6MH 2ZOTA 3CZSA 3QHZL 4JFOB 4Z77B 4LLQA 4X0KA 3PXLA 4QPEA 2VH5L 5GGRY 4M61B 4QTFA 4QMEA 5GIRA 1U3HA 1MFCL 2BNUA 1CFMA 4XPTH 4XCNB 5AAWC 1RUQH 3W38A 3DC0A 3RWJB 2EC8A 2YSSB 1TEGA 3OLDA 2AJSL 4JHWL 4Y2NA 2WZPA 4D0EA 3EJCA 1FUNA 1QQDA 4KNUA 5TGBB 1QPKA 3IAQA 4HIXH 3ZY7A 2AK4D 2KV4A 4QD2E 4AMKH 1MLBA 3FQRB 4W4NA 2WZ0A 1AG0A 1WUZA 4L8SC 1EAIC 2ENQA 3N41F 1IC1A 4Y7OC 5DEGA 4M48L 5J56B 1QR1B 2UUDK 2YA1A 3VGBA 3CC5B 4X4XA 4S1DD 2PYFA 4A38A 3QUZC 3TJEL 2GK2A 1Q1JH 1H6EA 3QWRA 3F5WA 4U6VH 1W80A 3OB8A 4G6FD 3G5YA 3O45A 4HIEB 4KKLD 5I6KA 4IMLB 3DIVA 3MJ7A 4JPVH 3ZKQD 1JHTA 5FF6A 2NY0D 5K9QG 4CJ1A 1H9DA 1BQKA 2ICWA 2UX6A 3BPOB 1CPUA 3QA3B 4AC4A 4UM9D 1H3TA 2GIMA 3H0TA 1I7RA 1G1QA 4MA3B 5EMYA 5EU5B 3FFOA 2JELL 1MREL 4KUZH 3FB5A 1JI2A 4WHYH 2N7SA 3V6BR 1U3HD 2BRRH 2ZSWB 5KYXA 2Z7WA 1A1MA 3CSTA 3GMRA 3H56A 2WVUA 3SKJL 5L6YL 2AEIT 4UQEA 3S5YA 4LQ1A 2WZPD 3QHTC 5DJZB 1RZIB 3JWNC 1KN2H 1UACH 3GSXB 5HY9A 2P8MB 4J3OG 1UM5L 2BSDA 4IRJA 3ISYA 3BOVA 3NPSB 1U58B 2GCYA 1BW8A 3WJJC 4KKAC 2R9HC 3FCSA 2FNBA 1HWGB 3IGFA 3VD9A 1QA9A 1Z9NA 2F5AL 3QZMA 2ZQKA 1ZKAA 2FE0A 5BMFH 3FKUS 2A9NH 2EI6B 2HKHL 2MOVA 3QWRD 5I5MA 1YUKB 3FTWA 2PR4H 1ZVNA 5MENB 3LRSB 2JH2A 2FLGA 2F53E 3CPLB 5E9DE 4PRIE 4LLUB 5DUPL 1ODAA 4BSWB 1BVOA 1KB5A 5GPRA 5GZOC 1LO3L 3A23A 4LHUA 5GJSL 2BVQB 2F1EA 1W72H 5CWSA 2J7LA 5I76A 3X13B 1KCKA 3P30H 1YJDH 5DUBB 4WKXA 5EEVA 2YGVA 2P8LB 3JV4B 1NLBH 1BEYH 4JLRB 4LCUB 1JRHH 2EUXA 3PHSA 3PL6C 5EO1A 4FADA 4FCHA 1YNLH 3KBFA 4UMSA 4AL8L 3QFJA 4IRJD 3QEQA 1YMMA 3IJEA 1ET5A 3II2A 1E43A 3LN4B 1J86A 4HFUL 4JY4B 4KFMA 4J3VA 4TNGA 4XN8A 1L5GA 2WXGA 2FQDA 3GO1H 1FDLH 3QI9C 4FN0A 4KKBC 4BEIA 5HYQB 1E5YA 4M62H 3B83A 2CHXA 2HN7A 2O5XL 3D85A 5KYWA 1A3LH 3KH4A 4O2FB 4J27A 4UOQA 5EC2B 4GRLB 5FHBL 2A6IB 1EZUA 1CVWL 3QDJA 5AVQB 1BFVL 3FB8B 1INQB 3BP4B 4Y1AB 2W0KA 1NKOA 3IETA 1B3JA 2WLIA 3BVVA 3HCVB 4JQIH 4RAUB 1K8DA 3OMNB 3T3PF 1VPOL 1AZBA 5L4FA 2ZNXA 4A6YH 5AAPA 3C60A 1JWMB 3Q3GB 1BREA 1LP9A 2XVBA 5CLYA 4LHUD 4WGKA 1KIQB 1VACA 3LRKA 4A7UA 5HDWA 5E2TH 3DRTB 1NCWL 4M7JL 3QH3B 4M5ZL 4X5WB 3AMKA 5KVDH 1L9QA 4V1DB 4Z0BH 5MERA 1L7TH 2DYPB 1DVFD 4U1KA 3GIVB 2VOTA 1G94A 2WBKA 3BZ5A 1DVYA 1G84A 2WG4B 1ZV5A 4TXVB 3H4HA 1SLWA 3P4NB 1WIUA 1FNGB 3QFJD 2H6PB 4M1DL 2WUCH 3DMMC 3MCKA 2FATL 2X4OB 4IOIB 1TF4A 2RCSH 4KKNA 2R27A 1NBZA 1HSBB 5BXFB 2XDHA 4MJ6A 3GSUA 4DP7X 2A4EA 3D85D 1INEL 3KVPA 3U0WL 4Y2OA 4RRXA 3GMLA 4Y4HB 1HKLH 3QDJD 2MPAL 7PAZA 1NWPA 4WNQA 3SGJC 5I2IB 3L2MA 4U1MB 1HSAB 1GGIH 4HIIA 5ACMA 3LRGA 4JG9A 5D2LB 5D7IE 5JLZA 4GS7C 2WYTA 4Y16B 3SB3A 3IRZA 5IKQA 1U8KA 4HK3N 3VMPA 5D2NB 3C60D 2WLYA 5C0FB 1Z3GL 3WBDA 3HG1A 4UIMA 1T0MB 3IFPB 4GW5A 2B5IB 4BFJA 1J5IA 4YDNA 5FS5A 5JYMA 2QQNH 2YJQA 2VRQA 4ILDA 3CZJA 4S1RL 3K6SB 5CD5C 3TO4A 3TC9A 2L8AA 1BP3B 4L4JA 3GMOA 1OP3K 5CBEA 4Q6YA 4FYRA 5B3JF 1BJ1H 2DQDL 5H2BB 1FH2A 3L5WA 4P5TC 4MJ5B 1TTAA 3X17A 1G6RB 1ZLEA 3C2SA 4HS3A 3SDCA 1SVCP 2IQAB 3EADA 5D1QB 4E9TA 1HWHB 1O5DT 3ZMEA 2FTAA 4APQB 3P4OB 2OR7A 1HVXA 1LO5A 2VDLB 4NKIL 5A40E 5E2UL 2A9ML 3WS3A 2QSVA 4XP9L 5I71C 4JFEB 1XCTA 4PS7A 3UYRL 3DOSB 2KZKA 3PLYA 4EN3B 5C6TL 2GSIB 2AJ3A 3GZPA 4TPRH 4IBZA 1GS8A 3B9VA 1F3RB 4E41B 5HDLA 3VX0A 1I3VA 2NPLX 1D9KB 3HG1D 2D0GA 3BP6A 1KBWA 1VEPA 2DQGH 2ALAA 3PDDA 3IE4A 1YO8A 3BN3B 3CFQA 1FYTB 4N2AA 5DRXA 5FUCE 3TO4D 5CCGE 1KCUH 5I8CA 2PLTA 2J34B 3QHFL 5IMOA 2R0WH 3NAAH 4YC2C 4CVZA 1MLCB 1CQEA 1TR7A 4TL4A 5I30L 5FKPB 1SHMA 4YHOH 2JWYA 5D6DC 1F7MA 3BT0A 2XNAB 4FXTA 5LCVA 3SDCD 4WQOA 4J5VA 3OAZK 1W0YT 3EW3B 2KT6A 2GEEA 3D69B 3PWNB 5AW0B 2NY3C 2APWA 1G9MC 4JFPA 3RL2B 4NZRL 4HX1B 1ADXA 5I5IA 5I73C 1HKFA 5D5MB 4F7PB 1EQWA 3JV6A 1BBJA 4UAOB 4EIBA 3HPJA 4HWNA 1ILSA 4PGJA 2HT4D 1YEGL 5B8CC 2XV2A 3GMMA 3P0GB 2OXHA 3RB7A 5E5LA 4F9LC 3QUZB 1JDAA 3KYNA 4LPVA 5KVGH 2BCKB 2XFXB 3B7SA 5FYLD 4NQCB 4WCYH 2Q3XA 4K3EH 2VC2B 3FN9A 4MCZB 4ZXBA 1QLRA 3IJHA 2CDEB 3TA3A 4MD5A 3D5OF 1D7BA 2ZWYA 4H8WL 3QUMA 2HFEA 3KW7A 1ZMYA 4CU8A 3C5SB 3MC0A 3WKML 3S36L 3SQOH 1WG3A 3PGFL 3P0YH 2XG5A 2XZAH 1EMTL 1AHWA 2W07B 3GEFA 1NFDA 1G1KA 1R47A 2AJUL 4TUKL 1S6NA 3VI3F 3K72B 1JRHI 5JYLA 4HJJH 2OI9C 2XBTA 4U6YB 5CMAA 1LNUA 2BY2A 3BIBX 1QZ1A 4LASH 4LEOA 4ODSL 2YEZB 3H2PA 5DZNA 3N6YA 4ZFOA 3UOAB 1NFYB 1TO4A 2VR6A 5D9SB 1JGDB 5F7UA 2OCCB 5A2AA 1BEXA 2F54E 2HX7A 4G9FB 2VT0A 1DUYA 4IRZA 4YXHL 2ADIB 5L7XL 4WFGD 4QO1B 3VAEA 2XZCL 3UP1A 3LKQA 5GGRA 4DTGH 2RIKA 3FOLB 5F93C 5DD6B 5I18L 2CE6A 5SWQA 1IGYB 1FN4A 1QLEH 1OOWA 4KK8C 5KOVC 2HTLD 3MYZA 3KDPB 4NWTH 3ZDXE 1OAYL 1FF5A 3TA3D 4JG5A 3NEEA 4MMYB 5DK0B 2Q5BA 2WHVA 3BEWB 1LWRA 4UCFA 4GIOA 4N6RB 2J94B 3P77A 2Y7QA 2GBUA 4MXQD 1ZVSA 1J87A 2Z0BA 3UZQA 3ZZQA 1B0RA 1XXDC 5IVNA 2JKWA 2N0KA 3DX3A 4D7PA 5I28A 3FHQA 2FECI 1KLJL 3G6JE 3RVVC 3PL6B 3S5LB 2VSDA 2P95L 2DBJA 3PP4H 4KVPA 1QTYT 3L4WA 4ORGB 1TSHA 2AHIA 2BOKL 2COQA 4WF7A 3V7AG 2BQWA 3SQBA 2DH2A 4OLUH 2OKMA 4PVBA 4PJGE 1RXLA 2LU5A 2ZXAA 4N1EA 1DVAL 2P5WA 4QOKE 4X9IA 3QI9B 3T65A 3EO1A 3LHPL 1U8PA 2GVYA 2BW5A 4TF4A 3SYCA 2WWKO 2H2SD 3K74B 1J9RA 1AUTL 4R7XA 3HJEA 1JAEA 4DUVA 2AP2A 1T0NB 4KH9A 5AZ2H 1QEWB 4I5BB 4PGCA 2I9TB 3CDCA 5BV7H 1F18A 3D52A 5ES4B 1HT6A 1XIWC 5DRWA 3X1BA 4YZWA 1DX5I 4COXA 2DOCA 2X4NA 5A16B 3V4UH 4WWPA 4RMTA 4Z7OE 3P11L 1NAMH 1PZBA 4P9HL 4JM2A 3OGCB 5EDSA 3MBWA 3I50H 2OP4L 4LKXA 4CUEA 3FUKA 3MNZA 4TSCH 5KS9A 2VVUL 1U9KA 3HZMB 4PJDB 1JXDA 1RLBA 1UXWB 4KY2A 1AQHA 1J1XL 1IIIA 2V8LA 1ZHNB 2AF2A 2GJPA 4JFYA 4JFOA 2D7PA 1T89A 3ZHNA 2HFGL 1JUFB 2EVIA 1JPTH 3ZTJG 3HC3L 2WKOA 1ZTXL 1FFRA 1P4LB 3PNWB 2ENYA 3AY2A 2UWLB 1U8IA 2F9BT 3DMMB 4RAVB 5C9JA 5JW4N 1QSVA 4Y0GA 4CSTA 4E5XB 1O6TA 2IGLA 1D5XA 3ZYIA 2P5WD 2KHAA 2Z91A 4JFQA 2IANB 5ID0B 1FAIL 3U7WL 2YK1H 3BKCH 4B9YA 1MW1A 1BQSA 1K5NA 4WU7B 3NTCL 5AYUH 1FVDB 2AV7A 4FQ2L 5JHMA 3H6JA 1MHPL 1G7JA 1QR1A 2NCEA 4EUPB 3MLTA 1NJ9B 4GS7B 2YLKA 4BJLA 3KHOA 4TLUA 3U9PL 4HIEA 4S0SD 2W0LA 3TPUA 3CVHL 4ELKA 3ROOB 2DY2A 3Q1EA 4JM2D 3PCYA 1KC5L 4IIZA 4PTUB 2X12A 3S2CA 3LN5B 4KKRA 3UTQB 3K2UH 3FUNA 1OAXL 1ADWA 1OAUH 1HI6A 3T4AA 5KZCB 3GLEA 1YMHA 4OZGF 3T0EC 4C16A 1MXGA 5E23A 3SZKC 2EILB 3VD2A 2BSFA 5HHNB 3AT8A 1F4YH 4IEFA 5E2JA 1F3JA 1CVUA 1R5WB 3MLZH 4P2QB 4LMFA 4YDIL 3O2VH 3UPRA 4GQRA 2EDRA 1F90H 2ZT9C 1FJ1B 2OR8A 2ZPKL 4YDVB 5JMOC 2BXYA 3N8WB 3HUJF 5F7DB 1RZIA 3GXFA 4DP0X 2R29L 4QTHB 3VRLE 7TAAA 4AQEB 4XL1A 1IQGL 4EI6B 5GHWL 5I71B 3S4SG 3SGDI 2E27H 4N2MA 4WUKH 5T5NG 2GBAA 2NLJA 4HWBH 1W15A 3WHXB 1I1CA 1IEBA 4MNGA 2WBJB 5HHMD 3CFDB 1ZLWH 3MV01 2IG2L 5JIPA 5AZEL 4YEFA 2K8MA 1CYGA 1ED3A 3BPSE 1YC7A 3VH8B 1XSJA 5KBDA 1PYWA 1OCWH 1VFAA 3D05A 1F0RB 1EO7A 1ZHBB 1EDYA 3LKOB 3A6CL 4NCDA 3U2SB 1TVBB 5AW1B 4YC2B 1G7HB 5CHNB 2P8PA 3CHPA 3ECWA 2PW2B 4XMKH 1WE5A 5F21B 4UT9L 3D4GA 1NQLB 1PY9A 3BZ4B 1JSYA 2ZAHA 1M9SA 2PP7A 2G4EA 3RDTC 2H26A 5B4MC 5IOKA 2K6YA 4EI0A 2WO3B 5IQLA 1SYSA 2VE6A 2HT3C 3ARSA 4YR6B 4CAGA 1GJWA 5TDOB 2MSPA 2CGRL 3BH8A 4RDQG 1AZRA 1FG9C 2G75A 3TT3L 4HV8A 4PS3A 5J6SA 3GLZA 3DUSA 3SOBH 4L8CB 3KPSB 5I8EB 2VL4A 2HPOA 2DLIA 2CIKA 2B8OT 5FO2A 3CXFA 2Z31C 5HYJA 4KAQL 5CGMA 4M93C 3H2WA 2F19L 3ILDA 1HZ8A 5KSBB 3QIBC 4I2XE 3HFMH 2BLFA 3IB4A 2VR4A 1INQA 3BP4A 2NR6A 4FXKB 1KT2B 5A2LH 1JNJA 1FFQA 3K5SA 2FUTA 1O7VA 2GAZA 4NI3A 3TPKA 3TCLB 3BLBA 2HWZH 1C5MF 4NJ9L 4L4VA 1B0GB 5LDSA 4Z7VE 5FECA 2AXGB 3M1BA 3LQAH 4PRHE 3IJ8A 1WT5A 3KJ4B 4NZUL 3KLAA 1ONQB 3JWDC 5LNGA 1YC8A 1JHLL 5DVLA 1MIMH 1KIUA 3O6MH 5C08A 2EXYD 5ISZB 4I48B 2C3VB 4W4OA 3Q2VA 4H2CA 1WCQA 3N5AA 2V9RA 5F1IB 2MCPH 5J1AB 1FNGA 5JIMA 1KGXA 4KVCL 3A21A 4R4BB 2OI9B 1ZTXE 2DLGA 3UTPD 4MNHA 1FFNA 3MRCA 2NRDA 5FGSA 4Z7AA 4NSKB 1JGVH 3US9A 1KB3A 2LVCA 5HYJD 4CMHB 5GQBA 3QDMB 4LLAA 2ESVA 3MV9B 4PJ9C 2VLLA 5IFHL 3O0LA 3HAEB 3DX6B 3WNIA 1SN2A 4NXKA 3T8MA 2OMXB 4YHYC 3RNKB 4LOVA 2H8PB 1RIUL 2NR6D 3QJZA 4U1MA 2IXQB 3HS5A 3ILQC 1J8KA 1B2WH 4TULL 2MCMA 1ADQH 1UD3A 2XN1A 3ARZA 5D2NA 3FFDB 2UY7B 2ZG3A 4L4VD 5CIPH 4I89A 5EC1A 1UCBL 2FGZA 4FZEL 3MV8B 4UT6L 4PI2A 5E6RB 5T1MB 3RZWA 2C3XA 3QQNA 3BXNB 3K6SA 1F2QA 4NQSB 2HAZA 2HRPL 4GG8B 4PG9A 2BVOA 2XVKA 5C08D 4MNQA 3V0EA 4ZO9A 4ZXYL 2JLPA 5TPWL 4PRAA 1YJDC 4KJYB 4XI5C 4Z3TA 1YG9A 5DMYA 4N0YH 4BSVB 3F12A 2CZNA 3T3MB 4OJDH 3NCYS 3ZJAA 2BS8A 1QSEA 2BP8A 3VFOA 1G7MA 1MZZA 3CCHB 4PJFA 1V3MA 3R8BB 4OLXL 1RZFH 4OIBA 3KCGL 4A67A 4WW2F 5ICZB 2ESVD 5HYSB 4GKLA 3QIWC 1JNNH 1NCTA 3EDJA 3QULA 4IKNA 3I9IA 4FFWD 1LEKA 4PJIF 3DOSA 2KI6A 2N1KA 1KIRA 5IBUB 4JFHD 4LVHC 5A7BA 1L9TA 3SDYL 5EZIH 1OWWA 2GSIA 1CD1B 3T71A 1ZE3C 4J3UA 3MFGB 3KMDA 1OTSD 5C0IB 2EYRB 4FLSA 3T2NH 1U67A 1KV3A 2EYSB 2NXZB 4L4TB 3VFWB 3ZL2A 4TNEA 3VD3A 4BZ1H 1P1VA 4JFXB 1BPVA 3DK2A 5BNXD 2UX7A 4JPIA 3U0TA 2FSEA 2WJ7A 5BOJA 4PJ7A 5JHDB 2KKQA 4W70A 1XGPB 3VXUE 4QF1B 4XRCB 5DD1L 4Q4IA 4AIEA 2Q87A 4CN1A 5GGVL 3FZUD 3Q44A 3HS0B 4MNQD 4XBGA 1B0WA 2YUWA 5LBSA 1EPGA 1UA3A 5AVSB 2JKTM 1NSNH 2YZ1A 4HSCX 4Q9RH 4G6KH 4L37B 3KEDA 2VXQA 1OY3B 3SPJA 5AVXB 4H88H 4U3HA 2CQVA 4O51A 4CVXB 1G87A 1IE5A 3FUIA 5DFTA 2V3EA 2V17L 3IKKA 2BRQA 1CDJA 3V8OA 4ELMF 5C0JB 1QSED 1RZGB 3ZKXB 3DJ9A 2FBOJ 3D69A 3PWNA 3MSPA 3SYOA 4XCFL 5F6IC 1KCSL 2WAHA 3V4VA 4BQ9A 3DX9B 1HDMA 2ENPA 3O6LH 1C8QA 4KNSA 4GT0A 1AJ7H 4LQFH 3TGFA 1I9RH 4J3XA 1TJMA 1V7MH 5B1JC 1ZSHA 5DF0A 3LXUX 4Q9QL 4UINL 5HVFB 1WGVA 5C97A 3AY4A 3IMTA 3DUUB 3KXFA 2KQNA 3S98A 1BXUA 5EOTA 4NQCA 1PG7X 1WFUA 5H37G 4QRRE 4CGTA 2LU7A 4ZW6A 1UD4A 1CK0H 4JREB 4TVPH 2IWGA 1NCCL 4UV4L 5B7MA 1I1FA 4N0CC 3NCJH 2OYUP 4TSAH 4B9GA 4CKQA 2OMBA 4P4KD 1HEHC 4IKKA 3T0EB 6PAZA 1N10A 2XKNB 1YUHB 1OO2A 2UY6A 4IHBA 4KHXL 1M05A 4M5YL 2MIZA 3GYRA 1J9TA 2XY1A 4ONHA 3SIKA 3K71A 2RMNA 5CJOH 1F5WA 3FPXA 5B7FA 5CJQH 3ISWA 2I27N 5C0AA 3PJNA 1A9VA 1QR4A 3NFPA 1SHSA 4FTDA 2OJ1A 3L4YA 4FTVA 5TDPB 4AYSA 4YXLL 2HYMA 4QJ5B 3K72A 1M6UA 2WYHA 1G5GA 3L8QA 4MBOA 3ELAL 2CBQA 2EP6A 2EIZA 2J44A 3SDAC 5IW1A 4LCWA 3CX2A 1E4JA 1H3VA 4HJ1A 3W2DL 2WLKA 3ARFA 4N20A 3OAWA 4OAWB 5T3XH 1Q9LA 3FOMA 2O26U 1B90A 2K78A 3VGAC 1XGYL 2HFFB 5I6LA 1MQKL 3RKPA 3BW9B 2W9DL 5K9OA 2WTRA 3AUWB 4X8VL 3INUL 2HZHA 3AREA 5DVOA 4PBVC 3ZQ9A 5L4MA 3KXFD 4G9FA 4MJ4A 3CFEA 4PJBA 3EYFB 2FLRL 5EU3B 3W1ZA 2CKBB 3JV0A 3K0WA 2WCSA 5HGHA 3GMQB 4OCLC 2A99A 4K8RD 3UAJC 5LGHL 4N8VG 3LXCA 2DTMH 4AUYA 1P2CA 5DQ9B 3LH8A 1JK8B 1FG2B 2EDFA 1I9JH 3HBZA 4CUCA 1KB9K 1QBLH 3NH7L 2EE9A 2J12B 4YFLI 4MAUH 3NMEA 5AQ0A 4HD9A 3T08A 2GTWB 1MFEH 2ARJQ 1DJGA 1OSPL 4L9LA 5F7EH 1RSFA 1SDDB 2DJMA 5C0AD 3S3CB 3UXFA 2G9HB 1GGUA 1IGFH 1TXKA 4FTVD 5FCSH 4EVNB 1BFOB 1ZWIB 4NFDA 1HHKB 2RHPA 4HH9B 3WSQH 4LCWD 4JPSA 1QVOB 4PLNC 3N85L 4ZPTA 1XT5A 1E5BA 2ZG2A 3ARFD 3WTWA 4MMZA 3BKMH 2LE9A 1I31A 3SKMB 2G60H 3LEVL 4J3OC 2AJZA 4M93B 4APXA 3MJ8B 1Q94B 3L7EB 3OF6A 1FYHB 1X5LA 1JS4A 2CBMA 3BZFB 4YX2H 1EHXA 1INDH 3ARED 3PPEA 3QIBB 4KZ0A 3ZHKA 3K8MA 3OKMB 1T0NA 4PRPE 2Z65C 1X5YA 1G2MB 2XWDA 2MNJB 3CFKA 4F58H 2WQWA 3SCMB 4LSPL 1HXMB 5CM1A 1FF7A 4ZO8A 4QT5A 4A2EA 3OGCA 4ACPA 2AABL 1DCEA 4KK9D 3DLQR 4QHMA 1N6QL 4R84A 4ALAL 5IFAL 5F6HI 2IBZX 4OSUH 2WB1A 4HU8A 2GW5A 1PTHA 1CI3M 4NAQA 4PY8I 1CDBA 4LLMA 3W39B 5JPMC 3DHPA 1FNHA 4N0UE 3SGEI 3QJVB 4WFEE 4FXGA 4UTBA 2NW3A 4E0RA 3NJGA 3VU1A 2YXWA 1S9KC 5I1AA 3IJSA 2FB4H 2VLKE 4DKFH 4MD4A 2BVEA 3EGXB 3DVGA 3RY5A 4WU5B 4D8OA 1FO0A 4XAWH 5IK3A 4JRXA 1MCKA 3GS7A 5CS7A 3VVVA 3OL2A 3HNTL 1J8HA 4D0CA 4FFZA 3ARBC 1BZDA 2OFQA 4CDHA 2N59A 2NYKA 3BT2H 4PJ9B 2EO1A 1Y6MR 4B0MM 1UTDA 2HA1A 5E99L 3HMXA 4XMWA 4FMVA 5DTFA 2JKXA 5HDBB 3I85A 3EFFB 1QYGL 4UQDA 3BSZL 3PUUA 1Q90A 4M03A 3IGKA 2EZ0C 4QXWA 4RFOL 1R24B 2B59A 3KPRA 1NANH 2K3HA 1NJ9A 3VMNA 5CEZH 3LEYL 5HVGB 4N2IA 4RS0A 1WPCA 3ASOB 3U46B 4JKLA 3SY6A 2FYYB 2HUEA 2P43B 4PTUA 4I0CC 4XCCL 3VRJA 2B1AH 3UTQA 4JR9L 4DQOL 4BH7B 4DKDC 4R2GC 3ZHFA 1CU4L 1ZEAL 3NT1A 1KXQA 5BS0E 3T3PE 1NIFA 5HHNA 3U25A 3GT6A 1KJ2B 3ZYJB 43CAA 3NIDF 5EDXA 4KJQC 2O5YH 5IB5A 3KH3A 1MCIA 2VZUA 4ZMXA 1G7LB 4I0PD 4AVJA 2NX5A 3D0LB 4GSQA 5ECGA 4WK2B 1E4KA 3O6FA 4UQ2A 4UU9B 4JRXD 4LAQH 4AYFB 4OD2B 1WBZB 5I1CL 4JY6B 4BGLA 3OLUA 1KY6A 1J8HD 1H3XA 1REIA 4EI6A 2ENSA 3C2AL 2NPRA 3DURB 4YSUA 3VG0H 3AU0A 3TJHD 1JMXA 1ZT7B 2E7LC 3FQXA 4YHNA 2K1MA 3IF1B 2AZAA 1XGQB 4UMGA 2EYTA 4LVHB 1THAA 3KPRD 4M43H 2Z4QB 1ACYH 4BD4A 1BPLB 5I8KL 5IHZB 2AEOA 4XN9A 2VITB 3U83A 4BKLB 2NQCA 2V2WB 4MJ2A 4FQHB 1T04A 1ACZA 4PWIA 5H37H 4OQTH 1GCYA 3BPLC 3Q5TA 5IT2L 2OYLA 3EFOB 1QP1A 1UFGA 2F7OA 5F97E 1U91A 4OY9A 2ED6A 1U4FA 4A6YB 3D4ZA 2IPTH 3PABA 5TK4A 1UA7A 2WQVA 3LKOA 4WW1B 2VQUA 4QUOA 2ZXDA 1CL7L 1TVBA 3GB7B 1IC5L 4GUCA 4OCXL 4JB9H 1DQVA 3ZKMD 1LO2H 3EGSB 2CO7B 2QGDA 4YSSA 3RURA 4YDZA 4AG4H 2ZAGA 3BZ4A 1T21A 2NX5D 3P3YA 5I1EL 4WEEA 1OCRB 3O6FD 2DYRB 3OQRA 4RMWA 2OL3H 3D08A 4PVMA 5GS1C 3P0VL 2R8SH 5DWPA 4FHJA 1C5BL 1DZ0A 2YAQA 4B7IA 1E6OL 2P47B 1IQDA 3BISA 5B3JE 1BD2E 1TZIB 2XFGB 5F6IB 2YSTA 2D2OA 4RRPA 3BFOA 1L7IL 1N12A 5DD0H 3KPSA 1NPJA 4X7SL 1T22A 5DGRA 5EIIB 4LLYB 4OJEH 3L9RB 3AS3A 1AAJA 3I9PA 1OXYA 4YT7L 5F1SA 1VGEL 1T1XA 2A0LC 4MCMA 1U95B 2JTDA 4K3GA 2VXTL 1ZIAA 4HDIA 2KPNA 3K4ZA 1MWAA 1KT2A 1HILA 3WN6A 1UKSA 4P9ML 3A4FA 4U2ZA 4M1GH 1XH1A 2XXFA 1M6OB 3B8SA 3L81A 3RWEB 3TCLA 4NN5C 4XB7A 4FFVD 5HI3D 4KO9A 2Q1EA 2NY1B 3O3EB 4MXVF 3SDDC 1LMMA 3BD4A 5J9PA 5MEQA 2D4DA 4N2HA 1L9PA 3BAWA 4MHHG 4MSWB 5C07B 1S9XA 5LXGL 1U8OB 2VXSH 5AWNH 1Q0YL 2FBJH 2PPFA 2XQBH 3QO0A 3NFNA 4ZSOA 5FYKD 1I1RA 1V3KA 2OMNA 3U0PA 2CLRB 4LRNH 1HHHA 4XC1H 1IGJB 1XVSA 1M9WA 2AERT 5AL0A 3UZEA 5J1AA 2V2TB 2WWKT 4QKXB 5ICYA 1EQHA 1XO8A 2UWEF 3CSGA 3QJFB 5ESAA 4NRZA 4YDKH 1I8KA 3NJIA 3BRFA 1T03L 3IPFA 1R5IA 3SDAB 3NRFA 3KPSD 1EEQA 4PWKA 4HSQA 3OV6A 4NKQB 4J3TA 2Y7XB 4J2QA 4ZMZA 1VZGA 3ZT7A 3SW2A 3L3IB 5L0QC 3STBA 2W26B 1H6UA 2A9BA 1RY7B 4PR5B 3DX6A 4TRPH 1AQDB 2OMXA 3ROLB 2BNQA 4OIAA 3IFOB 3LS5H 4DGWC 12E8H 2X0UA 1N4XL 4Q0XH 1IARB 3DJTA 3OKNA 2CUHA 4ZODA 1JGUH 1OLZA 1Q0XH 2ICEA 1TMQA 1FAKT 4F2FA 4HCGA 2H32H 5IHUL 1SJEA 2HP4A 3KYAA 3VXQA 4NZTL 1PZCA 3HO5A 3DKHA 4EKJA 1ZCRA 2DBLL 3B1TA 3JTSB 3LIZA 5BUGA 1RMFH 1E3XA 3OB0K 4NQSA 2CU9A 3CH8A 4J6RH 3L1GA 1NBCA 2FDBP 3GHBH 4EO5A 1UZ8A 3PHOA 4AVIA 1OPGH 1BM3L 2EDMA 5EF3A 1E4WL 5FDWA 25C8H 4C4KT 2G2PA 1N9PA 4BSVA 3HZYB 4XNBA 1CE6B 3B5HA 4NNPH 5L30L 2BHFA 2BC4B 2CO6B 3GSRA 5FGBC 3NIFE 1AO7A 1PGRB 1U93B 1NTDA 2EDBA 2XJKA 5D70L 1EANA 2BWDA 1J0IA 2FCBA 3LZFL 4FNLL 3VI3E 1LP9F 2VM3A 3RWHB 4P9HC 1M71A 1SOQA 2ZIDA 1LO0H 3MR9A 5GSRA 3H54A 3O6KH 1PKQA 3HMWH 3QCTL 2BNQD 2W0PA 3AROA 4R7NA 3Q48A 4XO9A 3QNFA 4WO4A 4NQTA 4HS6A 4HC1H 4MJIA 4YL9A 4AIZA 3FF8A 3EYVA 5ADPH 1LQSR 1IQIL 2J88H 2Y06H 4FG6C 3VFWA 3DO7B 4QRUB 4NUGH 2XU9A 5LDUA 1NANI 3W9EB 4Z78B 4JFXA 1PFXL 1D5BA 4GUQA 4P8QA 4JKKA 4PV8B 1QKZH 4JZJA 5DJCA 3S36X 4MASA 1MFUA 1TJHL 1WZ1H 4X5XB 3ULUC 1DP0A 3WJMA 5DHVH 3BGFB 1B9WA 3HE6B 1K8IB 2X6UA 3I6GB 4YIQB 5GS2D 3F7QA 3IN2A 1AP2A 3MJ9H 5CD3B 4BIKA 2K4AA 1VEMA 2BT7A 2ZP8A 3HPLA 4OZIA 4F8NA 1AO7D 4C57C 3L5JA 5IVXF 5C0ND 2VDMB 2VMDA 3WD5L 2KLTA 1GK5A 4ZPVB 4R0LB 5E0QA 3DX4A 5GRJH 4JN1H 2IPUG 1HT8A 1RHHB 1UWXH 4CBZA 1AGCA 2G2RA 3D34A 4WO4D 2OX5B 1LDPH 3JTTB 4MJID 4L0PB 4YAQB 4PGBB 4DVBA 4CVWA 4D2NA 3BAIA 4ECNA 2EUZA 3TASA 1EPJA 2ATKB 3HZ3A 3MOAL 4HIQA 3TFKC 3U82B 3QDGD 3V65B 3VRIB 4LNVA 2WQ8A 1OIOA 4AEHH 5T3ZH 1T6WA 1ZS2A 2GIXA 3NK3A 3JWOH 4UQ3B 3FQ1A 1N68A 1RK0B 1QLEB 2EJ1A 2VN3A 2DQIL 4JHUA 4MCYA 1PD1A 4PRBA 1A2YB 4R2GB 2NT1A 4Y79B 1IQFL 3MJWA 4R96A 1JP5A 1UXMA 2P45B 1TJIH 5IMMB 4JNXA 3CZGA 4FKKA 1W6LA 4ODUA 4NCC1 1YNTB 3X12B 3VG9C 3WMQA 4FRWA 1SOSA 4KI5D 4QCIB 1CS6A 3AW5A 3O3DB 1WD9A 3C9NA 5CP3A 2ODHA 3QORC 5KSAA 4XP4L 5JZ7C 1D5MA 3ZXAC 5C2BH 1EMOA 1CLVA 3C5ZA 2BOHA 1OTUD 5L2KE 4IK7A 3S0PA 3V0JA 5DO2C 2W3KB 1FNSH 3ESUF 1DLHA 3DYOA 4OGAC 1Z5HA 1PDKA 3OAYK 5D6CA 4A2GA 1B2YA 2Y5QA 4XVTH 1NDGA 3EYFA 4GAYB 4XPGL 2I9LB 4LVNC 4PV9A 3GMQA 1AD9B 3ULVF 3GJFA 3GZKA 3BPLB 5BV7B 1U6AL 3OLIA 2NUTA 5F3BB 4XZUA 5HHXH 2NNAB 1JK8A 2XKUA 1DN2A 3GXDA 4GAAA 4G6JL 1IEAB 2ADJA 5DUJA 4HCFA 1NAMB 4PJEA 4PW3A 4YBHA 4KGJA 4N2KA 3WLWD 2P44B 2J38B 4NN6C 2WSPA 5HDQH 2J8UB 5TTRA 5CCJA 1I75A 1YPZB 1YEIH 4XXWC 3WKPA 1GSMA 1CBVH 1Q72L 3KPMB 4ZD3L 4XN1A 4CMMA 1WHFA 1WA1X 2YD1A 4PS4L 1BZ7B 1LE9A 1XF4B 3GSVB 3GCXE 1C1EH 4OZGE 4BH8A 1ZLDA 1FVCA 4HK0B 2CK2A 4M6OH 5KSAD 4CRPA 5JXEC 3T6QC 1ZLUK 3LN1A 2HKFL 3BKJL 2ERJB 4M7LT 5CUSL 3C5ZD 2ZUQC 3NDYE 4Q74A 4YDLC 4CC0A 1O5DL 4Y5VC 4L3CB 1IBGL 1M1XA 3HB3D 3IMSA 3T1FB 3ZDYB 1IAIM 4BXVA 1YEEH 4F7TA 5FO9B 3HVDA 5HD8D 2Q8AH 4D9LL 4DESA 3HUJE 2VLRA 1AI1H 2XWEA 5JHLL 4E9WA 5D4HA 4ZDHA 4TOYL 4TL5A 3X11B 1SLVA 2EECA 4XHJC 3A22A 1HAUA 4NJAL 5M95B 2AJVH 3AXLA 5EIQA 1NFDF 3GRBA 1UXSB 5D96C 3SCMA 1AQKH 2VR8A 4H26A 4NN5B 4DN4H 3GSNL 3MODL 3ZOAA 4EI5C 3WTSA 3VE0B 4KH2A 1N5YH 3MLRH 4PLKC 4ISVA 1KGWA 5A6IA 5L8KB 3ZMRA 2VH5H 4OLWL 4RZCA 3PQYA 2M8XA 4OZHB 1DVSA 1IBHA 3BI9X 3NA9L 3PNRB 2BVPA 4G80A 2XBXL 4PGZA 4RA3A 4YGAB 5EPMB 4X6DB 4U1GB 2BW4A 2FWSA 1JK9B 1LEIB 4JCWA 1AD0B 4P4RA 4LCIL 5IUCA 1PNCA 4NGAL 2AJSH 1AOZA 1TUPA 4GI6A 2Y2WA 1VEOA 4P23A 4QDGA 5H35B 2BOUA 2XIDA 3KR3L 1OAKH 5A2JH 3NEOA 1DSFL 1XH2A 2Y3NA 3C08L 4IU3B 3EDDA 3SD2A 5DFWH 1DDHB 1HJ7A 2Q86A 2WLLB 3D18A 3MNVB 4OF0A 1LD9B 2GG1A 3REWA 4XTRC 2VLRD 5ITFA 4JFVA 3RGVC 3EOAB 3NP4A 1DO5A 5D1XB 4JYVL 3VTAA 1QFWL 1FFOB 3DDFA 4ETQB 1IQML 1E4XL 2L7UA 5C0BE 1UFUA 4Z7WA 4KDTA 2I7OA 4ZUUB 3SCMD 1OVZA 3ZGIA 4F8TA 3F00A 3U46A 3VXMB 3BP5A 4BH7A 1MREH 1PZAA 2GJJA 3GS0A 3PQYD 3QFGA 4UTAL 2P1YA 1W0VB 2CO4A 3ZDWA 1PPIA 1RUMH 1G2LB 3V52L 3BWUF 1ID2A 1DQTA 4FABL 4XBPA 5T1LB 1W72A 2ZSVA 3EJJX 1GL4B 1HHIA 1G7LA 4P23D 1UM5H 1I9IL 5E5MB 3UGEA 1T5WA 4UU9A 4U49A 2FT6A 3L2NA 1U8LB 1CGUA 2BSRB 4OD2A 1WBZA 1K37A 1ZPUA 2ADGB 3CX5K 3MA7B 1TTCA 5CKNA 5I16B 2YBGA 4QR7A 4JM2F 1JBUL 4PS8A 5FYKL 2HKHH 3RFRA 4KMQA 5HHQA 4HIPA 3IGLA 2F6AA 1K4DA 5IW6A 2WANA 1U8QB 2HVKA 3IF1A 4J28A 1IZKA 5ALBL 3H9SA 4I4WB 3L3JB 1FC2D 1S46A 3E9TA 5DUPH 5AAMA 2WNWA 1MAKA 3EJZD 1P7QD 1OT4A 1LO3H 4ACTA 3L2LA 4GMTL 2FJFB 4IRSC 5GJSH 3K1DA 3DARA 4N0FA 1EBVA 3EFOA 3ZL4L 3VJ6A 3N44B 3C6SB 3TBSB 4MA7L 4OM1H 4KUCD 4ISIL 1CXKA 4GSXA 2D8KA 2C1PB 2JK5B 5KG9B 3DDGA 3CN1A 1RVFL 1ATBA 4PGEB 3UIZA 3OXRB 4BUHA 4U7MA 4K3DH 1Z9PA 4UILH 1MW2A 3CSPA 1TZOA 1MHEB 3PWPA 4XNUH 5DZPA 2QHRH 3Q6FA 2NY4B 3HBPA 1TQTA 4AL8H 1A6UL 1G7PB 3R19A 4WGVB 1JZIA 1XH3A 4HFUH 1SXSA 2Z35B 2QDVA 3D2TA 4YO0B 1GIGL 3ZTCC 1HL4A 2Z4TA 5IOPA 4MYPA 3L9BA 3V5KB 3ASIA 3CXDL 3JXAA 2O5XH 4FQIL 5H8DA 3E6FA 1XAKA 1YEDA 4Y4FC 2TRYA 2ZX6A 1DLFH 4KQ4L 4NUPA 2VDOL 3E8VA 1E5CA 5CZKA 1BFVH 3L9RA 2JE8A 5ABAA 4BE6A 3DX7A 3H9SD 2MGPA 5ACZA 3CU1A 3GF8A 2AV1B 1VPOH 1F58L 1YYMH 3VTMA 5I6NA 2D3VA 2BO2A 1U4EA 2WXNA 2Y2TA 4R3SA 4Q56A 5A1AA 3ZRSA 1SJMA 1MI5A 3L3GB 3DEMA 1KENH 4IS6B 4KJPC 4MQ7B 2J2ZB 1LK2B 3QRLA 2XBYL 4UB0L 2X40A 3I6KB 3FAWA 2OTPA 2W65A 1CQYA 3MGOA 4ZFQA 1RJCA 3HNVL 4M7JH 4PTTA 3DTDA 4UBDD 3H5CB 2XSKA 5CIPB 1JF1B 4LESA 5BQDA 3IVKA 1A6VL 2AJXL 3BN9C 4LBAA 1BVLB 4LDLB 2QFPA 2Q9OA 4X5QA 1SXZA 2WYZA 5AD0A 3PWPD 2N56A 3WE1A 4QRQB 5F8RC 4LKCB 4M1DH 3BSHA 3T0BA 4ZW7A 2QVMA 4ZAKA 3F2LA 3M1CA 2D31B 2F1BA 3BUQA 4NIYE 3VG9B 2Q2LA 2J21A 3ZTDC 1YYLH 5DMGD 1HOCA 1A7NH 1INEH 3IDUA 4UUJB 1WK0A 2C9AA 3U0WH 2OAAA 2OA9A 5DFAA 2IGFL 2MPAH 3O41B 3WFCL 5HHPB 4ELME 4NG9L 2XIIA 4N2OA 3BH9A 3IDJA 3UC0H 2PCPB 4LSVH 1QOKA 4PR5A 4DETA 3ZTEA 1AFVL 1WISA 2EIJB 2ZCHL 3IBEA 1SMDA 3CIQA 3CJJA 3OJDB 1K85A 5HPOA 4KOBA 1X7TA 2VR9A 1Z3GH 1MI5D 3FSZA 1BX2A 2EE2A 4FLOA 4MAYA 2MCG1 1N59B 4PN6A 2BZDA 2E6QA 4HLEA 5KOMC 2Y7OA 2DQTL 4LVNB 3EBHA 1OP4A 3ETBJ 4S1RH 5IG7B 3BMWA 4LNRA 3QXAA 1JZ7A 2VDRB 1S3KL 1LEGA 1PZ3A 1H15B 1MFVA 3EDKA 1BFSA 3RWIA 4BDVA 5DFVC 3UJJH 2FRGP 1I1AC 4PWFA 5BJTA 4D90A 3K0YA 2FJHB 1L3WA 4IDJL 3P40A 4XMUA 2DWSA 3H85A 2WINB 5K39A 2YLHA 3RUGA 3S97C 2BK8A 2BQ7A 4ZAKD 1GZPB 3VWKA 4GKOA 2DW5A 4ZUVA 4NKIH 5E2UH 5F44A 2A9MH 2CJSA 2FEDD 3VI4B 1DVQA 4Z0KB 3IDMA 1UWFA 1W8NA 1GC1L 2X42A 4JKPL 3VXSB 2XG4A 2CMRL 1AXSA 1NICA 2GJ6E 2IPUK 4ADIA 3TESA 3UYRH 3CK0L 2R2EA 2ZUQB 2X09A 1DE4A 1TLMA 3CLWA 4OJFL 4Y5VB 1CGXA 3ESOA 2A6DA 3QJHB 4JN2B 1Z6EL 4J8QA 3RY6C 4ALAC 4B9IA 3T4YB 4DVRL 4XNXL 5CNHA 1IT9L 3S4SB 4IQHA 4MAYD 5E08L 4M9OA 1J5HA 4Q8BA 5F7BA 2B16A 3FFCD 5ESQB 3O4LA 6TAAA 4B95C 4X2UA 4F7MA 1G9NC 2XN9B 3B3BA 1EQGA 3GS4A 3KQCL 4KJWD 3TWYA 4ORZC 4F33B 4QRUA 3DVNA 4EI5B 3S88H 5INCA 1I7UB 4I3SL 1VHPA 5D7KD 4AZUA 4ANVA 4BK5A 1ZA6B 3LZNA 3NCXA 5I30H 4IKLA 1IM3D 5DMIL 3SHSA 1TT6A 4F2EA 3FONB 1K8IA 2ZP9A 4F91B 5F9JA 4YIQA 2CDGB 4PD4K 4NQDD 4HHAA 4ETYA 3VWKD 4LHUG 4YSQA 1R75A 2CO2A 1FJSL 4ZG1A 4DWHA 3QR0A 3D25A 2O6CA 5E6SB 1HHJA 2P80A 4DHLA 2VDKH 1NOFA 5D2LF 4I9XA 1NLDL 1IQJL 2EIBA 1KBGL 3AQYA 4HOMA 3OG4B 1RJYA 2GBVA 1P53A 2DRUA 1OZUA 3QNYB 4RBPH 4TS6A 5E8NA 1DSYA 5IW3A 3FUMA 1YEGH 4R0LA 2BMKB 1I8IB 4YUEL 4KXZI 1JV5B 1TVDA 5EU6E 5E1GA 4PGDA 3RKDD 4Z0XA 3UYPA 2ETWA 4PGBA 4G1MB 1CYXA 2BNRB 3LNIA 4HJGA 2DLHA 4S1SL 4OV5A 1M2VB 4NP4L 4B9JA 3O4LD 3OVUB 4RWHA 2KH2B 3RPIA 2Q2EB 3W0WE 3AGVA 4ANKA 4HFWB 2F7RA 3OKDB 1U92B 5SWSB 4HG4J 4H8WH 15C8L 3UBXG 1B9ZA 3QUYD 1T7WA 4PJ6A 2Y7LA 3WKMH 5GRZA 4B5EA 3PGFH 3MRBB 2VH0B 1IU1A 1EMTH 1O7SA 4O02L 5J8OA 2AJUH 2XQYA 4KTDL 1WLHA 2J6WA 4WAFA 3PDOB 3F3HA 4EIUA 3J8F7 5D7HA 1C12B 2P80D 3UJIH 1YNTA 2E7MA 2JV6A 3PXHA 3W57A 5JDJA 4ODSH 1HRFA 5B38A 4KROC 8FABA 3M36L 5JNYB 3BQUA 4XP6H 3K4DA 2GIYA 5DVNA 3MCLL 3MVSA 4OLZL 4AE0A 5K9QI 4XNQB 5IEKB 1HFUA 1WV7T 1MDTA 3H42H 4IIQA 3VVWA 4F2MA 2G5BB 1GVIA 3CVIH 3ZX1A 2DQ6A 1EGJH 5L7XH 1YEWA 3SE4A 1UKQA 2OSLB 1S9YB 2KNIA 2XZCH 4LSQL 2YMTA 4QXTB 5F0JB 2UXTA 4BWTA 5I18H 1QATA 1QFKL 4AQ1C 4YVUA 5HGDB 5T8IA 4GAYA 1OAYH 3MRFB 4OLVL 3UG5A 5DJ6B 2WK2A 4IRSB 2OCFD 3SN6N 1OGAE 3DXAE 3GRWL 1AHMA 5D7LA 3FSOA 4C56B 1KTLB 4V11A 2PTUA 1IEAA 4W1TA 5E4EC 3VACA 4DP4X 3X3FL 3DECA 4MS8C 2F8OA 5KAQG 1FV1B 4KNTA 1YAIA 5D5MF 3ESVF 3LNFA 1GYCA 3AMLA 4XGZB 2ZTBA 4XOCA 2C3GA 5J0BA 1NEUA 2OMYB 4XWGL 4CSPA 4XBEL 1XF4A 4H5SB 5FDYA 1ORSA 3RVXC 2I26N 3PWVB 2IPKA 3BQUD 3NZHL 3IDYB 3QO1B 1NKRA 4AYEC 1QWHA 1CFSA 2Y6TE 4QYAA 3QEHA 3NIDE 3UABA 2AK4E 4Y2LA 3LHPH 4BGDA 4K5PA 1KELH 2JIXB 4ZUWB 2MCAA 2OTUB 1JVLA 4Y4FB 1Z7JA 3MRNB 1LMIA 5DS8A 5DQDL 2Y5TB 3T1FA 5HGBB 1KLUA 1EMNA 1P4BL 1OQOA 4JJ5A 3ZT6A 2YD8A 1Z5LA 3D0VA 4XVJL 3X11A 3P11H 4Q9CA 1V1IA 5AVVB 1X5AA 3L5IA 2EACA 4MFHA 2VH6B 1UXSA 3MMEB 4NUJB 5D7LD 2WVTA 1QUNB 2WQAA 2XWBB 4AGOA 3VE0A 3CZNA 1SVBA 4HH8A 2AS5M 3RVUC 3BGMB 4U6HB 5KYUA 4D9QE 1U8CA 2W94A 4F7EA 5AUMA 5EIVA 1TEYA 3TL5A 3I6LD 3CLEH 4JG1H 3QIUC 4DK6A 5KTEH 4B53A 2HFGH 4FEIA 5JR1L 1OOAA 3UC2A 3HC3H 1T0OA 3RL1B 4K9JA 1JL8A 5F1NB 1BV8A 2EI7B 4PM1A 4N0RA 1ASPA 2IH1B 2OMWB 3TWCH 2RFXB 4KI1A 1FAIH 4KO5A 4LPCA 3U7WH 1SOXA 3SPIA 4WY7H 4AW7A 3D48R 1DSWA 2BDNL 3U7YL 5EEYA 2Q20A 4ZTOL 4FQ2H 4ANWA 1MHPH 1V54B 1CT8A 1F4AA 3RJQB 5FEBA 2WLLA 3EFDL 2JJSA 4DO5A 2E47A 2Y4SA 4YSCA 2ZWKA 3BFWA 3VWJB 1MJUL 1RZKH 3CMOH 3U9PH 3CVHH 1BYOA 5C6PB 3GBEA 5KW9L 1RL1A 4X8CA 2GQHA 1MHHB 2X2IA 3II3A 4LPTA 5MP6H 1KTJA 2XN2A 4JKNA 5GGTL 3BAJA 2X05A 4JHZA 2B77A 3NN8B 3V6OA 1BD2B 5FYJD 5ITBL 2K9FB 1TYRA 3ILEA 1GZQA 2LFGA 2WO2B 4KK5D 3WMPA 5TH2A 5KYNA 1I1AB 1QMUA 1EK3A 3L45A 4YDIH 1HWWA 2FWUA 2AAAA 4FJ6A 1KB5H 4IU2B 3RJOA 5CSZB 1ETB1 4KOCA 4MXVE 4XAKD 1E9PB 2ENJA 2OCJA 3B1UA 3O8XC 4UDUA 2Q6WB 4E68A 3BAYA 2J6EA 1UEYA 2R29H 4M6ML 1YN7A 3T5WA 1T7VA 4R5XA 3QG6B 4PJ5A 2DQEL 3GMNA 1JPGB 5GHWH 3P3UA 4GQPH 1NGXB 2OL3B 1WHPA 3PJSB 4HCRL 2UZXA 4OCWL 1CFTB 1SMAA 1RJLB 2WXFA 4DIXA 1RUAL 3L9YA 5GZNA 4NQEE 1P69B 3DETC 1EA9C 2DTSA 2JNZA 5CEXB 4H40A 2QPSA 3IDGB 3SOQA 3MDJA 1ROCA 4OQ1A 3PIQB 4WFFD 2UWEE 3RWDB 2IG2H 2LABA 3IU3A 4PJDF 4X9BA 2WZ5A 3AFLA 3APCA 4FFTA 1KJVA 4G2AA 4CC1A 2OR9H 1YYCA 3PHQB 1JZ4A 2AXWA 2FJFA 3U9UB 1H0DA 3QGVA 3PWLB 5E70A 2EIDA 1SEBA 3MA9L 3TBDA 5IWLC 1JPFA 4OJYA 5EUKB 3TBSA 1O6SA 3DBSA 4UT9H 2BSEA 3IN0A 4WJ5A 2QFRA 1E8ZA 4XCEB 4FA7B 3ULVL 3WFZA 4DKEH 3U4EA 1GMIA 1XR9A 4G42A 1XF2A 4X6CB 1VADB 4XP5L 2Q8BH 4KDVA 3EJTA 1U8JB 5BZXA 2EABA 4C55A 1MHEA 5I1JL 2W2NE 3X14B 4ZZKA 3ATAA 3QFJE 3QEQE 5TJWK 1YMME 2CGRH 1FI8C 1NCOA 2IQ9L 2R1WB 1MIEL 4PJ5D 3CXHK 3HC0A 2IDCA 2NYYD 4S2SB 5GS3A 4X9FA 5FR3A 4OCSL 5FOBB 3V5KA 1AOHA 1T4WA 5GZND 4LCCB 2F19H 2A9DA 3EG9A 1XV8A 2A73B 4ZFGL 4ZX3A 3EH5B 4NQXB 1FSKC 1A7OL 3BWAA 4KV5F 4Z7QE 1TOXA 2HRGA 2XYCA 3WFEL 1PEZA 4ODWB 1A4BA 2VR7A 2DYSB 3SO3C 1M42A 4K9EC 5CEYA 4N9GB 2X1XR 5C3IA 2A6KA 4K5OA 3DV6A 1BECA 1EZQB 3F8UB 4PBXA 5AAWA 4U3CA 2W9LA 1JPSH 1LP9E 2YQGA 3B9AA 5IBTH 4AV4A 1Y18B 2VZOA 4LCYA 4Q7DA 4NZUH 2ZWNA 2W0FB 3F65A 3RU8L 2V2XB 4OF5A 1X5FA 4X6EB 1AGFB 2PO6B 1JHLH 3R06B 5JW5A 3L1EA 5CIPA 2GITA 2H32B 1NCBL 2YC1A 3ECVA 3MLWL 4AGPA 1SRDA 4LPUA 1E5AA 1ZJAA 2ZCKH 4NEHB 2X89D 2EVHA 3O9WC 3LKPA 1CX2A 3I02B 1JOIA 4JFWA 1A47A 4LKCA 4ZOEA 3CWGA 4X9GA 2RH0A 3RFZC 1F7EA 4ZQKA 3MV7B 1HYSD 4QYOA 1HL8A 3RIFF 4BTTA 2QTVA 4AJWA 4DZ8A 5BVJB 5T1DL 3VD4A 2WIIB 1MQ5L 4M7KH 3G6AB 4GW4B 4X4ME 5IFHH 4G3YL 4ZUTA 4Y89A 4ZMLA 1B4JL 1N3NB 1EVTC 1RIUH 1KN4L 2D73A 2V9QA 1KPRA 2X53A 1A8JH 3MRHB 3SJVE 4TULH 3U36A 1L0YA 4Z7NB 5IVXE 1GTNA 4Y5XB 1L9SA 2TSAA 3MLUH 2NY6C 2WM0A 4QHKI 2DPKA 4AQ1B 4RX4A 3HG1E 4FZEH 4X4YB 3WJLC 1JIBA 4UT6H 2XPGB 1CICA 3E6HB 2VABB 2DWDB 4G1EA 1JWSB 2APXA 1T5KA 3SBWC 4HSAC 3U6XS 1FE8L 2HRPH 3H7LA 3I9AA 4RNRA 3EHBC 4K7FB 2WVVB 3WL9B 3VFVB 5K1JA 1S7QB 2H1PL 4IOFD 5E4EB 5FYLH 5TPWH 3Q2WA 1RIHL 1BQHA 4XN4A 3UAFA 4DUWA 1NCAL 4NM4L 1DBAL 1PLAA 3CSYB 3Q3KB 3IGUA 3TFBA 1OEZW 1PLGL 3FCUB 5KSBF 4JO4L 5AVZB 4GRMB 5DT1L 2UWOB 1DJYA 1Z2KA 3WIHA 3WDHA 1KPVB 4WHDA 4FZ8L 4GQQA 4P2RE 1E6JL 3OR7B 5KYYA 2OMTB 2YRLA 1FL6B 3LTFB 2L0DA 2FLBT 1S78C 3ARTA 2BZCA 1SEQL 2GFBB 4PB9L 5GS0L 1QD0A 4XE0A 1E50A 4NQVB 3SDYH 4I88A 2CPCA 5B39B 3LXAA 3V9EA 2FGWL 3FHEA 2XC0L 5KEZA 5IEHB 4PJAB 4RX4D 4EF3A 4N2GA 4IBWA 4GINA 4G8IB 1CICD 3TCTA 2X1OA 4S10A 5F71A 5A2KH 4G8GE 4F3FB 4E42B 3EIFA 1HQRB 3GI9L 3D8MA 4HKXB 2Z7YA 1MJJA 2BWIA 3CG8A 4RFEA 5GGVH 2R9HD 2XA8H 3KLSA 3P2BA 2YPLE 4JGMA 1UB6B 3QJXA 5EZJA 1SN5A 3BIKB 3OJMB 4PIBA 5E8OA 2KS0A 3IBOA 2VAAB 4MXWL 4AEEA 2YKKA 3IWVA 3QUGA 2V17H 3CVBA 2UYLA 3EYQC 2VZ1A 4JZOB 5ENWA 2HG5A 2V5SA 2CDGA 4A2HA 4DSYA 1KGUA 5JPNA 3ARXA 4XMZA 3DX8A 1LE5B 1SJVA 4TQEH 4NPYA 2CR6A 1JG9A 4L3EE 2ZF8A 5C09B 2P24B 3D9AL 2XC8A 1IC7L 1J8RA 5LN8A 1ZA3B 1ULVA 4YHZH 4JW3A 4KMTL 5EO9B 2XVLA 4Z76A 3WUZA 2VKXA 2I9AA 2UZPA 4ERSL 3AT9A 4Q9QH 3UTZA 2WFXB 4B9ZA 3H9ZA 3FQWA 4UINH 2Y38A 1FFMA 4LVOB 3X2QB 3SY0B 4ZOBA 5B1BB 3ZTNL 4NENA 4TUUA 2BNRA 3D3VE 3SKOA 1AR1B 5FCUL 4FQPA 3UCRA 4HAFA 4I1RA 4D0DA 1QRNA 2AANA 4UV4H 2V8MA 5DRZB 1JV2A 3CS7L 2N7BA 3DYPA 3V79C 2XTJC 4QRAA 4HF5L 1U92A 4JCMA 3R7QA 1BGXL 1GW0A 4KHXH 2OZ4L 4M5YH 2CLZB 3VFUB 3CDFA 2JCWA 5DZVA 2DQMA 2WC7A 4TVPD 5K33A 5DEJA 2YD2A 5DS1A 3WN5B 1CVSC 1YNKH 2Z92A 3OLEA 1XR8A 2YUZA 1NFDE 1XEUA 1EPIA 1GS6X 3O11A 5J12B 1EBPA 5TFSL 1I8AA 2Z8SA 1HCFX 3GXMA 4XVOA 2VL5A 3ESNA 4YXLH 5HVHC 4BUGA 5DJDB 2V7HB 1C12A 3FU3A 2YRZA 2VXUL 4L0ZA 4WI0A 2ODIA 1SHWA 2Y22A 5IM7B 3VXTA 5I1KL 5KJRL 3HNSH 3D09A 3MRKA 1WFTA 4X80L 1TKWA 2F61A 1VB9A 2HLAB 1T7XA 3NRPA 5GSVA 4AXWB 3GM8A 2W80C 1N64H 1Z0MA 2QZ5A 3AQZA 3EJYC 5E6IA 1XGYH 3KS0H 4QXUL 4JFDE 4K94L 2IDFA 1MNUL 3LPFA 2B2XH 5E9AA 5IEKA 3GGWA 3INUH 3EXJA 4DN3L 4AT6B 2K9UA 4KTYA 1QI4A 3MDLA 1UD8A 2G5BA 2CR3A 3QQ9C 3VXRA 4YZUB 1G1SA 4PREA 2XZZA 4EDXB 2BNRD 3AM8C 5T3XD 3V0VA 3FDWA 3B2VL 3D39E 5LGHH 1QRND 4NOBA 3OZKA 4AM0A 2E86A 1SDAB 3NH7H 1D7DA 2H6UA 3CN2A 5EORL 3APDA 1B4LA 4HZLB 4KX9A 2DJ4A 4IGBC 4AENB 3V5DA 1KTLA 4Q52A 3TN0A 1D5ZB 1FAKL 2HPTA 5SWZA 1A6WL 4KX8A 3ILPB 5FHAH 5CP7B 1TZAA 1Q8MA 3P5BL 1HYRC 4GKSA 3V8CA 3V0GA 2Z6FA 1PFCA 3STLB 2OMYA 4WRLA 1S7VB 4Z95H 5KVEL 3B43A 2CIIB 4H5SA 3ZE2B 4M3KB 1M7XA 3T0XA 3UMTA 5ANMA 5E6ID 4WWKB 3C6LA 4XLWA 1U8MB 4WKZA 4RGND 3LEVH 4KXDA 4LVEA 4ZUWA 4O2EB 2YD9A 1H5BB 2OTUA 5E00A 3VXRD 2E6PA 1V3JA 1WVZA 3B6SB 5I66B 5D6DA 2V7NB 2Z93A 4HKZA 3SO3B 1WAAF 2PCFB 1KACB 3CPUA 5CXPA 2DM4A 1QSFB 5DJ8B 4U4IA 2IH3A 4LSPH 3BT2A 1CF8L 1UGNA 2RD0A 3WNMA 2W86A 3L3DA 5ILTL 5DJ0A 3HS8A 1HC1A 2ED8A 2AABH 1C08B 3KPTA 2Y3AA 1XFEA 3R18A 4L2YA 5LAXB 1XZ0A 8PAZA 3MMEA 1SF5A 1L6ZA 3G5WA 5IFAH 1QUNA 3GTNA 3TN0D 1NL0H 2M2DA 5IROC 1SY6A 4U6HA 5DI8A 5SWZD 4MQXC 5M7QA 2AYLA 2QV2A 3NYKA 2KPWA 1V1HA 3HZKB 5AW7B 1KLOA 2VISA 2WAQA 1UT2A 1RQ5A 2CXKA 3GUFA 4TNWF 4BA8A 2IAMC 2F18A 3SSGA 3FAXA 4NGHL 4E2OA 1RLWA 4HWZB 3BAXA 1F13A 3HNTH 1S9WB 1QWNA 4I1PA 3HRPA 3F6JA 3C6LD 4GOSA 4JRYA 5H94A 1JXKA 1KGCD 3F04A 1EEYA 2EO7A 4M8VA 3U7UG 4L9DA 4V2BA 4F7CA 3BQVA 3EKCA 4JFFB 5E99H 4OKVA 3MX0A 2X4TB 3D7PA 3MGTA 1QYGH 3ZE0B 4BTIA 2JB6A 3BSZH 1IGZA 4RFOH 2N4IA 1H19A 3O3UN 1BG9A 1IQHL 2HJFB 3LEYH 3R1GL 5F0LB 2NY6B 1BVNP 1BQLL 3L1FA 3NUKA 3MYJB 1FSBA 2WUBL 1EHAA 1MHHA 3FT4A 2C7FA 2VIRA 4XCCH 1S9VA 5CEZD 4X99A 4JR9H 2ZKHH 4AITA 3JZYA 1NBVH 4LRIC 1A6TB 1CU4H 4H1LH 4AK2A 1P1ZB 3VCLB 3EHBB 2XICA 1PFOA 1QNZH 2NSQA 4ZYKB 2QDWA 2FIRT 3P02A 1PRHA 1G6RL 4OQTA 1X5KA 2C1OB 2WO4A 3BP7A 3OMIB 4S1DC 2GTZA 3QAZB 5FGCB 1K36A 4IU2A 4FQQA 1QFUL 3CUPB 5IJVA 2BS71 3FULA 4CDGC 3HE7C 4KKLC 4LL9A 4PVNA 4XH2A 4NM8H 1FZKB 4YSPA 1SLXA 1DVXA 1NGYB 5JO5A 4JRYD 2IO5A 2R1XB 3C2AH 4X6BB 4PJIB 3MRIB 1EO5A 2H41A 3WYRA 2C4FU 2VLJA 2OL3A 1WRFA 3EF4A 3IKCA 1CFTA 1E8WA 2NOYA 3ZRFC 4PSRA 5LQBL 2EIKB 3TVMA 3NSCA 5LGJA 1BMWA 5I8KH 2WXPA 2FD6L 2IBZY 1UB5B 5D71H 2ZX9A 5LGKA 5MENE 1CLOL 1T7YA 1EPFA 5DYFA 1BAWA 2NY2C 3TBTB 4O5LL 3G04A 3SE9L 4GKNB 4IBSA 5IT2H 2YARA 4YE4H 2ZXEB 4M56A 4GUOA 3ZN6A 1ET7A 4H8QA 4IKJA 3PHQA 4NC1E 2FL5B 4PRDB 3PWLA 3QWNA 1U8NA 1H8NA 1CL7H 1WHEA 1ORQB 2WYIA 4YHPA 3TBYA 2HJKB 2RTTA 4U3XA 4J1UB 3VXNB 3QNXB 2QTEA 4EQ3A 3N50A 5I1EH 1S7XB 3Q13A 3EO0A 3RE0A 1F41A 3P0VH 2EICA 1C5CL 4WUUB 1C5BH 1XIWA 4XR8C 1MW3A 2X4QA 4YDJA 5HDBF 2VN5A 4KZEL 1TPXB 4JFSA 1RP8A 2ZYRA 2AW2A 4A7GA 5KVEE 1ECZA 2VLJD 1A1NA 1G43A 4Z7WF 4G5ZL 2D7OA 5FOBA 2D03L 4OTXL 1TVHB 2P5EA 1T20A 4LCCA 3F7LA 5BRZA 3TVMD 3RQ3A 5FXCH 4NQXA 3S5LG 5CGTA 2PYEB 3PGCA 1UZGA 1CG9B 3DROA 2VXTH 4EE2A 4HEPA 2E59A 4BQCA 4Y1AE 3IMUA 1EGFA 1E8YA 3RVVD 4PJCB 4BCYA 2LOEA 4HHWA 4BFKA 3KGUA 4TN9A 5FOJA 2MGRA 3EDEA 3FT3B 2IFFL 4JPWH 4BFIA 3SZ6A 1CFNB 4IRJC 4CILA 1N5AA 3AU1A 5JIIA 1Y18A 4UZSA 4J7RA 3J27A 4HXAL 2YPVL 2XTJB 5DJAB 5LXGH 5EBMA 3GBLA 3WG7B 5KSUB 1Q0YH 4P48A 2PO6A 5AOIA 4V1DE 1I9EA 3THML 4URKA 3GKZA 4OLYH 2H32A 3VYOA 3B3IB 4ISHL 2XC4L 4M02A 3IXAB 3N43B 4K71C 3MXVL 3DTUB 3TK5B 1Z1WA 1XIWD 5IVZB 5HVHB 4ZJ9A 4BM7A 3N55A 4J3WA 4ODBD 4Z7UB 5IFJA 1S7SB 1G4RA 1DN0A 3CFCL 4AGLA 4L29A 4Y8DC 4BZ2A 5AVTB 4P06A 4HU2A 2P5ED 3U7AA 4HT1L 5BRZD 2WPLE 3SDXB 3G6AA 3EJQA 4AQZA 5AW2B 4D0BA 3BO8A 1A4JB 4HKBA 5CFHA 2EDYA 4UTCA 5D2LE 2Y82B 1RPQA 3QZWA 4P5KA 2VO5A 1MJ7L 4MRCA 2IGTA 4DCQA 2ICCA 4Y5XA 5D2NE 1MRFL 4CW1B 1BIIA 1W2KT 1PZ2A 2O6PA 5D7SH 3QMOA 1EAPA 1PSKL 3F83A 2XPGA 3E6HA 1CDUA 2BIHA 3MFFA 3OXSA 4HC1A 4M5SA 5DJXB 5AOMA 5FK9B 1HX2A 4H25A 4GG6B 1I8LC 1D7CA 2DBLH 3IXTB 4XVSL 3SKUD 1MF2L 2PO6D 1NINA 4IGBB 2YHGA 3GSOB 4LF3B 1IAKB 1BM3H 1CCVA 2BSSB 1A66A 2QPUA 4AVKA 1HH9B 4WEBL 1UUSA 4H8PA 4LSRH 2AI0L 1WZKA 3U4BH 4HJ0D 5D1QE 3G5ZA 4I7ZC 5IMLB 5DWUL 3IFLH 4BFFA 5DHVA 3C60C 5L2JB 1C16A 4DK5A 4X8JB 4YFDB 3CLFL 4FI8A 5D70H 2AKRB 2H3NA 3I84A 5LKNA 1R3JB 5LBSH 3LZFH 4FNLH 5E51A 4ZQTA 3LKNA 3MJ9A 4JFEE 4A37A 5TE7L 4WTXA 3J7HA 4NHCH 2DQFB 2VDKB 1ZANL 1SMOA 2OMTA 3EYSL 3QCTH 4UDTB 1XD1A 2R4RL 1XGTA 2OQJB 3N1FC 4A2MA 4NKMA 3CQQA 3WMSA 5B39A 2YN5A 3UTTD 4RVBA 1MUJB 4E41E 4Z3JA 4GPVA 4I9WD 2F7PA 2ZOKA 2Y7ZB 3V4VH 3UTZB 1MRCH 2ADXA 5F88A 32C2B 1DUZB 1LJMA 2JI1A 3WIFA 3BWZA 4EZLA 5E8DL 1HAEA 5ERWA 4GLRH 1FYTE 3TNNB 1KGYE 3P4MB 1TJHH 4C47A 1PLCA 4L48A 3ZHDA 4Z3IA 1ZHLB 4NUMA 1XF1A 4PJHB 4U1HB 2R7EB 3MRPB 1IAII 1AXTH 3QWQB 5GGQL 2IWFA 1SYVB 4L5FL 3RBGA 1T0PB 4TUOB 5TQ0L 2VAAA 1KBVA 4K8RH 5TDNA 1E42A 2HLEB 3E2HB 4PP1D 3OKOA 4W93A 1NOAA 3V4PL 1IOXA 1WF5A 3N9GL 2DQUL 2P42B 2VZTA 2PTTB 1OCZB 4AUUA 3TO4C 5D5ME 1BF5A 5HJGA 3OKLB 1EXUB 4L3FA 2EDHA 3LNHA 4LSUL 1EJOL 1FLRL 3WKYA 1CCZA 1HXYB 3Q8AA 3MOAH 3SDCC 3AS0A 4AUJA 4P59L 4RRPG 4JO2H 4KVNL 5DMKB 1J48A 4NQCE 4ZX4A 3BUBA 4QXGL 4RISH 4M4PA 4QHUA 3BDBA 1DDXA 5FA4A 3V0DA 3FHAA 3ZSSA 5JQHC 2F53A 5E9DA 3KCWA 4XC3H 3LC5B 1X3DA 1N8ZA 1YLBB 5IKTA 3B7TA 4GO9A 4P5RA 4P5MA 4PRIA 2X70B 4KRPC 3S2AA 3O2DL 1KCWA 43C9B 4NKOB 5G5DA 5T3ZD 2AK4B 4IHOA 3K5RA 4KY1L 1R3KB 2HT4C 4DP5X 3WN5A 1Z6JT 3B37A 4GMSL 4BFEA 2H9EL 3F7VA 2ZWZA 1H8LA 4BBWA 4J3OF 1NMCB 3RWFA 1OM3L 2WBXA 4G6FB 4N2CA 5DJDA 1JZDC 2CHDA 4LFHD 3O3BB 4EOWL 1A3QA 2WXMA 2FIKB 2NY0B 3GHEH 4MMXA 3RDJA 4XPFH 1XXFC 3VFRA 5JW4M 1V10A 5JOFA 5LG6A 4AXWA 4QGTA 2CJUL 1F4XL 3HRZA 4UM9B 2EH7L 2R51A 3NBNA 2EC9U 1Q9KB 3MRMB 4LLQB 2P3YA 2XXMB 4X0KB 4PWEA 2AGJL 3FU9A 4AT6A 4H8HA 4G9FE 5GIRB 5DLML 1U3HB 5JQIB 1W0WB 3ULVC 5T1JA 4OFIA 2BNUB 4XPGH 1CDIA 5JW3H 1OHZA 3NJVA 1PY4A 4HWEL 4HXBL 4LGSB 1X9RA 3Q1SH 2FNWA 2F53D 5E9DD 4N8CL 1U6AH 4PRID 1R3LA 2CRIA 2MH4A 2XXGA 1QQDB 4RFNC 2O6EA 3KVQA 5CZXC 4BE5A 4G6JH 3APNA 4Y2DC 1RK1A 4AX3A 3QXTA 4KWUA 1NC4A 3W11C 5DEGB 4OFQA 5HXMA 2AC0A 4BZYA 3SOVA 4ZD3H 4B9PA 3ILQD 5E4AA 1QG3A 3ILPA 4N5ED 3F5WB 3N8YA 4U0QB 1H3UA 3MUGA 4WI8A 4DGUA 1QACA 1DANU 3G5YB 3O45B 1G9ML 1XCQA 3MJ7B 5I9QC 2WXQA 5A6LA 4BXWA 4IDLA 3STLA 1JHTB 3WO4C 4HOZA 5FF6B 3ARRA 4ZXBC 2HKFH 3BKJH 4JMXA 2HTLC 1OT1A 5D1ZC 5SX5K 3TA3C 5I1LA 3RY4A 5EBLA 1E9QB 4CNIB 3DSNA 3ZZLA 3TH4T 2BXZA 5JMRA 4KTEL 4WWKA 4XMPL 3H0TB 1I7RB 5K1NA 2AQPA 3QJRB 1HEZA 1GRWA 4MXQC 4FQJL 2PNDA 3V6FA 1H5BA 3ML9A 2DMCA 1RJZA 2BSBA 3FB5B 3QRBA 1A14L 5JHLH 3LKSB 4TOYH 1J9CL 1AHWC 2X9WA 3RB5A 5I66A 4NJAH 4AOFA 2V7NA 1FO0H 5EUOF 3GMRB 1A1MB 5D7IA 3QQ4A 3RNQA 3H55A 1K3ZA 1MCPH 2B4CC 4JZNA 2D7NA 3Q6GH 5HY9B 2X4UB 4FQXC 4GH7B 4W9ZA 4IRJB 2C8NA 4KFZC 3DA0A 1QIUA 2NTSP 2GCYB 2WXJA 4OM0H 1YNTF 1NC4D 3DGGA 1IO4C 3CIAA 3FCSB 4OLWH 4NN7C 5B1CA 4WWID 1PLBA 4PJDE 4F57L 1QA9B 1U36A 1A5FL 2BVYA 3TO2A 4LCIH 4YFEA 1WC7A 2Y07L 3HZKA 1L6PA 1UYWH 4L5FE 1P5VA 3C5JB 3MBEC 1R0AL 4ZO6A 4QEGA 1AZUA 1HL9A 3KR3H 1H3PL 4NBXB 3S34H 4RRWA 1KB5B 1DSFH 3ULSA 1CTMA 1FL5A 3GXIA 4KKZA 1S9WA 3NFSL 1CLCA 2IANE 2IVFC 1RIVH 4LHUB 4WWKD 5CWSB 4M11A 5K59F 4CSSA 1GGBL 1J0JA 2VXVL 1XGUA 3Q05A 2VN4A 1BIHA 3W37A 1UVQA 1QFWH 1ITBB 3Q01A 1KEGL 1UGKA 1DVFB 4MHHI 1DQIA 5EO1B 4R7VA 5L4IA 3FH5A 2XV3A 1TLKA 2WZPP 4HGKC 2WW8A 2J8UF 1YPZF 1YN6A 3IJEB 2QKSA 4OI8A 3HC2A 4KV5E 1L5GB 1ZT4A 4JEGB 2V33A 3OPZL 1YQ2A 1IKFL 1THCA 2HN7B 3D85B 3VCLA 4P05A 1LQBC 5KYWB 4O2CA 3CBRA 4XXCA 3QDJB 2TGFA 3AXHA 3KS0J 3RX5A 3T6VA 3VQ1C 4P2QE 3IETB 2WLIB 2MHAA 5I1GL 3ZDYF 2XTSA 2VLME 3PPSA 3HI6L 3CUPA 3JZ7A 4CC4A 4X8UL 4HEME 3V2AR 1S5HA 4QJ3B 4JM2C 1NIAA 1VACB 2R1XA 2Y24A 3KBEA 2OXGA 4N0CD 5C70A 3CFBA 4ZUSA 1N7DA 3MRIA 3HN3A 4G7VL 5FYKH 2V5YA 4LGPB 1J5CA 1BMGA 3UACA 5ALBH 5MERB 4X5PA 4NPJA 1U2HA 3B5TA 1KLIL 1L9NA 3ELAT 1G1RA 1T89C 4L3AA 1JXGA 1IGTA 2JKIS 5IJKA 4OZHF 2YXFA 3K46A 4YWGH 4GMTH 3TBTA 1O9WA 3MCKB 3TV8A 3CU7A 4X6DF 1LYQA 2C7UB 1MZYA 3TA4D 3ZL4H 3IMRA 1KUMA 3WEXB 3HI5L 4MA7H 1IILE 4MJ6B 3GSUB 3LV3A 1MAML 3VFSA 1RVFH 4Y2OB 1MKFA 3GMLB 4CU6A 1MWAH 5JIDA 2EAEA 1FH5L 1PQZB 3QAQA 4WNQB 4PB0H 4PUBL 4HIIB 1JGIA 1S7XA 1A6UH 5SX4H 3I75B 5FWRA 5I46L 4HUUA 4OLEA 5IB3A 3CD4A 1IC0A 4GW5B 2XLLA 3NESA 4FQIH 2WNGA 5FFLA 1NAKH 2F74B 3TXAA 2ZOLA 3BPOC 4KQ4H 3KPSE 3T4AC 1OT2A 3TO4B 1L9OA 5EB9A 2VDOH 5EEZA 4BUQA 3W9DA 1OCCB 1NGWA 3GMOB 3DO3A 4D9RE 4JDVA 5CBEB 5DJ2A 2DDQL 5HJ3A 5TE6H 1MCLA 5KSBE 2O72A 3OX8B 3L5WB 1FP5A 2PYEA 3FU0A 1NPUA 4BRJA 4WHCA 1SDYA 4HS3B 4WSJA 4HUWA 2F54A 3LC3B 5E7BA 4PQXA 3AJ7A 2EE3A 1JXJA 1HZLA 1PKOA 5JBCE 1PL3A 2CALA 3HNVH 3WS3B 5A6MA 1AH1A 4MDJA 3NPSC 5GGUB 4FKHA 5LBVA 2AJXH 5DJAA 1XCTB 4F37K 3U1SH 3BPCA 5F0MB 4KK6C 3DOHA 2DWTA 4WI7A 1RUPL 4PYGA 2AJ3B 4K94C 4LP4A 1WFNA 1CD9B 1S5IL 3LSOA 4YXKL 3G6JA 3BAKA 3WNPA 4LSTH 2BOCA 4BQ8A 6PCYA 4MB1A 3REVA 3HC4L 3P9LA 4AIXA 3OZ9H 3FT2A 3D2UA 2IGFH 3BCDA 5I8CB 2W3IB 3CHXA 4NC1C 4IJ3C 3WFCH 4NIKB 3FTSA 3GJEB 4PJGA 5IMOB 3QDME 5MEPB 2VMFA 1JTOA 2X3CA 4QOKA 3SDXA 3T8XA 4CVZB 4M00A 2PYED 5CGBA 3HJ0A 2ZCHH 2UXVA 5J3HC 4U1IA 3N44F 4Y76B 2CKBL 2I24N 3FW6A 1W9XA 2F54D 1MCSA 4HLZH 2EXYC 3UPCA 1YDPA 4AJVA 1HIMH 1NPEB 4A94C 4EZMA 2DQTH 2XIBA 2P3FN 2Z1PA 1DEEA 1RFDL 3L5HA 3V9FA 5I1DA 4JFPB 3R0NA 1IAMA 4WEUD 3MV8E 3UAAA 2CNZA 3S8GB 3CMGA 3L3OA 4R4ND 5FK9A 3MLYL 4RRYA 1W7XL 3JV6B 1BBJB 3TIEB 4GW1A 2IMNA 3HPJB 5D55A 3LZLA 4U6XA 3IT8D 2X10A 4IDJH 1S7WA 1R46A 1BWMA 3GMMB 3ES6A 2YQBA 2OXHB 2VJXA 4G6ML 5G4OA 1CIUA 1TSRA 2Z8VC 4H13C 1GPOH 3KYNB 3VB8A 2FR4A 3A67L 3T3ME 3MACL 1CLZH 5IMLA 5I74C 4XPTL 4QI3A 5I9QB 1KG0B 1GC1H 3VFGH 5CKQA 2CMRH 2PXYA 3D2UD 5E5RB 5FM4A 4XBMA 3RHWF 3IJHB 2HLFC 3IITB 1WT5C 3CK0H 3TA3B 1RFNB 1JERA 4QOKD 5DD3H 4MD5B 4OJFH 1CMOA 4HIXL 3KPOA 5HGAA 2HFEB 4AMKL 2QZQA 1X5MA 3GPEA 4DVRH 4ZFFA 1MH5A 4XOBA 1IT9H 4KJQD 2R39A 5E08H 2XG5B 5CISA 3RYMA 1AHWB 1HT5A 1NFDB 5EEXA 2I85A 2G2NA 4N22A 2NNXA 3U2IA 5A2BA 2ITCA 4L4TE 1KTDA 2WWNA 4FLQA 1AACA 1E4XI 2PWGA 32C2A 3C8KA 4P2OA 4Q9BA 5T5FL 4HOXA 5CMAB 1LNUB 5PCYA 4X50A 3CBJB 3V95A 3ARDA 3P3RA 1A65A 2JVUA 3HOGA 5JHDE 1P84K 3TNNA 4MRBA 5DMIH 1Z9MA 3KM1A 1NGQL 4NN7B 1KLFA 4NPKA 3QQDA 4Y4HC 1MCBA 4GNKB 4WJKB 4X8TL 1MFMA 2FHFA 4FFWC 4PJHA 3IJ9A 1HOEA 2D3LA 1SYVA