4XBMA

X-ray crystal structure of notch ligand delta-like 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
270
structure length
253
Chain Sequence
SGVFELKLQEFVNKKGLLGNRNCCRGPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPNPIRFPFGFTWPGTFSLIIEALHTDSPDLATPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Notch ligand delta-like1: X-ray crystal structure and binding affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Delta-like protein 1
total genus 38
structure length 253
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
A PF12661 hEGF Human growth factor-like EGF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4xbmA03
2.10.25.140 Mainly Beta Ribbon Laminin Laminin 4xbmA02
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4xbmA01
2PHBB 1HT5A 2XC4L 3NJPC 1EBVA 4Y6DB 3LC3B 1LPKA 3TBDA 1EPGA 1TLEA 2W2QE 3DEMA 2WPKE 1NFXB 1FAXL 4YT7L 2W3KB 3LN1A 1B9WA 2MGPA 2BQ6A 2WYGB 4BXWA 1HX2A 1XKAL 1LPZA 4X8TL 1F0SB 3ZYIB 1WHEA 1IGZA 2K2TA 5E8DA 1IQEL 1CCFA 2RHPA 1A3PA 4OTYA 2BOUA 3N8YA 2J34B 3NT1A 4RUTA 2MGRA 4X8SL 2J94B 2W26B 2NPRA 1WU1B 3HO5A 3OLTA 5CISA 1IGXA 3HO4A 3ZYGA 3BT2A 5CKNA 5I46L 4RRWA 3SOBB 1IQLL 3ELAL 4RS0A 1W8BL 1W7XL 1U67A 1Z6EL 1DIYA 4D0FA 4CC0A 1IQJL 3GISX 2P93L 4O1ZA 1FE2A 4O02B 2WPHE 4NA9L 5L30L 1G1TA 2Y5GL 5COXA 1XKBA 4LMFA 2VWNL 2P3FN 4ISIL 5CKMA 3N8WA 1IJQA 3MQEA 5JBCE 1IQML 3H5CB 4M11A 3TGFA 1N7DA 3QCWA 2WG3C 1DQBA 4JZFL 2YGOA 3QH0A 2WPME 5JBBE 5KN5C 2XBWL 1KLIL 1UZJA 1OB1C 4Z6AL 4ZH8B 2PR3B 4M10A 1JBUL 2VH6B 4MMXB 2XBYL 1HCGB 1NZIA 2P16L 3MDLA 1KLJL 4Y7AB 2VWMK 3P5BL 1YUKB 5F1AA 2J4IB 2BQ7A 2M74A 3FFGL 2Y5FL 3K9XA 2K2SB 1PRHA 1MQ5L 3LAQA 3LC5B 1QFKL 2XBVL 2I9BA 2AYLA 3GCXE 1YUFA 3HS5A 1BF9A 5JBAE 4YZUB 1PFXL 1PXXA 2KB9A 4Y79B 4A7IA 1IQIL 3N8WB 3ENSA 1JL9A 3KQCL 1FJSL 4PH9A 4RRZA 4MMYB 2Y7XB 4LORA 1YUGA 2Y82B 4G1MB 2XC5L 1IQKL 3HS7A 4BTIA 1FAKL 1IOXA 2B7DL 3KCGL 1HAFA 2WPLE 4AQTA 1CCVA 1EZQB 2W86A 1EQHA 3CENL 1J9CL 2BO2A 4CC1A 5JVZA 3Q3KB 5F19A 3KRKA 2FLRL 3CA7A 3IITB 4TGFA 2P28B 1DX5I 3R05A 2WPJE 4X8VL 1IQFL 6COXA 4BTUA 1K36A 2EI8B 4BTTA 3LIWB 1U8CB 2EI7B 1WHFA 3PGHA 3BPSE 3M36L 5IKRA 5K0HB 3POYA 3KL6B 1EQGA 4MMZB 5IKQA 3NTBA 2PUQL 4BDXA 5JB9E 3TK6B 2G00L 3SOQA 1N1IA 4ISHL 1I0UA 2BOKL 4JZDL 3F1SB 3GCWE 2UWOB 3OLUA 3KQDL 1IQGL 3LTGD 2WFTA 1NFUB 2BQWA 2VJ3A 3SW2A 1EMOA 3BT1A 5JW1A 1KIGL 3RR3A 4CUEA 1G2MB 2XC0L 2FLGA 3CS7L 2RA0L 4RRYA 2WPIE 2XBXL 2P94L 1UZPA 2UWLB 2P26A 1G2LB 3N8VA 1Z6CA 1KSNB 4ZHAB 1SZBA 4Z0LA 3IJEB 4E1GA 3QMOA 1Q4GA 1F0RB 2J95B 2VWOL 4CUFA 1EPIA 2CJIB 1O5DL 2VWLL 3V65B 3U73A 3N8ZA 1G1QA 4ZAEB 2P3UA 5CKQA 3N8XA 4ZXXL 2WFXB 2WG4B 1F7MA 3V64C 2P95L 1EGFA 2VH0B 2F9BL 5JB8E 4XL1A 2BZ6L 2KL7A 2WYJB 5FDQA 1FFMA 1PGEA 4JZEL 1K37A 1NFYB 2P3FL 4XLWA 4BDWA 1NQLB 2JKHL 1L3YA 5L2YL 1ATAA 1CEJA 1ATBA 1C5MF 4YT6L 1M1XB 2BOXA 3TZIA 2ADXA 1YO8A 3EGFA 1DVAL 3FBYA 1LPGA 3Q7DA 1HRFA 2I9AA 3F6UL 1NFWB 1X7AL 1HREA 4D90A 1MOXC 3FCSB 3HS6A 3CFWA 2YGPA 1V3XB 1URKA 2H9EL 1G1RA 4Y76B 1IQNL 2W2ME 2OYUP 1GK5A 2J38B 1XFEA 4Y7BB 2FLBL 2OYEP 5JVYA 1LMJA 1CVWL 2D1JB 1NPEB 4NGAL 1HT8A 3LN0A 1ADXA 2W2NE 1HZ8A 3N8YB 3M37L 4OTJA 2Y81B 2FD6A 4CSYA 2FZZL 1CVUA 1CX2A 1APOA 5IKVA 2RNLA 1EAIC 2Y7ZB 3LTFB 3KQEL 1ATDA 2TGFA 2VVVL 1DDXA 4FM5A 2Y38A 2W2PE 4ZXYL 2GD4A 4D0EA 5EGMB 3SOVA 3TH3L 1XDTR 3C9AC 3ZYJB 4BXSA 4COXA 1EPJA 3KK6A 1UZQA 4C16A 2Y5HL 1IOEL 1LQDA 5L2ZL 2Q1JB 3ASIA 3U7UG 1YGCL 2MHPA 1ATEA 2VVUL 1NT0A 1P0SL 4CBZA 1CQEA 1F7EA 1JV2B 2BMGA 1IVOC 2W3IB 2P3TA 2J2UB 1FF7A 4X8UL 1EMNA 1UZKA 4Y71B 2KV4A 1KLOA 5IKTA 1PTHA 1L5GB 3KQBL 4NG9L 1HJ7A 2BOHA 3NTGA 2UWPB 1APQA 5KIRA 1P9JA 1EPHA 2W2OE 3HPTA 1HAEA 2EI6B 1IQHL 2DDUA 1G1SA 4CUDA 4RRXA 1AUTL 4Z0KB 4XBMA 3HO3A 3TK5B 1TPGA 1MQ6L 1ZAQA 4JYVL 4JYUL 1IP0A 1COUA 1FSBA 2VVCK 1TOZA 1RFNB 2Y80B
chains in the Genus database with same CATH superfamily
1OAJA 3PXJA 2R1YA 2VDNH 4KAQL 3SDDD 4IU2A 4PCKA 1G6VK 3T65B 5J13C 3KLLA 3TBDA 4JVPA 3UGEA 2JB6A 2Y7MA 4LOEA 4WWID 5DTFA 3RNQB 4ODBD 4AL8L 4DEPC 1Q1JH 1HYRC 2JI1A 2OJZL 4PBVC 5DRXA 4OAWA 3PGCB 6PCYA 5IQ9B 4AW7A 4JVUA 2IEPA 2VO5A 2MQGA 1V8HA 3C5JB 4F7EB 4N0FB 4MDJB 4QHUA 3CD4A 5JIPA 4D9LH 5IY5B 4M93B 5AZEH 2BSFA 3MX0A 3L7FA 1A3RH 4PJ9B 3IMWA 2GJ6E 4WZ9A 1EEUA 2CO7B 1MCWM 3APFA 4EBQH 1BWMA 1WZAA 5HGGS 2PWFA 4AX3A 1J5IA 2OMXB 3NPSC 3ATFA 2XTLA 1AGEA 5ANHA 4Z9KB 2MGRA 4WI7A 4L4TE 2ATPB 3KXFD 1WU1B 1VPOL 5E6IB 2P1YA 4TF4A 3WG7B 1TVBA 3N85H 1Y07A 3X1GA 1GRWA 2CLVB 3QUZC 4PM1A 1ETJA 3BAEH 1PKQE 2CKBB 5DRZA 1XGQB 2CIKA 4BHUA 1DQML 1WA0X 1JERA 1GS7A 2Z35B 2L4OA 3JWDL 4HWNA 3QUHA 3SKNB 3QIUC 4O1ZA 4JFEA 1NFKA 3WL9A 3VFSA 4F7MB 3WAJA 2G75B 3BISA 3QXTA 1YEDA 3K3QA 1FNEB 4R7DB 4W1TA 5ICXB 5HP5A 4DT2A 2W9EL 5AAWC 2AXWA 4URKA 3E6FB 4NT6B 2BNUB 4PV8B 5CP3A 3QEQE 3TH3T 5JO5A 3MRNB 1A22B 3LH8A 3N41B 2I5YH 4R4BB 5TH2A 4HPOH 3KS0H 2MHAB 3CFJA 2VW7A 3GTTA 3N04A 3SGDI 5I1LB 2YKKA 3H5CB 4AVJA 3BP7A 1UWEH 1OCCB 3IKCA 5DGQA 4JPVL 3DHUA 5FA4B 2ICWI 3DUUB 3GRBA 4YEEA 4Z5RB 2X7LB 1RZJL 4PJ7E 5I26A 5IESL 4GPVA 2ZYIA 1M7DA 3DGDA 1OB1C 3TJPA 3LPPA 2WZAA 3P3YA 3O0LA 4XMLL 3NZHL 4ZMPA 2YRLA 4GMTL 2PWDA 3Q5OA 1WEJL 4P59L 5CZXC 3P2DA 1AHWC 1U3ZA 4JPWH 1YMMD 4H8PA 3RBSA 1W15A 2D8KA 1U58A 1EMTL 5D5MF 2E0PA 3SY6A 4HK3J 1UWGH 3IETA 4HJIA 1OO2A 2F53E 2OCCB 1AXSB 1MCOL 2DYPB 2X4TB 2VZTA 1JZHA 1YUHA 4M8UA 4PREB 1S7TB 2WQUA 1BQLL 3ZX1A 4Q58C 3AC0A 2QHRH 4Y4KC 1SN5A 2LVEA 4FF9A 4XMPL 4QWWC 2Y5FL 3ZTNH 3RTLA 4LO9A 2BOCA 6FABL 3EUUA 4L4TD 4BGLA 1P5UB 3HS9A 3FT2B 1GOFA 3UTTE 2DL2A 1QKZL 5DD6A 2X6UA 1TTCA 1A14L 1NC2A 3QO0B 3X11B 3FN0L 4RIRA 5ICZA 3P9MA 5IBUG 1PFXL 2AGJH 5CKGA 4Y9FA 3ZBMA 1CCZA 2H3KA 3GIVA 3O3DA 5IVZA 3OJMB 3IPBA 3GZOA 2CGRL 2ITDA 5C09B 4M7ZC 1U42A 4YUEL 4DVBA 3OD3A 3KPQA 1CL7H 1HXYB 4LORA 4WUUD 1PZ5B 4OCRL 3WELA 5IM7A 3NACH 3UPRB 2R56H 1GZHA 2V8MA 2PTUA 2QKSA 5FUOH 2EZ0D 4P4KB 1IQWL 2QVKA 2D7NA 4IRJA 4JY6A 4P57B 3CFBB 4LEXH 4X7CC 5F19A 1NCDL 2V17L 4H25A 2ADGA 2D0HA 1E8ZA 5ERWB 4E36A 3UP6A 5EU6A 3GKWH 1T5XB 3AUVA 4Y5XA 1DZBA 3FKUS 4B41A 5IIEB 4HU8A 1KBKA 1WGOA 2VE6B 4Z6AT 4AG4L 5TK2A 4MXVF 1NDMB 1XB8A 4U1KB 5DEFA 3UCQA 4BH7B 2EECA 2O5XH 1XGPA 4LLWA 4W9JC 3QWRD 3PGHA 3MOAH 4NN7B 1QSFE 3I6SA 1ASOA 4EXKA 1FFRA 3T4AB 3D0LA 3HE7A 2QL1A 4PWIA 4TNVK 3NTBA 1F6LL 1O7DE 1R17A 2CWRA 3B3IA 3OHXB 1E9OA 1AAJA 2YSTA 4M29A 4MB3A 4XNYH 1C7SA 4AEHL 1I0UA 3HZKA 1I9JL 5EDXA 1N6QH 1R6VA 3MV8A 4L8BB 3SDAB 1MCSA 3RVTD 4N5EC 2AV1B 2E4FA 1ZJAA 3SIKA 3GHBL 1BZEA 4DN3L 1M3JA 4A2EA 3RDTB 4Z7VB 4M4RA 2A74A 4PRHD 1NC4D 1T2XA 3WENA 4W81A 4F7MA 5IF0A 4HT1L 5E56A 3U7YH 3GXIA 1AOZA 4L3ED 4G8IB 1G9NL 4G6ML 3CX5K 4LSSL 4XCCH 1P1VA 4LBAA 1GCFA 5G55A 2BNQB 3GIZL 4G11A 5AOKA 2BLFA 5JHBA 1RK1B 3QPXL 1IGYA 3I6KA 2X2YA 3UAJA 4UNVA 3AS2A 1ZGLM 2F8XC 3T9WA 1RCYA 4E5XA 5IHHA 4D7BA 3C5ZA 1HHIA 2OK0L 2P45B 5I1HL 2CBOA 4HZLB 4PR5B 1A1MB 5HJGA 4PJ8A 3WJLC 2VABB 3QAZC 3Q05A 4X9BA 1YAZA 3TF7C 1MHHB 4E9QA 4E41D 1UFGA 4ZMNA 2QV2A 1KTRL 1R5IB 1WV7T 3QORA 2MNUA 2UWEB 4GRWF 4BDVA 3BIBX 3WLBB 4HZ1A 4LVHB 4PLJC 2ZCHH 1CT8A 3HCVB 3VXNA 1X3DA 3PYCA 2WWNA 4DNLA 3IXTA 3Q2NA 1JS4A 4AUJA 2X4TA 3KWWA 3TFKC 5K9OB 3NCCB 4K07A 3AQXA 2HUHA 2CO6B 4KJYA 2VLJA 4JFZL 3ROOA 3TEYA 1DQJB 2ARJQ 1QBBA 3FTXA 5DR5H 2K70A 5FDQA 3BUIA 1X7QB 5ALBH 4Z3FA 2FQFA 3FUDA 2F19L 1NFYB 2YUXA 3FQUB 1BMZA 1IAMA 1WQVT 5EPMA 1L3YA 1BVNP 2I69A 1CEJA 2XZZA 4UV4L 5E5MB 3WSQL 1PS3A 2EIDA 1YECL 2OSXA 1DVAL 2X9XA 3FBYA 1IGJA 2JFCA 2Y5TA 1AR1B 4YSUA 3U6RB 4U1SA 3TNNA 4NXKA 4CU8A 3QDGB 1RUKH 1SJEB 3WHE1 3B7YA 1BM3H 1EDHA 1GZQB 4WSJA 2Y3NA 1MLCB 5HPMB 4XN4A 1JRHH 1B6DA 2G9KA 3B34A 3KPQB 2NNAB 3LKOA 3FCSB 4FFZL 3H9SD 2DI9A 4YR6A 3ZIYA 3FJTA 3RWGB 3ECBA 3TJEL 4YHLL 3FHAA 3C6SA 1RJLB 3OKLB 2JLLA 1E4KC 4U7KA 4H13C 3ZDWA 1PD1A 1N64H 5CINH 3BSGA 3RX8A 1H6FA 3RTQB 5GJSL 4UDUA 3ERXA 3T2LA 2R9HD 3KYAA 4OLZH 2OYUP 1J10A 3OKEA 1Z9LA 1TLKA 1Z9NA 1TQSA 1MQKH 1KJ3H 4JCMA 4UZUA 2OYEP 1YEFL 1SDAB 2ICEC 3IDMB 3I3BA 4ICXA 4Y1AD 4B50A 5DSCB 1U95A 1LO4H 1RZIB 3VGHA 4KHXL 4NWTL 4XP9L 2X4OB 3V7AG 4F7TB 2OM5A 3IRZA 4LCYA 2F53B 1Z9PA 2H8PA 2KMWA 4OLVH 5KSBF 4NZTH 3LPGA 5D7JC 3D39A 1CD1B 2W0KA 4J1UA 3V6OC 3MGTB 5IKVA 3SCMD 1WE5A 1JMXA 4X6BA 3QZBA 4ENZA 2KZBA 3OKDB 1PPIA 1KTJA 1IM3B 4WW1A 3HN8A 5GGSA 2Y38A 4OGXL 2CIIA 3BIKA 4LPVA 4PY8I 4UB0L 3Q8AA 1NINA 1B4LA 1OTTD 1ZXKA 3AG4B 4IBZA 5TE7H 5HVWA 1WFUA 2DF3A 2XBZA 4BSVB 3AM8A 4TQPA 4Y19D 2CHDA 3TH3L 3ARFC 1KNOA 2YOCA 1ETA1 4YXKH 5BRPA 1LP9E 1U8HA 2YKLH 3GDBA 3V4LA 3KBFA 2YC1A 5FO7A 4R26H 3VWJA 2GJ6A 3VD5A 4E9RA 1A7RL 4JQIA 3B6SA 5E2VH 3TVMA 2A9ML 2H1PL 5KAQG 2H6OA 3F12A 4LQFH 1B0GA 5FW6A 1VFBB 5EO1A 4WF7A 2VR7A 4UT9A 3JSSA 1D9KB 4NBZB 1SJMA 4E9WA 2HP4A 1YJDC 2DYRB 1FNSH 3BO8B 3L95A 4IEFB 3UBXA 4CBZA 3WEAA 1I1AB 1CQEA 4O9HH 5CIPB 3JQOB 1YAIA 1JV2B 2ZF9A 5TDPB 2ILLA 4R97B 3RKDD 5L7XH 4NO3B 1WFMA 3GSVA 3HFFA 2DDQH 2ZX9A 4MA8H 4M3JA 1B4JH 2NY5L 3W3BA 2AFNA 3SE4A 1EMNA 5HDWA 2CCWA 3QISA 5E8PA 4OLWL 4MDRA 2YK1L 5ETUB 2D7QA 3DHPA 3GO1L 4PJFA 1JZ6A 5E95B 4JFUA 3DXAD 4XNYL 1J12A 2J6EH 2YQ2A 3F7VB 3QUYC 3BH4A 4WFGD 3RVVC 2WOBA 3RYMA 2JI3A 2NNCA 3ESPA 1NIFA 4R5TA 1JGLL 5GS0C 4H40A 5J6HB 2ZOKA 2VQ1B 3AS3A 3DIFA 2APBA 2IWGA 5C8JB 4NNXA 3WCYA 1A7OL 1BVKA 2HX9A 5DJAB 1M2VA 2XLLA 1ZAQA 3H2PA 4K9EH 4KJQD 2A99A 1TG8A 1IP0A 2BOBA 3LXUX 3G3LA 2C4XA 1KB3A 2AEOA 3D25B 1QI5A 4UTAA 4GQPH 4I0PC 3RWHB 5DMKB 1NZRA 1RKRA 1A6AA 3BP4B 3SB3A 2CE6A 4KTDH 1CR9H 2WN3A 3FQUA 3QUYD 4IK6A 2ENQA 1GZPB 4HLZH 1WS7A 3CHSA 4RFOL 2DJUA 5B1JA 2GIXA 1OW0A 5DRNB 1HT5A 3WS3B 1QFWI 5CKAA 4CJ0A 1IEAB 3WFBH 2BC4B 2VAAA 4ZTOH 4H5SB 4FS0A 4HIIA 1CL7L 4Y2DC 4OKVB 1OP3K 1TOXA 4OCRH 3T3PB 2WLHA 2L0DA 4BFKA 3DEMA 3AADB 3GMOA 1WLHA 3IJ7A 2EDXA 2YAEA 5ID0A 4LBEB 4IU3A 3BGMA 3HG4A 1BG1A 2W3KB 1MI5E 2HN7A 1UQSB 2DM3A 2XV3A 3IEAA 3KM1A 4Z7IA 2D31A 4YH6A 3QJQB 4FDWA 4QRTA 3O3AA 4ZXBD 5KYWB 4GI8A 1KWGA 1IC4H 1R47A 1DUYA 4CMMB 4L18A 1IEHA 3VXPB 4TUKH 2ICEB 2KL6A 4KKCD 4ZX4A 4N26A 2P46B 1I1YA 5ELIA 5FHAH 4LSDA 4RBPH 3MOQA 3WKQA 2PPDA 3RTQD 2G3ZA 4MNGB 5EZOH 2PCPB 3RVWD 2NYYC 3LKNA 1X5HA 4RMTA 2PNDA 3WTXA 3QK0A 1F11A 4LDEB 6FABH 1TDQA 2WXKA 2VLRE 3N8YA 3NT1A 2R23A 4X5XA 1YEWA 2P5WA 2XACC 3CXDL 3EYFB 3MLTB 4IBLT 4DF9A 2CRZA 1LK2A 1ZLSL 5CKNA 1BFVL 5CJOL 2JNZA 2VLKE 3IDNA 4FQHA 1SEQL 2NXZB 4KRMB 1U67A 3X1EA 2WB7A 2W91A 5A43C 1HAUA 4CMHC 3PLYA 3MACL 1M05A 3F7QA 4HC1H 4IKKA 1OT4A 3TBVA 1S3RA 2WO2B 2YA0A 5MENA 2QR0B 1GGBH 3PJNA 4B9ZA 4X6BB 4JFXA 5L30L 3ZE0F 5HHQA 5LWYH 2NYYD 4WI6A 4FG4A 3ESNA 4NNPL 1NGWA 2A83B 3HRZB 3MRRB 2V6HA 4MX7A 2BT8A 2VWNL 1TQVA 3VI4B 4ISIL 3QXDB 3G5XA 4JJ5B 4PJHA 4ONHB 1IQML 5KVFL 3X17A 4CDGC 1TSRA 4PGEB 3RWDA 4PGDA 2A6KA 5FM5O 2V5MA 5ABAA 2VH5L 3LIZH 5GRUL 2NXZD 1R75A 1H0DA 4N2AA 4OI9A 3SHSA 3A3YB 1BF8A 1QPKA 3MXVH 4K4KA 1HEZA 4YZFE 4QRRA 1ZTXH 4G70B 4ZW3A 2EDFA 1SY6H 4ANWA 3FU8A 3CHXA 5ID1B 5E1HB 1M1XA 2GJZB 4OVUA 1U8JA 5EUOA 3MRPA 1WUZA 5AVUB 3I6GB 3MUJA 4PRAB 2DWYA 1LO0H 5DGRA 4JM2A 2KQMA 4ZTEA 1OEZW 3QWNA 4PJ6A 2OYPA 4FXKA 5FV2A 3G6JF 4BE5A 1S46A 1V7NL 4OM0L 4TSBL 2WXNA 5E7BA 5E0FA 1OGTA 3WIHL 4GO8A 1I4FB 3A4EA 1JZGA 5DEJA 1QFKL 1FGNL 4HG4J 3WDJA 4F2FA 2AEWA 1IZKA 1WHPA 1ESOA 2I9TA 1KYOJ 1XIWD 5FA4A 4ADGA 2X28A 5JBAE 3U46A 4YHZL 2OMZB 1O7DC 3VRLE 3SE3A 3RL2A 1XCWA 5HYSG 2HG5A 4I89A 4YHML 3UTQB 2F15A 4OF0A 4TNGA 2BHZA 4X9FA 1UATA 1T1ZA 4QY8B 1G0DA 3PGFH 4LCWE 4U49A 4XCCL 5E51A 3CFEB 3MBEC 1J0ZA 2QKIC 3BXNB 3O6MH 3L7EB 4FHJA 4L1BA 5JUEL 5D7EA 1KLGB 4PH8A 4ZK8A 1AJ7L 4YL9A 3MR9B 1WBYB 3VH8B 2R0ZH 3ZL4L 3T0AA 1IOXA 2OULB 3TH4T 2HJFA 1TQUA 2CDFB 5F7DA 1MFBL 4O00A 4YUEH 1LE9B 3ZE2B 1DO6A 3GS0A 1H3GA 1XIWC 4CC1A 3G6AA 3AT8A 2Z3FA 3CC1A 2G4EA 2O5NA 5CUSL 5I6LA 4NN6C 5GQBA 1CMOA 1SQMA 2H6PB 4J3OG 4PJAF 4YLCA 2CDEB 5I17A 4N2GA 3E0GA 2FLMA 1G6RB 3TURA 2ZP8A 4IIQC 4Z8FH 2FEEI 4YSTA 5D2LE 4XPTH 1KT2B 1KOAA 4X8VL 4TL5A 5TE4L 4XXCC 2AXGB 4NOFA 4QXUH 4I3SH 5C6PB 4XO8A 2JLPA 3NCMA 4FQXC 4KK5D 5E2UH 5F6HI 2GSGA 1JXFA 2WQXA 1CYXA 2NCEA 4AEEA 4YJZL 5JOFA 4X9YA 1GC1C 3OKMA 4MKTA 4MMZB 1SYVA 4M8QB 4UDTB 1PY9A 4KKBC 2YSSB 5ADPH 2Y6SC 1HXYA 2O93L 1KTBA 3MLXH 5EN2B 2R1WA 4KMTL 5IM7B 2QHLA 3O3BA 3C8HA 5HDBF 1E2ZA 1J87A 1S7WA 2GCYA 1KN4L 3M1OA 3PGDA 1KJVB 3DSNB 5I8CB 3J2PA 4P2QD 3MCG1 4PTTA 5EBWB 4YX2L 4AKQA 3MRQB 4EI6A 4A2GA 4HMDA 1NMBL 4O2EA 1MVYA 4QXTA 5J3HD 1VGEL 4A39A 4CNIA 4HZAA 2BSTA 2B0SH 3O6KH 5SX5K 1GKEA 4OVVA 4Z3GA 1M05B 5C0JA 1SVCP 4XN1A 4KKBD 2QR0A 3GXNA 4AMXA 2Z1PA 3DOSB 5L2KE 2EINB 1T22B 3VXUD 3SZ6A 3EYQC 4KHTH 2K8MA 1KFAL 3AREA 4JANA 5D7IE 5J0BA 3PDDA 1PG7L 3NJIA 3NQKA 4N24A 5HGAB 3T0DA 2UYLA 3RAJL 5BVPL 3FFDB 2UWLB 1NKOA 1CTMA 1DANU 1CG9A 4EQ3A 1AO7A 1BEYL 4GUPA 3WNOA 5K1VA 1DFBH 2AAAA 2WCPA 3MFFB 2IO5A 3E38A 4QTIH 1FFPB 5FUCE 3IAPA 2MOGA 1YHPA 5BMFH 3AGWA 4NNYB 3SE3C 4ICWA 2ARWA 3MV8B 4G3YL 2VWLL 1BXVA 3CMOH 3A67H 2VB5A 1DHKA 3BQUD 3UC0L 3ELQA 2JJWA 1DN2A 5LAPA 1GC1H 2NZ9C 3U73A 2ZYHA 4HX1A 2CG9X 3M1BB 1DUZA 4GAFB 4LXFA 1TETL 2WG4B 3DO4A 1XHHA 1F7MA 5SWQB 4J28A 3CPLB 1GA2A 2NYZA 3LRSA 4ISVA 4OGQC 7TAAA 3D1MC 4PRDA 5HDOA 2N01B 3T6WA 1VRSA 3L3IA 1MN4A 1UH4A 1YEEH 2MNWA 4G7YL 2OSWA 5LXVA 5DRXB 5GS0H 4FXKC 5DMIL 1INQB 4BV1A 3BGFB 1S3KL 5B39G 3DARA 2KERA 5D7KD 3FRPA 3HS8A 4APQC 1UWEL 4NRZA 1PGEA 1MCFA 2NY2C 4JHZA 4X4ZA 1RK1A 3N3EA 4W9LC 3G9AB 4ATWA 1GYWA 3O8XA 5IR1A 5IJKA 1QD0A 5F0PB 4K8RD 1WA1X 1IGTB 4OGAC 4Z7VE 2H32A 2LR4A 5CWSB 1FFTB 4A7VA 4Q52A 1A3LL 4ANUA 4FNPA 3GSNB 2DQUH 3F7RA 1UKTA 4IMKC 4N0UE 4PJCA 1AIZA 5GJTH 5HGBB 2B3IA 3TNMA 1NFWB 2EDJA 1A4CA 2WM0A 2VUOA 3X2QB 5C2BH 2EO1A 3QI9B 2VLJE 3MV7D 1T66D 4NO5B 2ZNXA 5E8NA 3RVTC 3HPJB 3GF8A 1GS8A 4FMFA 5DUBA 4AXWA 2YARA 4LFHD 3BP5A 3DURB 3WIIH 4L8CB 4XOBA 2ZKYA 3HC4H 4FNLH 4ORGA 5ALCL 4H2CA 4MA8L 4LRIC 4P05A 4YDLC 1FIGL 3WFEH 5C0BE 1S7SB 4Y4FB 1TLMA 1CIDA 3AVEA 4KBPA 2AK1H 2B14A 3CLFH 4WI4A 1BP3B 1XMEB 3F85A 4F8OA 3FU7B 3ZE1F 2O5ZH 2VR6A 1SM3H 4JFED 3UTOA 1WD9A 3NJLA 4ILDA 4WO4D 3EG9B 3IU3B 4LASL 3LN0A 2PYFB 4B9KC 1NCUA 3FQWA 3G5YA 3L3GA 5MEPA 4OZIB 2AXGA 3LOWA 5E23A 4Q74A 2FDBP 2XWEA 3NAAH 3MLVH 4C4UA 5AZ2L 3O2WH 3U1SH 1PIGA 2K9UA 5HVHB 1XR9A 3SDDB 4GKZA 3VGDA 2WVVA 4Z78A 1DVXA 4L23A 4FTVA 3AS1A 2J8HA 3O6LL 4RAVB 3SGDH 2UY6A 1QWNA 5DQDH 1OTSD 3SJVD 4PVBA 4OLEA 3CZSA 2GI0A 3RPKA 4R5VA 1FGVL 2MEJB 1DQQA 1WZ1L 1Y1UA 2QZQA 2B1HH 5HSFA 4GQ9L 1NOLA 1WAEA 5ESQB 1MNUL 3EH5B 2AZAA 3ZGIA 5DMGC 3ZYJB 3IGFA 1QNZH 2WMPA 4QXTB 3LX9A 3TT1H 1O6SB 2JCCB 3W1ZA 1O6VA 3Q8BA 3D3VE 4KPHL 3IMRA 1EEYB 5K1JA 4I1NB 5DQJB 3QJFA 4LOFA 1JPFB 2ADIA 1QZNA 4KXZI 3MOAL 2MHPA 2UUDH 3OHMB 3SO3B 3BH8A 4YSDA 3LS5L 1P0SL 1WSST 2VMDA 4IRZA 3GRWA 5E5UB 2MKLC 2OMYA 1BD2E 4J27A 2C9SA 4U4BA 3K81A 5ICZB 2FQDA 3QS2A 3NCJL 5CM1A 4KUZH 3C5JA 2NY6C 2E7LA 2Y72A 3GMLA 1MWAL 2AEPL 4HK0B 3U0TB 3RWFA 2R2HB 2ROYA 4OF8A 1XD0A 3K8KA 2BOHA 1KN4H 2AKRA 3S48A 2UWPB 3ZU8A 5HVHC 4G6JL 4FJYA 1TUPA 3MJ8B 4KV5E 5F3BB 1C1EH 4OZIE 1URIA 4B95C 2DJMA 4W68A 2BVPB 2R9HC 4PGBA 5AYUL 1F3RB 2AV7B 4Q56A 4XOAA 3S35L 4ZQTA 1CICD 1A7PL 4CUDA 3B2DC 3SZKC 3CSBA 3TVMB 1AUTL 3ESMA 2Y23A 1ZANL 4G80B 1WD8A 4X9HA 2CO1A 5TPWH 3WFHB 4AIEA 3GB7A 5I1DB 1KIUA 5KW9L 5DJCA 5AVWB 4JYUL 1S7XA 2R4SL 1N7MH 5IMOA 3MRGB 3ALWA 2J8UB 1GGCL 2RFXB 3ISRA 2FVNA 4TPRL 3S36H 3VJ6A 3ULUC 3L9BA 5SX4I 1TZIA 1Z9OA 1RIHH 3GBDA 3PV7A 2ZP9A 5GRYA 3I75B 1CLOH 4OM1L 1NJ9B 2A9BA 4M1CD 2VXTL 4P5TD 3FONB 5A2JH 2Y7LA 4FL4B 5EEVA 4L9DA 1VZIA 3BVDB 1CXFA 5ACMA 3V0VB 1I9IL 2IGLA 3DLQR 4IBWA 5JO5B 3EOAB 3IK2A 5JUEH 5FO8B 3SGKC 3CPUA 3GI8L 2GVYA 4KFMA 5I19H 4FHKA 3B3BA 1CZ8L 2ITCA 4UI2A 3VWJC 3TN0C 4X9IA 4L4TB 5B4MD 3X12B 1OM3L 3V4PH 4PJIF 3ARFA 4XCYA 3QCTL 1QRNB 5L4JA 2H26A 1ASPA 1QAWA 1QATA 3EIFA 3PWLA 3RY5A 1IM9D 1KTDA 5DLML 1WHEA 2COQA 1I1AD 3C5SA 3OQRA 4XVUC 3VXQA 2ZP0T 4RX4A 1BZOA 2BP0A 3GZPA 4XC1H 5JHMA 1VCAA 2WHVA 2ESVA 1NICA 4F2MA 5HJ3A 4WWOA 4BUQA 1FBIH 1NC4A 1PSKH 5HYQB 2XCMC 1S9WB 3WUWB 1M6OB 4XNUH 5JHDE 5I6OA 3PY9A 4WAFA 2DQJL 3W81A 1IGYB 5HDQH 4XPBH 1I3VA 4U1LB 5I1AB 1EVTC 1X9QA 4EPSA 1Z0MA 3UTSE 1XGTA 1Z6EL 1EIBA 2HG0A 2QSVA 2QQLL 3GSUB 5EU6D 3QULB 5C0BB 3SCMC 1YMHA 1PDKA 4IHOA 1R3JA 3ZDYB 3VDBA 1HX0A 1IAKA 5IFAH 1NUFA 3COOA 4BFFA 3TC9A 2FX9H 4XOEA 4U6TA 1T5KA 4UOZA 2AVGA 1K8DB 2YMXH 2DWEB 3GUFA 1BM7A 1E8WA 4H4NA 3MUY1 4PJGF 3CX5J 3QUXD 4RGNE 3V4VA 4KDVA 2ZT9C 4MQ7A 3CNKA 4H26A 3IPFA 2XG5B 3M86A 2V2WA 4IU2B 4E9YA 2EYSB 4NGHH 1VADA 1PZSA 1CFNB 2R2CA 2BW4A 4PG2C 3IXTB 3VVWA 5E99H 3V52H 3MJWA 4DHLA 5DVMA 1DQBA 1E65A 5DJ8A 2EUXA 5JIDA 3OSKA 4A2DA 1E4XI 4PUBL 1IKFH 1A6VL 2D3JA 1R3IL 3OR6B 4F7EA 4Z7OB 2WWKT 2X42A 1RZ7L 5MENE 2VN3A 2PR3B 3BAJA 1GOGA 4KK8C 4KROC 5C0AD 2C9RA 5F93C 4LASH 5MEQA 3SKMB 2XKSA 5ACZA 4I87A 5DDHB 5HVGB 3QQ3B 4XB3A 2UWEF 4WKXA 1BQHG 2Y1VA 1M7UA 1IBBA 1YUKB 3SCMA 3D0VB 3PJSB 3GMMB 2D03L 3VDAA 2Z9TA 4A2LA 1K72A 3DUSA 2IPKB 4X7TA 1JZJA 1MLCA 5HPMA 2R4RH 5BZZA 4HJSA 5EIIB 1NH6A 4R2GD 5ESVB 1UZ6F 3L3OC 4JL2A 1RUAH 3HHMA 2FRGP 5GGUA 3S37L 4PGJA 3PV6A 3LJ3A 4QRUB 3RPIB 4PLKC 1LO0L 2CGRH 3N06B 2QQKL 4FL4C 3EBAA 5E2WH 2X38A 2NX5B 3LZFH 1JD9A 1J1PL 1ET7A 2CLZB 2VDKH 3GPEA 4M1DL 4YZUB 4PY7B 4HWUA 1PXXA 2ZONA 1RL1A 5A6IA 1IEBA 2OJ1A 3HZKB 1MKFA 1WZMA 2NMSA 3ENSA 1RZGB 3VXOA 4LHQB 1ZDQA 1FJSL 4XVSH 2Z8WC 4CSTA 2VDRB 4C4KT 4RSVA 1HH6B 3U6XA 2E7HA 4M3KB 2DDQL 2G2RA 1S6NA 3GS7A 5EORH 1MCRA 1T0NA 3APMA 1OT1A 3DVGB 3IN2A 3IT8D 3PWNB 4IRSC 3SDCB 4AEIL 1V3JA 4M48L 4PLNC 5I0WA 5C0RH 1DSWA 4QLWA 3LB6D 4FQ2L 4ZQKB 3LKRA 2WLZA 3ZY7A 2VZ1A 4DAGL 1OP3H 3BVNA 1CCVA 1FO0A 2VLLA 3U2IA 3DGGB 2WNKA 1H3VA 4JUTA 1F1GA 5BPPA 2P47B 3QIWB 2ADJA 3LNHA 3OB0H 4Q8BA 2WBJD 5AOJA 1HHJB 3UZEC 3MZTA 5E9NA 1C12A 5FGBA 1LWJA 1J18A 3BVVA 5FX3A 3T3MB 2P28B 3ZHNA 5DD5L 3GHEH 2X87A 1HVXA 1NPJA 3T2QA 3KVPA 4WY7L 3HC2A 5DD0H 2J4WL 1GGYA 1OY3B 2EI7B 1JN6B 1A02N 1FVEB 2ZKHL 1MFNA 3POYA 2F7QA 5AKRA 2BNQD 1JGVL 3GWJA 3CFKB 4AW4A 3M17A 1A0QL 5DO2D 4GOSA 1PZAA 1Q1PA 3LHPH 4AJVA 3MRJA 3V0DA 4N0UA 3S36L 4P3DB 1XL6A 4FNRA 3LZPA 2Z31B 5I1IH 1VGKB 2XZCH 2W9EH 3U7WL 4RA0C 3I9GH 3US1A 4N2FA 4F37F 1DBBL 2FGWH 2BOKL 3P9MB 4TMPA 2EIEA 2HTLC 4WEMB 1FNEA 2VXQL 4R7DA 3E6FA 3FQRA 2P5EB 1EMOA 1MRFH 2ATKB 3DIDA 1CL7I 5D1ZD 3CLEH 3OR7A 1H3PH 1RK0B 1KXTA 2UY7A 5EU5B 3V0WL 4PRPA 1MJ7L 4PJXA 3N1PC 2ZX5A 1I8LC 5IB1B 2I25N 4IW4C 1RPKA 1VGEH 1WG3A 4U1NB 3VRIB 4EKXA 2WPIE 3DMMA 3V4UH 4S1RH 4JJHA 2P26A 2YFOA 1G2LB 1XL4A 3IWUA 1Z6CA 1I3GH 4ZHAB 4GMTH 4CADB 1KBGL 3SQBA 2L7UA 4JLRB 1BLNA 2XVKA 5I8OL 2VJ8A 1HESA 1UG9A 4KRNA 4NCDA 4FI6A 1TJHL 3QMOA 4Y5XB 5IIEA 1FRGL 5CJOH 1U91A 1UD3A 5GSVA 4CSZA 4DCQB 2FWOA 4UZGA 3FUJA 4N90D 1WWWX 4JM2D 3BP4A 2HT4C 4X5PA 1CFMA 2CJIB 1FNLA 1BMWA 1O5DL 4H0HB 3VE0B 4BQBA 4MA7H 3CZUB 2VLKB 4G43A 5EZJB 5SWZA 1FFOB 3HAEG 1IB5A 4K7PH 1CPUA 2Q3AA 4UM9D 3IJYB 4OUUA 5DS8A 2BSTB 4X6DF 4A7UA 4WHTA 4P4KD 1MH5A 3BWUC 1AFVH 5F7NC 3S7GA 4EAEA 3IKKA 4JO2L 4FC3E 4MQTB 5KBDA 4P2RD 5DZ9A 1Q94A 3W9DA 1XIWA 4JDEB 1Z6JT 4HAFA 1EXGA 2ZUVA 4NENA 1VKXA 1YNTA 1NMAH 1RP9A 2CH8A 4JZEL 1YYMH 2V7HA 1BGXL 1MLBA 4FMKA 3FT1A 1S9XA 1AHWB 1UGKA 2VH5H 1W2KT 5F44A 3HE6D 4XP4H 1IKNC 4GG6E 3SE9H 4WU7B 3VRJA 2R7EB 5TPWL 4ALAH 1OB1B 4FFZH 3V6ZB 2Y7NA 4JNXA 4Q9QL 1KB9J 1GAFH 2VR5A 4MVBC 2F5AH 2XX1A 2LV4A 1NDGA 1BSIA 3RVXD 3QFJB 4CC4C 4XCNA 2XG4A 4NYLA 4YHPA 5AZUA 4LEXL 1PAMA 4ONGH 1G7QA 1HREA 3QUKB 1AGFB 1OXYA 4XPFH 4ELMA 1I3RB 4KKPA 4LL4A 1NGXB 1G9NH 2EEFA 5C07D 3SD5A 2DQFA 5A40E 5PCYA 1CI3M 3VFGL 1SOSA 2H9GB 1PZ2A 3CCHB 4YDZA 1N3NB 3C09C 3BRGC 2O6CA 2ED9A 3GI8H 2KT6A 1CZ8H 4HC1A 4PJAB 1INQA 1V5JA 2NCMA 1KC5L 1GY2A 2NY0B 1D5RA 1JHLL 1AZVA 1TJIL 3OXSA 2WY3B 3QUML 4RMUA 4XMWA 3WJJA 3P4MB 1X5AA 1V7ML 5I1GH 2ADYA 3DX6A 1FIGH 3WFEL 5IJDC 3EGDA 5M7QA 4PWJA 4BK5A 3M8OH 5CBEA 1KCUH 3CVCA 3GQFA 4XMXA 4AZ8B 2DD8L 3KW7A 5KVMC 1QUPA 2EZ0C 5FA3A 1J1PH 3H3PL 3L4YA 4HIXL 5DEFB 5IKCB 3W38A 4NKDB 1INEL 2Y81B 1S7RA 2EXSA 3CBKB 1SN0A 4M7JL 3HI5L 5I74C 2ZUQB 4JAMA 3C9NB 4LP8A 2YPKB 4LCUB 1HNGA 5C0CE 3VACA 3NK3A 2FYYA 2R4SH 3WMQA 1PGRB 3H9HB 3PWVB 3ZDYF 2IWEA 2W38A 3DV6B 4GRMA 4X5WB 4UILL 2PWGA 2HH0H 1W0VA 3WFZA 5T3ZH 3BC9A 2VVVL 4JJOA 2ZUXA 3ARXA 3RX9A 4M56A 5T1MA 5IB5A 4X5QA 1FV1A 5F8RC 2ZCZA 5AZ2H 4G6AC 3FFCB 4NM4H 3QDJA 1H6UA 2V9UA 5D1ZI 1KKEA 1UJ3B 4Q0XL 2PP7A 4JPWL 4UQBA 5SX5H 4AM0A 5B39A 1G7IB 3LMJH 4PRAA 3FCGA 1RERA 4KVCH 4YGVA 1JWMB 2GK0B 5H37H 4HEPA 1DBJH 5E8DH 1YJDH 3GLZA 2GTWA 3CSPA 5E6ID 3BZFB 4YPJA 1FVCA 3GEWB 4Q89A 2DB8A 3WKMH 4NZUL 5H94A 5KS9F 3BZDA 3OQ3B 2F7PA 2QDWA 3U7UG 1GIGH 3O45A 4OKDA 2V3EA 2VITA 3V4PA 1C5BL 2N59A 1BMGA 2ZOTA 1KTLB 2BX5A 5CEYA 3INOA 2CNZA 3KS0J 2EDBA 4DGIL 4O58L 2Q8BH 1JFQL 1W91A 1QP1A 2D0GA 3HEIB 5IV2B 2OV0A 4Y9GA 5J1AA 1SJHB 1KACB 4RDQF 4EIGB 4IDJH 3X11A 4FEMA 4WWKD 4GLRI 2GC7C 3GRGA 3LTVA 3F5WA 4P2OB 1FFQA 1BFTA 1Z7JA 4J12A 4RSYA 3UADA 3O4LD 2QLYA 5KYXB 5IVXF 4YDVB 3FO1A 3BAKA 3KPTA 2B77A 2CLRB 3MREB 3QNYB 5AEAA 3SBWA 5FB8A 3MCLL 1APQA 3RZCD 2KBGA 3MRCB 3STZA 4XB7A 1BBDL 3IDYC 4XRCB 1ANUA 4N90E 3IJHA 1ACYH 1IFHH 2DQGL 4BFIB 3A6BL 4ZI8A 3H3BC 2HLAA 3IYLW 2DDUA 4OJDH 4QXWA 4QUOA 1T7XA 3RI5F 1HJCA 5AW3B 4Z0KB 3NCBB 3FS9A 1X5FA 1N9PA 1I7UB 1EMTH 4ZMZA 5KSVA 4LGPB 3QNXA 1LK2B 2XN9E 3NP3A 3K46A 3QAQA 2OBGA 3VXMA 3GKWL 1X9LA 2P5PA 2OR9H 1W6WA 3WFBL 3MLRL 3GSWB 4NIYE 2OTPA 4Y4HD 3AAZB 3M7FB 2MFNA 1Z0NA 2HUEA 4ALAC 5DUPL 3I50L 1BFSA 1DN0B 2HORA 4KI5F 2DEWX 4ZAKC 3QQ4B 1DZ0A 3WDHA 2IGFL 2J20A 5LCVA 3HUJE 2BHFA 3HLAA 4MJ6A 3WE6A 4JDVA 2Y4SA 4F8PA 2N4IA 4GW5A 3A67L 4G1EB 4BFRA 4MAYB 1IKFL 2W2QE 3MKGA 3VGAB 5ISZD 3WNNA 4ES8A 3NA9H 3Q9PA 3ECUA 4XR8C 5GSRB 4NQEE 4DGYH 5B8CB 3RNKB 1CBVH 2FSEA 1XGYL 4F93B 3KPPA 4HMCA 2WQWA 4JFEB 5TF1L 4ELMF 1IC7L 1NLBH 3WXWL 4OGYL 2WJ5A 4KHXH 4MS8C 4NWTH 4RRPG 4X4XB 1AQKH 1NCGA 1T4KA 1U8MA 4XP9H 4Z0XB 5KVGL 5JORA 2P8LB 3HKZA 4B7LA 3SE8H 3EDJA 1EJOL 4YVUA 1KIPB 3DK2A 1HSAA 1ZWIB 5BW7A 4LLYA 4U7SA 2P8MA 4MBOA 1AP2B 1DCEA 4GSRA 2O6EA 5D7KE 1MPAH 3LQAC 4KKAC 4LLDA 4XAWL 2VDQH 3C8KA 4GU3A 4PS3A 1WDAA 4MRBA 4A1RA 5IBUB 3Q5YA 3ETBJ 4HH8A 4MKMA 2DKMA 1HYSD 3FU9A 4KOBA 1DIYA 5AVVB 4JHBA 3N41F 4B5ZA 4OZHE 1T1WA 2I07B 3D4CA 4R9HA 2AQNA 4S11A 3ARGC 5EC1A 5GGSB 4LDCA 3PGCA 3MJ9L 2VDOH 5HYSA 2GJRA 4HA1A 2C9VA 1A2YA 3PHOB 4LSUL 5B7MA 4XPFL 1OE3A 1A7RH 3CDZA 1U2CA 4NO2B 4M48H 1NBYB 1W8OA 3B1TA 4KKAD 2W07B 5AVXB 3PABB 3N8WA 2B4CL 2DLTA 4R0LC 4PYGA 2IG2L 1I8KA 3FUKA 4K5LA 3FCBA 4KTEH 1OGAB 4L29A 5LGHH 3E80A 4IBUA 2MPVA 4U6YA 5IQNA 2P7TB 3LRSB 4ISVB 2QADB 4ZPTA 1BJMA 3FK3A 3TF4A 1N7DA 2JCCF 1L9RA 5HBBA 4KJWD 5IEHA 1A9BB 3OMIB 4XNDA 1UCTA 1UKSA 1KFGA 2PPEA 2YAHA 3BAXA 4LBEA 4MCMA 1LEIA 4KUCF 3KPNA 1I1AA 4Q14A 4XX5A 5CIPA 2QQNL 4KGLA 3FFCE 2X1OA 1D9KA 3TA3C 2EE3A 1BQHA 3D5OF 3VI3E 4DP8X 4P5TC 2CLVA 3QUGA 3RUGB 4GKLA 3E2HC 2ESVD 1ZKAA 3DUHA 2ITDB 2VMJA 1A7BA 2ZSVB 3MO1B 1Q8MA 4IRZL 5DK2B 3BCDA 1CFVL 1IC4L 3R4RA 3DTUB 4MSWB 1OE1A 1GHFH 3EYSL 4XC3L 2B16A 4LKXB 1BZ9B 4JM2F 3HZVA 4PJ7B 4GXFA 4G5ZH 4ZT1A 4ZFGH 3WD5H 3L5WA 2M74A 4EUPB 1FF5A 1DQLL 3FFOA 3O0RH 1OHQA 4Y2DB 1T1YB 3S2AA 5JOFB 1SXCA 4HIJB 4KJPD 4G2AA 1BVKB 3JV6B 4NQCB 1CICC 4TVPH 1N8ZB 1BF9A 2HKFH 1UOLA 3QDHA 4X6FA 2VRQA 1GGUA 2F6AA 2GTQA 1HHKA 1NCWL 1CR9L 4EIZC 1MIEH 3S6XA 2XOTA 5KYUA 4DQOL 5KYNA 3WN6A 2IDUA 1TMQA 2DQEL 3MRRA 2FUTA 1O7SA 4GW1A 3HNTH 2Y82B 1KY7A 1NFIA 2PYEA 2EH8L 4WHYH 3H2WA 4OB5H 3VWKD 4XVOA 2X70B 4ZZKA 2VN6A 1U95B 5CGBA 1QEWB 4YBHA 1N19A 2BWQA 2FR4A 1UM6L 3UERA 1AZZC 4DK3A 3SOTA 4BZ1A 2PPCA 1SF3A 2IAMB 3MMEA 5FHBL 3JZ7A 2APTA 1OCOB 2OLDA 5D93C 4L4VD 3QJTB 4Z7WF 1II4E 3BPCA 3IITB 2AC0A 1QQDB 4KI5E 4GG6B 4K7FB 2ZWNA 2R29H 2RTTA 1EDYA 3LZNA 3RNKA 1HKFA 3HPLB 1LO5A 1U9KA 4OFQA 2HFEB 5I75C 5GZNC 1ZTXL 5IHZA 1TTUA 5EUOB 6COXA 4BTUA 3GMRB 4PWFA 4QJ5B 5ESAA 2Z65C 2QFRA 1U8OB 3QUMH 2GFBA 5FYJU 2DQHL 2Z7YA 3VNYA 4BSVA 4UQ2B 3WXVL 2ZAIA 4N2EA 3F84A 5I28A 4J7RA 4OQ1A 5IQ9A 5DD1L 3TN0A 3MRBA 1F4YL 1YVLA 4Y16C 3UXFA 1CDJA 1EA9C 4GNKB 4TNWF 4RISH 1U36A 2G2RB 4GINA 4W6YB 2A9MH 2PUQL 4BDXA 2LTQC 5DVLA 2QT6A 2EICA 2G00L 3X1NA 4UTCA 3UMNA 1DVYA 4BFBD 3HZMA 3ABGA 2Q2EB 1Z2KA 1E43A 3V0AC 1OARH 1JL8A 5FS5A 2X4UB 1CLVA 2VWEC 2VXSL 2WWKO 3ABZA 1OW0C 2AANA 3KYKL 4WNJA 3BKML 8PAZA 4JZDL 4OQTA 4KKCC 1KJ2A 2NW2B 1CXHA 5F8QC 5F7HA 1G7LB 4CGTA 2GSMB 1WK0A 5T3ZL 1G7JA 4PFEA 3OAUH 2EP6A 3RFZA 2VJ3A 3CFDA 3BT1A 5C70A 4ZUUB 4YDKH 3ZZLA 5SWSE 1ED3B 3BRFA 2Y7OA 1ZVSB 3FOMB 2QGEA 1G2MB 2XC0L 1IQDB 1PY4A 1TCRB 2QGCA 2UZXA 3DMMD 1NSNH 4YWGH 3T4AA 1RMFL 4L48A 4PGEA 5IMMB 2BP8B 4Z7AA 4F8TA 4OZFH 5I0YA 1JPEA 2WTOA 1H6EA 1JZ3A 5IGXH 3AJ7A 1R33A 1MWAA 5TE6H 3HE7C 1MFBH 4HKXA 1WAAF 5EFIA 1FAKT 1SQ2N 2VM4A 4J6RH 2KC0A 4I3RH 3KXFA 3FYEB 4L8CA 5KZCB 4GLRH 1IE5A 3V10A 2P8PB 4X8XA 2VN5A 2FL5B 4X8JA 1W0WB 1PKQB 1AD0A 1A4BA 3QCUL 5MERA 1YEKH 1TTAA 4NC0B 4LQFL 4NZFA 3RUGA 5I8OH 3QRLA 5D7LD 3U6RA 4BGDA 2J55A 4DO5A 4MZ2A 4QYOA 3DXAE 4TM9A 3RGHA 1P7HL 4A37A 1QHOA 2WWMD 3CN4A 4R4FH 3C6LB 5IF0B 1XSIA 5JOEA 4ZTOL 1S2EA 1JGDA 2N7BA 3QH3A 2H2PC 2YPLD 5GGVY 4O2CB 4YHKL 4LSUH 2C1PA 5BQDA 5IB3A 5ECJE 3V6OE 1JRHL 2CJTA 3QZNA 2DTML 3MLXL 4RAHA 2CUHA 3TVMC 1YN6A 5JR1H 2XBDA 1CK0H 3ULAB 3SD2A 1JBJA 1NAKL 3NIFF 1XSJA 1UWYA 1ATBA 3Q6FB 4UQDA 1OPOA 2HOXA 1J9RA 4GMSL 4GIAA 4UUJB 4X6FB 1X7TA 2HN7B 4W9IC 3VSQA 1NBCA 3ULUH 3ZXAC 1D6VH 4DWHA 1NGYA 2ADFH 5PAZA 5JHDB 5KYYB 1SUHA 4G9FE 3MNVB 4PRNA 2RCSL 4JG9A 4JO1L 3VE0A 2J1WA 5IMKB 5EF2A 1LO4L 2B1OA 2AQPA 1LDSA 4E9SA 3QNZB 3II3A 2Z92B 1AGDB 3GJFK 5E6IA 3UEZA 4JHAH 3SDYL 3VRLF 1KFAH 3D39B 1OCZB 1IAIH 4PU2A 5HHMD 3ILEA 2BINA 2PP8A 1ICTA 4JG0L 4S10A 1JCVA 2HPTA 1Q9OA 4J3OD 1AO7B 1JPSL 3BLBA 3F7YB 3O81A 3UFIA 1G6RA 5KWYC 4F58H 1PYWA 5DHEA 1MJJB 3GPSA 5L2KA 2X41A 4Y1AE 5B38B 4WDIA 1R5VB 2KPWA 5DRWA 4EDWL 5D7IA 4FYRA 5AVYB 3ARUA 4FFVC 5J06A 1CTOA 1MCHA 2DQCL 3KNBA 1FJ1B 3OMZA 4UV7H 2DQIL 2IFFH 2PPAA 4NJ9L 2CD0A 4JDTH 5DHMC 1GPOH 3SGEI 1OSZA 2IMMA 2XWTA 4R4BA 5TH2B 4QXGH 1ADXA 4GFXA 4PBXA 3RKPA 1Z5YD 1ZE3H 4X80L 2EYTA 2YLKA 3PHQA 5JOPE 3NZUA 5JW4N 3V6ZA 2WUCH 1L6ZA 3BZEA 3GJFA 3ZZSA 5JMOC 1ZEAH 2A6JA 4JZJA 4LK4A 4CSSA 1KJVA 5DK3A 1BV8A 2ID5A 1G4RA 3C6LD 4JRYE 4AV5A 3G9VA 4KNQA 4OV5B 1URZA 3WL9B 5E9DA 3ARTA 3MCKB 4AENB 2G75A 3GSVB 4KC3B 3PWJA 4TNFA 3AT0A 1TVHA 4B96A 1SNRA 2IDSA 1KIUB 2GI7A 2A4CA 3MJGX 3CQFA 2VIRB 1BVZA 1K4DB 4MBRA 2EDEA 1FYTE 1CFTA 3FTGA 3MRPB 4XBPB 4M1GL 4MNQA 3WS6A 3O4LE 2VM9A 3QWQB 1JNLH 1IOEL 2CA4A 3U0PB 3N2JA 5L2ZL 4YHNB 3S5LB 1JPGA 2Y22A 4OSUH 3QRGH 1CD1A 4IDLA 3QR0A 2ZKHH 2XRAH 3ARRA 3P0VL 2XKNB 3L3JA 4QHLA 2WLMA 3T4AC 1CDCA 4YIQB 1Z3GH 5LGHL 2IPTH 3EGSA 1NT0A 2ICWJ 2Z4TA 4FFZA 4Y9CA 2QSQA 3DXAB 2MH4A 1XCQA 2BMGA 3MUGB 1QA9B 1YDPA 1XSKA 1OTUD 2J57A 3MX0B 4U1GB 2YQ3A 4B9JA 2H2SC 4KRPC 3VD9A 4QHUB 5LXGH 4X8UL 5DZJA 3NSFA 3F7KA 4PBWD 4U2ZA 3U9PH 3I74A 2VSKB 4ERSL 4ZRGA 1FL3B 5GGTA 3PL6C 1RPUA 3KQBL 4NG9L 1QSEE 4X6DA 5DFVD 5EUOE 1YEEL 2EVFA 4PMFA 3VD4A 3K6DA 3GSXB 2B15A 1B6UA 3NIGB 1A25A 4BKSC 4YSEA 3D7PA 3BXNA 2X0UA 4BWUA 1NEUA 3LQMA 4DKAA 3G6JA 1MJ7H 1N70A 1XH1A 4WHDA 1FCGA 1ZE3C 5IJVA 4P46A 3OAYK 3UEQA 2NY4B 1TPXB 2W0FA 2DTSA 1TPGA 2FT8A 3VXSB 3A22A 1FH2A 2P5WD 3BWUF 4QWWD 4Z7UB 4JYVL 1YNKL 2C26A 4O2CA 3OC8A 5EOQL 5AW1B 5H35B 5IROC 1NGPL 3CU7A 4I3GA 1QRNE 4P23D 4I88A 1FL6B 1JF1B 2C3HA 2PW2B 4P2YA 3H6JA 3RX7A 3IM1A 2H6UA 4B9CA 5IOPB 4FQ1H 1ZT4A 1IM3D 3DPBB 5D7JB 5C2BL 4ZYKB 1CUOA 5IR1B 4LSTL 4HF5L 3TM6A 2XC4L 4QR7A 1CICB 1V1IA 1QX1A 4WK2B 1ZTMA 4B53A 4ZG1A 5K9OA 2F18A 4H1LB 4L8SC 2Z7WA 2BDNL 2BERA 1FZOB 1MCEA 1N59B 2PCFB 4FTVE 5F89B 2IADA 1RI8A 1KYUA 2MPAL 3OHXA 3MRCA 4PRNB 3RFRA 5L4MA 3IJSA 5MHSD 1ZVNA 3EO0B 1PQZB 1SUJA 1H3TA 3U25A 5CS7A 2LU5A 3NCYP 3ULVE 1J8HB 4D3CH 3PAZA 3D4YA 2XQ0A 4Z3TA 2WKOA 2GUOB 1F0SB 4OGAD 1CWVA 4XP6H 5DJ2A 5AB2A 2G3NA 3U36B 2BJML 1NDMA 4FFWD 4BELD 3WY4A 3VQ2C 4F92B 3S98A 4A63A 4PJBA 2ZICA 4AV4A 5IESH 5MEOA 3WEOA 4KUZL 3WD5L 3F05A 3VI4A 1CLZL 4FX5A 4AYSA 4HUUB 4YVNA 3SPIA 4RMWA 1DCLA 1E40A 4D9RE 1G9NC 1DN0A 2CR3A 3ULSB 3L1OH 3PQYB 4PWHA 2YXWA 3ZE0B 2P49B 1T5WA 2VXQA 2KDYA 4LAJH 5I46L 1ML0A 4RRWA 4YAQA 4G71B 3UTPE 1JYXA 2PTTA 2OMWA 4WI0A 1E9QA 1RQ5A 2UYLB 4CC0A 5EBLA 4NC1E 4XAKD 4W4NA 2YS4A 3NDZE 4Z3JA 5KVEE 4RAVA 2RQEA 1HHGA 4DGVH 4ECNA 1BYOA 4NZDA 2EUZA 4GKZB 4NA9L 3VTMA 2DY2A 1G1TA 1QNZL 2CM5A 3D50A 1DEDA 3IAQA 4PQXA 5C0IA 5CAYB 1MF2H 5KJRL 2KLSA 1X9RA 2VRKA 4ODTH 5IOKA 4GUOA 3NIFE 3N55A 1V3MA 4P5MA 1QKZH 2JE8A 2VDKB 1G4MA 3B7TA 4FQXB 1JHLH 4WGKA 3CHRA 4X5XB 1BWWA 1LEKB 2L04A 2VDPL 2CMRH 2Z31C 2GTZA 1KENL 3D06A 1HZHH 1XB6A 2BWIA 3D48R 4JY5L 3PHSA 2BMKA 2R2EB 1DVFC 4XVJL 1BPVA 2EDOA 1WWCA 2EYRA 3LH9A 4A66A 5JBBE 3L1GA 2HJLA 3T04D 2WXQA 3EYUL 3H0TA 1I7ZB 1RJYB 3QO1B 3ZT6A 2EXTA 4FKKA 4M10A 2VUKA 2IAAC 1JI2A 2CR0A 4QXGL 2VH6B 1FL5B 2HWZL 3RJQB 1WEJH 2BRRL 2DPKA 5I5MA 4L5FE 4PJ9C 3V4PL 4MQSB 4I2XA 3ZT7A 3WTYA 2E9BA 4BFOA 2V17H 2XN1A 3HJEA 3U7AA 5E8EA 1L0QA 3CVIL 3B37A 2OMXA 4XBGA 4MJ5B 1MFDL 2XQBL 3FTVA 4QKTA 5JXEC 4YSSA 3MV7B 4JFEE 1CE6A 1PNDA 3VD2A 4P2RE 4NI3A 5HI3D 1L0PA 1S7QA 1PRHA 3G6AB 3OKNB 4P2QE 3UJTH 3QDMD 3BZ4B 2X4SB 4GEIA 4L3EB 4XVSL 3BFQG 1EHXA 2BSSB 4OF6A 3GSUA 5ALCH 5I1EH 4O4YL 4ZD3L 1BQKA 4OD3H 2NY5C 2ZCLL 1OTSC 1M7IB 3HJ0A 3IS0X 1QNIA 4FQCH 2F08A 3FB8A 1IQIL 2E8YA 2ODIA 1NAML 4HBCL 3AWFA 3P30L 4KQ4L 2BNUA 4PV8A 3B7UX 1BQRA 5F7EH 4Z7WB 3L81A 2R1YB 2XC5L 4ABWA 4F7TA 3S3DB 2PR4H 2AJUL 3SYPA 3IMTA 4TYUA 2FJHB 4O9HL 1S9YA 5JHLA 3QUZA 2V5RA 4PJCE 4LLUB 4WKZA 3FB5A 3EJYD 3H56A 2MOVA 3IDYB 5E00A 3FU5A 7FABL 1NLDH 3VXSE 5AYTA 3X12A 3MV8D 4JB9H 5JHAA 4J3SA 5AB0A 3D30A 4V33A 3EZJB 5EU3B 5F9DC 1OAZH 3UPCA 4HD9A 3EJUA 4JKLA 2GUYA 3ARDA 4PJIB 4LHUD 4DVRH 5JPMA 3FHQA 3T0BA 3HB3B 3NGBC 5EN3A 5FCSH 1LGVA 2PO6B 4XNMA 3X1BA 1U3HB 4PS4H 1EXUA 2P52A 2BOCB 4FYTA 4NRYA 3BPLB 3B6SB 4AQOA 4WEBH 3F00A 5FV1L 3KPSD 3U7WH 5DUMH 1DQKA 3TPUA 3P2TA 4Y5YC 5F7DB 1OV8A 4NDMB 2FB4H 4PIBA 1W0YT 2XETA 4KAQH 3K6SB 5IW6B 1KLGA 3BLKA 3JTSA 3VH8A 5B4MC 3K71B 4PV9B 3DX0A 4FQ1L 3EYVB 1U92B 2ED7A 2Z34A 3FT3B 4FZEH 2KLRA 4PD4K 5CCKL 2QQKH 4HQQH 4HUVB 5IBTL 5DT1H 1YNTB 3EHBC 1YY8A 1X7QA 3N42B 5KSAA 4NT6A 4XNZB 2D0FA 2QPUA 1QFWM 2HFGH 3VSTA 3SW2A 4K2UL 1KIQA 4WWKB 1XEUA 4Q6IC 4G83A 1CJYA 1KCBA 5FF6B 2GIMA 2O5XL 3HVDA 1TJGL 3ETBF 4N8PA 5EEYA 3AMKA 4V1DB 3U4EA 3RWFB 1TO4A 4R84A 4AOFA 4RRYA 3UAAA 5ITFA 2HX8A 1EO8L 2GSGB 1L3WA 1VFUA 1UZGA 1QBLH 1ROCA 3GIZH 5DQ9A 1JGIA 5D4QA 2ZKXA 4S1QH 3MYJB 2IAND 3Q1EA 3LKQA 3OAZH 2PPFA 1VA9A 4KJWC 3AB0B 4NIKB 3CZGA 1X6NA 4I13B 2DQCH 3GMNB 3FSOA 2BFVH 3G5VB 4YSPA 3SBRA 1DJSA 2AJXH 3QRBA 1T80A 3UO8B 1JP5A 1QUNB 2VSCA 3BPOB 4Z0BL 1F3DH 1FE8L 1ZV2A 4UNIA 1DBML 1IC0A 5IMOB 3TV3H 4FLRA 2FX7H 3BQUA 5KVEH 5L6YL 5D1XA 1L9TA 1MFCL 4QXVA 4F8LA 1N18A 2WFXB 2DIAA 4G7VL 1L0YA 4K3DL 4CGUB 3CFDB 2NSQA 5BRZA 5T1LA 5E8EB 3CK0H 1DVZA 1YEFH 1WBZA 2D7PA 1JAEA 3MGTA 3QA3B 1SDDB 5IMLB 2AV1A 1A0QH 3KXFE 2NDGA 3U4KA 4UINL 2JB6B 4OJCA 2MWCA 2DS4A 3C9NA 3MRLA 4JEGB 1C5DB 3SDAA 4NCC2 5F3FA 3MJ7A 1GGIH 4Z3IA 4OZGA 3ARBD 3HB3C 3NGBB 1CDGA 3AM8C 3EGFA 1MRCH 1AVAA 2CLZA 5JORB 4P2CG 1ZLVK 3OXRB 4KZCA 3WGVB 1R3KA 5B3SB 2DM2A 4W6XB 5CD3A 4EMZA 1F3JA 4NP9A 2ZYSA 2DMCA 2AEQL 3FNKA 4G1MA 4OIBA 3M1BA 1FFNB 2WKGA 3LKSA 1D6EA 5IHBA 1MJUL 1TITA 2BVUA 4NKOA 4P5KA 3UBHA 4X6CE 3WIFA 2OL3A 3JWOH 5C0CB 3KPMA 5E5RB 3QARA 3K8LA 1KYAA 2FIRT 1AC6A 3BEWB 2HWZH 2HX7A 3C5ZB 5AUMB 4KX8A 4N8VB 4PCSA 4HZLA 3NVQA 1J1XH 5HHVL 3S8WA 1FVCB 4YXKL 2FIKB 3W0WB 5DVOA 1T5XA 3TCLB 1LP9F 1EGJH 3PP3K 1MJ8L 4KRPB 2QKIB 2WVUA 2AXFB 3QXAA 3DYOA 1DUYB 2FECI 5FUCC 1IAIL 4IBVA 2ICEA 3H7BB 5L8LB 3SYQA 2M83A 3UBFA 4F33B 4DUXA 2FATH 3CQPA 1CVWL 4KO9A 4WTXA 2D1JB 5CWSA 3VGAC 3DJRA 4ZXBC 3IGKA 4E5XG 3K4DA 3HKFA 4DPBX 2A38A 3IFNL 4KXDA 3DK0A 3GM0A 3OKKB 4GIPD 1HZ8A 2AK4D 2V2TA 1KB9K 1X5ZA 4UNUA 1MUJA 3A47A 3O2DA 3MJ9A 4LEOA 4KTYA 3I02A 4K8RL 4NFDA 2Q76A 3UCRA 3S3JA 4OB5L 3NA4A 1TJXA 3C2AL 4M62L 2RNLA 1NGPH 1C08B 3L1OL 4NEHB 4UANA 5IHLB 3DVIA 1TKWA 3HG3A 4QJ4B 2XJLA 1AGCA 2EIZB 5IW6A 4OBRA 5KSUA 3UTSA 4JREC 3QWOB 1JK8A 3T3ME 5CHNA 3K1KC 5DJAA 3QSKB 3NSXA 4TUOA 3CVBA 2P42B 2X6BA 2P5EE 4NZUH 5LBSH 4N2LA 3QPKA 1XDTR 3U4BL 1QOKA 3DETC 4LKXA 1IC1A 1X5YA 1OAXH 1GAFL 1UZQA 4C16A 3GLEA 2Y5HL 1SFHA 3IETB 4S1DC 5KG9A 4WW2C 5E8OB 2OSLB 3NT0A 4KUCD 3ISYA 2Q1JB 5AW0B 4O51B 2DQHH 4EDXA 2HRPH 3S88L 4FCAA 1KENH 1F4YH 2EACA 3QHFH 1SOXA 1RVFL 3JVGC 2OXHB 1F1AA 1IVLA 2A77L 5E2UL 3EJRA 3CC5A 4JFPB 4YK4B 3FQNA 2ZWKA 3QORC 3MYJA 2A7BA 3GS4A 4HD5A 5I71B 4X99A 1F4WL 5TJWK 2ZQKA 3MRFA 1T0OA 4OJFH 3SDXB 2XN9D 4AYID 2K7PA 4I9WD 4N9GB 3WAKA 4OV5A 2YQBA 4KMQA 1DLFL 1PTHA 3BW9A 3GXUB 4D8PB 1JZIA 3Q5TA 4IM8A 3UYPA 3RJOA 2BNRD 4HKZA 4LSRH 2NY1B 2K0RA 2VLRA 4GIOA 2GJPA 4TVUA 5E08L 1O5DT 3II2A 3H2QA 1JPFA 2ADIB 4MYWB 4N8CL 4JDEA 1G87A 4GP8B 2JELH 3B9KC 2Q86A 4RRXA 2WXMA 4WHTB 3ARWA 4DP0X 2UZYB 1KEGL 2OMUB 2F58H 1I1CA 1A4AA 5TGBB 2QTVA 2EIMB 1J0HA 3N44B 1ZLEA 4B3VA 1HFUA 2YEZA 3G5ZB 4JRXB 5AFAA 4POYA 1BXAA 5T3ZD 4FN0A 3GMPA 2DBLH 2QQQA 3ILPA 1IGJB 3MV11 4KTDL 4FLHA 3D52A 3P77A 1A1NB 3WNPA 4F1SA 1OSPL 3PRZA 1BX2A 4HWBL 5DJYA 3CHPA 3DHMA 5D1ZC 4BBWA 2XNAB 4RFOH 5CN1A 2FE0A 2PHBB 4WU5A 1B3JA 4F1ZA 4ZUVB 5HJ3B 4R7LA 1KGIA 2JK5B 2F8IA 3B9KD 3K5SA 4I2XE 3OZKA 2OSYA 4ELMB 1QRKA 3EYUH 2VR4A 1NM9A 3N0AA 3CXHJ 3KYNA 2CO6A 3ROOB 3EADA 1H5BA 2I60L 4NKOB 1T7WA 3GXTA 1AGFA 3CMOL 4AQ8C 1MCBA 4XMKL 4S0HA 1FAXL 4OFIA 5AALA 1XKAL 2PLTA 4JFZH 3P11H 3VYOA 1SPDA 4KDTA 4IHBA 2MQCA 2WBXA 1RLWA 3ZTDC 2WINB 3PWUA 1UM4H 1RJZA 2CXGA 2GEQA 4GQQA 4QRPA 1KXQA 1AXIB 1JGUL 3CFJB 2YQGA 5GRVL 2E47A 2ENYA 1OT2A 4M61B 3BP7B 3MXVL 1JG9A 1N0LB 2LOEA 3FONA 2EH7H 3WO3B 1D2PA 2ZWYA 3LNIA 2MHAA 4RUTA 1TZAA 5EBMB 4QHPA 2NNAA 4H2AA 5AW9B 5D5ME 5D6CB 1HDMB 2EILB 4JFFB 2VDML 1CLZH 1D2OA 1F58L 1OB0A 1GR7A 1BOGA 1U93B 4TTGA 4ODSH 5I1JL 4DN4L 5EOTA 3S35X 1SLWA 2VDMB 3GISX 3L13A 2ZX7A 1KBGH 2E7MA 1N8OE 4YHOL 1IM3A 3IFOA 4PEEA 2P93L 3EDKA 4O02B 2PXYC 5KOMC 5LQBL 5FOBA 1IL1A 1G7PB 3MLZL 3AACA 2FL5A 2W94A 4O2FA 3ZTEA 3ULUE 4MNHA 2R8SL 2B2XH 2K45A 4APXA 4OW6A 2P3FN 4R97C 2G0KA 1IJQA 4HFWA 2X1QA 2EJ1A 1E8YA 5CILH 4D0BB 3H42H 3FTSA 3MQEA 3WUZA 3TBCA 1LEGA 4PJBB 1E2VA 3RWJB 1OSEA 1U3YA 3FQTB 4KXBA 3I9IA 6PAZA 3UMTA 1FYHB 1IMHC 1D7BA 4GBXD 4XHJC 1GMIA 3VXNB 2A9DA 5CEYB 2FSEB 4UMGA 1J0JA 3BGMB 2UZIH 3AG2B 4ZH8B 4XO5A 2D2CC 3GSNH 5E2TL 3GLAA 3X3GH 4AVKA 1HQRB 2VDLB 4FQQB 1HCGB 3GBNH 3Q6FA 2XWDA 1NTDA 2B08A 3VXOB 2ZWLT 3T0WA 4Y7AB 2EE2A 2A4EA 1J9SA 4HWEL 4WEBL 2PWEA 4UYQA 5T5FL 3WXWH 4MQ7B 2A73A 4LGRB 2IH3A 2AJXL 1OAUL 2EVHA 3D69B 4YHIA 3AWGA 1K8DA 5KANG 2OMVA 1G0YR 5EU6B 1MCLA 1REIA 3Q2WA 1S8DA 2SEBB 3HG1E 3UBXI 4B97A 1P84K 4XCNB 3VM7A 2DIEA 4Z7QE 1HINL 3X3FH 3QZWB 3LIZA 4ZPVA 1ZTXE 1M2VB 1RPQA 2WNWA 1YUFA 3MA9L 4M6ML 5K39B 3LRKA 1MOEA 3I50H 5F88B 5FK9A 2Q86B 1PLAA 4HKBB 2WXLA 1NBVH 3JWNH 1F6AB 4G6AD 2OS7A 4KDTC 5CF3A 1U8IA 4JRYD 1ZLWK 4NM8L 1AHKA 2Y6TE 4P23C 2HKHH 3A4FA 43CAA 4D0DA 1MCJA 3IU3A 2JCWA 3MPCA 5FUZH 4GI9A 5SWSD 1FDLH 4K5PA 2EUVA 3QQ3A 3P4MA 1E9OB 4TOYL 4LSVL 3PHQB 5I6NA 3CIQA 2EEBA 4BTIA 3KL0A 1K8IB 2DLFL 3DSFL 3CN3A 1KZQA 1ORSA 4XCEA 1QI3A 1WZLA 3P30H 2A6KB 4OIIH 3UABA 2J6EL 4G8FA 2BO2A 5EEUA 4I85A 4EZLA 4L8SA 5CUSH 2ZG3A 3GFUA 1OGAD 3DVFA 2ZOWA 2DIBA 4JFSA 1MZZA 4J2QA 1MIMH 3PWPA 5F3HB 4RMBA 3JYCA 1PBYA 1J9QA 5I2IA 2VERA 5L0QB 4U1JA 1Z3RA 2DEXX 1WITA 4U6HA 4Q7DA 4GXVL 2O26U 3MO1A 1HE8A 3BYTA 4P5SA 2WN2A 5E9DD 5LGJB 3QZOA 1A7PH 5B38G 3K2KA 2Q87A 1WHFA 1MI5D 3ME0A 1A3QA 4UOQA 2VZOA 3S34L 4FTDA 3UJJL 4DKFH 4DP1X 4M5SA 3O41A 3LEXA 4U1NA 4YGVB 3EJTA 3M7OA 3DX7B 4N4YB 3PIQB 4MCZA 4XI5C 1FH5L 5KAQF 4XODA 1YYLH 4I18C 5J89A 4BCYA 4LLDB 2KDGA 1F45A 4MA3B 3S3SA 1BG9A 4XXDA 2R0LH 1YQ2A 3QEHB 5EA0L 3C87A 2UWOB 2WZ6A 4F91B 5CSBA 3TT3H 4W70A 2QSCL 1N5AA 1V7NH 3K6FA 4TSBH 3FO0H 3OC5A 4YBQC 2NT0A 1U4EA 3O11A 3NIDF 3VCLB 2X0WA 3NZ8B 4C8XA 4C59B 3BKYH 4I18B 1FYTD 1Y0LA 1AG0A 3EW3B 1A7NL 2OA9A 5DT1L 3KJ4C 4FXTA 2R1XA 5ETUA 5MP6H 3KVDD 2X6AA 2P94L 1C5CH 3RAJH 1ZGLB 2JJTA 1NFDA 4JFQB 4GAGH 5IUCA 4BZYA 4FI8A 3NTCL 1W72A 1M71A 4LOVA 2BVQB 3PG2A 1KJMB 3NOIA 1MY5A 3JV4A 3GRWH 2A1WL 3ZKMD 3AT9A 3OAZK 4QCIA 1KT2A 4QYAA 2CDEA 4YLQT 3V9EA 5I17B 1N26A 2DWEA 2DYSB 4OFYD 4LLMB 3ROLA 2P24A 2RQ8A 4FFYL 4GAAA 4X7SL 4KTGA 1IGFL 1U8JB 1QFUL 5L0QC 3ATAA 4XNQB 1PSKL 3KG5A 1T04B 2HXAA 3PU7A 2X4QB 4RWYL 4A04A 2BOBB 2HRHA 3KLHC 4ZAKB 2X5PA 1UA3A 1SJEA 4NNPH 1MWOA 4JGUA 2IGFH 4YHPB 4XE0A 4I48A 2P5EA 4UNTA 7PCYA 3V64C 5H4YA 4YMPA 5IQOA 4PGDB 5BO1H 2PWHA 4IRJC 3LVEA 4LF3B 3TOPA 4TQ8A 4HP5A 3HZVB 2QEJA 2BZ6L 1JV5A 2VTFA 1IFGA 4WUKL 1AI1H 4GRWB 1H15A 3CHQA 3OSVA 4JKPH 3RZCB 1TU2B 3KCWA 1BZ8A 4PTTB 1NCCH 4FAAB 1PNCA 2HG5B 1B2WH 3FPXA 3QIBA 2V5SA 3U48A 2DEYX 2PCXA 5F7AA 3A21A 4AV0A 1I9RL 3C5SB 4ZW5A 1AR2A 4UINH 4JHAL 3V8OA 3ZRSA 2V7NB 1FZKA 2NZIA 3UTZB 3ZE0E 1MG3C 1YRKA 1HWWA 1NFIB 3HTLX 1AIFB 1JXDA 2I5YL 3ARFD 3FUHA 2YGNA 5GHWL 3F6UL 4D0CA 1EJOH 5EH1A 3LEVL 2GITA 3L8QA 4FXKB 3GSNL 3T6XA 9CGTA 43CAB 5KJ7E 1WZ1H 3DO3A 5ADOH 2X05A 2DD8H 2X53A 3TBYB 1KCRL 2YGPA 3QQNA 2BNRE 1JZFA 1TEYA 1XB3A 5GGRA 3Q3GA 2CM6A 2P44B 3BAEL 1PFCA 2D03H 3CJJA 1KNOB 1A64A 4PRIB 2HFTA 4ZNCD 3OTTA 4F27A 5IJKC 2VR3A 5HHNB 2NUTB 2W88A 5EC1B 3KDMB 5EZLB 5F6HJ 5DZVA 1TQBC 1BA9A 1ZEAL 3LKRB 3IXAA 2E59A 4U1GC 5E03A 1L9QA 2CHZA 1ZLUH 3ZSTA 1KIRA 2W2NE 1HWGB 5DHVA 2X2HA 3MA9H 4QRQB 1JWUB 4NQXB 3K2UL 1IZJA 5FM8A 2BVPA 3MDJA 3G5XB 2O61B 5ENWA 3W56A 4CSYA 3TBSB 1JZDC 3A6CH 3PPEA 2AJUH 2EDDA 3QUXA 2IPUK 2WVTA 2C1PB 5D4HA 2ZKWA 4GW4B 2YRBA 4WUUA 5D9SA 3ZQ9A 1YN6B 3EBIA 3K1DA 3KBPA 3UC0H 3VFVB 3D0AA 5T3XL 5DFWH 5J56B 3DI2B 3SKNA 4BFJA 3U9WA 5A3IC 4DP6X 5J1AB 5TFSH 1JUFA 2AK1L 2QELA 3X13A 3C2AH 1E4WH 1NUNB 1S7VA 3SKUD 3F5WB 4JHUA 5I1KH 1RMFH 3P4NB 4MB4A 4WJG3 2W0PA 5E9AA 1WS8A 4UWQB 3H7BA 4PLKD 3KLQA 1WP6A 3ZE2E 5IGXL 4ORGB 3I6GA 1LWHA 2X2UA 1T1XB 1XR8A 1QSVA 3ASIA 1BVNT 3ZT5A 4G9DB 4N86A 8FABA 1MWAB 2YAFA 3EFOB 4TSAL 2BP8A 4OLZL 1ZLVH 2OX5B 3REWB 4IMLB 4R0LB 1H8SA 3IVKA 4HYTB 2UVFA 4L0PB 1YLBB 4PG9A 1FV1B 2IG2H 2Q10A 1ES0A 1XF2A 1FF7A 1NMCC 3HZYA 1EZSA 5LAXB 3IMVA 2APWA 3RWCA 3LEYH 3WO4C 2RB8A 1LNUA 2J43A 3JVFC 3GZQA 2XXFA 4KJPC 1YPZB 3UC2A 2AZUA 2VW4A 2WNGA 3U0WL 1JK8B 1L0XA 4JFFD 5CO1A 1IC5L 3MLRH 2OKMA 5DI8B 1MZYA 4P9HH 3FZUD 2FCBA 3IDXL 2X3BA 2DI7A 2XV2A 1IJNA 4H5SA 3SDDA 4HIIB 3SO5A 4KKQA 1X5XA 1QYGH 2YD5A 1UC6A 5EO1B 4Y5YA 1VERA 3I9PA 4HUUA 3V5HA 1PJ9A 2DJ4A 4ZS6C 1I53A 1TJGH 2LU4A 3PXLA 4PAZA 2XWRA 3IDIB 2NUPA 3NIGE 3CLFL 3VFUB 2ZKMX 4WSGA 3SOBH 3AREC 3ARSA 2Y36L 3VFWA 5JXAL 1PDKB 3KYOB 5KSBE 5F72S 2OCJA 1R3JB 5IV2A 2L7QA 1R5IA 3DECA 3WOVA 3NFPA 4WNSA 2R29L 5T1KD 3PDOA 3D85B 1N6UA 2YRZA 2XVGA 1BZ7A 2V4LA 4LVNB 1C5CL 5JA8B 4JO1H 1TOZA 2P3YA 4LCWB 4HG4K 3GJEB 5DO2C 2WKOF 3GINA 1IC7H 3E9TA 3GKZA 3GI9H 2WBJA 1FHNA 3OPZL 3JWNE 4OM1H 5SX4H 3Q8EA 2PCPA 4HCIA 5F7FA 4PJDA 3MBXL 3TA4D 3B9KB 4ZJ9A 4HUXB 5CEZD 1P7QB 1TZOA 5E8NB 4Z1PA 4NO5A 2PYEE 2MNJB 3TV3L 2OMTA 2YZ1A 4JRYA 4RLDA 5HHPA 5GRZA 1MFCH 1KB5L 2VXVL 4PP2A 4G7SB 4LSVH 2AJ3A 2PW1B 3BAIA 4XH2A 3TYFA 3HE7D 4PVLA 2L8AA 4BSWA 5KSVB 4UQEA 5D1XD 1FYTB 1SOQA 3CXFA 1B9WA 2BIIA 4RDQG 4H8VA 4I5BB 3EH4B 5D7IB 2A2QT 4LCCB 4NFCA 3IGLA 3FCTB 4EI6B 2DJSA 2AK4A 3POCA 3S97C 5LXGL 5DC4B 1JXKA 4ZMLA 1XF5A 4JFFE 5CXPA 2J34B 3O6FB 1WYJA 3OBAA 4GAYA 3P02A 3QZMA 4WW2B 1GW6A 1A7OH 3ZYGA 4CW1A 4YL4A 4RS0A 1VENA 1HWHB 4BIKA 3FSAA 2J8UA 4XP5H 5ALBL 4JM2C 1IQJL 1AY1L 2A6IB 2F1AA 4Z7OE 1ND0B 1AANA 1EZVY 5L2JB 1UCBL 4B9IA 2Q9OA 3L54A 5GHWH 3V0HA 4NZ8A 3DX9B 5AENA 4UU9B 1H8LA 1Z9SA 5I66B 5COXA 4K9JA 4JN1L 2IQ9L 2H8PB 2XT1B 3IFLH 2XTJD 4XMVA 3TA3A 2XWJB 3HOGA 2YEVB 1FSKC 3BAYA 2OW7A 3EO1B 5CKMA 1HSAB 4HV8B 2D9CA 4LAQL 2QPSA 2PN5A 2P8MB 3FUEA 5JBCE 1INDH 3A23A 4QDGA 5DS2A 1UWGL 4U3XA 1YEHH 3VRIA 4CU6A 1KYFA 5IHUH 3QCWA 2WG3C 1ITCA 2R39A 2LTQB 3QHZH 1PLGH 4PJGE 2PYED 3UBGA 4YHLH 5IB5B 5T1MB 4P48A 3L7FB 4F9LC 1XX9C 4MD0A 4UM8A 2ITCB 1EVUA 4J3OC 4UQ3B 1BLIA 3MLVL 4XGZB 3ZUNC 2NXYB 3FQ1A 3O2WL 3U1SL 4LDLB 3QDME 1IBGH 4MVBD 4PJ7F 3CDCA 1GMEA 4ZXBA 2I9LA 4NUJB 1S5HB 5C0FA 4ZMXA 2VUYA 5B1CA 2HKFL 4JM4L 5C9JB 2VWMK 1XZWA 3ARPA 3OZLA 3UJJH 2JB5H 4HMEA 3F12B 4LVOC 1QFUH 4LP5A 2J4IB 4O2FB 2D3NA 3GM8A 3IF1B 4UILH 4XB8A 1M42A 5GGRY 3UTSD 4NQSB 4YDIL 3FFGL 1FG2B 1BXXA 4NZTL 5DI8A 4TUJB 4WK4B 2GK2A 3LAQA 5D1QE 4MJJA 3EOTH 3NFSH 3NH7L 3QG7L 4MJHA 4P4KC 4J2XA 1DVFB 1EJ6A 2F54A 3QFGA 3TPUB 1R19A 4X0KA 1TTBA 2DV6A 1I8UA 1JGVH 3TYGH 2NW3B 3DJSA 3IPEA 4YNYA 2KB9A 4AYEC 1R34A 5DYOA 4HJEA 2HA1A 5EDSA 5D70L 5KTEL 1EWHA 1MQKL 3FU3A 1A6PA 2RMNA 4NHUA 5E94A 1ZHNA 2WYTA 5CP3H 5GS1B 3C5ZD 3LQZA 3TEXA 4NN5B 2Y7XB 2X2JA 1QABA 4BUHA 2UXTA 3QBTB 2Y69B 2W9DL 5C0CD 4MMZC 2YD8A 4GO9A 2CO3A 2MCMA 4N2KA 2H1PH 4MMXC 4GBXB 4LNRB 2WUCL 1OAZL 2EDNA 3IE4A 4AQTA 2BP5M 1UT2A 2WQ8A 3DJ9A 4AH2B 2WQSA 2KKQA 4LIQL 5IB1A 1UH2A 3UIYA 3IGAB 3L4WA 3KHOA 4L1DA 5ABZA 15C8H 1HOCA 4PJDF 5I76B 1NIBA 3U0WH 3L5XH 2RH0A 3BZEB 1AGCB 2BJMH 2EIZA 4PBDA 2E5EA 4PRBA 4F5CE 1DL7H 4AQEA 1MCCA 4PR5A 4TVPD 3T5WA 1BM3L 3UTQA 3KH4A 3B56A 5AKSA 4QRSA 5HGDA 3HLAB 3MFGB 2F58L 2IWKA 4ODHL 1IEAA 3JUYA 4KI5C 4G1EA 3TZVA 3WNJA 1IU1A 3QQ9D 3LIWB 1OP5K 4OUUB 5DS8B 2G5RA 3T6QC 3W9EB 5JPNB 5IKRA 3RPIA 4YDNA 1YPZE 5CJ8A 5INDA 2DBJA 2EC8A 2ZXAA 3T6ZA