3N8VA

Crystal structure of unoccupied cyclooxygenase-1
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
553
structure length
553
Chain Sequence
PVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Comparison of Cyclooxygenase-1 Crystal Structures: Cross-Talk between Monomers Comprising Cyclooxygenase-1 Homodimers
pubmed doi rcsb
source organism Ovis aries
molecule tags Oxidoreductase
molecule keywords Prostaglandin G/H synthase 1
total genus 162
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 3n8vA02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3n8vA01
1HAFA 2BZ6L 4OTJA 3U7UG 4MMYB 3KQBL 3LTGD 3LN0A 2PUQL 2Y5HL 4LORA 5JB9E 4NA9L 1K37A 1EBVA 1IGZA 2BQWA 3Q9KA 1IVOC 4XBMA 1DNWC 3KRKA 4IG5A 4KSZA 1CVWL 4NT3A 2BOHA 5GLSA 3NTGA 3R4XA 1U67A 2GJMA 1FFMA 1CCFA 4COXA 2NPRA 5JBAE 1TLEA 3NT1A 2FLGA 1LPKA 3R55A 1EMNA 2BMGA 3CS7L 1MQ5L 1MHLC 4X8TL 3N8WA 3KRQA 2NQXA 1FSBA 2OYEP 1Q4GA 4HHRA 3QL6A 2Y82B 2YGPA 3FNLA 3TK6B 2H9EL 5IKVA 2R5LA 5L2YL 1LQDA 1P9JA 3ZYIB 3LAQA 1NFYB 1F0SB 5FF1A 5KN5C 3C9AC 2PHBB 5L2ZL 4CUDA 4QJQA 1IQKL 1JL9A 2KB9A 5COXA 2W3KB 4FM5A 4CSYA 2W3IB 4CUFA 4KVJA 4OTYA 1CEJA 4C1MC 2Y5GL 1KLJL 4Y55A 3LIWB 4LMFA 3POYA 3GCJA 3F6UL 1MQ6L 3ASIA 2BOUA 4Y7AB 1G1QA 3RR3A 3CA7A 3QH0A 4NG9L 2IPSA 1HREA 4BTIA 5I46L 3ZS1C 3CFWA 2VVCK 3N8WB 2XC4L 5JVYA 2J95B 2W26B 3HO5A 2BQ6A 2TGFA 3ERHA 3UBAA 1ZAQA 4MMXB 3LC3B 1DQBA 5F1AA 5IKQA 1CXPC 3N8VA 4KVKA 2WYGB 1GK5A 4BXWA 3HPTA 5JBCE 2P16L 3IITB 1CCVA 1URKA 2K2TA 1IQJL 2ADXA 2EI6B 1COUA 2WG3C 4D90A 1EPHA 1OB1C 1XDTR 1I0UA 4Z0LA 2W2QE 2MHPA 4XL1A 3GISX 1DIYA 5JW1A 3OLTA 2QRBA 1HT5A 2K2SB 1TPGA 1PFXL 2P95L 2XBVL 1PRHA 2W86A 1EPIA 1YGCL 1NFWB 2P93L 1BF9A 1IP0A 3NYHA 3HS6A 2GD4A 2W2OE 3Q3KB 1ATEA 3ENSA 1ATAA 1LPZA 1NPEB 2WFXB 4KVLA 1SZBA 2BOXA 2JKHL 3IJEB 1CQEA 3KQCL 3V64C 3V65B 5K0HB 2YGOA 3NAKA 4QYQA 1EPJA 3KQEL 4JZFL 3GCKA 3P5BL 2WPJE 2OYUP 2CJIB 5CKNA 5JBBE 3GCLA 1EAIC 3QMOA 5FIWC 2D1JB 3EGFA 4TGFA 1PGEA 2WYJB 1HAEA 4X8SL 3ZYGA 3TK5B 1X7AL 1W7XL 3V6QA 3TH3L 1JBUL 1MOXC 5CKMA 2QPKA 2P3TA 3BT1A 1G1RA 2WPIE 3CENL 2WPME 3M36L 3R05A 1CVUA 3LC5B 4Y7BB 4C16A 5GH0A 5FDQA 3HO4A 1HRFA 1G2LB 4YT7L 4RS0A 2J34B 3LTFB 2VWNL 3PGHA 3FCSB 5F19A 2FLRL 3GCWE 1APQA 5IKTA 4Y76B 2I9BA 4AQTA 3TBDA 1V3XB 1WHEA 2Z5ZA 4BDWA 5IKRA 2F9BL 1FAKL 2Y80B 4MMZB 1CX2A 4RRWA 2RHPA 1WU1B 5B72A 2FD6A 2G00L 1XKAL 2W2ME 2PUMA 1O5DL 1UZKA 2UWLB 3BXIA 3K9XA 3KK6A 2KL7A 4YT6L 1RFNB 1N7DA 2B7DL 4BXSA 2WFTA 3N8FA 3N8XA 3ERIA 3OGWA 1KSNB 2O86A 4YZUB 1NFXB 2BO2A 4D0EA 2P3FN 1IQFL 2P3FL 1LPGA 2EFBA 4O02B 1UZJA 3SOQA 1F0RB 4D0FA 3KL6B 4JYVL 6COXA 1Z6EL 3N8YB 1EGFA 2VVVL 2OJVA 4A7IA 5JB8E 3NIUA 4LJJA 1KLOA 2XC0L 1EQHA 1D5LC 4Z0KB 1XFEA 1IOEL 5L30L 1HCGB 3H5CB 4BDXA 1PTHA 1K36A 1L3YA 3TGFA 1NT0A 3KQDL 3RKEA 2Y81B 4E1GA 1F7MA 1FJSL 2J94B 1DNUC 1APOA 1FE2A 1KLIL 4NGAL 1DX5I 3QCWA 1J9CL 1UZPA 1YUKB 2P94L 2Y38A 1HZ8A 3MQEA 5KIRA 1EPGA 3HS5A 1N1IA 4HHSA 1IGXA 3R5OA 1KIGL 2P3UA 2VJ3A 4JZEL 4Y79B 1D2VC 1ATBA 3NJPC 5CISA 2BOKL 3DEMA 2EI7B 1A3PA 4XLWA 1EQGA 4RRZA 2Y5FL 1NFUB 2VWOL 3TZIA 2UWPB 1G2MB 5EGMB 2VH0B 3N8YA 3I6NA 2J38B 2W2PE 2EHAA 4G1MB 2IKCA 4Z6AL 3LN1A 1U8CB 3NTBA 2EI8B 1LMJA 1PXXA 4DL1C 4ZHAB 1D7WC 1EZQB 2MGRA 3GCXE 1IQHL 1XKBA 2XBWL 1FF7A 1NQLB 2PT3A 2Y7ZB 4PNXA 3FAQA 5CKQA 1YUGA 1G1SA 3GC1A 3HS7A 2P28B 2Y7XB 4ZAEB 3F9PC 2VWMK 3SOVA 2RNLA 4Y71B 1IQLL 1M1XB 4CUEA 3M37L 1HT8A 4MSFA 3PY4A 2QQTA 2BQ7A 3SOBB 3FBYA 2XBYL 2DDUA 2MGPA 3N8ZA 2XC5L 1IQNL 2FZZL 2P26A 4BTTA 1C5MF 4PH9A 1EMOA 4N7AA 1IQGL 1P0SL 2WPLE 1HX2A 4O1ZA 2WPKE 2VH6B 5JVZA 1YO8A 3ZS0C 3BPSE 1ADXA 2J2UB 2WPHE 1FAXL 3FFGL 3QF1A 1UZQA 4Y6DB 4ZH8B 3F1SB 1B9WA 1DVAL 3Q7DA 3R5QA 3ZYJB 3HO3A 1JV2B 2PR3B 1MYPC 4JYUL 1F7EA 1IJQA 3OLUA 3KCGL 5E8DA 4ZXXL 2M74A 1DDXA 4M11A 1NZIA 4GM7A 1AUTL 4M10A 1TOZA 4ISIL 3TGYA 2W2NE 3SXVA 4ISHL 2XBXL 4ZXYL 4X8VL 1G1TA 2E9EA 3SW2A 2J4IB 2I9AA 2RA0L 1L5GB 1QFKL 1YUFA 2AYLA 1Z6CA 2VVUL 2FLBL 1W8BL 3U73A 2VWLL 1IQML 2WG4B 2KV4A 3ELAL 4BTUA 4GN6A 2UWOB 4RRYA 1ATDA 4NJBA 3S4FA 1WHFA 4JZDL 3BT2A 1IQEL 2Q1JB 1IOXA 1HJ7A 4RUTA 4OEKA 4X8UL 3MDLA 5HPWA 4RRXA 1IQIL
chains in the Genus database with same CATH superfamily
1HAFA 2BZ6L 2KNIA 4OTJA 3U7UG 4MMYB 3KQBL 3LTGD 3LN0A 2PUQL 2Y5HL 4LORA 5JB9E 4NA9L 1K37A 1EBVA 1IGZA 2BQWA 3Q9KA 1IVOC 4XBMA 1DNWC 3KRKA 4IG5A 4KSZA 1CVWL 4NT3A 2BOHA 5GLSA 3NTGA 3R4XA 1U67A 2GJMA 1FFMA 1CCFA 4COXA 2NPRA 5JBAE 1TLEA 3NT1A 2FLGA 1LPKA 3R55A 1EMNA 2BMGA 3CS7L 1MQ5L 1MHLC 4X8TL 3N8WA 3KRQA 2NQXA 1FSBA 2OYEP 1Q4GA 4HHRA 3QL6A 2Y82B 2YGPA 3FNLA 3TK6B 2H9EL 5IKVA 2R5LA 5L2YL 1LQDA 1P9JA 3ZYIB 3LAQA 1NFYB 1F0SB 2WZPP 5FF1A 5KN5C 3C9AC 2PHBB 5L2ZL 1V1HA 4CUDA 4QJQA 1IQKL 1JL9A 2KB9A 5COXA 2W3KB 4FM5A 4CSYA 2W3IB 4CUFA 4KVJA 4OTYA 1CEJA 4C1MC 2Y5GL 2BT7A 1KLJL 4Y55A 3LIWB 4LMFA 3POYA 3GCJA 3F6UL 1MQ6L 3ASIA 2BOUA 4Y7AB 1G1QA 3RR3A 3CA7A 3QH0A 4NG9L 2IPSA 1HREA 4BTIA 5I46L 3ZS1C 3CFWA 2VVCK 3N8WB 2XC4L 5JVYA 2J95B 4A94C 2W26B 3HO5A 2BQ6A 2TGFA 3ERHA 3UBAA 1ZAQA 4MMXB 3LC3B 1DQBA 5F1AA 5IKQA 1CXPC 3N8VA 4KVKA 2WYGB 1GK5A 4BXWA 3HPTA 1QIUA 2P16L 3IITB 5JBCE 1CCVA 1URKA 2K2TA 1IQJL 2ADXA 2EI6B 1COUA 2WG3C 4D90A 1EPHA 1OB1C 1XDTR 1I0UA 4Z0LA 2W2QE 2MHPA 4XL1A 3GISX 1DIYA 5JW1A 3OLTA 2QRBA 1HT5A 2K2SB 4GU4A 1TPGA 1PFXL 2P95L 2XBVL 1PRHA 2W86A 1EPIA 1YGCL 1NFWB 2P93L 1BF9A 1IP0A 3NYHA 3HS6A 2GD4A 2W2OE 3Q3KB 1ATEA 3ENSA 1ATAA 1LPZA 1NPEB 2WFXB 4KVLA 1SZBA 2BOXA 2JKHL 3IJEB 1CQEA 3KQCL 3V64C 3V65B 5K0HB 2YGOA 3NAKA 4QYQA 1EPJA 3KQEL 4JZFL 3GCKA 3P5BL 2WPJE 2OYUP 2CJIB 5CKNA 5JBBE 3GCLA 1EAIC 3QMOA 5FIWC 2D1JB 3EGFA 4TGFA 1PGEA 2WYJB 1HAEA 4X8SL 2YGQA 3ZYGA 3TK5B 1X7AL 1W7XL 3V6QA 3TH3L 1JBUL 1MOXC 5CKMA 2QPKA 2P3TA 2VRSA 3BT1A 1LK9A 1G1RA 2WPIE 3CENL 2WPME 3M36L 3R05A 1CVUA 3LC5B 4Y7BB 4C16A 5GH0A 5FDQA 3HO4A 1HRFA 1G2LB 4YT7L 4RS0A 2J34B 3LTFB 2VWNL 3PGHA 3FCSB 5F19A 2FLRL 3GCWE 1APQA 5IKTA 4Y76B 2I9BA 4AQTA 3TBDA 1V3XB 1WHEA 2Z5ZA 4BDWA 5IKRA 2F9BL 1FAKL 2Y80B 4MMZB 1CX2A 4RRWA 2RHPA 1WU1B 5B72A 2FD6A 2G00L 1XKAL 2W2ME 2PUMA 1O5DL 1UZKA 1V1IA 2UWLB 3BXIA 3K9XA 3KK6A 2KL7A 4YT6L 1RFNB 1N7DA 2B7DL 4BXSA 2WFTA 3N8FA 3N8XA 1KKEA 3ERIA 3OGWA 1KSNB 2O86A 4YZUB 1NFXB 2BO2A 4D0EA 2P3FN 1IQFL 2P3FL 1LPGA 2EFBA 4O02B 1UZJA 3SOQA 1F0RB 4D0FA 3KL6B 4JYVL 6COXA 1Z6EL 3N8YB 1EGFA 2VVVL 2OJVA 4A7IA 5JB8E 3NIUA 4LJJA 1KLOA 2XC0L 1EQHA 1D5LC 4Z0KB 1XFEA 2JJLA 1IOEL 5L30L 2BSFA 1HCGB 3H5CB 4BDXA 1PTHA 1K36A 1L3YA 3TGFA 1NT0A 3KQDL 3RKEA 2Y81B 4E1GA 1F7MA 1FJSL 2J94B 1DNUC 1APOA 1FE2A 1KLIL 4NGAL 1DX5I 3QCWA 1J9CL 1UZPA 1YUKB 2P94L 2Y38A 1HZ8A 3MQEA 5KIRA 2BT8A 1EPGA 3HS5A 1N1IA 4HHSA 1IGXA 3R5OA 1KIGL 2P3UA 2VJ3A 4JZEL 4Y79B 1D2VC 1ATBA 3NJPC 5CISA 2BOKL 3DEMA 2EI7B 1A3PA 4XLWA 1EQGA 4RRZA 2Y5FL 1NFUB 2VWOL 3TZIA 2UWPB 1G2MB 5EGMB 2VH0B 3N8YA 3I6NA 2J38B 2W2PE 2EHAA 4G1MB 2IKCA 4Z6AL 3LN1A 1U8CB 3NTBA 2EI8B 1LMJA 1PXXA 4DL1C 4ZHAB 1D7WC 1EZQB 2MGRA 3GCXE 1IQHL 1XKBA 2XBWL 1FF7A 1NQLB 2PT3A 2Y7ZB 4PNXA 3FAQA 5CKQA 1YUGA 1G1SA 3GC1A 3HS7A 2P28B 2Y7XB 4ZAEB 3F9PC 2VWMK 3SOVA 2RNLA 4Y71B 1IQLL 1M1XB 4CUEA 3M37L 1HT8A 4MSFA 4GU3A 3PY4A 2QQTA 2BQ7A 3SOBB 3FBYA 2XBYL 2DDUA 2MGPA 3N8ZA 2XC5L 1IQNL 2FZZL 2P26A 4BTTA 1C5MF 4PH9A 1EMOA 4N7AA 1IQGL 1P0SL 2WPLE 1HX2A 4O1ZA 2WPKE 2VH6B 5JVZA 3S6XA 1YO8A 3ZS0C 3BPSE 1ADXA 2J2UB 2WPHE 1FAXL 3FFGL 3QF1A 1UZQA 4Y6DB 4ZH8B 3F1SB 1B9WA 1DVAL 2H9EC 3Q7DA 3R5QA 3ZYJB 3HO3A 1JV2B 2PR3B 1MYPC 4JYUL 1F7EA 1IJQA 3OLUA 3KCGL 5E8DA 4ZXXL 2M74A 1DDXA 2HORA 4M11A 1NZIA 4GM7A 1AUTL 4M10A 1TOZA 4ISIL 3TGYA 2W2NE 3SXVA 4ISHL 2XBXL 4ZXYL 4X8VL 1G1TA 2E9EA 3SW2A 2J4IB 2I9AA 2RA0L 1L5GB 1QFKL 1YUFA 2AYLA 1Z6CA 2VVUL 2FLBL 1W8BL 2HOXA 3U73A 2VWLL 1IQML 2WG4B 2KV4A 3ELAL 4BTUA 4GN6A 2UWOB 4RRYA 1ATDA 4NJBA 3S4FA 1WHFA 4JZDL 3BT2A 1IQEL 2Q1JB 1IOXA 1HJ7A 4RUTA 4OEKA 4X8UL 1LMMA 3MDLA 5HPWA 4RRXA 1IQIL
chains in the Genus database with same CATH topology
1HAFA 2BZ6L 2KNIA 4OTJA 3U7UG 4MMYB 3KQBL 3LTGD 3LN0A 2PUQL 2Y5HL 4LORA 5JB9E 4NA9L 1K37A 1EBVA 1IGZA 2BQWA 3Q9KA 1IVOC 4XBMA 1DNWC 3KRKA 4IG5A 4KSZA 1CVWL 4NT3A 2BOHA 5GLSA 3NTGA 3R4XA 1U67A 2GJMA 1FFMA 1CCFA 4COXA 2NPRA 5JBAE 1TLEA 3NT1A 2FLGA 1LPKA 3R55A 1EMNA 2BMGA 3CS7L 1MQ5L 1MHLC 4X8TL 3N8WA 3KRQA 2NQXA 1FSBA 2OYEP 1Q4GA 4HHRA 3QL6A 2Y82B 2YGPA 3FNLA 3TK6B 2H9EL 5IKVA 2R5LA 5L2YL 1LQDA 1P9JA 3ZYIB 3LAQA 1NFYB 1F0SB 2WZPP 5FF1A 5KN5C 3C9AC 2PHBB 5L2ZL 4CUDA 4QJQA 1IQKL 1JL9A 2KB9A 5COXA 2W3KB 4FM5A 4CSYA 2W3IB 4CUFA 4KVJA 4OTYA 1CEJA 4C1MC 2Y5GL 1KLJL 4Y55A 3LIWB 4LMFA 3POYA 3GCJA 3F6UL 1MQ6L 3ASIA 2BOUA 4Y7AB 1G1QA 3RR3A 3CA7A 3QH0A 4NG9L 2IPSA 1HREA 4BTIA 5I46L 3ZS1C 3CFWA 2VVCK 3N8WB 2XC4L 5JVYA 2J95B 4A94C 2W26B 3HO5A 2BQ6A 2TGFA 3ERHA 3UBAA 1ZAQA 4MMXB 3LC3B 1DQBA 5F1AA 5IKQA 1CXPC 3N8VA 4KVKA 2WYGB 1GK5A 4BXWA 3HPTA 5JBCE 2P16L 3IITB 1CCVA 1URKA 2K2TA 1IQJL 2ADXA 2EI6B 1COUA 2WG3C 4D90A 1EPHA 1OB1C 1XDTR 1I0UA 4Z0LA 2W2QE 2MHPA 4XL1A 3GISX 1DIYA 5JW1A 3OLTA 2QRBA 1HT5A 2K2SB 1TPGA 1PFXL 2P95L 2XBVL 1PRHA 2W86A 1EPIA 1YGCL 1NFWB 2P93L 1BF9A 1IP0A 3NYHA 3HS6A 2GD4A 2W2OE 3Q3KB 1ATEA 3ENSA 1ATAA 1LPZA 1NPEB 2WFXB 4KVLA 1SZBA 2BOXA 2JKHL 3IJEB 1CQEA 3KQCL 3V64C 3V65B 5K0HB 2YGOA 3NAKA 4QYQA 1EPJA 3KQEL 4JZFL 3GCKA 3P5BL 2WPJE 2OYUP 2CJIB 5CKNA 5JBBE 3GCLA 1EAIC 3QMOA 5FIWC 2D1JB 3EGFA 4TGFA 1PGEA 2WYJB 1HAEA 4X8SL 2YGQA 3ZYGA 3TK5B 1X7AL 1W7XL 3V6QA 3TH3L 1JBUL 1MOXC 5CKMA 2QPKA 2P3TA 3BT1A 1G1RA 2WPIE 3CENL 2WPME 3M36L 3R05A 1CVUA 3LC5B 4Y7BB 4C16A 5GH0A 5FDQA 3HO4A 1HRFA 1G2LB 4YT7L 4RS0A 2J34B 3LTFB 2VWNL 3PGHA 3FCSB 5F19A 2FLRL 3GCWE 1APQA 5IKTA 4Y76B 2I9BA 4AQTA 3TBDA 1V3XB 1WHEA 2Z5ZA 4BDWA 5IKRA 2F9BL 1FAKL 2Y80B 4MMZB 1CX2A 4RRWA 2RHPA 1WU1B 5B72A 2FD6A 2G00L 1XKAL 2W2ME 2PUMA 1O5DL 1UZKA 2UWLB 3BXIA 3K9XA 3KK6A 2KL7A 4YT6L 1RFNB 1N7DA 2B7DL 4BXSA 2WFTA 3N8FA 3N8XA 3ERIA 3OGWA 1KSNB 2O86A 4YZUB 1NFXB 2BO2A 4D0EA 2P3FN 1IQFL 2P3FL 1LPGA 2EFBA 4O02B 1UZJA 3SOQA 1F0RB 4D0FA 3KL6B 4JYVL 6COXA 1Z6EL 3N8YB 1EGFA 2VVVL 2OJVA 4A7IA 5JB8E 3NIUA 4LJJA 1KLOA 2XC0L 1EQHA 1D5LC 4Z0KB 1XFEA 1IOEL 5L30L 1HCGB 3H5CB 4BDXA 1PTHA 1K36A 1L3YA 3TGFA 1NT0A 3KQDL 3RKEA 2Y81B 4E1GA 1F7MA 1FJSL 2J94B 1DNUC 1APOA 1FE2A 1KLIL 4NGAL 1DX5I 3QCWA 1J9CL 1UZPA 1YUKB 2P94L 2Y38A 1HZ8A 3MQEA 5KIRA 1EPGA 3HS5A 1N1IA 4HHSA 1IGXA 3R5OA 1KIGL 2P3UA 2VJ3A 4JZEL 4Y79B 1D2VC 1ATBA 3NJPC 5CISA 2BOKL 3DEMA 2EI7B 1A3PA 4XLWA 1EQGA 4RRZA 2Y5FL 1NFUB 2VWOL 3TZIA 2UWPB 1G2MB 5EGMB 2VH0B 3N8YA 3I6NA 2J38B 2W2PE 2EHAA 4G1MB 2IKCA 4Z6AL 3LN1A 1U8CB 3NTBA 2EI8B 1LMJA 1PXXA 4DL1C 4ZHAB 1D7WC 1EZQB 2MGRA 3GCXE 1IQHL 1XKBA 2XBWL 1FF7A 1NQLB 2PT3A 2Y7ZB 4PNXA 3FAQA 5CKQA 1YUGA 1G1SA 3GC1A 3HS7A 2P28B 2Y7XB 4ZAEB 3F9PC 2VWMK 3SOVA 2RNLA 4Y71B 1IQLL 1M1XB 4CUEA 3M37L 1HT8A 4MSFA 3PY4A 2QQTA 2BQ7A 3SOBB 3FBYA 2XBYL 2DDUA 2MGPA 3N8ZA 2XC5L 1IQNL 2FZZL 2P26A 4BTTA 1C5MF 4PH9A 1EMOA 4N7AA 1IQGL 1P0SL 2WPLE 1HX2A 4O1ZA 2WPKE 2VH6B 5JVZA 3S6XA 1YO8A 3ZS0C 3BPSE 1ADXA 2J2UB 2WPHE 1FAXL 3FFGL 3QF1A 1UZQA 4Y6DB 4ZH8B 3F1SB 1B9WA 1DVAL 2H9EC 3Q7DA 3R5QA 3ZYJB 3HO3A 1JV2B 2PR3B 1MYPC 4JYUL 1F7EA 1IJQA 3OLUA 3KCGL 5E8DA 4ZXXL 2M74A 1DDXA 4M11A 1NZIA 4GM7A 1AUTL 4M10A 1TOZA 4ISIL 3TGYA 2W2NE 3SXVA 4ISHL 2XBXL 4ZXYL 4X8VL 1G1TA 2E9EA 3SW2A 2J4IB 2I9AA 2RA0L 1L5GB 1QFKL 1YUFA 2AYLA 1Z6CA 2VVUL 2FLBL 1W8BL 3U73A 2VWLL 1IQML 2WG4B 2KV4A 3ELAL 4BTUA 4GN6A 2UWOB 4RRYA 1ATDA 4NJBA 3S4FA 1WHFA 4JZDL 3BT2A 1IQEL 2Q1JB 1IOXA 1HJ7A 4RUTA 4OEKA 4X8UL 1LMMA 3MDLA 5HPWA 4RRXA 1IQIL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HAF A;  2BZ6 L;  4OTJ A;  3U7U G;  4MMY B;  3KQB L;  3LTG D;  3LN0 A;  2PUQ L;  2Y5H L;  4LOR A;  5JB9 E;  4NA9 L;  1K37 A;  1EBV A;  1IGZ A;  2BQW A;  3Q9K A;  1IVO C;  4XBM A;  1DNW C;  3KRK A;  4IG5 A;  4KSZ A;  1CVW L;  4NT3 A;  2BOH A;  5GLS A;  3NTG A;  3R4X A;  1U67 A;  2GJM A;  1FFM A;  1CCF A;  4COX A;  2NPR A;  5JBA E;  1TLE A;  3NT1 A;  2FLG A;  1LPK A;  3R55 A;  1EMN A;  2BMG A;  3CS7 L;  1MQ5 L;  1MHL C;  4X8T L;  3N8W A;  3KRQ A;  2NQX A;  1FSB A;  2OYE P;  1Q4G A;  4HHR A;  3QL6 A;  2Y82 B;  2YGP A;  3FNL A;  3TK6 B;  2H9E L;  5IKV A;  2R5L A;  5L2Y L;  1LQD A;  1P9J A;  3ZYI B;  3LAQ A;  1NFY B;  1F0S B;  5FF1 A;  5KN5 C;  3C9A C;  2PHB B;  5L2Z L;  4CUD A;  4QJQ A;  1IQK L;  1JL9 A;  2KB9 A;  5COX A;  2W3K B;  4FM5 A;  4CSY A;  2W3I B;  4CUF A;  4KVJ A;  4OTY A;  1CEJ A;  4C1M C;  2Y5G L;  1KLJ L;  4Y55 A;  3LIW B;  4LMF A;  3POY A;  3GCJ A;  3F6U L;  1MQ6 L;  3ASI A;  2BOU A;  4Y7A B;  1G1Q A;  3RR3 A;  3CA7 A;  3QH0 A;  4NG9 L;  2IPS A;  1HRE A;  4BTI A;  5I46 L;  3ZS1 C;  3CFW A;  2VVC K;  3N8W B;  2XC4 L;  5JVY A;  2J95 B;  2W26 B;  3HO5 A;  2BQ6 A;  2TGF A;  3ERH A;  3UBA A;  1ZAQ A;  4MMX B;  3LC3 B;  1DQB A;  5F1A A;  5IKQ A;  1CXP C;  3N8V A;  4KVK A;  2WYG B;  1GK5 A;  4BXW A;  3HPT A;  5JBC E;  2P16 L;  3IIT B;  1CCV A;  1URK A;  2K2T A;  1IQJ L;  2ADX A;  2EI6 B;  1COU A;  2WG3 C;  4D90 A;  1EPH A;  1OB1 C;  1XDT R;  1I0U A;  4Z0L A;  2W2Q E;  2MHP A;  4XL1 A;  3GIS X;  1DIY A;  5JW1 A;  3OLT A;  2QRB A;  1HT5 A;  2K2S B;  1TPG A;  1PFX L;  2P95 L;  2XBV L;  1PRH A;  2W86 A;  1EPI A;  1YGC L;  1NFW B;  2P93 L;  1BF9 A;  1IP0 A;  3NYH A;  3HS6 A;  2GD4 A;  2W2O E;  3Q3K B;  1ATE A;  3ENS A;  1ATA A;  1LPZ A;  1NPE B;  2WFX B;  4KVL A;  1SZB A;  2BOX A;  2JKH L;  3IJE B;  1CQE A;  3KQC L;  3V64 C;  3V65 B;  5K0H B;  2YGO A;  3NAK A;  4QYQ A;  1EPJ A;  3KQE L;  4JZF L;  3GCK A;  3P5B L;  2WPJ E;  2OYU P;  2CJI B;  5CKN A;  5JBB E;  3GCL A;  1EAI C;  3QMO A;  5FIW C;  2D1J B;  3EGF A;  4TGF A;  1PGE A;  2WYJ B;  1HAE A;  4X8S L;  3ZYG A;  3TK5 B;  1X7A L;  1W7X L;  3V6Q A;  3TH3 L;  1JBU L;  1MOX C;  5CKM A;  2QPK A;  2P3T A;  3BT1 A;  1G1R A;  2WPI E;  3CEN L;  2WPM E;  3M36 L;  3R05 A;  1CVU A;  3LC5 B;  4Y7B B;  4C16 A;  5GH0 A;  5FDQ A;  3HO4 A;  1HRF A;  1G2L B;  4YT7 L;  4RS0 A;  2J34 B;  3LTF B;  2VWN L;  3PGH A;  3FCS B;  5F19 A;  2FLR L;  3GCW E;  1APQ A;  5IKT A;  4Y76 B;  2I9B A;  4AQT A;  3TBD A;  1V3X B;  1WHE A;  2Z5Z A;  4BDW A;  5IKR A;  2F9B L;  1FAK L;  2Y80 B;  4MMZ B;  1CX2 A;  4RRW A;  2RHP A;  1WU1 B;  5B72 A;  2FD6 A;  2G00 L;  1XKA L;  2W2M E;  2PUM A;  1O5D L;  1UZK A;  2UWL B;  3BXI A;  3K9X A;  3KK6 A;  2KL7 A;  4YT6 L;  1RFN B;  1N7D A;  2B7D L;  4BXS A;  2WFT A;  3N8F A;  3N8X A;  3ERI A;  3OGW A;  1KSN B;  2O86 A;  4YZU B;  1NFX B;  2BO2 A;  4D0E A;  2P3F N;  1IQF L;  2P3F L;  1LPG A;  2EFB A;  4O02 B;  1UZJ A;  3SOQ A;  1F0R B;  4D0F A;  3KL6 B;  4JYV L;  6COX A;  1Z6E L;  3N8Y B;  1EGF A;  2VVV L;  2OJV A;  4A7I A;  5JB8 E;  3NIU A;  4LJJ A;  1KLO A;  2XC0 L;  1EQH A;  1D5L C;  4Z0K B;  1XFE A;  1IOE L;  5L30 L;  1HCG B;  3H5C B;  4BDX A;  1PTH A;  1K36 A;  1L3Y A;  3TGF A;  1NT0 A;  3KQD L;  3RKE A;  2Y81 B;  4E1G A;  1F7M A;  1FJS L;  2J94 B;  1DNU C;  1APO A;  1FE2 A;  1KLI L;  4NGA L;  1DX5 I;  3QCW A;  1J9C L;  1UZP A;  1YUK B;  2P94 L;  2Y38 A;  1HZ8 A;  3MQE A;  5KIR A;  1EPG A;  3HS5 A;  1N1I A;  4HHS A;  1IGX A;  3R5O A;  1KIG L;  2P3U A;  2VJ3 A;  4JZE L;  4Y79 B;  1D2V C;  1ATB A;  3NJP C;  5CIS A;  2BOK L;  3DEM A;  2EI7 B;  1A3P A;  4XLW A;  1EQG A;  4RRZ A;  2Y5F L;  1NFU B;  2VWO L;  3TZI A;  2UWP B;  1G2M B;  5EGM B;  2VH0 B;  3N8Y A;  3I6N A;  2J38 B;  2W2P E;  2EHA A;  4G1M B;  2IKC A;  4Z6A L;  3LN1 A;  1U8C B;  3NTB A;  2EI8 B;  1LMJ A;  1PXX A;  4DL1 C;  4ZHA B;  1D7W C;  1EZQ B;  2MGR A;  3GCX E;  1IQH L;  1XKB A;  2XBW L;  1FF7 A;  1NQL B;  2PT3 A;  2Y7Z B;  4PNX A;  3FAQ A;  5CKQ A;  1YUG A;  1G1S A;  3GC1 A;  3HS7 A;  2P28 B;  2Y7X B;  4ZAE B;  3F9P C;  2VWM K;  3SOV A;  2RNL A;  4Y71 B;  1IQL L;  1M1X B;  4CUE A;  3M37 L;  1HT8 A;  4MSF A;  3PY4 A;  2QQT A;  2BQ7 A;  3SOB B;  3FBY A;  2XBY L;  2DDU A;  2MGP A;  3N8Z A;  2XC5 L;  1IQN L;  2FZZ L;  2P26 A;  4BTT A;  1C5M F;  4PH9 A;  1EMO A;  4N7A A;  1IQG L;  1P0S L;  2WPL E;  1HX2 A;  4O1Z A;  2WPK E;  2VH6 B;  5JVZ A;  1YO8 A;  3ZS0 C;  3BPS E;  1ADX A;  2J2U B;  2WPH E;  1FAX L;  3FFG L;  3QF1 A;  1UZQ A;  4Y6D B;  4ZH8 B;  3F1S B;  1B9W A;  1DVA L;  3Q7D A;  3R5Q A;  3ZYJ B;  3HO3 A;  1JV2 B;  2PR3 B;  1MYP C;  4JYU L;  1F7E A;  1IJQ A;  3OLU A;  3KCG L;  5E8D A;  4ZXX L;  2M74 A;  1DDX A;  4M11 A;  1NZI A;  4GM7 A;  1AUT L;  4M10 A;  1TOZ A;  4ISI L;  3TGY A;  2W2N E;  3SXV A;  4ISH L;  2XBX L;  4ZXY L;  4X8V L;  1G1T A;  2E9E A;  3SW2 A;  2J4I B;  2I9A A;  2RA0 L;  1L5G B;  1QFK L;  1YUF A;  2AYL A;  1Z6C A;  2VVU L;  2FLB L;  1W8B L;  3U73 A;  2VWL L;  1IQM L;  2WG4 B;  2KV4 A;  3ELA L;  4BTU A;  4GN6 A;  2UWO B;  4RRY A;  1ATD A;  4NJB A;  3S4F A;  1WHF A;  4JZD L;  3BT2 A;  1IQE L;  2Q1J B;  1IOX A;  1HJ7 A;  4RUT A;  4OEK A;  4X8U L;  3MDL A;  5HPW A;  4RRX A;  1IQI L; 
#chains in the Genus database with same CATH topology
 1HAF A;  2BZ6 L;  2KNI A;  4OTJ A;  3U7U G;  4MMY B;  3KQB L;  3LTG D;  3LN0 A;  2PUQ L;  2Y5H L;  4LOR A;  5JB9 E;  4NA9 L;  1K37 A;  1EBV A;  1IGZ A;  2BQW A;  3Q9K A;  1IVO C;  4XBM A;  1DNW C;  3KRK A;  4IG5 A;  4KSZ A;  1CVW L;  4NT3 A;  2BOH A;  5GLS A;  3NTG A;  3R4X A;  1U67 A;  2GJM A;  1FFM A;  1CCF A;  4COX A;  2NPR A;  5JBA E;  1TLE A;  3NT1 A;  2FLG A;  1LPK A;  3R55 A;  1EMN A;  2BMG A;  3CS7 L;  1MQ5 L;  1MHL C;  4X8T L;  3N8W A;  3KRQ A;  2NQX A;  1FSB A;  2OYE P;  1Q4G A;  4HHR A;  3QL6 A;  2Y82 B;  2YGP A;  3FNL A;  3TK6 B;  2H9E L;  5IKV A;  2R5L A;  5L2Y L;  1LQD A;  1P9J A;  3ZYI B;  3LAQ A;  1NFY B;  1F0S B;  2WZP P;  5FF1 A;  5KN5 C;  3C9A C;  2PHB B;  5L2Z L;  1V1H A;  4CUD A;  4QJQ A;  1IQK L;  1JL9 A;  2KB9 A;  5COX A;  2W3K B;  4FM5 A;  4CSY A;  2W3I B;  4CUF A;  4KVJ A;  4OTY A;  1CEJ A;  4C1M C;  2Y5G L;  2BT7 A;  1KLJ L;  4Y55 A;  3LIW B;  4LMF A;  3POY A;  3GCJ A;  3F6U L;  1MQ6 L;  3ASI A;  2BOU A;  4Y7A B;  1G1Q A;  3RR3 A;  3CA7 A;  3QH0 A;  4NG9 L;  2IPS A;  1HRE A;  4BTI A;  5I46 L;  3ZS1 C;  3CFW A;  2VVC K;  3N8W B;  2XC4 L;  5JVY A;  2J95 B;  4A94 C;  2W26 B;  3HO5 A;  2BQ6 A;  2TGF A;  3ERH A;  3UBA A;  1ZAQ A;  4MMX B;  3LC3 B;  1DQB A;  5F1A A;  5IKQ A;  1CXP C;  3N8V A;  4KVK A;  2WYG B;  1GK5 A;  4BXW A;  3HPT A;  1QIU A;  2P16 L;  3IIT B;  5JBC E;  1CCV A;  1URK A;  2K2T A;  1IQJ L;  2ADX A;  2EI6 B;  1COU A;  2WG3 C;  4D90 A;  1EPH A;  1OB1 C;  1XDT R;  1I0U A;  4Z0L A;  2W2Q E;  2MHP A;  4XL1 A;  3GIS X;  1DIY A;  5JW1 A;  3OLT A;  2QRB A;  1HT5 A;  2K2S B;  4GU4 A;  1TPG A;  1PFX L;  2P95 L;  2XBV L;  1PRH A;  2W86 A;  1EPI A;  1YGC L;  1NFW B;  2P93 L;  1BF9 A;  1IP0 A;  3NYH A;  3HS6 A;  2GD4 A;  2W2O E;  3Q3K B;  1ATE A;  3ENS A;  1ATA A;  1LPZ A;  1NPE B;  2WFX B;  4KVL A;  1SZB A;  2BOX A;  2JKH L;  3IJE B;  1CQE A;  3KQC L;  3V64 C;  3V65 B;  5K0H B;  2YGO A;  3NAK A;  4QYQ A;  1EPJ A;  3KQE L;  4JZF L;  3GCK A;  3P5B L;  2WPJ E;  2OYU P;  2CJI B;  5CKN A;  5JBB E;  3GCL A;  1EAI C;  3QMO A;  5FIW C;  2D1J B;  3EGF A;  4TGF A;  1PGE A;  2WYJ B;  1HAE A;  4X8S L;  2YGQ A;  3ZYG A;  3TK5 B;  1X7A L;  1W7X L;  3V6Q A;  3TH3 L;  1JBU L;  1MOX C;  5CKM A;  2QPK A;  2P3T A;  2VRS A;  3BT1 A;  1LK9 A;  1G1R A;  2WPI E;  3CEN L;  2WPM E;  3M36 L;  3R05 A;  1CVU A;  3LC5 B;  4Y7B B;  4C16 A;  5GH0 A;  5FDQ A;  3HO4 A;  1HRF A;  1G2L B;  4YT7 L;  4RS0 A;  2J34 B;  3LTF B;  2VWN L;  3PGH A;  3FCS B;  5F19 A;  2FLR L;  3GCW E;  1APQ A;  5IKT A;  4Y76 B;  2I9B A;  4AQT A;  3TBD A;  1V3X B;  1WHE A;  2Z5Z A;  4BDW A;  5IKR A;  2F9B L;  1FAK L;  2Y80 B;  4MMZ B;  1CX2 A;  4RRW A;  2RHP A;  1WU1 B;  5B72 A;  2FD6 A;  2G00 L;  1XKA L;  2W2M E;  2PUM A;  1O5D L;  1UZK A;  1V1I A;  2UWL B;  3BXI A;  3K9X A;  3KK6 A;  2KL7 A;  4YT6 L;  1RFN B;  1N7D A;  2B7D L;  4BXS A;  2WFT A;  3N8F A;  3N8X A;  1KKE A;  3ERI A;  3OGW A;  1KSN B;  2O86 A;  4YZU B;  1NFX B;  2BO2 A;  4D0E A;  2P3F N;  1IQF L;  2P3F L;  1LPG A;  2EFB A;  4O02 B;  1UZJ A;  3SOQ A;  1F0R B;  4D0F A;  3KL6 B;  4JYV L;  6COX A;  1Z6E L;  3N8Y B;  1EGF A;  2VVV L;  2OJV A;  4A7I A;  5JB8 E;  3NIU A;  4LJJ A;  1KLO A;  2XC0 L;  1EQH A;  1D5L C;  4Z0K B;  1XFE A;  2JJL A;  1IOE L;  5L30 L;  2BSF A;  1HCG B;  3H5C B;  4BDX A;  1PTH A;  1K36 A;  1L3Y A;  3TGF A;  1NT0 A;  3KQD L;  3RKE A;  2Y81 B;  4E1G A;  1F7M A;  1FJS L;  2J94 B;  1DNU C;  1APO A;  1FE2 A;  1KLI L;  4NGA L;  1DX5 I;  3QCW A;  1J9C L;  1UZP A;  1YUK B;  2P94 L;  2Y38 A;  1HZ8 A;  3MQE A;  5KIR A;  2BT8 A;  1EPG A;  3HS5 A;  1N1I A;  4HHS A;  1IGX A;  3R5O A;  1KIG L;  2P3U A;  2VJ3 A;  4JZE L;  4Y79 B;  1D2V C;  1ATB A;  3NJP C;  5CIS A;  2BOK L;  3DEM A;  2EI7 B;  1A3P A;  4XLW A;  1EQG A;  4RRZ A;  2Y5F L;  1NFU B;  2VWO L;  3TZI A;  2UWP B;  1G2M B;  5EGM B;  2VH0 B;  3N8Y A;  3I6N A;  2J38 B;  2W2P E;  2EHA A;  4G1M B;  2IKC A;  4Z6A L;  3LN1 A;  1U8C B;  3NTB A;  2EI8 B;  1LMJ A;  1PXX A;  4DL1 C;  4ZHA B;  1D7W C;  1EZQ B;  2MGR A;  3GCX E;  1IQH L;  1XKB A;  2XBW L;  1FF7 A;  1NQL B;  2PT3 A;  2Y7Z B;  4PNX A;  3FAQ A;  5CKQ A;  1YUG A;  1G1S A;  3GC1 A;  3HS7 A;  2P28 B;  2Y7X B;  4ZAE B;  3F9P C;  2VWM K;  3SOV A;  2RNL A;  4Y71 B;  1IQL L;  1M1X B;  4CUE A;  3M37 L;  1HT8 A;  4MSF A;  4GU3 A;  3PY4 A;  2QQT A;  2BQ7 A;  3SOB B;  3FBY A;  2XBY L;  2DDU A;  2MGP A;  3N8Z A;  2XC5 L;  1IQN L;  2FZZ L;  2P26 A;  4BTT A;  1C5M F;  4PH9 A;  1EMO A;  4N7A A;  1IQG L;  1P0S L;  2WPL E;  1HX2 A;  4O1Z A;  2WPK E;  2VH6 B;  5JVZ A;  3S6X A;  1YO8 A;  3ZS0 C;  3BPS E;  1ADX A;  2J2U B;  2WPH E;  1FAX L;  3FFG L;  3QF1 A;  1UZQ A;  4Y6D B;  4ZH8 B;  3F1S B;  1B9W A;  1DVA L;  2H9E C;  3Q7D A;  3R5Q A;  3ZYJ B;  3HO3 A;  1JV2 B;  2PR3 B;  1MYP C;  4JYU L;  1F7E A;  1IJQ A;  3OLU A;  3KCG L;  5E8D A;  4ZXX L;  2M74 A;  1DDX A;  2HOR A;  4M11 A;  1NZI A;  4GM7 A;  1AUT L;  4M10 A;  1TOZ A;  4ISI L;  3TGY A;  2W2N E;  3SXV A;  4ISH L;  2XBX L;  4ZXY L;  4X8V L;  1G1T A;  2E9E A;  3SW2 A;  2J4I B;  2I9A A;  2RA0 L;  1L5G B;  1QFK L;  1YUF A;  2AYL A;  1Z6C A;  2VVU L;  2FLB L;  1W8B L;  2HOX A;  3U73 A;  2VWL L;  1IQM L;  2WG4 B;  2KV4 A;  3ELA L;  4BTU A;  4GN6 A;  2UWO B;  4RRY A;  1ATD A;  4NJB A;  3S4F A;  1WHF A;  4JZD L;  3BT2 A;  1IQE L;  2Q1J B;  1IOX A;  1HJ7 A;  4RUT A;  4OEK A;  4X8U L;  1LMM A;  3MDL A;  5HPW A;  4RRX A;  1IQI L; 
#chains in the Genus database with same CATH homology
 1HAF A;  2BZ6 L;  2KNI A;  4OTJ A;  3U7U G;  4MMY B;  3KQB L;  3LTG D;  3LN0 A;  2PUQ L;  2Y5H L;  4LOR A;  5JB9 E;  4NA9 L;  1K37 A;  1EBV A;  1IGZ A;  2BQW A;  3Q9K A;  1IVO C;  4XBM A;  1DNW C;  3KRK A;  4IG5 A;  4KSZ A;  1CVW L;  4NT3 A;  2BOH A;  5GLS A;  3NTG A;  3R4X A;  1U67 A;  2GJM A;  1FFM A;  1CCF A;  4COX A;  2NPR A;  5JBA E;  1TLE A;  3NT1 A;  2FLG A;  1LPK A;  3R55 A;  1EMN A;  2BMG A;  3CS7 L;  1MQ5 L;  1MHL C;  4X8T L;  3N8W A;  3KRQ A;  2NQX A;  1FSB A;  2OYE P;  1Q4G A;  4HHR A;  3QL6 A;  2Y82 B;  2YGP A;  3FNL A;  3TK6 B;  2H9E L;  5IKV A;  2R5L A;  5L2Y L;  1LQD A;  1P9J A;  3ZYI B;  3LAQ A;  1NFY B;  1F0S B;  2WZP P;  5FF1 A;  5KN5 C;  3C9A C;  2PHB B;  5L2Z L;  4CUD A;  4QJQ A;  1IQK L;  1JL9 A;  2KB9 A;  5COX A;  2W3K B;  4FM5 A;  4CSY A;  2W3I B;  4CUF A;  4KVJ A;  4OTY A;  1CEJ A;  4C1M C;  2Y5G L;  1KLJ L;  4Y55 A;  3LIW B;  4LMF A;  3POY A;  3GCJ A;  3F6U L;  1MQ6 L;  3ASI A;  2BOU A;  4Y7A B;  1G1Q A;  3RR3 A;  3CA7 A;  3QH0 A;  4NG9 L;  2IPS A;  1HRE A;  4BTI A;  5I46 L;  3ZS1 C;  3CFW A;  2VVC K;  3N8W B;  2XC4 L;  5JVY A;  2J95 B;  4A94 C;  2W26 B;  3HO5 A;  2BQ6 A;  2TGF A;  3ERH A;  3UBA A;  1ZAQ A;  4MMX B;  3LC3 B;  1DQB A;  5F1A A;  5IKQ A;  1CXP C;  3N8V A;  4KVK A;  2WYG B;  1GK5 A;  4BXW A;  3HPT A;  5JBC E;  2P16 L;  3IIT B;  1CCV A;  1URK A;  2K2T A;  1IQJ L;  2ADX A;  2EI6 B;  1COU A;  2WG3 C;  4D90 A;  1EPH A;  1OB1 C;  1XDT R;  1I0U A;  4Z0L A;  2W2Q E;  2MHP A;  4XL1 A;  3GIS X;  1DIY A;  5JW1 A;  3OLT A;  2QRB A;  1HT5 A;  2K2S B;  1TPG A;  1PFX L;  2P95 L;  2XBV L;  1PRH A;  2W86 A;  1EPI A;  1YGC L;  1NFW B;  2P93 L;  1BF9 A;  1IP0 A;  3NYH A;  3HS6 A;  2GD4 A;  2W2O E;  3Q3K B;  1ATE A;  3ENS A;  1ATA A;  1LPZ A;  1NPE B;  2WFX B;  4KVL A;  1SZB A;  2BOX A;  2JKH L;  3IJE B;  1CQE A;  3KQC L;  3V64 C;  3V65 B;  5K0H B;  2YGO A;  3NAK A;  4QYQ A;  1EPJ A;  3KQE L;  4JZF L;  3GCK A;  3P5B L;  2WPJ E;  2OYU P;  2CJI B;  5CKN A;  5JBB E;  3GCL A;  1EAI C;  3QMO A;  5FIW C;  2D1J B;  3EGF A;  4TGF A;  1PGE A;  2WYJ B;  1HAE A;  4X8S L;  2YGQ A;  3ZYG A;  3TK5 B;  1X7A L;  1W7X L;  3V6Q A;  3TH3 L;  1JBU L;  1MOX C;  5CKM A;  2QPK A;  2P3T A;  3BT1 A;  1G1R A;  2WPI E;  3CEN L;  2WPM E;  3M36 L;  3R05 A;  1CVU A;  3LC5 B;  4Y7B B;  4C16 A;  5GH0 A;  5FDQ A;  3HO4 A;  1HRF A;  1G2L B;  4YT7 L;  4RS0 A;  2J34 B;  3LTF B;  2VWN L;  3PGH A;  3FCS B;  5F19 A;  2FLR L;  3GCW E;  1APQ A;  5IKT A;  4Y76 B;  2I9B A;  4AQT A;  3TBD A;  1V3X B;  1WHE A;  2Z5Z A;  4BDW A;  5IKR A;  2F9B L;  1FAK L;  2Y80 B;  4MMZ B;  1CX2 A;  4RRW A;  2RHP A;  1WU1 B;  5B72 A;  2FD6 A;  2G00 L;  1XKA L;  2W2M E;  2PUM A;  1O5D L;  1UZK A;  2UWL B;  3BXI A;  3K9X A;  3KK6 A;  2KL7 A;  4YT6 L;  1RFN B;  1N7D A;  2B7D L;  4BXS A;  2WFT A;  3N8F A;  3N8X A;  3ERI A;  3OGW A;  1KSN B;  2O86 A;  4YZU B;  1NFX B;  2BO2 A;  4D0E A;  2P3F N;  1IQF L;  2P3F L;  1LPG A;  2EFB A;  4O02 B;  1UZJ A;  3SOQ A;  1F0R B;  4D0F A;  3KL6 B;  4JYV L;  6COX A;  1Z6E L;  3N8Y B;  1EGF A;  2VVV L;  2OJV A;  4A7I A;  5JB8 E;  3NIU A;  4LJJ A;  1KLO A;  2XC0 L;  1EQH A;  1D5L C;  4Z0K B;  1XFE A;  1IOE L;  5L30 L;  1HCG B;  3H5C B;  4BDX A;  1PTH A;  1K36 A;  1L3Y A;  3TGF A;  1NT0 A;  3KQD L;  3RKE A;  2Y81 B;  4E1G A;  1F7M A;  1FJS L;  2J94 B;  1DNU C;  1APO A;  1FE2 A;  1KLI L;  4NGA L;  1DX5 I;  3QCW A;  1J9C L;  1UZP A;  1YUK B;  2P94 L;  2Y38 A;  1HZ8 A;  3MQE A;  5KIR A;  1EPG A;  3HS5 A;  1N1I A;  4HHS A;  1IGX A;  3R5O A;  1KIG L;  2P3U A;  2VJ3 A;  4JZE L;  4Y79 B;  1D2V C;  1ATB A;  3NJP C;  5CIS A;  2BOK L;  3DEM A;  2EI7 B;  1A3P A;  4XLW A;  1EQG A;  4RRZ A;  2Y5F L;  1NFU B;  2VWO L;  3TZI A;  2UWP B;  1G2M B;  5EGM B;  2VH0 B;  3N8Y A;  3I6N A;  2J38 B;  2W2P E;  2EHA A;  4G1M B;  2IKC A;  4Z6A L;  3LN1 A;  1U8C B;  3NTB A;  2EI8 B;  1LMJ A;  1PXX A;  4DL1 C;  4ZHA B;  1D7W C;  1EZQ B;  2MGR A;  3GCX E;  1IQH L;  1XKB A;  2XBW L;  1FF7 A;  1NQL B;  2PT3 A;  2Y7Z B;  4PNX A;  3FAQ A;  5CKQ A;  1YUG A;  1G1S A;  3GC1 A;  3HS7 A;  2P28 B;  2Y7X B;  4ZAE B;  3F9P C;  2VWM K;  3SOV A;  2RNL A;  4Y71 B;  1IQL L;  1M1X B;  4CUE A;  3M37 L;  1HT8 A;  4MSF A;  3PY4 A;  2QQT A;  2BQ7 A;  3SOB B;  3FBY A;  2XBY L;  2DDU A;  2MGP A;  3N8Z A;  2XC5 L;  1IQN L;  2FZZ L;  2P26 A;  4BTT A;  1C5M F;  4PH9 A;  1EMO A;  4N7A A;  1IQG L;  1P0S L;  2WPL E;  1HX2 A;  4O1Z A;  2WPK E;  2VH6 B;  5JVZ A;  3S6X A;  1YO8 A;  3ZS0 C;  3BPS E;  1ADX A;  2J2U B;  2WPH E;  1FAX L;  3FFG L;  3QF1 A;  1UZQ A;  4Y6D B;  4ZH8 B;  3F1S B;  1B9W A;  1DVA L;  2H9E C;  3Q7D A;  3R5Q A;  3ZYJ B;  3HO3 A;  1JV2 B;  2PR3 B;  1MYP C;  4JYU L;  1F7E A;  1IJQ A;  3OLU A;  3KCG L;  5E8D A;  4ZXX L;  2M74 A;  1DDX A;  4M11 A;  1NZI A;  4GM7 A;  1AUT L;  4M10 A;  1TOZ A;  4ISI L;  3TGY A;  2W2N E;  3SXV A;  4ISH L;  2XBX L;  4ZXY L;  4X8V L;  1G1T A;  2E9E A;  3SW2 A;  2J4I B;  2I9A A;  2RA0 L;  1L5G B;  1QFK L;  1YUF A;  2AYL A;  1Z6C A;  2VVU L;  2FLB L;  1W8B L;  3U73 A;  2VWL L;  1IQM L;  2WG4 B;  2KV4 A;  3ELA L;  4BTU A;  4GN6 A;  2UWO B;  4RRY A;  1ATD A;  4NJB A;  3S4F A;  1WHF A;  4JZD L;  3BT2 A;  1IQE L;  2Q1J B;  1IOX A;  1HJ7 A;  4RUT A;  4OEK A;  4X8U L;  1LMM A;  3MDL A;  5HPW A;  4RRX A;  1IQI L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...